BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF001J13

Length=683
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAA13440.1|  calcium dependent protein kinase                       272   1e-84   Ipomoea batatas [batate]
ref|XP_009592788.1|  PREDICTED: calcium-dependent protein kinase 2      251   2e-76   Nicotiana tomentosiformis
ref|XP_009783685.1|  PREDICTED: calcium-dependent protein kinase ...    250   5e-76   Nicotiana sylvestris
ref|XP_011095398.1|  PREDICTED: calcium-dependent protein kinase ...    248   3e-75   Sesamum indicum [beniseed]
ref|XP_006365956.1|  PREDICTED: calcium-dependent protein kinase 2      246   1e-74   
ref|NP_001275322.1|  calcium-dependent protein kinase                   246   1e-74   Solanum tuberosum [potatoes]
gb|AEY99979.1|  calcium-dependent protein kinase                        245   3e-74   Nicotiana tabacum [American tobacco]
gb|AAD28192.2|  calcium-dependent protein kinase                        245   4e-74   Solanum tuberosum [potatoes]
emb|CDP05759.1|  unnamed protein product                                243   3e-73   Coffea canephora [robusta coffee]
ref|XP_006346214.1|  PREDICTED: calcium-dependent protein kinase ...    238   1e-71   Solanum tuberosum [potatoes]
ref|NP_001234582.1|  calcium-dependent protein kinase CDPK1             238   2e-71   
ref|XP_009798561.1|  PREDICTED: calcium-dependent protein kinase ...    236   6e-71   Nicotiana sylvestris
ref|XP_009627158.1|  PREDICTED: calcium-dependent protein kinase ...    237   6e-71   Nicotiana tomentosiformis
ref|XP_009770081.1|  PREDICTED: calcium-dependent protein kinase ...    237   7e-71   Nicotiana sylvestris
gb|AAC25423.1|  calcium-dependent protein kinase                        236   1e-70   Nicotiana tabacum [American tobacco]
ref|XP_009604147.1|  PREDICTED: calcium-dependent protein kinase ...    236   1e-70   Nicotiana tomentosiformis
ref|XP_011096067.1|  PREDICTED: calcium-dependent protein kinase-...    235   3e-70   Sesamum indicum [beniseed]
ref|XP_010093289.1|  Calcium-dependent protein kinase 15                235   3e-70   Morus notabilis
ref|XP_008226901.1|  PREDICTED: calcium-dependent protein kinase 2      235   4e-70   Prunus mume [ume]
gb|KHN11921.1|  Calcium-dependent protein kinase 9                      231   4e-70   Glycine soja [wild soybean]
gb|KHN38276.1|  Calcium-dependent protein kinase 33                     231   5e-70   Glycine soja [wild soybean]
gb|AET00506.2|  calcium-dependent kinase                                234   6e-70   Medicago truncatula
ref|XP_008806408.1|  PREDICTED: calcium-dependent protein kinase 2      234   2e-69   Phoenix dactylifera
ref|XP_009406510.1|  PREDICTED: calcium-dependent protein kinase ...    233   2e-69   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011086186.1|  PREDICTED: calcium-dependent protein kinase-...    233   2e-69   Sesamum indicum [beniseed]
ref|XP_004294385.1|  PREDICTED: calcium-dependent protein kinase ...    233   3e-69   Fragaria vesca subsp. vesca
gb|AIU98507.1|  calcium-dependent protein kinase                        232   3e-69   Musa acuminata AAA Group [Cavendish banana]
tpg|DAA62901.2|  TPA: putative calcium-dependent protein kinase f...    220   5e-69   
ref|XP_010276092.1|  PREDICTED: calcium-dependent protein kinase ...    232   5e-69   Nelumbo nucifera [Indian lotus]
ref|XP_010545509.1|  PREDICTED: calcium-dependent protein kinase 33     232   6e-69   Tarenaya hassleriana [spider flower]
gb|KFK39368.1|  hypothetical protein AALP_AA3G235800                    232   7e-69   Arabis alpina [alpine rockcress]
ref|XP_010092160.1|  Calcium-dependent protein kinase 9                 232   8e-69   Morus notabilis
ref|XP_010278695.1|  PREDICTED: calcium-dependent protein kinase ...    231   8e-69   Nelumbo nucifera [Indian lotus]
ref|NP_001275371.1|  calcium-dependent protein kinase 2                 231   8e-69   Solanum tuberosum [potatoes]
gb|ACR36994.1|  unknown                                                 219   1e-68   Zea mays [maize]
gb|ACY78680.1|  calcium-dependent protein kinase 1                      231   1e-68   Panax ginseng [Asiatic ginseng]
ref|XP_002891589.1|  calcium-dependent protein kinase 33                230   2e-68   Arabidopsis lyrata subsp. lyrata
gb|EPS59225.1|  calcium-dependent protein kinase 1                      229   2e-68   Genlisea aurea
ref|XP_007212312.1|  hypothetical protein PRUPE_ppa006748mg             226   2e-68   
gb|AGA83664.1|  calcium-dependent protein kinase 1                      230   2e-68   Dendrobium officinale
ref|XP_006406385.1|  hypothetical protein EUTSA_v10020475mg             230   3e-68   Eutrema salsugineum [saltwater cress]
ref|XP_009360996.1|  PREDICTED: calcium-dependent protein kinase ...    230   3e-68   Pyrus x bretschneideri [bai li]
ref|XP_011047988.1|  PREDICTED: calcium-dependent protein kinase-...    230   3e-68   Populus euphratica
ref|XP_008439982.1|  PREDICTED: calcium-dependent protein kinase 2      230   3e-68   Cucumis melo [Oriental melon]
ref|XP_006303970.1|  hypothetical protein CARUB_v10008860mg             229   3e-68   Capsella rubella
gb|KHN35744.1|  Calcium-dependent protein kinase 33                     226   3e-68   Glycine soja [wild soybean]
ref|XP_011047987.1|  PREDICTED: calcium-dependent protein kinase-...    230   4e-68   Populus euphratica
ref|XP_004134759.1|  PREDICTED: calcium-dependent protein kinase ...    230   5e-68   Cucumis sativus [cucumbers]
gb|KDO62722.1|  hypothetical protein CISIN_1g0096581mg                  223   5e-68   Citrus sinensis [apfelsine]
ref|XP_008365060.1|  PREDICTED: calcium-dependent protein kinase 2      229   5e-68   
ref|XP_003519577.1|  PREDICTED: calcium-dependent protein kinase ...    229   5e-68   Glycine max [soybeans]
ref|XP_002532559.1|  calcium-dependent protein kinase, putative         229   6e-68   Ricinus communis
ref|NP_175485.1|  calcium-dependent protein kinase 33                   229   6e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007213894.1|  hypothetical protein PRUPE_ppa003830mg             229   7e-68   Prunus persica
gb|KDP39132.1|  hypothetical protein JCGZ_00889                         229   9e-68   Jatropha curcas
ref|XP_006389625.1|  hypothetical protein POPTR_0021s00750g             228   1e-67   Populus trichocarpa [western balsam poplar]
gb|AFY10519.1|  calcium dependent protein kinase 1                      228   2e-67   Dendrobium officinale
ref|XP_006449723.1|  hypothetical protein CICLE_v10014823mg             228   2e-67   Citrus clementina [clementine]
ref|NP_001234806.1|  calcium-dependent protein kinase                   228   2e-67   Solanum lycopersicum
gb|KDO78217.1|  hypothetical protein CISIN_1g009091mg                   228   2e-67   Citrus sinensis [apfelsine]
ref|XP_006467440.1|  PREDICTED: calcium-dependent protein kinase ...    228   3e-67   Citrus sinensis [apfelsine]
ref|XP_008384073.1|  PREDICTED: calcium-dependent protein kinase ...    224   3e-67   
emb|CDP04396.1|  unnamed protein product                                228   3e-67   Coffea canephora [robusta coffee]
ref|XP_009388872.1|  PREDICTED: calcium-dependent protein kinase ...    228   3e-67   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_188676.1|  calmodulin-domain protein kinase 9                    227   3e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008804309.1|  PREDICTED: calcium-dependent protein kinase ...    227   3e-67   Phoenix dactylifera
ref|XP_009776253.1|  PREDICTED: calcium-dependent protein kinase-...    228   3e-67   Nicotiana sylvestris
ref|XP_003529633.1|  PREDICTED: calcium-dependent protein kinase ...    227   4e-67   Glycine max [soybeans]
ref|XP_007153943.1|  hypothetical protein PHAVU_003G078400g             227   4e-67   Phaseolus vulgaris [French bean]
ref|XP_010923910.1|  PREDICTED: calcium-dependent protein kinase ...    226   4e-67   Elaeis guineensis
ref|NP_001280761.1|  calcium-dependent protein kinase 2-like            227   4e-67   Malus domestica [apple tree]
ref|XP_010466227.1|  PREDICTED: calcium-dependent protein kinase ...    227   4e-67   Camelina sativa [gold-of-pleasure]
ref|XP_009360846.1|  PREDICTED: calcium-dependent protein kinase ...    227   4e-67   Pyrus x bretschneideri [bai li]
emb|CAA65500.1|  protein kinase                                         227   5e-67   Medicago sativa [alfalfa]
gb|ABE72958.1|  calcium dependent protein kinase 3                      227   5e-67   Medicago truncatula
gb|KEH33831.1|  calmodulin-domain kinase CDPK protein                   227   6e-67   Medicago truncatula
ref|XP_010929942.1|  PREDICTED: calcium-dependent protein kinase ...    227   6e-67   Elaeis guineensis
gb|AHN49725.1|  calcium-dependent protein kinase 1                      226   7e-67   Hippeastrum hybrid cultivar
ref|XP_008224828.1|  PREDICTED: LOW QUALITY PROTEIN: calcium-depe...    227   8e-67   Prunus mume [ume]
gb|ADZ52811.1|  calcium-dependent protein kinase 3                      227   8e-67   Solanum tuberosum [potatoes]
ref|XP_002305576.2|  hypothetical protein POPTR_0004s01530g             226   8e-67   Populus trichocarpa [western balsam poplar]
ref|XP_002883243.1|  calmodulin-domain protein kinase 9                 226   9e-67   Arabidopsis lyrata subsp. lyrata
ref|XP_003610427.1|  Calcium-dependent protein kinase                   226   9e-67   
ref|XP_002518484.1|  calcium-dependent protein kinase, putative         226   1e-66   Ricinus communis
ref|XP_007026066.1|  Calcium-dependent protein kinase 21 isoform 1      226   1e-66   
ref|XP_010923909.1|  PREDICTED: calcium-dependent protein kinase ...    226   1e-66   Elaeis guineensis
ref|XP_006350481.1|  PREDICTED: calcium-dependent protein kinase-...    226   1e-66   Solanum tuberosum [potatoes]
gb|AIO04122.1|  calcium-dependent protein kinase                        226   1e-66   Hevea brasiliensis [jebe]
ref|XP_004491400.1|  PREDICTED: calcium-dependent protein kinase ...    226   2e-66   Cicer arietinum [garbanzo]
ref|XP_011037643.1|  PREDICTED: calcium-dependent protein kinase-...    225   2e-66   Populus euphratica
ref|XP_010461925.1|  PREDICTED: calcium-dependent protein kinase 33     225   2e-66   Camelina sativa [gold-of-pleasure]
ref|XP_010508871.1|  PREDICTED: calcium-dependent protein kinase 9      225   3e-66   Camelina sativa [gold-of-pleasure]
ref|XP_010686845.1|  PREDICTED: calcium-dependent protein kinase ...    226   3e-66   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006297378.1|  hypothetical protein CARUB_v10013403mg             225   3e-66   Capsella rubella
ref|XP_009597333.1|  PREDICTED: calcium-dependent protein kinase-...    224   4e-66   Nicotiana tomentosiformis
gb|EAZ40006.1|  hypothetical protein OsJ_24444                          222   5e-66   Oryza sativa Japonica Group [Japonica rice]
gb|EYU27336.1|  hypothetical protein MIMGU_mgv1a004414mg                224   5e-66   Erythranthe guttata [common monkey flower]
emb|CAN60225.1|  hypothetical protein VITISV_039919                     223   5e-66   Vitis vinifera
dbj|BAE71239.1|  putative calcium dependent protein kinase              224   5e-66   Trifolium pratense [peavine clover]
ref|XP_003617547.1|  Calcium dependent protein kinase                   230   6e-66   
ref|XP_009357448.1|  PREDICTED: calcium-dependent protein kinase ...    224   6e-66   Pyrus x bretschneideri [bai li]
gb|ACB71246.2|  calcium-dependent protein kinase 1                      224   7e-66   Hevea brasiliensis [jebe]
gb|KCW66998.1|  hypothetical protein EUGRSUZ_F007612                    213   8e-66   Eucalyptus grandis [rose gum]
ref|XP_004500067.1|  PREDICTED: calcium-dependent protein kinase ...    224   9e-66   Cicer arietinum [garbanzo]
ref|XP_010479536.1|  PREDICTED: calcium-dependent protein kinase ...    223   9e-66   Camelina sativa [gold-of-pleasure]
gb|KFK35914.1|  hypothetical protein AALP_AA4G052700                    223   1e-65   Arabis alpina [alpine rockcress]
ref|XP_004231610.1|  PREDICTED: calcium-dependent protein kinase ...    223   1e-65   Solanum lycopersicum
emb|CBI23246.3|  unnamed protein product                                223   1e-65   Vitis vinifera
ref|XP_006600312.1|  PREDICTED: calcium-dependent protein kinase ...    223   1e-65   Glycine max [soybeans]
ref|NP_001059775.1|  Os07g0515100                                       222   2e-65   
gb|AAP03014.1|  seed calcium dependent protein kinase c                 222   2e-65   Glycine max [soybeans]
emb|CAA57157.1|  calcium-dependent protein kinase                       222   3e-65   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002268814.1|  PREDICTED: calcium-dependent protein kinase 2      223   3e-65   Vitis vinifera
ref|NP_001235641.1|  calmodulin-like domain protein kinase isoenz...    222   3e-65   
ref|XP_006452371.1|  hypothetical protein CICLE_v10007983mg             222   3e-65   Citrus clementina [clementine]
gb|ACJ61504.1|  calcium-dependent protein kinase                        222   4e-65   Glycine max [soybeans]
ref|XP_004293286.1|  PREDICTED: calcium-dependent protein kinase ...    222   5e-65   Fragaria vesca subsp. vesca
ref|XP_006657762.1|  PREDICTED: calcium-dependent protein kinase ...    221   5e-65   Oryza brachyantha
ref|XP_007142270.1|  hypothetical protein PHAVU_008G266600g             221   5e-65   Phaseolus vulgaris [French bean]
ref|XP_008651864.1|  PREDICTED: calcium-dependent protein kinase ...    221   6e-65   
gb|ACR34538.1|  unknown                                                 221   6e-65   Zea mays [maize]
ref|NP_001105542.1|  calcium-dependent protein kinase 2                 221   7e-65   
gb|KHG10851.1|  Calcium-dependent protein kinase 21                     221   7e-65   Gossypium arboreum [tree cotton]
gb|KHN02836.1|  Calcium-dependent protein kinase 9                      221   9e-65   Glycine soja [wild soybean]
emb|CBI26637.3|  unnamed protein product                                215   9e-65   Vitis vinifera
ref|XP_004957849.1|  PREDICTED: calcium-dependent protein kinase ...    221   1e-64   
gb|KDP20751.1|  hypothetical protein JCGZ_21222                         221   1e-64   Jatropha curcas
ref|NP_001275456.1|  calcium-dependent protein kinase 3                 221   1e-64   Solanum tuberosum [potatoes]
ref|NP_001105306.1|  calcium-dependent protein kinase                   220   1e-64   Zea mays [maize]
ref|XP_003563028.1|  PREDICTED: calcium-dependent protein kinase ...    220   2e-64   
gb|ABC59620.1|  calcium-dependent protein kinase                        220   2e-64   Triticum aestivum [Canadian hard winter wheat]
gb|ABD98803.1|  calcium-dependent protein kinase                        220   2e-64   Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ99143.1|  predicted protein                                      220   2e-64   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABC59619.1|  calcium-dependent protein kinase                        220   2e-64   Triticum aestivum [Canadian hard winter wheat]
ref|XP_007020820.1|  Calmodulin-domain protein kinase 9 isoform 1       220   2e-64   
gb|ABD98804.1|  calcium-dependent protein kinase                        220   2e-64   Triticum aestivum [Canadian hard winter wheat]
gb|AGJ83806.1|  calcium-dependent protein kinase 1d                     220   3e-64   Vitis amurensis
gb|ADM14342.1|  calcium-dependent protein kinase 19                     219   3e-64   Oryza sativa Japonica Group [Japonica rice]
gb|KJB69279.1|  hypothetical protein B456_011G014200                    219   4e-64   Gossypium raimondii
gb|ABB54456.1|  calcium-dependent protein kinase                        219   4e-64   Hordeum brevisubulatum
gb|KFK28778.1|  hypothetical protein AALP_AA7G046400                    218   4e-64   Arabis alpina [alpine rockcress]
emb|CDY36037.1|  BnaC03g41610D                                          219   5e-64   Brassica napus [oilseed rape]
ref|XP_008463413.1|  PREDICTED: calcium-dependent protein kinase-...    218   5e-64   Cucumis melo [Oriental melon]
ref|XP_004152931.1|  PREDICTED: calcium-dependent protein kinase-...    218   6e-64   Cucumis sativus [cucumbers]
gb|AGG35978.1|  calcium-dependent protein kinase 9                      219   6e-64   Brassica napus [oilseed rape]
gb|KHG26977.1|  Calcium-dependent protein kinase 9                      218   8e-64   Gossypium arboreum [tree cotton]
ref|XP_010529441.1|  PREDICTED: calcium-dependent protein kinase 21     218   8e-64   Tarenaya hassleriana [spider flower]
ref|XP_010448965.1|  PREDICTED: calcium-dependent protein kinase 15     218   1e-63   Camelina sativa [gold-of-pleasure]
ref|XP_010439398.1|  PREDICTED: calcium-dependent protein kinase ...    218   2e-63   Camelina sativa [gold-of-pleasure]
ref|NP_001266075.1|  calcium-dependent protein kinase 21-like           218   2e-63   Cicer arietinum [garbanzo]
gb|KJB62816.1|  hypothetical protein B456_009G438300                    217   2e-63   Gossypium raimondii
gb|KJB13679.1|  hypothetical protein B456_002G088800                    217   2e-63   Gossypium raimondii
ref|XP_007146477.1|  hypothetical protein PHAVU_006G0437000g            215   2e-63   Phaseolus vulgaris [French bean]
gb|KHG28675.1|  Calcium-dependent protein kinase 9                      217   3e-63   Gossypium arboreum [tree cotton]
emb|CDX82244.1|  BnaA03g35770D                                          217   3e-63   
ref|XP_009135689.1|  PREDICTED: calcium-dependent protein kinase 9      217   3e-63   Brassica rapa
ref|XP_010538709.1|  PREDICTED: calcium-dependent protein kinase ...    217   3e-63   Tarenaya hassleriana [spider flower]
ref|XP_010434101.1|  PREDICTED: LOW QUALITY PROTEIN: calcium-depe...    217   4e-63   Camelina sativa [gold-of-pleasure]
emb|CAD70165.1|  calcium-dependent protein kinase                       216   5e-63   Landoltia punctata
ref|XP_009135461.1|  PREDICTED: calcium-dependent protein kinase 15     217   6e-63   Brassica rapa
ref|XP_002869852.1|  hypothetical protein ARALYDRAFT_354567             213   6e-63   Arabidopsis lyrata subsp. lyrata
ref|XP_010057925.1|  PREDICTED: calcium-dependent protein kinase ...    216   6e-63   Eucalyptus grandis [rose gum]
gb|KJB68586.1|  hypothetical protein B456_010G252400                    216   6e-63   Gossypium raimondii
gb|EYU33891.1|  hypothetical protein MIMGU_mgv1a004201mg                216   7e-63   Erythranthe guttata [common monkey flower]
emb|CDX79112.1|  BnaA01g11790D                                          216   7e-63   
ref|XP_006283446.1|  hypothetical protein CARUB_v10004493mg             216   1e-62   Capsella rubella
gb|AGG35967.1|  calcium-dependent protein kinase 15                     216   2e-62   Brassica napus [oilseed rape]
ref|XP_006475136.1|  PREDICTED: calcium-dependent protein kinase ...    218   2e-62   
emb|CDX82886.1|  BnaC01g13360D                                          215   2e-62   
ref|XP_002278179.1|  PREDICTED: calcium-dependent protein kinase 2      215   2e-62   Vitis vinifera
ref|NP_193925.1|  calcium-dependent protein kinase 15                   215   2e-62   Arabidopsis thaliana [mouse-ear cress]
gb|KCW67039.1|  hypothetical protein EUGRSUZ_F00807                     213   4e-62   Eucalyptus grandis [rose gum]
ref|NP_001190794.1|  calcium-dependent protein kinase 15                214   4e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006413708.1|  hypothetical protein EUTSA_v100267671mg            205   5e-62   
gb|AGJ83807.1|  calcium-dependent protein kinase 1e                     213   6e-62   Vitis amurensis
ref|XP_010060380.1|  PREDICTED: calcium-dependent protein kinase ...    213   7e-62   Eucalyptus grandis [rose gum]
ref|XP_010060346.1|  PREDICTED: calcium-dependent protein kinase ...    213   7e-62   
ref|XP_010060348.1|  PREDICTED: calcium-dependent protein kinase ...    213   9e-62   
ref|XP_002869856.1|  calcium-dependent protein kinase 15                213   1e-61   Arabidopsis lyrata subsp. lyrata
gb|AGG35970.1|  calcium-dependent protein kinase 21                     212   2e-61   Brassica napus [oilseed rape]
gb|AFR11230.1|  calcium dependent protein kinase 1                      212   3e-61   Chenopodium album [lamb's-quarters]
gb|AAQ17506.1|  calcium dependent protein kinase 3                      211   4e-61   Oryza sativa Japonica Group [Japonica rice]
gb|KJB81727.1|  hypothetical protein B456_013G159300                    211   7e-61   Gossypium raimondii
gb|KHG17079.1|  Calcium-dependent protein kinase 9                      211   7e-61   Gossypium arboreum [tree cotton]
gb|KCW75309.1|  hypothetical protein EUGRSUZ_E04057                     211   7e-61   Eucalyptus grandis [rose gum]
gb|KCW75310.1|  hypothetical protein EUGRSUZ_E04057                     211   8e-61   Eucalyptus grandis [rose gum]
ref|XP_009144515.1|  PREDICTED: calcium-dependent protein kinase 21     209   2e-60   Brassica rapa
gb|AAK92828.1|  putative calcium dependent protein kinase               209   2e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006396672.1|  hypothetical protein EUTSA_v10028567mg             209   2e-60   Eutrema salsugineum [saltwater cress]
ref|XP_006289661.1|  hypothetical protein CARUB_v10003219mg             209   3e-60   Capsella rubella
ref|XP_002874811.1|  calcium-dependent protein kinase 21                209   3e-60   
gb|KFK30982.1|  hypothetical protein AALP_AA6G053400                    208   3e-60   Arabis alpina [alpine rockcress]
gb|KFK30983.1|  hypothetical protein AALP_AA6G053500                    208   4e-60   Arabis alpina [alpine rockcress]
ref|NP_192381.1|  calcium-dependent protein kinase 21                   208   6e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002869854.1|  hypothetical protein ARALYDRAFT_914449             212   9e-60   
ref|XP_006828852.1|  hypothetical protein AMTR_s00001p00158780          207   1e-59   Amborella trichopoda
ref|XP_010455773.1|  PREDICTED: calcium-dependent protein kinase ...    206   2e-59   Camelina sativa [gold-of-pleasure]
ref|XP_010100127.1|  Calcium-dependent protein kinase 29                206   3e-59   Morus notabilis
ref|XP_010422295.1|  PREDICTED: calcium-dependent protein kinase 21     206   3e-59   Camelina sativa [gold-of-pleasure]
ref|XP_003610425.1|  Calcium-dependent protein kinase                   206   3e-59   Medicago truncatula
ref|XP_006657761.1|  PREDICTED: calcium-dependent protein kinase ...    206   4e-59   
ref|XP_004957848.1|  PREDICTED: calcium-dependent protein kinase ...    205   1e-58   
emb|CDX94570.1|  BnaC09g22660D                                          207   3e-58   
ref|XP_010501945.1|  PREDICTED: calcium-dependent protein kinase ...    204   4e-58   
ref|XP_011083439.1|  PREDICTED: calcium-dependent protein kinase 29     202   1e-57   Sesamum indicum [beniseed]
gb|AAD17800.1|  Ca2+-dependent protein kinase                           202   1e-57   Mesembryanthemum crystallinum
ref|XP_004164365.1|  PREDICTED: calcium-dependent protein kinase ...    195   2e-57   
ref|XP_002888057.1|  predicted protein                                  201   3e-57   
emb|CDP12100.1|  unnamed protein product                                197   3e-57   Coffea canephora [robusta coffee]
ref|XP_002509886.1|  calcium-dependent protein kinase, putative         201   4e-57   Ricinus communis
ref|NP_177731.2|  calcium-dependent protein kinase 29                   195   5e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011003084.1|  PREDICTED: calcium-dependent protein kinase ...    200   5e-57   Populus euphratica
ref|XP_006391947.1|  hypothetical protein EUTSA_v10023804mg             200   6e-57   Eutrema salsugineum [saltwater cress]
ref|XP_006301218.1|  hypothetical protein CARUB_v10021616mg             200   7e-57   Capsella rubella
ref|XP_010467929.1|  PREDICTED: calcium-dependent protein kinase ...    203   9e-57   
ref|XP_002306955.1|  hypothetical protein POPTR_0005s26640g             199   1e-56   Populus trichocarpa [western balsam poplar]
ref|XP_002874810.1|  hypothetical protein ARALYDRAFT_490109             198   1e-56   
gb|KFK40633.1|  hypothetical protein AALP_AA2G022000                    199   1e-56   Arabis alpina [alpine rockcress]
gb|KHN16773.1|  Calcium-dependent protein kinase 3                      192   1e-56   Glycine soja [wild soybean]
ref|XP_010675716.1|  PREDICTED: calcium-dependent protein kinase ...    199   2e-56   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011003085.1|  PREDICTED: calcium-dependent protein kinase ...    199   2e-56   Populus euphratica
ref|XP_009114553.1|  PREDICTED: calcium-dependent protein kinase 22     198   2e-56   Brassica rapa
ref|XP_004238385.1|  PREDICTED: calcium-dependent protein kinase 29     199   2e-56   Solanum lycopersicum
gb|KHG01345.1|  Calcium-dependent protein kinase 29                     192   3e-56   Gossypium arboreum [tree cotton]
ref|XP_006396673.1|  hypothetical protein EUTSA_v10028617mg             197   5e-56   Eutrema salsugineum [saltwater cress]
ref|XP_006342079.1|  PREDICTED: calcium-dependent protein kinase ...    197   7e-56   Solanum tuberosum [potatoes]
emb|CBI34415.3|  unnamed protein product                                194   9e-56   Vitis vinifera
sp|Q9ZSA3.2|CDPKM_ARATH  RecName: Full=Calcium-dependent protein ...    196   1e-55   Arabidopsis thaliana [mouse-ear cress]
gb|KHN35055.1|  Calcium-dependent protein kinase 3                      192   1e-55   Glycine soja [wild soybean]
ref|XP_007017899.1|  Calcium-dependent protein kinase 29                195   3e-55   
ref|XP_010430219.1|  PREDICTED: calcium-dependent protein kinase 19     194   3e-55   
ref|XP_006439443.1|  hypothetical protein CICLE_v10019724mg             195   4e-55   Citrus clementina [clementine]
gb|KDO76376.1|  hypothetical protein CISIN_1g010013mg                   195   4e-55   Citrus sinensis [apfelsine]
ref|XP_006476469.1|  PREDICTED: calcium-dependent protein kinase ...    195   4e-55   Citrus sinensis [apfelsine]
gb|EYU17566.1|  hypothetical protein MIMGU_mgv1a004597mg                195   4e-55   Erythranthe guttata [common monkey flower]
gb|AAC28510.1|  Similar to gb|AF072908 calcium-dependent protein ...    196   4e-55   Arabidopsis thaliana [mouse-ear cress]
ref|NP_176386.2|  calcium-dependent protein kinase 19                   196   4e-55   Arabidopsis thaliana [mouse-ear cress]
emb|CAN61364.1|  hypothetical protein VITISV_032639                     194   4e-55   Vitis vinifera
ref|XP_010251583.1|  PREDICTED: calcium-dependent protein kinase ...    195   5e-55   Nelumbo nucifera [Indian lotus]
ref|XP_009798869.1|  PREDICTED: calcium-dependent protein kinase 29     195   6e-55   Nicotiana sylvestris
sp|Q8RWL2.2|CDPKT_ARATH  RecName: Full=Calcium-dependent protein ...    195   7e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007017897.1|  Calcium-dependent protein kinase 29                194   8e-55   
ref|XP_002298000.1|  calcium-dependent protein kinase 1                 194   8e-55   Populus trichocarpa [western balsam poplar]
ref|XP_011026960.1|  PREDICTED: calcium-dependent protein kinase 3      194   8e-55   Populus euphratica
emb|CDY16652.1|  BnaA09g20300D                                          193   8e-55   Brassica napus [oilseed rape]
ref|XP_010055801.1|  PREDICTED: calcium-dependent protein kinase 3      194   1e-54   Eucalyptus grandis [rose gum]
ref|XP_011073451.1|  PREDICTED: calcium-dependent protein kinase ...    194   1e-54   Sesamum indicum [beniseed]
gb|AGS15000.1|  calcium-dependent protein kinase 3                      194   1e-54   Vitis amurensis
ref|XP_002272270.1|  PREDICTED: calcium-dependent protein kinase 3      194   1e-54   Vitis vinifera
gb|KGN53365.1|  hypothetical protein Csa_4G050200                       194   1e-54   Cucumis sativus [cucumbers]
ref|XP_008221211.1|  PREDICTED: calcium-dependent protein kinase 29     194   1e-54   Prunus mume [ume]
ref|XP_011034967.1|  PREDICTED: calcium-dependent protein kinase 29     194   1e-54   Populus euphratica
ref|XP_006386161.1|  hypothetical protein POPTR_0002s01850g             194   1e-54   Populus trichocarpa [western balsam poplar]
ref|NP_974150.2|  calcium-dependent protein kinase 29                   194   1e-54   Arabidopsis thaliana [mouse-ear cress]
gb|KJB52214.1|  hypothetical protein B456_008G251000                    190   1e-54   Gossypium raimondii
emb|CDP07348.1|  unnamed protein product                                194   1e-54   Coffea canephora [robusta coffee]
gb|KDP36877.1|  hypothetical protein JCGZ_08168                         193   2e-54   Jatropha curcas
ref|XP_007222396.1|  hypothetical protein PRUPE_ppa004027mg             193   2e-54   Prunus persica
ref|XP_010428651.1|  PREDICTED: calcium-dependent protein kinase ...    193   2e-54   
ref|XP_002304529.2|  hypothetical protein POPTR_0003s13380g             193   2e-54   
emb|CDY07254.1|  BnaC04g19170D                                          193   3e-54   
ref|XP_010471751.1|  PREDICTED: calcium-dependent protein kinase ...    194   3e-54   
ref|XP_011022588.1|  PREDICTED: calcium-dependent protein kinase ...    193   3e-54   Populus euphratica
ref|XP_007040387.1|  Calcium-dependent protein kinase 6 isoform 1       193   3e-54   
ref|XP_003538256.1|  PREDICTED: calcium-dependent protein kinase ...    192   3e-54   Glycine max [soybeans]
ref|XP_008451994.1|  PREDICTED: calcium-dependent protein kinase 3      193   3e-54   Cucumis melo [Oriental melon]
gb|AEY99978.1|  calcium-dependent protein kinase                        192   3e-54   Nicotiana tabacum [American tobacco]
ref|XP_010428653.1|  PREDICTED: calcium-dependent protein kinase ...    193   3e-54   Camelina sativa [gold-of-pleasure]
ref|XP_010416511.1|  PREDICTED: calcium-dependent protein kinase ...    193   3e-54   Camelina sativa [gold-of-pleasure]
gb|KDP25359.1|  hypothetical protein JCGZ_20515                         192   4e-54   Jatropha curcas
ref|XP_009414364.1|  PREDICTED: calcium-dependent protein kinase ...    185   4e-54   
ref|XP_008239005.1|  PREDICTED: calcium-dependent protein kinase 3      190   4e-54   
ref|XP_006473713.1|  PREDICTED: calcium-dependent protein kinase ...    191   4e-54   Citrus sinensis [apfelsine]
ref|XP_009786035.1|  PREDICTED: calcium-dependent protein kinase 3      192   5e-54   Nicotiana sylvestris
sp|P28582.2|CDPK_DAUCA  RecName: Full=Calcium-dependent protein k...    192   5e-54   Daucus carota [carrots]
ref|XP_009620047.1|  PREDICTED: calcium-dependent protein kinase 29     192   5e-54   Nicotiana tomentosiformis
ref|XP_009620189.1|  PREDICTED: calcium-dependent protein kinase 3      192   5e-54   Nicotiana tomentosiformis
ref|XP_006413705.1|  hypothetical protein EUTSA_v10027200mg             187   6e-54   
ref|XP_010418170.1|  PREDICTED: calcium-dependent protein kinase ...    192   6e-54   Camelina sativa [gold-of-pleasure]
ref|XP_006352261.1|  PREDICTED: calcium-dependent protein kinase ...    192   6e-54   
emb|CAC83060.1|  calcium dependent calmodulin independent protein...    189   7e-54   
gb|AAD48958.1|AF149414_7  similar to Pfam families PF00069 (Eukar...    190   7e-54   
ref|XP_010533815.1|  PREDICTED: calcium-dependent protein kinase 19     192   8e-54   
gb|KHN25667.1|  Calcium-dependent protein kinase 3                      188   9e-54   
ref|XP_004503656.1|  PREDICTED: calcium-dependent protein kinase ...    191   1e-53   
ref|XP_006473712.1|  PREDICTED: calcium-dependent protein kinase ...    191   1e-53   
ref|XP_006435253.1|  hypothetical protein CICLE_v10000897mg             191   1e-53   
gb|KJB63479.1|  hypothetical protein B456_010G001300                    191   1e-53   
ref|XP_010261434.1|  PREDICTED: calcium-dependent protein kinase ...    191   1e-53   
ref|XP_006302092.1|  hypothetical protein CARUB_v10020082mg             192   1e-53   
ref|XP_008345823.1|  PREDICTED: calcium-dependent protein kinase ...    179   1e-53   
gb|KHG11508.1|  Calcium-dependent protein kinase 3                      191   1e-53   
emb|CDY24863.1|  BnaA03g59670D                                          191   1e-53   
ref|XP_010536433.1|  PREDICTED: calcium-dependent protein kinase 29     191   2e-53   
gb|KJB52213.1|  hypothetical protein B456_008G251000                    191   2e-53   
ref|NP_192380.1|  calcium-dependent protein kinase 22                   191   2e-53   
ref|XP_009334485.1|  PREDICTED: calcium-dependent protein kinase 3      191   2e-53   
ref|NP_680596.2|  calcium-dependent protein kinase 31                   189   2e-53   
gb|AES59823.2|  calcium-dependent kinase                                190   3e-53   
ref|XP_003525360.1|  PREDICTED: calcium-dependent protein kinase ...    190   3e-53   
ref|XP_003611046.1|  Calcium dependent protein kinase                   190   3e-53   
ref|XP_007160124.1|  hypothetical protein PHAVU_002G294500g             190   3e-53   
tpg|DAA58513.1|  TPA: putative calcium-dependent protein kinase f...    184   4e-53   
ref|NP_001267714.1|  calcium-dependent protein kinase 3-like            189   4e-53   
ref|XP_008800033.1|  PREDICTED: calcium-dependent protein kinase 29     189   5e-53   
ref|XP_004244622.1|  PREDICTED: calcium-dependent protein kinase 3      189   5e-53   
gb|KEH21166.1|  calmodulin-domain kinase CDPK protein                   189   5e-53   
gb|KDO62708.1|  hypothetical protein CISIN_1g018604mg                   186   5e-53   
ref|XP_002510594.1|  calcium-dependent protein kinase, putative         189   6e-53   
ref|XP_009113383.1|  PREDICTED: LOW QUALITY PROTEIN: calcium-depe...    190   6e-53   
gb|AGJ83805.1|  calcium-dependent protein kinase 1a                     189   6e-53   
ref|XP_008387908.1|  PREDICTED: calcium-dependent protein kinase 29     189   6e-53   
ref|XP_004511540.1|  PREDICTED: calcium-dependent protein kinase ...    189   6e-53   
emb|CAN67210.1|  hypothetical protein VITISV_026712                     189   8e-53   
ref|XP_010106587.1|  Calcium-dependent protein kinase 3                 191   8e-53   
gb|ACH85192.1|  calcium-dependent protein kinase CDPK5                  188   1e-52   
ref|XP_007209903.1|  hypothetical protein PRUPE_ppa004162mg             189   1e-52   
ref|XP_003517491.2|  PREDICTED: calcium-dependent protein kinase ...    189   1e-52   
ref|XP_010266896.1|  PREDICTED: calcium-dependent protein kinase ...    189   1e-52   
ref|XP_002874809.1|  calcium-dependent protein kinase 31                187   1e-52   
ref|XP_010266895.1|  PREDICTED: calcium-dependent protein kinase ...    188   2e-52   
gb|ABC47163.2|  CDPK1                                                   188   2e-52   
gb|EEC79771.1|  hypothetical protein OsI_21169                          185   2e-52   
dbj|BAA81749.1|  calcium-dependent protein kinase                       188   2e-52   
dbj|BAK07881.1|  predicted protein                                      187   2e-52   
ref|XP_010924783.1|  PREDICTED: calcium-dependent protein kinase ...    187   3e-52   
ref|XP_002284750.2|  PREDICTED: calcium-dependent protein kinase 29     187   3e-52   
gb|AGF69185.1|  calcium-dependent protein kinase 3-like 1               180   3e-52   
ref|XP_006655639.1|  PREDICTED: calcium-dependent protein kinase ...    186   3e-52   
ref|XP_008792394.1|  PREDICTED: calcium-dependent protein kinase ...    187   3e-52   
ref|XP_004298849.1|  PREDICTED: calcium-dependent protein kinase 3      187   4e-52   
ref|XP_006446309.1|  hypothetical protein CICLE_v10014854mg             187   4e-52   
ref|XP_002526062.1|  calcium-dependent protein kinase, putative         187   4e-52   
ref|XP_003589572.1|  Calcium-dependent protein kinase                   190   5e-52   
ref|XP_008449648.1|  PREDICTED: calcium-dependent protein kinase ...    187   5e-52   
ref|XP_006287505.1|  hypothetical protein CARUB_v10000714mg             187   5e-52   
ref|XP_009414250.1|  PREDICTED: calcium-dependent protein kinase ...    183   7e-52   
gb|EEE64852.1|  hypothetical protein OsJ_19709                          187   7e-52   
ref|XP_006390245.1|  hypothetical protein EUTSA_v10018359mg             187   8e-52   
ref|XP_006470577.1|  PREDICTED: calcium-dependent protein kinase ...    186   1e-51   
ref|NP_001056455.1|  Os05g0585500                                       186   1e-51   
gb|KHG03431.1|  Calcium-dependent protein kinase 3                      187   1e-51   
gb|EMS56466.1|  Calcium-dependent protein kinase 34                     186   2e-51   
gb|KDP43197.1|  hypothetical protein JCGZ_22749                         185   2e-51   
emb|CDP20327.1|  unnamed protein product                                185   2e-51   
gb|KDO62703.1|  hypothetical protein CISIN_1g009382mg                   185   2e-51   
gb|EYU35947.1|  hypothetical protein MIMGU_mgv1a004350mg                185   2e-51   
ref|XP_004972225.1|  PREDICTED: calcium-dependent protein kinase ...    182   2e-51   
ref|XP_009789543.1|  PREDICTED: calcium-dependent protein kinase ...    185   2e-51   
ref|XP_004293141.1|  PREDICTED: calcium-dependent protein kinase 34     185   2e-51   
ref|XP_006849377.1|  hypothetical protein AMTR_s00158p00082100          185   2e-51   
ref|XP_006452344.1|  hypothetical protein CICLE_v10007980mg             185   2e-51   
gb|EYU23402.1|  hypothetical protein MIMGU_mgv1a004683mg                185   2e-51   
gb|AGG35971.1|  calcium-dependent protein kinase 29                     185   3e-51   
ref|XP_010106395.1|  Calcium-dependent protein kinase 17                185   3e-51   
emb|CDX73219.1|  BnaC06g36670D                                          185   3e-51   
ref|XP_010099802.1|  Calcium-dependent protein kinase 17                185   3e-51   
ref|XP_009106253.1|  PREDICTED: calcium-dependent protein kinase 29     185   3e-51   
ref|XP_009603797.1|  PREDICTED: calcium-dependent protein kinase ...    185   3e-51   
ref|XP_006452350.1|  hypothetical protein CICLE_v10007950mg             185   4e-51   
ref|XP_003568203.1|  PREDICTED: calcium-dependent protein kinase ...    184   4e-51   
ref|XP_006452359.1|  hypothetical protein CICLE_v10007873mg             185   4e-51   
ref|XP_010676387.1|  PREDICTED: calcium-dependent protein kinase 3      184   4e-51   
ref|XP_002313265.1|  calcium-dependent protein kinase                   184   5e-51   
ref|XP_003567831.1|  PREDICTED: calcium-dependent protein kinase ...    184   6e-51   
ref|XP_009416404.1|  PREDICTED: calcium-dependent protein kinase ...    184   6e-51   
ref|XP_002874812.1|  calcium-dependent protein kinase 23                184   6e-51   
ref|XP_010667438.1|  PREDICTED: calcium-dependent protein kinase 29     184   6e-51   
ref|XP_004140192.1|  PREDICTED: calcium-dependent protein kinase ...    184   6e-51   
gb|KJB58044.1|  hypothetical protein B456_009G191500                    187   7e-51   
gb|KDO78218.1|  hypothetical protein CISIN_1g009091mg                   184   7e-51   
gb|KHN23929.1|  Calcium-dependent protein kinase 17                     183   7e-51   
gb|EMT05629.1|  Calcium-dependent protein kinase 34                     184   7e-51   
gb|KJB83565.1|  hypothetical protein B456_013G253100                    184   8e-51   
ref|XP_006452347.1|  hypothetical protein CICLE_v10008020mg             183   8e-51   
ref|XP_007160621.1|  hypothetical protein PHAVU_001G002800g             186   8e-51   
ref|XP_007213195.1|  hypothetical protein PRUPE_ppa026653mg             184   8e-51   
tpg|DAA58514.1|  TPA: putative calcium-dependent protein kinase f...    182   1e-50   
ref|XP_006452355.1|  hypothetical protein CICLE_v10010314mg             183   1e-50   
ref|XP_003545013.1|  PREDICTED: calcium-dependent protein kinase ...    183   1e-50   
gb|EEC79448.1|  hypothetical protein OsI_20437                          183   1e-50   
gb|EEE64198.1|  hypothetical protein OsJ_19030                          183   1e-50   
emb|CDX78468.1|  BnaA03g03800D                                          183   1e-50   
gb|AHG06449.1|  calcium-dependent protein kinase 17                     183   1e-50   
ref|XP_009131258.1|  PREDICTED: calcium-dependent protein kinase ...    183   1e-50   
ref|XP_010247475.1|  PREDICTED: calcium-dependent protein kinase 34     183   1e-50   
ref|XP_008798404.1|  PREDICTED: calcium-dependent protein kinase ...    183   1e-50   
ref|XP_009406794.1|  PREDICTED: calcium-dependent protein kinase ...    182   1e-50   
ref|XP_011014420.1|  PREDICTED: calcium-dependent protein kinase ...    183   1e-50   
ref|XP_004961659.1|  PREDICTED: calcium-dependent protein kinase ...    184   1e-50   
gb|AAT69647.1|  hypothetical protein                                    183   1e-50   
emb|CDX85697.1|  BnaA02g01160D                                          183   1e-50   
ref|XP_004499307.1|  PREDICTED: LOW QUALITY PROTEIN: calcium-depe...    185   2e-50   
ref|XP_006596531.1|  PREDICTED: calcium-dependent protein kinase ...    183   2e-50   
gb|KDO62705.1|  hypothetical protein CISIN_1g040917mg                   182   2e-50   
ref|XP_003556786.1|  PREDICTED: calcium-dependent protein kinase ...    183   2e-50   
ref|NP_001055912.1|  Os05g0491900                                       183   2e-50   
ref|XP_008227265.1|  PREDICTED: calcium-dependent protein kinase ...    183   2e-50   
ref|XP_008656081.1|  PREDICTED: calcium-dependent protein kinase ...    183   2e-50   
ref|XP_006655439.1|  PREDICTED: calcium-dependent protein kinase ...    182   2e-50   
ref|NP_001169721.1|  uncharacterized LOC100383602                       182   2e-50   
gb|EMT22025.1|  Calcium-dependent protein kinase 3                      182   2e-50   
dbj|BAD61167.1|  putative calcium-dependent protein kinase              184   2e-50   
ref|XP_008802050.1|  PREDICTED: calcium-dependent protein kinase ...    182   2e-50   
ref|XP_007158545.1|  hypothetical protein PHAVU_002G161200g             182   2e-50   
ref|XP_010031714.1|  PREDICTED: calcium-dependent protein kinase ...    182   2e-50   
gb|KFK42039.1|  hypothetical protein AALP_AA2G204000                    182   2e-50   
gb|AIU98501.1|  calcium-dependent protein kinase                        182   2e-50   
gb|AIU98504.1|  calcium-dependent protein kinase                        182   2e-50   
gb|KJB35709.1|  hypothetical protein B456_006G124800                    182   2e-50   
ref|XP_006475078.1|  PREDICTED: calcium-dependent protein kinase ...    182   3e-50   
ref|XP_004961071.1|  PREDICTED: calcium-dependent protein kinase ...    182   3e-50   
ref|XP_002441592.1|  hypothetical protein SORBIDRAFT_09g029950          182   3e-50   
dbj|BAA81748.1|  calcium-dependent protein kinase                       182   3e-50   
gb|EAY76207.1|  hypothetical protein OsI_04143                          181   3e-50   
ref|XP_010924782.1|  PREDICTED: calcium-dependent protein kinase ...    182   4e-50   
ref|XP_010529626.1|  PREDICTED: calcium-dependent protein kinase ...    182   4e-50   
emb|CDY10955.1|  BnaA03g46140D                                          179   4e-50   
ref|XP_009125853.1|  PREDICTED: calcium-dependent protein kinase ...    182   4e-50   
dbj|BAJ94561.1|  predicted protein                                      182   4e-50   
gb|KJB55472.1|  hypothetical protein B456_009G078000                    182   4e-50   
ref|XP_009137376.1|  PREDICTED: calcium-dependent protein kinase 3      178   4e-50   
ref|XP_002456506.1|  hypothetical protein SORBIDRAFT_03g037570          181   4e-50   
ref|NP_001044575.1|  Os01g0808400                                       181   4e-50   
ref|XP_010541306.1|  PREDICTED: calcium-dependent protein kinase 3      181   5e-50   
ref|XP_009404695.1|  PREDICTED: calcium-dependent protein kinase ...    181   5e-50   
ref|XP_006452360.1|  hypothetical protein CICLE_v10010555mg             181   5e-50   
ref|XP_011009111.1|  PREDICTED: calcium-dependent protein kinase ...    181   5e-50   
tpg|DAA57188.1|  TPA: putative calcium-dependent protein kinase f...    181   5e-50   
gb|KDO62709.1|  hypothetical protein CISIN_1g010756mg                   181   5e-50   
ref|NP_001152509.1|  calcium-dependent protein kinase, isoform 2        181   5e-50   
ref|XP_009334623.1|  PREDICTED: calcium-dependent protein kinase 29     182   5e-50   
ref|XP_010266343.1|  PREDICTED: uncharacterized protein LOC104603873    186   6e-50   
ref|XP_006475079.1|  PREDICTED: calcium-dependent protein kinase ...    181   6e-50   
ref|XP_010454209.1|  PREDICTED: calcium-dependent protein kinase 34     181   6e-50   
ref|XP_006399734.1|  hypothetical protein EUTSA_v10013236mg             181   6e-50   
gb|EEC71113.1|  hypothetical protein OsI_02910                          181   6e-50   
ref|XP_010420737.1|  PREDICTED: calcium-dependent protein kinase ...    181   6e-50   
gb|KDO37230.1|  hypothetical protein CISIN_1g047606mg                   180   6e-50   
ref|XP_010492994.1|  PREDICTED: calcium-dependent protein kinase ...    181   7e-50   
ref|XP_006400491.1|  hypothetical protein EUTSA_v10013240mg             181   7e-50   
gb|AGT17455.1|  hypothetical protein SHCRBa_258_F08_F_40                181   7e-50   
gb|EMT20115.1|  Calcium-dependent protein kinase 3                      177   7e-50   
ref|XP_002455974.1|  hypothetical protein SORBIDRAFT_03g028340          181   7e-50   
ref|NP_197437.1|  calcium-dependent protein kinase 34                   181   7e-50   
ref|XP_010519814.1|  PREDICTED: calcium-dependent protein kinase ...    181   8e-50   
ref|XP_008674922.1|  PREDICTED: calcium-dependent protein kinase 34     181   8e-50   
ref|XP_002873943.1|  calcium-dependent protein kinase 34                181   8e-50   
ref|XP_006452345.1|  hypothetical protein CICLE_v10007978mg             181   8e-50   
ref|XP_009419685.1|  PREDICTED: calcium-dependent protein kinase ...    181   8e-50   
gb|AGT15898.1|  calcium-dependent protein kinase                        181   8e-50   
emb|CDX70450.1|  BnaC03g05340D                                          181   9e-50   
ref|XP_007015253.1|  Calcium-dependent protein kinase 17                181   9e-50   
gb|EMS46165.1|  Calcium-dependent protein kinase 3                      177   9e-50   
gb|AGG35954.1|  calcium-dependent protein kinase 34                     180   1e-49   
ref|XP_006475082.1|  PREDICTED: calcium-dependent protein kinase ...    180   1e-49   
gb|AGT17376.1|  calcium-dependent protein kinase                        181   1e-49   
ref|XP_010519813.1|  PREDICTED: calcium-dependent protein kinase ...    181   1e-49   
gb|KJB19075.1|  hypothetical protein B456_003G084000                    180   1e-49   
gb|KJB21813.1|  hypothetical protein B456_004G015100                    181   1e-49   
gb|KCW45109.1|  hypothetical protein EUGRSUZ_L012821                    175   1e-49   
gb|AFW59214.1|  putative calcium-dependent protein kinase family ...    181   1e-49   
ref|NP_001151970.1|  calcium-dependent protein kinase                   181   1e-49   
gb|EAZ12734.1|  hypothetical protein OsJ_02652                          180   1e-49   
gb|EYU46187.1|  hypothetical protein MIMGU_mgv1a004352mg                181   1e-49   
ref|XP_006845045.1|  hypothetical protein AMTR_s00269p00011940          180   1e-49   
gb|AGT17166.1|  calcium-dependent protein kinase                        179   1e-49   
gb|KFK26202.1|  hypothetical protein AALP_AA8G215800                    180   1e-49   
gb|KJB09335.1|  hypothetical protein B456_001G135000                    180   1e-49   
emb|CDY63783.1|  BnaCnng42690D                                          180   1e-49   
ref|XP_009126355.1|  PREDICTED: calcium-dependent protein kinase 34     180   1e-49   
emb|CDY44912.1|  BnaA02g04170D                                          180   2e-49   
emb|CDX91168.1|  BnaC02g04290D                                          180   2e-49   
ref|XP_010061106.1|  PREDICTED: calcium-dependent protein kinase ...    180   2e-49   
gb|EPS70504.1|  calcium dependent protein kinase 25                     180   2e-49   
ref|NP_196779.1|  calcium-dependent protein kinase 17                   180   2e-49   
ref|XP_008466461.1|  PREDICTED: calcium-dependent protein kinase 29     180   2e-49   
gb|AFW84809.1|  putative calcium-dependent protein kinase family ...    179   2e-49   
gb|AFW82381.1|  putative calcium-dependent protein kinase family ...    181   2e-49   
gb|AAL59948.1|  putative calcium-dependent protein kinase               180   2e-49   
gb|KFK25494.1|  hypothetical protein AALP_AA8G122000                    180   2e-49   
emb|CDY13993.1|  BnaC09g38330D                                          179   2e-49   
ref|NP_192383.1|  calcium-dependent protein kinase 23                   180   2e-49   
ref|XP_006289743.1|  hypothetical protein CARUB_v10003311mg             180   2e-49   
ref|XP_006289327.1|  hypothetical protein CARUB_v10002812mg             180   2e-49   
ref|XP_011080420.1|  PREDICTED: calcium-dependent protein kinase ...    180   2e-49   
ref|XP_009121874.1|  PREDICTED: calcium-dependent protein kinase 17     180   2e-49   
ref|XP_006475081.1|  PREDICTED: calcium-dependent protein kinase ...    180   2e-49   
ref|XP_009120894.1|  PREDICTED: calcium-dependent protein kinase 34     179   2e-49   
ref|XP_002871516.1|  calcium-dependent protein kinase 17                180   2e-49   
ref|XP_006349794.1|  PREDICTED: calcium-dependent protein kinase ...    179   3e-49   
ref|XP_008657141.1|  PREDICTED: calcium-dependent protein kinase ...    179   3e-49   
gb|KHN28162.1|  Calcium-dependent protein kinase 17                     179   3e-49   
ref|XP_009412989.1|  PREDICTED: calcium-dependent protein kinase ...    179   3e-49   
ref|XP_002441304.1|  hypothetical protein SORBIDRAFT_09g024100          179   3e-49   
ref|XP_009796949.1|  PREDICTED: calcium-dependent protein kinase ...    179   3e-49   
ref|XP_006287670.1|  hypothetical protein CARUB_v10000880mg             178   3e-49   
gb|AGT16545.1|  calcium-dependent protein kinase 34                     179   3e-49   
emb|CDX97174.1|  BnaC09g44510D                                          179   3e-49   
ref|XP_009368734.1|  PREDICTED: calcium-dependent protein kinase ...    179   3e-49   



>dbj|BAA13440.1| calcium dependent protein kinase [Ipomoea batatas]
Length=514

 Score =   272 bits (695),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 132/134 (99%), Positives = 132/134 (99%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER
Sbjct  381  TDNSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  440

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC
Sbjct  441  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  500

Query  321  TMMRSGTKQQPKLF  280
            TMMRSGTKQQ KLF
Sbjct  501  TMMRSGTKQQAKLF  514



>ref|XP_009592788.1| PREDICTED: calcium-dependent protein kinase 2 [Nicotiana tomentosiformis]
Length=522

 Score =   251 bits (640),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/134 (90%), Positives = 126/134 (94%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ LTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER
Sbjct  389  TDNSGTITYEELKSGLARLGSKLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  448

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            EENLYKAFQYFDKD SGFITRDELETAM+EHGI DAA+I+EIISEVDAD+DGRINYEEFC
Sbjct  449  EENLYKAFQYFDKDGSGFITRDELETAMEEHGIGDAASIREIISEVDADNDGRINYEEFC  508

Query  321  TMMRSGTKQQPKLF  280
            TMMRSG KQ  KLF
Sbjct  509  TMMRSGAKQPGKLF  522



>ref|XP_009783685.1| PREDICTED: calcium-dependent protein kinase 2-like [Nicotiana 
sylvestris]
Length=522

 Score =   250 bits (638),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 119/134 (89%), Positives = 126/134 (94%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ LTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER
Sbjct  389  TDNSGTITYEELKSGLARLGSKLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  448

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            EENLYKAFQYFDKD SGFITRDELETAM+EHG+ DAA+I+EIISEVDAD+DGRINYEEFC
Sbjct  449  EENLYKAFQYFDKDGSGFITRDELETAMEEHGVGDAASIREIISEVDADNDGRINYEEFC  508

Query  321  TMMRSGTKQQPKLF  280
            TMMRSG KQ  KLF
Sbjct  509  TMMRSGAKQPGKLF  522



>ref|XP_011095398.1| PREDICTED: calcium-dependent protein kinase 33-like [Sesamum 
indicum]
Length=523

 Score =   248 bits (633),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 116/134 (87%), Positives = 127/134 (95%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ LTEAEV+QLM+AADVDGNGSIDYIEFITATMH+HRLER
Sbjct  390  TDNSGTITYEELKAGLARLGSKLTEAEVRQLMDAADVDGNGSIDYIEFITATMHRHRLER  449

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            EENLYKAFQYFDKDSSGFITRDELETAM+E+GI DA+TIKEII+EVD D+DGRINYEEFC
Sbjct  450  EENLYKAFQYFDKDSSGFITRDELETAMQEYGIGDASTIKEIIAEVDTDNDGRINYEEFC  509

Query  321  TMMRSGTKQQPKLF  280
            TMMR+G  QQPKLF
Sbjct  510  TMMRTGNPQQPKLF  523



>ref|XP_006365956.1| PREDICTED: calcium-dependent protein kinase 2 [Solanum tuberosum]
Length=526

 Score =   246 bits (629),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/134 (87%), Positives = 125/134 (93%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ LTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER
Sbjct  393  TDNSGTITYEELKSGLARLGSKLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  452

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +ENLYKAFQYFDKD SGFITRDELET+M+EHGI D A+I+EIISEVDAD+DGRINYEEFC
Sbjct  453  DENLYKAFQYFDKDGSGFITRDELETSMEEHGIGDPASIREIISEVDADNDGRINYEEFC  512

Query  321  TMMRSGTKQQPKLF  280
            TMMRSG KQ  KLF
Sbjct  513  TMMRSGAKQPGKLF  526



>ref|NP_001275322.1| calcium-dependent protein kinase [Solanum tuberosum]
 gb|ACZ26302.1| calcium dependant protein kinase [Solanum tuberosum]
Length=532

 Score =   246 bits (629),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/134 (87%), Positives = 125/134 (93%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ LTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER
Sbjct  399  TDNSGTITYEELKSGLARLGSKLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  458

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +ENLYKAFQYFDKD SGFITRDELET+M+EHGI D A+I+EIISEVDAD+DGRINYEEFC
Sbjct  459  DENLYKAFQYFDKDGSGFITRDELETSMEEHGIGDPASIREIISEVDADNDGRINYEEFC  518

Query  321  TMMRSGTKQQPKLF  280
            TMMRSG KQ  KLF
Sbjct  519  TMMRSGAKQPGKLF  532



>gb|AEY99979.1| calcium-dependent protein kinase [Nicotiana tabacum]
Length=522

 Score =   245 bits (626),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 117/134 (87%), Positives = 125/134 (93%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ LTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRL  
Sbjct  389  TDNSGTITYEELKSGLARLGSKLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLNS  448

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            EENLYKAFQYFDKDSSGFITRDELETAM+EHGI DAA+I+EI+S+VDAD+DGRINYEEFC
Sbjct  449  EENLYKAFQYFDKDSSGFITRDELETAMEEHGIGDAASIREIMSDVDADNDGRINYEEFC  508

Query  321  TMMRSGTKQQPKLF  280
            TMMRSG KQ  KLF
Sbjct  509  TMMRSGAKQPGKLF  522



>gb|AAD28192.2| calcium-dependent protein kinase [Solanum tuberosum]
 gb|ABF56558.1| calcium-dependent protein kinase 1 [Solanum tuberosum]
Length=532

 Score =   245 bits (626),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 116/134 (87%), Positives = 125/134 (93%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ LTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER
Sbjct  399  TDNSGTITYEELKSGLARLGSKLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  458

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +ENLYKAFQYFDKD SGFITRDELET+M+EHGI D A+I+EII+EVDAD+DGRINYEEFC
Sbjct  459  DENLYKAFQYFDKDGSGFITRDELETSMEEHGIGDPASIREIIAEVDADNDGRINYEEFC  518

Query  321  TMMRSGTKQQPKLF  280
            TMMRSG KQ  KLF
Sbjct  519  TMMRSGAKQPGKLF  532



>emb|CDP05759.1| unnamed protein product [Coffea canephora]
Length=520

 Score =   243 bits (619),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 116/134 (87%), Positives = 125/134 (93%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ LTEAEVKQLMEAADVDGNG+IDYIEFITATMHKH+LER
Sbjct  387  TDNSGTITYEELKSGLARLGSKLTEAEVKQLMEAADVDGNGTIDYIEFITATMHKHKLER  446

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            EENLY AFQYFDKD+SGFITRDELETAMK++G+ D ATIKEIISEVD D+DGRINYEEFC
Sbjct  447  EENLYTAFQYFDKDNSGFITRDELETAMKDYGMGDPATIKEIISEVDTDNDGRINYEEFC  506

Query  321  TMMRSGTKQQPKLF  280
            TMMRSGTKQ  KLF
Sbjct  507  TMMRSGTKQPNKLF  520



>ref|XP_006346214.1| PREDICTED: calcium-dependent protein kinase isoform 2 [Solanum 
tuberosum]
Length=521

 Score =   238 bits (608),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/134 (84%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ LTEAEVKQLMEAADVDGNGSIDY EFITATMHKHRLER
Sbjct  388  TDNSGTITYEELKSGLAKLGSKLTEAEVKQLMEAADVDGNGSIDYTEFITATMHKHRLER  447

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +ENLY AFQYFDKDSSGFITRDELE AM+EHGI D + I+EIISEVD D+DGRINYEEFC
Sbjct  448  DENLYTAFQYFDKDSSGFITRDELEAAMQEHGIGDPSCIREIISEVDTDNDGRINYEEFC  507

Query  321  TMMRSGTKQQPKLF  280
            TMMRSG KQ  K+F
Sbjct  508  TMMRSGAKQPGKVF  521



>ref|NP_001234582.1| calcium-dependent protein kinase CDPK1 [Solanum lycopersicum]
 gb|AAK52801.1|AF363784_1 calcium-dependent protein kinase CDPK1 [Solanum lycopersicum]
Length=521

 Score =   238 bits (607),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/134 (84%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ LTEAEVKQLMEAADVDGNGSIDY EFITATMHKHRLER
Sbjct  388  TDNSGTITYEELKSGLAKLGSKLTEAEVKQLMEAADVDGNGSIDYTEFITATMHKHRLER  447

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +ENLY AFQYFDKDSSGFITRDELE AM+EHGI D + I+EIISEVD D+DGRINYEEFC
Sbjct  448  DENLYTAFQYFDKDSSGFITRDELEAAMEEHGIGDPSCIREIISEVDTDNDGRINYEEFC  507

Query  321  TMMRSGTKQQPKLF  280
            TMMRSG KQ  K+F
Sbjct  508  TMMRSGAKQPGKVF  521



>ref|XP_009798561.1| PREDICTED: calcium-dependent protein kinase 2-like [Nicotiana 
sylvestris]
Length=521

 Score =   236 bits (603),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 112/134 (84%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEEL+ GLA+LG+ LTEAEVKQLMEAADVDGNGSIDY EFITATMHKHRLER
Sbjct  388  TDNSGTITYEELRSGLAKLGSKLTEAEVKQLMEAADVDGNGSIDYTEFITATMHKHRLER  447

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +ENLY AFQYFDKD SGFITRDELETAM+EHGI D A I+EIISEVD D+DGRINY+EFC
Sbjct  448  DENLYTAFQYFDKDGSGFITRDELETAMEEHGIGDPACIREIISEVDTDNDGRINYDEFC  507

Query  321  TMMRSGTKQQPKLF  280
             MMRSG KQ  KLF
Sbjct  508  AMMRSGVKQPGKLF  521



>ref|XP_009627158.1| PREDICTED: calcium-dependent protein kinase 21-like [Nicotiana 
tomentosiformis]
Length=534

 Score =   237 bits (604),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 111/134 (83%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ LTE EVKQLMEAADVDGNG+IDYIEFITATMH+HRLER
Sbjct  401  TDNSGTITYEELKSGLARLGSKLTETEVKQLMEAADVDGNGTIDYIEFITATMHRHRLER  460

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+L+KAFQYFDKD SGFITRDELE+AMKE+G+ D ATIKEII+EVD D+DGRINYEEFC
Sbjct  461  DEHLFKAFQYFDKDHSGFITRDELESAMKEYGMGDEATIKEIIAEVDTDNDGRINYEEFC  520

Query  321  TMMRSGTKQQPKLF  280
             MMRSGT+ QPKLF
Sbjct  521  AMMRSGTQPQPKLF  534



>ref|XP_009770081.1| PREDICTED: calcium-dependent protein kinase 21-like [Nicotiana 
sylvestris]
Length=542

 Score =   237 bits (604),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 111/134 (83%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ LTE EVKQLMEAADVDGNG+IDYIEFITATMH+HRLER
Sbjct  409  TDNSGTITYEELKSGLARLGSKLTETEVKQLMEAADVDGNGTIDYIEFITATMHRHRLER  468

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+L+KAFQYFDKD SGFITRDELE+AMKE+G+ D ATIKEII+EVD D+DGRINYEEFC
Sbjct  469  DEHLFKAFQYFDKDHSGFITRDELESAMKEYGMGDEATIKEIIAEVDTDNDGRINYEEFC  528

Query  321  TMMRSGTKQQPKLF  280
             MMRSGT+ QPKLF
Sbjct  529  AMMRSGTQPQPKLF  542



>gb|AAC25423.1| calcium-dependent protein kinase [Nicotiana tabacum]
Length=540

 Score =   236 bits (603),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/134 (83%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ LTE EVKQLMEAADVDGNG+IDYIEFITATMH+HRLER
Sbjct  407  TDNSGTITYEELKSGLARLGSKLTETEVKQLMEAADVDGNGTIDYIEFITATMHRHRLER  466

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+L+KAFQYFDKD SGFITRDELE+AMKE+G+ D ATIKEII+EVD D+DGRINYEEFC
Sbjct  467  DEHLFKAFQYFDKDHSGFITRDELESAMKEYGMGDEATIKEIIAEVDTDNDGRINYEEFC  526

Query  321  TMMRSGTKQQPKLF  280
             MMRSGT+ QPKLF
Sbjct  527  AMMRSGTQPQPKLF  540



>ref|XP_009604147.1| PREDICTED: calcium-dependent protein kinase 2-like [Nicotiana 
tomentosiformis]
Length=521

 Score =   236 bits (602),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/134 (84%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEEL+ GLA+LG+ LTEAEVKQLMEAADVDGNGSIDY EFITATMHKHRLER
Sbjct  388  TDNSGTITYEELRSGLAKLGSKLTEAEVKQLMEAADVDGNGSIDYTEFITATMHKHRLER  447

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +ENLY AFQYFDKD SGFITRDELETAM+EHGI D A I+EII+EVD D+DGRINYEEFC
Sbjct  448  DENLYTAFQYFDKDGSGFITRDELETAMEEHGIGDPACIREIITEVDTDNDGRINYEEFC  507

Query  321  TMMRSGTKQQPKLF  280
             MMRSG KQ  KLF
Sbjct  508  AMMRSGVKQPGKLF  521



>ref|XP_011096067.1| PREDICTED: calcium-dependent protein kinase-like [Sesamum indicum]
Length=541

 Score =   235 bits (600),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 111/134 (83%), Positives = 126/134 (94%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ L+EAEVKQLMEAADVDGNG+IDYIEFITATMH+H+LER
Sbjct  408  TDRSGTITYEELKSGLARLGSKLSEAEVKQLMEAADVDGNGTIDYIEFITATMHRHKLER  467

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+L+KAFQ+FDKDSSG+ITRDELETAMKE+G+ D ATIKEIISEVD D+DGRINYEEFC
Sbjct  468  DEHLFKAFQFFDKDSSGYITRDELETAMKEYGMGDEATIKEIISEVDTDNDGRINYEEFC  527

Query  321  TMMRSGTKQQPKLF  280
             MMRSGT+QQ KLF
Sbjct  528  AMMRSGTQQQVKLF  541



>ref|XP_010093289.1| Calcium-dependent protein kinase 15 [Morus notabilis]
 gb|EXB53814.1| Calcium-dependent protein kinase 15 [Morus notabilis]
Length=539

 Score =   235 bits (600),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 111/134 (83%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA++G+ LTEAEVKQLMEAADVDGNG+IDYIEFI+ATMH+HRLER
Sbjct  406  TDKSGTITYEELKSGLARIGSRLTEAEVKQLMEAADVDGNGTIDYIEFISATMHRHRLER  465

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+LYK FQYFDKD+SGFITRDELETAMKEHGI D A IKEIISEVD D+DGRI+Y EFC
Sbjct  466  DEHLYKVFQYFDKDNSGFITRDELETAMKEHGIGDEANIKEIISEVDTDNDGRIDYTEFC  525

Query  321  TMMRSGTKQQPKLF  280
            TMMRSGT+Q  KLF
Sbjct  526  TMMRSGTQQSTKLF  539



>ref|XP_008226901.1| PREDICTED: calcium-dependent protein kinase 2 [Prunus mume]
Length=545

 Score =   235 bits (600),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 111/134 (83%), Positives = 126/134 (94%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ LTEAEVKQLMEAADVDG+G+IDYIEFITATMH+HRLER
Sbjct  412  TDNSGTITYEELKSGLARLGSKLTEAEVKQLMEAADVDGSGAIDYIEFITATMHRHRLER  471

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+L+KAFQYFDKD+SGFITRDELE+AMKE+G+ D ATI+EIISEVD D+DGRINYEEF 
Sbjct  472  DEHLFKAFQYFDKDNSGFITRDELESAMKEYGMGDDATIREIISEVDTDNDGRINYEEFS  531

Query  321  TMMRSGTKQQPKLF  280
            TMMRSGT+ QPKLF
Sbjct  532  TMMRSGTQPQPKLF  545



>gb|KHN11921.1| Calcium-dependent protein kinase 9 [Glycine soja]
Length=404

 Score =   231 bits (590),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 108/134 (81%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEEL+ GL +LG+ LTE EV+QLM+AADVDGNG+IDYIEFITATMH+HRLER
Sbjct  271  TDNSGTITYEELRAGLQRLGSKLTETEVRQLMDAADVDGNGTIDYIEFITATMHRHRLER  330

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+LYKAFQYFDKD SG+ITRDELE AMKE+G+ D ATI+EIISEVD D+DGRINYEEFC
Sbjct  331  DEHLYKAFQYFDKDGSGYITRDELEIAMKEYGMGDEATIREIISEVDTDNDGRINYEEFC  390

Query  321  TMMRSGTKQQPKLF  280
            TMMRSGT+QQ KLF
Sbjct  391  TMMRSGTQQQGKLF  404



>gb|KHN38276.1| Calcium-dependent protein kinase 33 [Glycine soja]
Length=391

 Score =   231 bits (588),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 108/134 (81%), Positives = 125/134 (93%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEEL+ GL +LG+ LTEAEV+QLM+AADVDGNG+IDYIEFITATMH+HRLER
Sbjct  258  TDNSGTITYEELRAGLQRLGSKLTEAEVQQLMDAADVDGNGTIDYIEFITATMHRHRLER  317

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+L+KAFQYFDKD SG+ITRDELETAMKE+G+ D ATI+EIISEVD D+DGRINY+EFC
Sbjct  318  DEHLHKAFQYFDKDGSGYITRDELETAMKEYGMGDEATIREIISEVDTDNDGRINYDEFC  377

Query  321  TMMRSGTKQQPKLF  280
            TMMRSGT+QQ KLF
Sbjct  378  TMMRSGTQQQGKLF  391



>gb|AET00506.2| calcium-dependent kinase [Medicago truncatula]
Length=540

 Score =   234 bits (598),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEEL+ GL +LG+ LTEAEV+QLMEAADVDGNG+IDYIEFITATMH+HRLER
Sbjct  407  TDKSGTITYEELRAGLQRLGSKLTEAEVRQLMEAADVDGNGTIDYIEFITATMHRHRLER  466

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+LYKAFQYFDKD+SGFITRDELETAMKE+G+ D  TI+EIISEVD D+DGRINYEEFC
Sbjct  467  DEHLYKAFQYFDKDNSGFITRDELETAMKEYGMGDEETIREIISEVDTDNDGRINYEEFC  526

Query  321  TMMRSGTKQQPKLF  280
            TMMRSG +QQ KLF
Sbjct  527  TMMRSGVQQQGKLF  540



>ref|XP_008806408.1| PREDICTED: calcium-dependent protein kinase 2 [Phoenix dactylifera]
Length=548

 Score =   234 bits (596),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ L+EAEVKQLM+AADVDGNG+IDYIEFITATMH+HRLER
Sbjct  415  TDNSGTITYEELKTGLARLGSKLSEAEVKQLMDAADVDGNGTIDYIEFITATMHRHRLER  474

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+LYKAFQYFDKDSSGFITRDELE+AM+EHGI DA+TIKEIISEVDAD+DGRINYEEFC
Sbjct  475  DEHLYKAFQYFDKDSSGFITRDELESAMEEHGIGDASTIKEIISEVDADNDGRINYEEFC  534

Query  321  TMMRSGTKQQPKLF  280
             MM+ G +Q  KL 
Sbjct  535  AMMKGGIQQPVKLM  548



>ref|XP_009406510.1| PREDICTED: calcium-dependent protein kinase isoform 2 [Musa acuminata 
subsp. malaccensis]
Length=519

 Score =   233 bits (593),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 124/134 (93%), Gaps = 1/134 (1%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITY+ELK GLA+LG+ L+EAE+KQLM+AADVDGNGSIDYIEFITATMH+H+LER
Sbjct  386  TDKSGTITYDELKTGLARLGSKLSEAEIKQLMDAADVDGNGSIDYIEFITATMHRHKLER  445

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            EE+LY+AFQYFDKD SGFITR+ELE+AMK+HG+ DA TIKEIISEVDADHDGRINYEEFC
Sbjct  446  EEHLYRAFQYFDKDRSGFITREELESAMKQHGVGDADTIKEIISEVDADHDGRINYEEFC  505

Query  321  TMMRSGTKQQPKLF  280
            +MMRSG  QQP L 
Sbjct  506  SMMRSGM-QQPVLL  518



>ref|XP_011086186.1| PREDICTED: calcium-dependent protein kinase-like [Sesamum indicum]
Length=543

 Score =   233 bits (594),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ L+EAEVKQLMEAADVDGNG+IDYIEFITATMH+H+LER
Sbjct  410  TDKSGTITYEELKSGLARLGSKLSEAEVKQLMEAADVDGNGTIDYIEFITATMHRHKLER  469

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+LY AFQYFDKDSSG+ITRDELETAMKE+G+ D ATIKEIISEVD D+DGRINY+EFC
Sbjct  470  DEHLYSAFQYFDKDSSGYITRDELETAMKEYGMGDEATIKEIISEVDTDNDGRINYDEFC  529

Query  321  TMMRSGTKQQPKLF  280
             MMRSGT+Q  KLF
Sbjct  530  AMMRSGTQQPVKLF  543



>ref|XP_004294385.1| PREDICTED: calcium-dependent protein kinase 2-like [Fragaria 
vesca subsp. vesca]
Length=541

 Score =   233 bits (594),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITY+ELK GLA+LG+ LTEAEVKQLMEAADVDGNG IDYIEFITATMH+H+LER
Sbjct  408  TDKSGTITYDELKSGLARLGSKLTEAEVKQLMEAADVDGNGGIDYIEFITATMHRHKLER  467

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+LYKAFQYFD D+SGFITRDELE AMKE+G+ D ATI++IISEVD D+DGRINYEEFC
Sbjct  468  DEHLYKAFQYFDTDNSGFITRDELEKAMKEYGMGDEATIRDIISEVDTDNDGRINYEEFC  527

Query  321  TMMRSGTKQQPKLF  280
            TMMRSGT+QQ KLF
Sbjct  528  TMMRSGTQQQGKLF  541



>gb|AIU98507.1| calcium-dependent protein kinase [Musa acuminata AAA Group]
Length=519

 Score =   232 bits (592),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 107/133 (80%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITY+ELK GLA+LG+ L+EAE+KQLM+AADVDGNGSIDYIEFITATMH+H+LER
Sbjct  386  TDKSGTITYDELKTGLARLGSKLSEAEIKQLMDAADVDGNGSIDYIEFITATMHRHKLER  445

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            EE+LY+AFQYFDKD SGFITR+ELE+AMK+HG+ DA TIKEIISEVDADHDGRINYEEFC
Sbjct  446  EEHLYRAFQYFDKDRSGFITREELESAMKQHGVGDADTIKEIISEVDADHDGRINYEEFC  505

Query  321  TMMRSGTKQQPKL  283
            +MMRSG +Q  +L
Sbjct  506  SMMRSGMQQPVQL  518



>tpg|DAA62901.2| TPA: putative calcium-dependent protein kinase family protein 
isoform 1 [Zea mays]
Length=140

 Score =   220 bits (560),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ L+EAEVKQLMEAADVDGNGSIDY+EFITATMH+H+LER
Sbjct  7    TDNSGTITYEELKAGLAKLGSKLSEAEVKQLMEAADVDGNGSIDYVEFITATMHRHKLER  66

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+L+KAFQYFDKD+SGFITRDELE+A+ EH + D +TIKEIISEVD D+DGRINYEEFC
Sbjct  67   DEHLFKAFQYFDKDNSGFITRDELESALIEHEMGDTSTIKEIISEVDTDNDGRINYEEFC  126

Query  321  TMMRSGTKQQPKL  283
             MMR G +Q  +L
Sbjct  127  AMMRGGMQQPMRL  139



>ref|XP_010276092.1| PREDICTED: calcium-dependent protein kinase 2-like [Nelumbo nucifera]
Length=538

 Score =   232 bits (592),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SG+ITYEELK GLA+LG+ L+EAEVKQLMEAADVDGNG+IDYIEFITATMH+HRLER
Sbjct  405  TDKSGSITYEELKTGLARLGSKLSEAEVKQLMEAADVDGNGTIDYIEFITATMHRHRLER  464

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+LYKAFQYFDKD SGFITRDELETAMKE+G+ D A+IKEIISEVD D+DGRINYEEFC
Sbjct  465  DEHLYKAFQYFDKDHSGFITRDELETAMKEYGMGDEASIKEIISEVDTDNDGRINYEEFC  524

Query  321  TMMRSGTKQQPKLF  280
            TMMRSG +Q  KL 
Sbjct  525  TMMRSGMQQPVKLI  538



>ref|XP_010545509.1| PREDICTED: calcium-dependent protein kinase 33 [Tarenaya hassleriana]
 ref|XP_010545510.1| PREDICTED: calcium-dependent protein kinase 33 [Tarenaya hassleriana]
Length=534

 Score =   232 bits (591),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEEL++GLA+LG+ LTE+EVKQLMEAADVDGNGSIDYIEFITATMH+HRLE 
Sbjct  401  TDNSGTITYEELREGLAKLGSKLTESEVKQLMEAADVDGNGSIDYIEFITATMHRHRLES  460

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +ENLYKAFQ+FDKD SG+IT DELE A+KE+G+ D ATIKEI+S+VD+D+DGRINYEEFC
Sbjct  461  DENLYKAFQHFDKDGSGYITIDELEAALKEYGMGDDATIKEILSDVDSDNDGRINYEEFC  520

Query  321  TMMRSGTKQQPKLF  280
            TMMRSG  QQP+LF
Sbjct  521  TMMRSGNPQQPRLF  534



>gb|KFK39368.1| hypothetical protein AALP_AA3G235800 [Arabis alpina]
Length=535

 Score =   232 bits (591),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK+GLA+LG+ LTEAEVKQLM+AADVDGNGSIDYIEFITATMH+HRLE 
Sbjct  402  TDNSGTITYEELKEGLAKLGSKLTEAEVKQLMDAADVDGNGSIDYIEFITATMHRHRLES  461

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
             ENLYKAFQ+FDKDSSG+IT DELE A+KE+G+ D ATIKE++S+VD+D+DGRINYEEFC
Sbjct  462  NENLYKAFQHFDKDSSGYITIDELEAALKEYGMGDDATIKEVLSDVDSDNDGRINYEEFC  521

Query  321  TMMRSGTKQQPKLF  280
             MMRSG  QQP+LF
Sbjct  522  AMMRSGNPQQPRLF  535



>ref|XP_010092160.1| Calcium-dependent protein kinase 9 [Morus notabilis]
 gb|EXB50311.1| Calcium-dependent protein kinase 9 [Morus notabilis]
Length=548

 Score =   232 bits (591),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITY+ELK GLA+LG+ LTE EVKQLMEAADVDGNG+IDYIEFITATMH+HRLER
Sbjct  415  TDNSGTITYDELKSGLARLGSKLTETEVKQLMEAADVDGNGTIDYIEFITATMHRHRLER  474

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            EE+L+KAFQ+FDKDSSGFITRDELETAMK++G+ D ATI+EIISEVD D+DGRINY EFC
Sbjct  475  EEHLFKAFQFFDKDSSGFITRDELETAMKDYGMGDEATIREIISEVDTDNDGRINYSEFC  534

Query  321  TMMRSGTKQQPKLF  280
             MMRSGT+ Q KLF
Sbjct  535  AMMRSGTQHQGKLF  548



>ref|XP_010278695.1| PREDICTED: calcium-dependent protein kinase 2-like [Nelumbo nucifera]
Length=539

 Score =   231 bits (590),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ L+EAEVKQLMEAADVDGNG+IDYIEFITATMH+H+LER
Sbjct  406  TDKSGTITYEELKTGLARLGSKLSEAEVKQLMEAADVDGNGTIDYIEFITATMHRHKLER  465

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+LYKAFQ+FDKD SGFITRDELETAMKE+G+ D A+I+EIISEVD D+DGRINYEEFC
Sbjct  466  DEHLYKAFQHFDKDQSGFITRDELETAMKEYGMGDEASIREIISEVDTDNDGRINYEEFC  525

Query  321  TMMRSGTKQQPKLF  280
            TMMRSG +Q  KLF
Sbjct  526  TMMRSGLQQHAKLF  539



>ref|NP_001275371.1| calcium-dependent protein kinase 2 [Solanum tuberosum]
 gb|AAL09044.3|AF418563_1 calcium-dependent protein kinase 2 [Solanum tuberosum]
 gb|ADK10908.1| calcium-dependent protein kinase 2 [Solanum tuberosum]
Length=515

 Score =   231 bits (589),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 109/128 (85%), Positives = 116/128 (91%), Gaps = 0/128 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ LTEAEVKQLMEAADVDGNGSIDY EFITATMHKHRLER
Sbjct  388  TDNSGTITYEELKSGLAKLGSKLTEAEVKQLMEAADVDGNGSIDYTEFITATMHKHRLER  447

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +ENLY AFQYFDKD SGFITRDELE AM+EHGI D + I+EIISEVD D+DGRINYEEFC
Sbjct  448  DENLYTAFQYFDKDGSGFITRDELEAAMQEHGIGDPSCIREIISEVDTDNDGRINYEEFC  507

Query  321  TMMRSGTK  298
            TMMRSG K
Sbjct  508  TMMRSGAK  515



>gb|ACR36994.1| unknown [Zea mays]
Length=140

 Score =   219 bits (557),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ L+EAEVKQLMEAADVDGNGSIDY+EFITATMH+H+LER
Sbjct  7    TDNSGTITYEELKAGLAKLGSKLSEAEVKQLMEAADVDGNGSIDYVEFITATMHRHKLER  66

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E L+KAFQYFDKD+SGFITRDELE+A+ EH + D +TIKEIISEVD D+DGRINYEEFC
Sbjct  67   DEYLFKAFQYFDKDNSGFITRDELESALIEHEMGDTSTIKEIISEVDTDNDGRINYEEFC  126

Query  321  TMMRSGTKQQPKL  283
             MMR G +Q  +L
Sbjct  127  AMMRGGMQQPMRL  139



>gb|ACY78680.1| calcium-dependent protein kinase 1 [Panax ginseng]
Length=549

 Score =   231 bits (589),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ L+EAEV+QLMEAADVDGNG+IDYIEFITATMH+H+LER
Sbjct  415  TDNSGTITYEELKSGLARLGSKLSEAEVQQLMEAADVDGNGTIDYIEFITATMHRHKLER  474

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+LYKAFQYFDKDSSGFITRDELE+AMKE+G+ D ATIKEIISEVD D+DGRINYEEFC
Sbjct  475  DEHLYKAFQYFDKDSSGFITRDELESAMKEYGMGDEATIKEIISEVDTDNDGRINYEEFC  534

Query  321  TMMRSGTKQQ  292
            TMMRSGT Q 
Sbjct  535  TMMRSGTTQH  544



>ref|XP_002891589.1| calcium-dependent protein kinase 33 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67848.1| calcium-dependent protein kinase 33 [Arabidopsis lyrata subsp. 
lyrata]
Length=521

 Score =   230 bits (587),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK+GLA+LG+ LTEAEVKQLM+AADVDGNGSIDYIEFITATMH+HRLE 
Sbjct  388  TDNSGTITYEELKEGLAKLGSKLTEAEVKQLMDAADVDGNGSIDYIEFITATMHRHRLES  447

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
             ENLY+AFQ+FDKD SG+IT DELE A+KE+G+ D ATIKEI+S+VDAD+DGRINYEEFC
Sbjct  448  NENLYRAFQHFDKDGSGYITIDELEAALKEYGMGDDATIKEILSDVDADNDGRINYEEFC  507

Query  321  TMMRSGTKQQPKLF  280
             MMRSG  QQP+LF
Sbjct  508  AMMRSGNPQQPRLF  521



>gb|EPS59225.1| calcium-dependent protein kinase 1, partial [Genlisea aurea]
Length=503

 Score =   229 bits (585),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 109/135 (81%), Positives = 125/135 (93%), Gaps = 1/135 (1%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ L+EAEVKQLMEAADVDGNG+IDYIEFITATMH+HRLER
Sbjct  369  TDNSGTITYEELKTGLARLGSKLSEAEVKQLMEAADVDGNGTIDYIEFITATMHRHRLER  428

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+L+ AFQ+FD D+SG+ITRDELETAMK++G+ D ATI+EIISEVD D+DGRINYEEFC
Sbjct  429  DEHLFGAFQFFDTDNSGYITRDELETAMKKYGMGDEATIREIISEVDTDNDGRINYEEFC  488

Query  321  TMMRSGTKQQP-KLF  280
            TMMRSGT QQP KLF
Sbjct  489  TMMRSGTTQQPVKLF  503



>ref|XP_007212312.1| hypothetical protein PRUPE_ppa006748mg [Prunus persica]
 gb|EMJ13511.1| hypothetical protein PRUPE_ppa006748mg [Prunus persica]
Length=397

 Score =   226 bits (577),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 106/134 (79%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA++G+ L+EAEV+QLM+AADVDGNGSIDYIEFI+ATMH+ RLER
Sbjct  264  TDKSGTITYEELKTGLARIGSRLSEAEVRQLMDAADVDGNGSIDYIEFISATMHRQRLER  323

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+LYKAFQYFDKDSSG+ITRDELE AMKEH + D  TI+EIISEVDAD+DGRINY EFC
Sbjct  324  DEHLYKAFQYFDKDSSGYITRDELEAAMKEHAMGDENTIREIISEVDADNDGRINYSEFC  383

Query  321  TMMRSGTKQQPKLF  280
             MMRSGT+Q  KLF
Sbjct  384  AMMRSGTQQPGKLF  397



>gb|AGA83664.1| calcium-dependent protein kinase 1 [Dendrobium catenatum]
Length=534

 Score =   230 bits (587),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SG+ITYEELK GLA+LG+ L+EAEVKQLM+AADVDGNG+IDYIEFITATMH+H+LER
Sbjct  401  TDKSGSITYEELKTGLARLGSKLSEAEVKQLMDAADVDGNGTIDYIEFITATMHRHKLER  460

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +ENLY AFQYFDKD SGFITRDELETA++EHG+ DAATIKEIISEVDAD+DGRINYEEFC
Sbjct  461  DENLYSAFQYFDKDDSGFITRDELETALEEHGMGDAATIKEIISEVDADNDGRINYEEFC  520

Query  321  TMMRSGTKQQPKLF  280
             MM+SG +Q  K+ 
Sbjct  521  AMMKSGLQQPAKII  534



>ref|XP_006406385.1| hypothetical protein EUTSA_v10020475mg [Eutrema salsugineum]
 gb|ESQ47838.1| hypothetical protein EUTSA_v10020475mg [Eutrema salsugineum]
Length=537

 Score =   230 bits (587),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK+GLA+LG+ LTEAEVKQLM+AADVDGNGSIDYIEFITATMH+HRLE 
Sbjct  404  TDNSGTITYEELKEGLAKLGSKLTEAEVKQLMDAADVDGNGSIDYIEFITATMHRHRLES  463

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
             ENLYKAFQ+FDKDSSG+IT DELE A+KE+G+ D  TIKE++S+VD+D+DGRINYEEFC
Sbjct  464  NENLYKAFQHFDKDSSGYITIDELEVALKEYGMGDDETIKEVLSDVDSDNDGRINYEEFC  523

Query  321  TMMRSGTKQQPKLF  280
             MMRSG  QQPKLF
Sbjct  524  AMMRSGNPQQPKLF  537



>ref|XP_009360996.1| PREDICTED: calcium-dependent protein kinase 2-like [Pyrus x bretschneideri]
Length=544

 Score =   230 bits (587),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITY+ELK GLA+LG+ LTEAEVKQLMEAADVDG+GSIDY+EFITATMH+HRLER
Sbjct  411  TDNSGTITYDELKSGLARLGSKLTEAEVKQLMEAADVDGSGSIDYLEFITATMHRHRLER  470

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+LYKAFQYFDKD+SGFITRDELE+AMKE+G+ D ATI+EIISEVD D+DGRINYEEF 
Sbjct  471  DEHLYKAFQYFDKDNSGFITRDELESAMKEYGMGDEATIREIISEVDTDNDGRINYEEFS  530

Query  321  TMMRSGTKQQPKLF  280
            TMMRSG + Q KLF
Sbjct  531  TMMRSGMQPQAKLF  544



>ref|XP_011047988.1| PREDICTED: calcium-dependent protein kinase-like isoform X2 [Populus 
euphratica]
Length=533

 Score =   230 bits (586),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 125/134 (93%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ L+EAEVKQLMEAADVDGNGSIDYIEFI+ATMH+++LER
Sbjct  400  TDKSGTITYEELKTGLARLGSKLSEAEVKQLMEAADVDGNGSIDYIEFISATMHRYKLER  459

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+LYKAFQYFDKDSSG+ITRDELE+AMKE+G+ D ATIKEII+EVDAD+DGRINYEEFC
Sbjct  460  DEHLYKAFQYFDKDSSGYITRDELESAMKEYGMGDEATIKEIIAEVDADNDGRINYEEFC  519

Query  321  TMMRSGTKQQPKLF  280
             MMRSGT+   KLF
Sbjct  520  AMMRSGTQHAGKLF  533



>ref|XP_008439982.1| PREDICTED: calcium-dependent protein kinase 2 [Cucumis melo]
Length=552

 Score =   230 bits (587),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ L+EAEVKQLMEAADVDGNGSIDYIEFI+ATMH+HRLER
Sbjct  419  TDNSGTITYEELKTGLARLGSRLSEAEVKQLMEAADVDGNGSIDYIEFISATMHRHRLER  478

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+LYKAFQ+FDKDSSG+IT+DELETAMK++G+ D A+I+EIISEVD D+DGRINY+EFC
Sbjct  479  DEHLYKAFQFFDKDSSGYITKDELETAMKDYGMGDEASIREIISEVDTDNDGRINYQEFC  538

Query  321  TMMRSGTKQQPKLF  280
             MMRSGT Q  KLF
Sbjct  539  AMMRSGTTQPGKLF  552



>ref|XP_006303970.1| hypothetical protein CARUB_v10008860mg [Capsella rubella]
 gb|EOA36868.1| hypothetical protein CARUB_v10008860mg [Capsella rubella]
Length=520

 Score =   229 bits (585),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK+GLA+LG+ LTEAEVKQLM+AADVDGNGSIDYIEFITATMH+HRLE 
Sbjct  387  TDNSGTITYEELKEGLAKLGSKLTEAEVKQLMDAADVDGNGSIDYIEFITATMHRHRLES  446

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
             ENLYKAFQ+FDKD SG+IT DELE A+KE+GI D ATIKEI+S+VD+D+DG+INYEEFC
Sbjct  447  NENLYKAFQHFDKDGSGYITIDELEAALKEYGIGDDATIKEILSDVDSDNDGKINYEEFC  506

Query  321  TMMRSGTKQQPKLF  280
             MMRSG  QQP+LF
Sbjct  507  AMMRSGNPQQPRLF  520



>gb|KHN35744.1| Calcium-dependent protein kinase 33 [Glycine soja]
Length=404

 Score =   226 bits (577),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD+SGTITYEELK GLA++G+ L+EAEVKQLM+AADVDGNGSIDY+EFI+ATMH+HRLER
Sbjct  271  TDSSGTITYEELKTGLARIGSRLSEAEVKQLMDAADVDGNGSIDYLEFISATMHRHRLER  330

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+LYKAFQYFDKD+SG+ITRDELETAM +HG+ D ATIKEIISEVD D+DGRINYEEFC
Sbjct  331  DEHLYKAFQYFDKDNSGYITRDELETAMTQHGMGDEATIKEIISEVDTDNDGRINYEEFC  390

Query  321  TMMRSGTKQQPKLF  280
             MMRSG   Q +L 
Sbjct  391  AMMRSGMPHQGQLL  404



>ref|XP_011047987.1| PREDICTED: calcium-dependent protein kinase-like isoform X1 [Populus 
euphratica]
Length=544

 Score =   230 bits (586),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 125/134 (93%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ L+EAEVKQLMEAADVDGNGSIDYIEFI+ATMH+++LER
Sbjct  411  TDKSGTITYEELKTGLARLGSKLSEAEVKQLMEAADVDGNGSIDYIEFISATMHRYKLER  470

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+LYKAFQYFDKDSSG+ITRDELE+AMKE+G+ D ATIKEII+EVDAD+DGRINYEEFC
Sbjct  471  DEHLYKAFQYFDKDSSGYITRDELESAMKEYGMGDEATIKEIIAEVDADNDGRINYEEFC  530

Query  321  TMMRSGTKQQPKLF  280
             MMRSGT+   KLF
Sbjct  531  AMMRSGTQHAGKLF  544



>ref|XP_004134759.1| PREDICTED: calcium-dependent protein kinase 21-like [Cucumis 
sativus]
 ref|XP_004155602.1| PREDICTED: calcium-dependent protein kinase 21-like [Cucumis 
sativus]
 gb|KGN49114.1| hypothetical protein Csa_6G513780 [Cucumis sativus]
Length=552

 Score =   230 bits (586),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ L+EAEVKQLMEAADVDGNGSIDYIEFI+ATMH+HRLER
Sbjct  419  TDNSGTITYEELKTGLARLGSRLSEAEVKQLMEAADVDGNGSIDYIEFISATMHRHRLER  478

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+LYKAFQ+FDKDSSG+IT+DELETAMK++G+ D A+I+EIISEVD D+DGRINY+EFC
Sbjct  479  DEHLYKAFQFFDKDSSGYITKDELETAMKDYGMGDEASIREIISEVDTDNDGRINYQEFC  538

Query  321  TMMRSGTKQQPKLF  280
             MMRSGT Q  KLF
Sbjct  539  AMMRSGTTQPGKLF  552



>gb|KDO62722.1| hypothetical protein CISIN_1g0096581mg, partial [Citrus sinensis]
 gb|KDO62723.1| hypothetical protein CISIN_1g0096581mg, partial [Citrus sinensis]
Length=293

 Score =   223 bits (567),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ LTEAEV+QLMEAADVDGNG+IDYIEFITATMH+H+LER
Sbjct  160  TDNSGTITYEELKAGLARLGSKLTEAEVQQLMEAADVDGNGTIDYIEFITATMHRHKLER  219

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +++LYKAFQ+FDKD+SGFIT DELE AMK++G+ D  TIKEIISEVD D+DGRINY+EFC
Sbjct  220  DDHLYKAFQHFDKDNSGFITIDELEIAMKDYGMGDDDTIKEIISEVDTDNDGRINYDEFC  279

Query  321  TMMRSGTKQQPKLF  280
             MMRSGT+ Q KLF
Sbjct  280  AMMRSGTQPQAKLF  293



>ref|XP_008365060.1| PREDICTED: calcium-dependent protein kinase 2 [Malus domestica]
Length=544

 Score =   229 bits (585),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITY+ELK GLA+LG+ LTEAEVKQLMEAADVDG+GSIDYIEFITATMH+HRLER
Sbjct  411  TDNSGTITYDELKSGLARLGSKLTEAEVKQLMEAADVDGSGSIDYIEFITATMHRHRLER  470

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+LYKAFQYFDKD+SGFITRDELE+AMKE+G+ D ATI+EIISEVD D+DGRINYEEF 
Sbjct  471  DEHLYKAFQYFDKDNSGFITRDELESAMKEYGMGDEATIREIISEVDTDNDGRINYEEFS  530

Query  321  TMMRSGTKQQPKLF  280
            TMM+SG + Q KLF
Sbjct  531  TMMKSGMQPQAKLF  544



>ref|XP_003519577.1| PREDICTED: calcium-dependent protein kinase 9-like isoform 1 
[Glycine max]
Length=528

 Score =   229 bits (584),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 125/134 (93%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEEL+ GL +LG+ LTEAEV+QLM+AADVDGNG+IDYIEFITATMH+HRLER
Sbjct  395  TDNSGTITYEELRAGLQRLGSKLTEAEVQQLMDAADVDGNGTIDYIEFITATMHRHRLER  454

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+L+KAFQYFDKD SG+ITRDELETAMKE+G+ + ATI+EIISEVD D+DGRINY+EFC
Sbjct  455  DEHLHKAFQYFDKDGSGYITRDELETAMKEYGMGNEATIREIISEVDTDNDGRINYDEFC  514

Query  321  TMMRSGTKQQPKLF  280
            TMMRSGT+QQ KLF
Sbjct  515  TMMRSGTQQQGKLF  528



>ref|XP_002532559.1| calcium-dependent protein kinase, putative [Ricinus communis]
 gb|EEF29820.1| calcium-dependent protein kinase, putative [Ricinus communis]
Length=533

 Score =   229 bits (584),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 108/134 (81%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITY+ELK GLA+LG+ LTE EVKQLM+AADVDGNG+IDY+EFITATMH+HRLER
Sbjct  400  TDNSGTITYDELKAGLARLGSKLTETEVKQLMDAADVDGNGTIDYLEFITATMHRHRLER  459

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            EE+LYKAFQYFDKD+SGFITRDELETAMK++ + D ATIKEIISEVDAD+DGRINYEEFC
Sbjct  460  EEHLYKAFQYFDKDNSGFITRDELETAMKDYEMGDDATIKEIISEVDADNDGRINYEEFC  519

Query  321  TMMRSGTKQQPKLF  280
            TMM++G + Q KLF
Sbjct  520  TMMKTGNQHQGKLF  533



>ref|NP_175485.1| calcium-dependent protein kinase 33 [Arabidopsis thaliana]
 sp|Q9C6P3.1|CDPKX_ARATH RecName: Full=Calcium-dependent protein kinase 33 [Arabidopsis 
thaliana]
 gb|AAG51192.1|AC079279_13 calcium-dependent protein kinase [Arabidopsis thaliana]
 gb|AAT06478.1| At1g50700 [Arabidopsis thaliana]
 dbj|BAD43386.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE32581.1| calcium-dependent protein kinase 33 [Arabidopsis thaliana]
Length=521

 Score =   229 bits (583),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 106/134 (79%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK+GLA+LG+ LTEAEVKQLM+AADVDGNGSIDYIEFITATMH+HRLE 
Sbjct  388  TDNSGTITYEELKEGLAKLGSRLTEAEVKQLMDAADVDGNGSIDYIEFITATMHRHRLES  447

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
             EN+YKAFQ+FDKD SG+IT DELE A+KE+G+ D ATIKEI+S+VDAD+DGRINY+EFC
Sbjct  448  NENVYKAFQHFDKDGSGYITTDELEAALKEYGMGDDATIKEILSDVDADNDGRINYDEFC  507

Query  321  TMMRSGTKQQPKLF  280
             MMRSG  QQP+LF
Sbjct  508  AMMRSGNPQQPRLF  521



>ref|XP_007213894.1| hypothetical protein PRUPE_ppa003830mg [Prunus persica]
 gb|EMJ15093.1| hypothetical protein PRUPE_ppa003830mg [Prunus persica]
Length=545

 Score =   229 bits (584),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ LTEAEVKQLMEAADVDG+G+IDYIEFITATMH+HRLER
Sbjct  412  TDNSGTITYEELKSGLARLGSKLTEAEVKQLMEAADVDGSGAIDYIEFITATMHRHRLER  471

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+L+KAFQYFDKD+SGFITRDELE+AMKE+G+ D  TI+EIISEVD D+DGRINYEEF 
Sbjct  472  DEHLFKAFQYFDKDNSGFITRDELESAMKEYGMGDDQTIREIISEVDTDNDGRINYEEFS  531

Query  321  TMMRSGTKQQPKLF  280
            TMMRSGT+ Q KLF
Sbjct  532  TMMRSGTQPQAKLF  545



>gb|KDP39132.1| hypothetical protein JCGZ_00889 [Jatropha curcas]
Length=535

 Score =   229 bits (583),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITY+ELK GLA+LG+ LTEAEVKQLMEAADVDGNG+IDYIEFITATMH+HRLER
Sbjct  402  TDNSGTITYDELKTGLARLGSKLTEAEVKQLMEAADVDGNGTIDYIEFITATMHRHRLER  461

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            EE+LYKAFQYFDKD+SGFIT DELETAMK+ G+ D ATIKEIISEVD D+DGRINYEEFC
Sbjct  462  EEHLYKAFQYFDKDNSGFITTDELETAMKDFGMGDDATIKEIISEVDTDNDGRINYEEFC  521

Query  321  TMMRSGTKQQPKLF  280
             MMR+G + Q +LF
Sbjct  522  AMMRTGNQHQGRLF  535



>ref|XP_006389625.1| hypothetical protein POPTR_0021s00750g [Populus trichocarpa]
 gb|ERP48539.1| hypothetical protein POPTR_0021s00750g [Populus trichocarpa]
 emb|CEH19767.1| Calcium-dependent protein kinase [Populus tremula x Populus tremuloides]
Length=532

 Score =   228 bits (582),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 108/134 (81%), Positives = 125/134 (93%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ L+EAEVKQLMEAADVDGNGSIDYIEFI+ATMH+++LER
Sbjct  399  TDKSGTITYEELKTGLARLGSKLSEAEVKQLMEAADVDGNGSIDYIEFISATMHRYKLER  458

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+LYKAFQYFDKDSSG+ITRDELE+AMKE+G+ D ATIKEII+EVDAD+DG+INYEEFC
Sbjct  459  DEHLYKAFQYFDKDSSGYITRDELESAMKEYGMGDEATIKEIIAEVDADNDGKINYEEFC  518

Query  321  TMMRSGTKQQPKLF  280
             MMRSGT+   KLF
Sbjct  519  AMMRSGTQHAGKLF  532



>gb|AFY10519.1| calcium dependent protein kinase 1 [Dendrobium catenatum]
Length=525

 Score =   228 bits (580),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 107/130 (82%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ L+EAEVKQLM+AADVDG+G+IDYIEFITATMH+H+LER
Sbjct  392  TDGSGTITYEELKTGLARLGSKLSEAEVKQLMDAADVDGDGTIDYIEFITATMHRHKLER  451

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            EENLY AFQYFDKD+SGFITRDELETAM+EHG+ DAATIKEII EVD D+DGRINYEEFC
Sbjct  452  EENLYGAFQYFDKDNSGFITRDELETAMEEHGVGDAATIKEIILEVDTDNDGRINYEEFC  511

Query  321  TMMRSGTKQQ  292
             MMRSG  Q 
Sbjct  512  AMMRSGLPQP  521



>ref|XP_006449723.1| hypothetical protein CICLE_v10014823mg [Citrus clementina]
 gb|ESR62963.1| hypothetical protein CICLE_v10014823mg [Citrus clementina]
Length=544

 Score =   228 bits (581),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ L+E EVKQLM+AADVDGNG+IDYIEFI+ATMH++RLER
Sbjct  411  TDKSGTITYEELKTGLARLGSKLSETEVKQLMDAADVDGNGTIDYIEFISATMHRYRLER  470

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+LYKAFQYFDKD+SG+ITRDELETAMK++GI D A+IKEIISEVD D+DGRINYEEFC
Sbjct  471  DEHLYKAFQYFDKDNSGYITRDELETAMKDYGIGDEASIKEIISEVDTDNDGRINYEEFC  530

Query  321  TMMRSGTKQQPKLF  280
            TMMRSGT Q  KL 
Sbjct  531  TMMRSGTPQPAKLI  544



>ref|NP_001234806.1| calcium-dependent protein kinase [Solanum lycopersicum]
 emb|CAC87494.1| calcium-dependent protein kinase [Solanum lycopersicum]
Length=553

 Score =   228 bits (581),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 111/135 (82%), Positives = 122/135 (90%), Gaps = 1/135 (1%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ LTE EVKQLMEAADVDGNGSIDYIEFITATMH+HRLER
Sbjct  419  TDNSGTITYEELKSGLARLGSKLTETEVKQLMEAADVDGNGSIDYIEFITATMHRHRLER  478

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+L+KAFQ+FDKD SGFITRDELE AMKE+G+ D ATIKEII+EVD D+DGRINYEEFC
Sbjct  479  DEHLFKAFQHFDKDHSGFITRDELENAMKEYGMGDEATIKEIIAEVDTDNDGRINYEEFC  538

Query  321  TMMRSGTKQ-QPKLF  280
             MMRSGT Q Q KLF
Sbjct  539  AMMRSGTTQPQQKLF  553



>gb|KDO78217.1| hypothetical protein CISIN_1g009091mg [Citrus sinensis]
Length=544

 Score =   228 bits (580),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ L+E EVKQLM+AADVDGNG+IDYIEFI+ATMH++RLER
Sbjct  411  TDKSGTITYEELKTGLARLGSKLSETEVKQLMDAADVDGNGTIDYIEFISATMHRYRLER  470

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+LYKAFQYFDKD+SG+ITRDELETAMK++GI D A+IKEIISEVD D+DGRINYEEFC
Sbjct  471  DEHLYKAFQYFDKDNSGYITRDELETAMKDYGIGDEASIKEIISEVDTDNDGRINYEEFC  530

Query  321  TMMRSGTKQQPKLF  280
            TMMRSGT Q  KL 
Sbjct  531  TMMRSGTPQPAKLI  544



>ref|XP_006467440.1| PREDICTED: calcium-dependent protein kinase 21-like [Citrus sinensis]
Length=544

 Score =   228 bits (580),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ L+E EVKQLM+AADVDGNG+IDYIEFI+ATMH++RLER
Sbjct  411  TDKSGTITYEELKTGLARLGSKLSETEVKQLMDAADVDGNGTIDYIEFISATMHRYRLER  470

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+LYKAFQYFDKD+SG+ITRDELETAMK++GI D A+IKEIISEVD D+DGRINYEEFC
Sbjct  471  DEHLYKAFQYFDKDNSGYITRDELETAMKDYGIGDEASIKEIISEVDTDNDGRINYEEFC  530

Query  321  TMMRSGTKQQPKLF  280
            TMMRSGT Q  KL 
Sbjct  531  TMMRSGTPQPAKLI  544



>ref|XP_008384073.1| PREDICTED: calcium-dependent protein kinase 33-like [Malus domestica]
Length=397

 Score =   224 bits (570),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA++G+ L+E EV+QLM+AADVDGNGSIDYIEFI+ATMH+ RLER
Sbjct  264  TDNSGTITYEELKTGLARIGSRLSETEVRQLMDAADVDGNGSIDYIEFISATMHRQRLER  323

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+LYKAFQYFDKDSSG+ITRDELE AMKE+G+ D  TI+EIISEVDAD+DG+INY EFC
Sbjct  324  DEHLYKAFQYFDKDSSGYITRDELEAAMKEYGMGDDNTIREIISEVDADNDGKINYSEFC  383

Query  321  TMMRSGTKQQPKLF  280
             MMRSGT+Q  KLF
Sbjct  384  AMMRSGTQQPAKLF  397



>emb|CDP04396.1| unnamed protein product [Coffea canephora]
Length=549

 Score =   228 bits (580),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ L+E EVKQLMEAADVDGNGSIDYIEFITATMH+HRLER
Sbjct  416  TDNSGTITYEELKSGLARLGSKLSENEVKQLMEAADVDGNGSIDYIEFITATMHRHRLER  475

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+LYKAFQ+FD D SGFITRDELE+AM E+G+ D ATIKEIISEVD D+DGRINYEEFC
Sbjct  476  DEHLYKAFQHFDTDHSGFITRDELESAMMEYGMGDEATIKEIISEVDTDNDGRINYEEFC  535

Query  321  TMMRSGTKQQPKLF  280
             MMRSGT  Q KLF
Sbjct  536  AMMRSGTAAQGKLF  549



>ref|XP_009388872.1| PREDICTED: calcium-dependent protein kinase 2-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009388873.1| PREDICTED: calcium-dependent protein kinase 2-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009388874.1| PREDICTED: calcium-dependent protein kinase 2-like [Musa acuminata 
subsp. malaccensis]
Length=557

 Score =   228 bits (581),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 106/134 (79%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ L+EAEVKQLM+AADVDGNGSIDYIEFITATM++H+LER
Sbjct  424  TDKSGTITYEELKTGLARLGSKLSEAEVKQLMDAADVDGNGSIDYIEFITATMNRHKLER  483

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+LY+AFQYFDKD+SGFITRDELE+AM+EHG+ D ATIKEIISEVD D+DGRINY+EFC
Sbjct  484  DEHLYRAFQYFDKDNSGFITRDELESAMQEHGMGDIATIKEIISEVDTDNDGRINYQEFC  543

Query  321  TMMRSGTKQQPKLF  280
             MMRSG +Q  KL 
Sbjct  544  AMMRSGVQQPAKLI  557



>ref|NP_188676.1| calmodulin-domain protein kinase 9 [Arabidopsis thaliana]
 sp|Q38868.1|CDPK9_ARATH RecName: Full=Calcium-dependent protein kinase 9; AltName: Full=Calmodulin-domain 
protein kinase CDPK isoform 9 [Arabidopsis 
thaliana]
 gb|AAB03242.1| calmodulin-domain protein kinase CDPK isoform 9 [Arabidopsis 
thaliana]
 dbj|BAB02824.1| calmodulin-domain protein kinase CDPK isoform 9 [Arabidopsis 
thaliana]
 gb|AAM53285.1| calmodulin-domain protein kinase CDPK isoform 9 [Arabidopsis 
thaliana]
 gb|AAP68337.1| At3g20410 [Arabidopsis thaliana]
 gb|AEE76375.1| calmodulin-domain protein kinase 9 [Arabidopsis thaliana]
Length=541

 Score =   227 bits (579),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 107/136 (79%), Positives = 125/136 (92%), Gaps = 2/136 (1%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK+GLA+LG+ LTEAEVKQLM+AADVDGNGSIDYIEFITATMH+HRLE 
Sbjct  406  TDNSGTITYEELKEGLAKLGSKLTEAEVKQLMDAADVDGNGSIDYIEFITATMHRHRLES  465

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
             ENLYKAFQ+FDKDSSG+IT DELE+A+KE+G+ D ATIKE++S+VD+D+DGRINYEEFC
Sbjct  466  NENLYKAFQHFDKDSSGYITIDELESALKEYGMGDDATIKEVLSDVDSDNDGRINYEEFC  525

Query  321  TMMRSGT--KQQPKLF  280
             MMRSG   +QQP+LF
Sbjct  526  AMMRSGNPQQQQPRLF  541



>ref|XP_008804309.1| PREDICTED: calcium-dependent protein kinase isoform 2-like [Phoenix 
dactylifera]
Length=538

 Score =   227 bits (579),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 106/134 (79%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ L+EAEVKQLM+AADVDGNG+IDYIEFITATMH++RLER
Sbjct  405  TDKSGTITYEELKTGLARLGSRLSEAEVKQLMDAADVDGNGTIDYIEFITATMHRNRLER  464

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+LY+AFQYFDKD+SGFITRDELE+AMKEHGI DA+TIKEIISE+D D+DGRINYEEFC
Sbjct  465  DEHLYRAFQYFDKDNSGFITRDELESAMKEHGIGDASTIKEIISEIDTDNDGRINYEEFC  524

Query  321  TMMRSGTKQQPKLF  280
             MM+ G +Q  KL 
Sbjct  525  AMMKGGIQQPVKLM  538



>ref|XP_009776253.1| PREDICTED: calcium-dependent protein kinase-like isoform X1 [Nicotiana 
sylvestris]
Length=551

 Score =   228 bits (580),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ L+EAEVKQLMEAADVDGNG+IDYIEF+TATMH+HRLER
Sbjct  418  TDNSGTITYEELKSGLARLGSKLSEAEVKQLMEAADVDGNGTIDYIEFVTATMHRHRLER  477

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +++L+KAFQ+FD D SGFIT+DELE+AMKE+G+ D ATIKEII+EVD DHDGRINYEEFC
Sbjct  478  DDHLFKAFQFFDTDHSGFITKDELESAMKEYGMGDEATIKEIIAEVDTDHDGRINYEEFC  537

Query  321  TMMRSGTKQQPKLF  280
             MMRSGT+ Q K+F
Sbjct  538  AMMRSGTQPQEKIF  551



>ref|XP_003529633.1| PREDICTED: calcium-dependent protein kinase isoform [Glycine 
max]
Length=529

 Score =   227 bits (578),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD+SGTITYEELK GLA++G+ L+EAEVKQLM+AADVDGNGSIDY+EFI+ATMH+HRLER
Sbjct  396  TDSSGTITYEELKTGLARIGSRLSEAEVKQLMDAADVDGNGSIDYLEFISATMHRHRLER  455

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+LYKAFQYFDKD+SG+ITRDELETAM +HG+ D ATIKEIISEVD D+DGRINYEEFC
Sbjct  456  DEHLYKAFQYFDKDNSGYITRDELETAMTQHGMGDEATIKEIISEVDTDNDGRINYEEFC  515

Query  321  TMMRSGTKQQPKLF  280
             MMRSG   Q +L 
Sbjct  516  AMMRSGMPHQGQLL  529



>ref|XP_007153943.1| hypothetical protein PHAVU_003G078400g [Phaseolus vulgaris]
 gb|ESW25937.1| hypothetical protein PHAVU_003G078400g [Phaseolus vulgaris]
Length=546

 Score =   227 bits (579),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA++G+ L+EAEVKQLMEAADVDGNGSIDY+EFI+ATMH+HRLER
Sbjct  406  TDNSGTITYEELKTGLARIGSRLSEAEVKQLMEAADVDGNGSIDYLEFISATMHRHRLER  465

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+LYKAFQYFDKD+SG+ITRDELETAM +HG+ D ATIKEIISEVD D+DGRINYEEFC
Sbjct  466  DEHLYKAFQYFDKDNSGYITRDELETAMTQHGMGDEATIKEIISEVDTDNDGRINYEEFC  525

Query  321  TMMRSGTKQQ  292
             MMRSG   Q
Sbjct  526  AMMRSGMPHQ  535



>ref|XP_010923910.1| PREDICTED: calcium-dependent protein kinase isoform 2-like isoform 
X2 [Elaeis guineensis]
Length=503

 Score =   226 bits (577),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 106/132 (80%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ L+EAEVKQLM+AADVDG+G+IDYIEFITATMH+H+LER
Sbjct  370  TDKSGTITYEELKSGLARLGSRLSEAEVKQLMDAADVDGDGTIDYIEFITATMHRHKLER  429

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+LYKAFQYFDKD+SGFITRDELE+AMKEHGI DA+TIKEIISEVD D+DGRINYEEFC
Sbjct  430  DEHLYKAFQYFDKDNSGFITRDELESAMKEHGIGDASTIKEIISEVDTDNDGRINYEEFC  489

Query  321  TMMRSGTKQQPK  286
             MM+ G +Q  K
Sbjct  490  AMMKGGIQQPVK  501



>ref|NP_001280761.1| calcium-dependent protein kinase 2-like [Malus domestica]
 gb|AAR28084.1| calcium-dependent protein kinase [Malus domestica]
Length=543

 Score =   227 bits (579),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 106/134 (79%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA++G+ L+EAEV+QLM+AADVDGNGSIDYIEFI+ATMH+ RLER
Sbjct  410  TDKSGTITYEELKTGLARIGSRLSEAEVRQLMDAADVDGNGSIDYIEFISATMHRQRLER  469

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+LYKAFQYFDKDSSG+ITRDELE AMKEHG+ D  TI+EIISEVDAD+DGRINY EFC
Sbjct  470  DEHLYKAFQYFDKDSSGYITRDELEAAMKEHGMGDDNTIREIISEVDADNDGRINYSEFC  529

Query  321  TMMRSGTKQQPKLF  280
             MMRSG +Q  KLF
Sbjct  530  AMMRSGAQQPAKLF  543



>ref|XP_010466227.1| PREDICTED: calcium-dependent protein kinase 9-like [Camelina 
sativa]
 ref|XP_010466228.1| PREDICTED: calcium-dependent protein kinase 9-like [Camelina 
sativa]
 ref|XP_010466229.1| PREDICTED: calcium-dependent protein kinase 9-like [Camelina 
sativa]
Length=542

 Score =   227 bits (579),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 107/136 (79%), Positives = 124/136 (91%), Gaps = 2/136 (1%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK+GLA+LG+ LTEAEVKQLM+AADVDGNGSIDYIEFITATMH+HRLE 
Sbjct  407  TDNSGTITYEELKEGLAKLGSKLTEAEVKQLMDAADVDGNGSIDYIEFITATMHRHRLES  466

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
             ENLYKAFQ+FDKDSSG+IT DELE A+KE+G+ D ATIKE++S+VD+D+DGRINYEEFC
Sbjct  467  NENLYKAFQHFDKDSSGYITIDELEAALKEYGMGDDATIKEVLSDVDSDNDGRINYEEFC  526

Query  321  TMMRSGT--KQQPKLF  280
             MMRSG   +QQP+LF
Sbjct  527  AMMRSGNPQQQQPRLF  542



>ref|XP_009360846.1| PREDICTED: calcium-dependent protein kinase 2-like [Pyrus x bretschneideri]
Length=543

 Score =   227 bits (579),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 106/134 (79%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA++G+ L+EAEV+QLM+AADVDGNGSIDYIEFI+ATMH+ RLER
Sbjct  410  TDKSGTITYEELKTGLARIGSRLSEAEVRQLMDAADVDGNGSIDYIEFISATMHRQRLER  469

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+LYKAFQYFDKDSSG+ITRDELE AMKEHG+ D  TI+EIISEVDAD+DGRINY EFC
Sbjct  470  DEHLYKAFQYFDKDSSGYITRDELEAAMKEHGMGDDNTIREIISEVDADNDGRINYSEFC  529

Query  321  TMMRSGTKQQPKLF  280
             MMRSG +Q  KLF
Sbjct  530  AMMRSGAQQPAKLF  543



>emb|CAA65500.1| protein kinase [Medicago sativa]
Length=542

 Score =   227 bits (579),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 123/141 (87%), Gaps = 7/141 (5%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GL +LG+ L+EAEVKQLMEAADVDGNG+ID IEFITATMH+H+LER
Sbjct  402  TDNSGTITYEELKAGLQRLGSKLSEAEVKQLMEAADVDGNGTIDCIEFITATMHRHKLER  461

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKE-------IISEVDADHDGR  343
            +++LYKAFQYFDKDSSGFITRDELETAMKE+G+ D ATIKE       IISEVD DHDGR
Sbjct  462  DDHLYKAFQYFDKDSSGFITRDELETAMKEYGMGDDATIKEIISEVDTIISEVDTDHDGR  521

Query  342  INYEEFCTMMRSGTKQQPKLF  280
            INYEEFC MMRSG +QQ KLF
Sbjct  522  INYEEFCAMMRSGNQQQVKLF  542



>gb|ABE72958.1| calcium dependent protein kinase 3 [Medicago truncatula]
Length=538

 Score =   227 bits (578),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 123/141 (87%), Gaps = 7/141 (5%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GL +LG+ L+EAEVKQLMEAADVDGNG+ID IEFITATMH+H+LER
Sbjct  398  TDNSGTITYEELKAGLQRLGSKLSEAEVKQLMEAADVDGNGTIDCIEFITATMHRHKLER  457

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKE-------IISEVDADHDGR  343
            +++LYKAFQYFDKDSSGFITRDELETAMKE+G+ D ATIKE       IISEVD DHDGR
Sbjct  458  DDHLYKAFQYFDKDSSGFITRDELETAMKEYGMGDDATIKEIISEVDTIISEVDTDHDGR  517

Query  342  INYEEFCTMMRSGTKQQPKLF  280
            INYEEFC MMRSG +QQ KLF
Sbjct  518  INYEEFCAMMRSGNQQQVKLF  538



>gb|KEH33831.1| calmodulin-domain kinase CDPK protein [Medicago truncatula]
Length=538

 Score =   227 bits (578),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 123/141 (87%), Gaps = 7/141 (5%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GL +LG+ L+EAEVKQLMEAADVDGNG+ID IEFITATMH+H+LER
Sbjct  398  TDNSGTITYEELKAGLQRLGSKLSEAEVKQLMEAADVDGNGTIDCIEFITATMHRHKLER  457

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKE-------IISEVDADHDGR  343
            +++LYKAFQYFDKDSSGFITRDELETAMKE+G+ D ATIKE       IISEVD DHDGR
Sbjct  458  DDHLYKAFQYFDKDSSGFITRDELETAMKEYGMGDDATIKEIISEVDTIISEVDTDHDGR  517

Query  342  INYEEFCTMMRSGTKQQPKLF  280
            INYEEFC MMRSG +QQ KLF
Sbjct  518  INYEEFCAMMRSGNQQQVKLF  538



>ref|XP_010929942.1| PREDICTED: calcium-dependent protein kinase 2-like [Elaeis guineensis]
Length=544

 Score =   227 bits (578),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 106/134 (79%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ L+EAEVKQLM+AADVDGNG+IDYIEFITATMH HRLER
Sbjct  411  TDKSGTITYEELKAGLARLGSKLSEAEVKQLMDAADVDGNGTIDYIEFITATMHWHRLER  470

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+LY+AFQYFDKD+SGFITRDELE+AMKEHGI DA+TIKEIISE+D D+DGRINYEEFC
Sbjct  471  DEHLYRAFQYFDKDNSGFITRDELESAMKEHGIGDASTIKEIISEIDTDNDGRINYEEFC  530

Query  321  TMMRSGTKQQPKLF  280
             MM+ G +Q  +L 
Sbjct  531  AMMKGGMQQPVELM  544



>gb|AHN49725.1| calcium-dependent protein kinase 1 [Hippeastrum hybrid cultivar]
Length=531

 Score =   226 bits (577),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ L+EAEVKQLMEAADVDGNGSIDYIEFITATMH+HRLER
Sbjct  398  TDKSGTITYEELKTGLARLGSKLSEAEVKQLMEAADVDGNGSIDYIEFITATMHRHRLER  457

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+L+KAFQYFDKD+SGFITRDELE AMKEHG+ D +TIK+IISEVD+D+DGRINY+EFC
Sbjct  458  DEHLFKAFQYFDKDNSGFITRDELELAMKEHGLGDDSTIKDIISEVDSDNDGRINYDEFC  517

Query  321  TMMRSGTKQQPKL  283
             MM+ G +Q  KL
Sbjct  518  AMMKGGAQQPLKL  530



>ref|XP_008224828.1| PREDICTED: LOW QUALITY PROTEIN: calcium-dependent protein kinase 
2-like [Prunus mume]
Length=560

 Score =   227 bits (578),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 106/134 (79%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA++G+ L+EAEV+QLM+AADVDGNGSIDYIEFI+ATMH+ RLER
Sbjct  427  TDKSGTITYEELKTGLARIGSRLSEAEVRQLMDAADVDGNGSIDYIEFISATMHRQRLER  486

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+LYKAFQYFDKDSSG+ITRDELE AMKEH + D  TI+EIISEVDAD+DGRINY EFC
Sbjct  487  DEHLYKAFQYFDKDSSGYITRDELEAAMKEHAMGDENTIREIISEVDADNDGRINYSEFC  546

Query  321  TMMRSGTKQQPKLF  280
             MMRSGT+Q  KLF
Sbjct  547  AMMRSGTQQPGKLF  560



>gb|ADZ52811.1| calcium-dependent protein kinase 3 [Solanum tuberosum]
Length=554

 Score =   227 bits (578),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 110/135 (81%), Positives = 122/135 (90%), Gaps = 1/135 (1%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ LTE EVKQLMEAADVDGNG+IDYIEFITATMH+HRLER
Sbjct  420  TDNSGTITYEELKSGLARLGSKLTETEVKQLMEAADVDGNGTIDYIEFITATMHRHRLER  479

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+L+KAFQ+FDKD SGFITRDELE AMKE+G+ D ATIKEII+EVD D+DGRINYEEFC
Sbjct  480  DEHLFKAFQHFDKDHSGFITRDELENAMKEYGMGDEATIKEIITEVDTDNDGRINYEEFC  539

Query  321  TMMRSGTKQ-QPKLF  280
             MMRSGT Q Q KLF
Sbjct  540  AMMRSGTTQPQQKLF  554



>ref|XP_002305576.2| hypothetical protein POPTR_0004s01530g [Populus trichocarpa]
 gb|EEE86087.2| hypothetical protein POPTR_0004s01530g [Populus trichocarpa]
Length=532

 Score =   226 bits (576),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ L+EAEVK LMEAADVDGNGSIDYIEFI+ATMH+++LER
Sbjct  399  TDKSGTITYEELKTGLARLGSKLSEAEVKNLMEAADVDGNGSIDYIEFISATMHRYKLER  458

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+LYKAFQYFDKDSSG+ITRDELE AMKE+G+ D ++IKEII+EVDAD+DGRINYEEFC
Sbjct  459  DEHLYKAFQYFDKDSSGYITRDELELAMKEYGMGDESSIKEIIAEVDADNDGRINYEEFC  518

Query  321  TMMRSGTKQQPKLF  280
             MMRSGT   P L+
Sbjct  519  AMMRSGTPHAPSLY  532



>ref|XP_002883243.1| calmodulin-domain protein kinase 9 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59502.1| calmodulin-domain protein kinase 9 [Arabidopsis lyrata subsp. 
lyrata]
Length=541

 Score =   226 bits (576),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 106/136 (78%), Positives = 125/136 (92%), Gaps = 2/136 (1%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SG+ITYEELK+GLA+LG+ LTEAEVKQLM+AADVDGNGSIDYIEFITATMH+HRLE 
Sbjct  406  TDNSGSITYEELKEGLAKLGSKLTEAEVKQLMDAADVDGNGSIDYIEFITATMHRHRLES  465

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
             ENLYKAFQ+FDKDSSG+IT DELE+A+KE+G+ D ATIKE++S+VD+D+DGRINYEEFC
Sbjct  466  NENLYKAFQHFDKDSSGYITIDELESALKEYGMGDDATIKEVLSDVDSDNDGRINYEEFC  525

Query  321  TMMRSGT--KQQPKLF  280
             MMRSG   +QQP+LF
Sbjct  526  AMMRSGNPQQQQPRLF  541



>ref|XP_003610427.1| Calcium-dependent protein kinase [Medicago truncatula]
 gb|AES92624.1| calmodulin-domain kinase CDPK protein [Medicago truncatula]
Length=539

 Score =   226 bits (576),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 106/134 (79%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD+SGTITYEELK GLA++G+ L+EAEVKQLMEAADVDGNGSIDY+EFI+ATMH+HRLER
Sbjct  406  TDSSGTITYEELKTGLARIGSRLSEAEVKQLMEAADVDGNGSIDYLEFISATMHRHRLER  465

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+LYKAFQYFDKD+SG ITR+ELETAM +HG+ D ATIKEIISEVD D+DGRINYEEFC
Sbjct  466  DEHLYKAFQYFDKDNSGHITREELETAMTKHGMGDEATIKEIISEVDTDNDGRINYEEFC  525

Query  321  TMMRSGTKQQPKLF  280
             MMRSG   Q  LF
Sbjct  526  AMMRSGMPHQGPLF  539



>ref|XP_002518484.1| calcium-dependent protein kinase, putative [Ricinus communis]
 gb|EEF43871.1| calcium-dependent protein kinase, putative [Ricinus communis]
Length=551

 Score =   226 bits (577),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ L+E EVKQLMEAADVDGNG+IDYIEFI+ATMH++RLER
Sbjct  418  TDKSGTITYEELKTGLARLGSRLSETEVKQLMEAADVDGNGTIDYIEFISATMHRYRLER  477

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+LYKAFQ+FDKDSSG+ITRDELE+AMKE+G+ D ATIKEIISEVD D+DGRINYEEFC
Sbjct  478  DEHLYKAFQHFDKDSSGYITRDELESAMKEYGMGDEATIKEIISEVDTDNDGRINYEEFC  537

Query  321  TMMRSGTKQQPKLF  280
             MMRSG +Q  KLF
Sbjct  538  AMMRSGIQQAEKLF  551



>ref|XP_007026066.1| Calcium-dependent protein kinase 21 isoform 1 [Theobroma cacao]
 gb|EOY28688.1| Calcium-dependent protein kinase 21 isoform 1 [Theobroma cacao]
Length=538

 Score =   226 bits (576),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 125/134 (93%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ L+EAEVKQLM+AADVDGNG+IDYIEFI+ATMH++RLER
Sbjct  405  TDKSGTITYEELKAGLARLGSKLSEAEVKQLMQAADVDGNGTIDYIEFISATMHRYRLER  464

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+LYKAFQYFDKD+SG+IT+DELETAMKE+G+ D A+I+E+ISEVD D+DG+INYEEFC
Sbjct  465  DEHLYKAFQYFDKDNSGYITKDELETAMKEYGMGDEASIREVISEVDTDNDGKINYEEFC  524

Query  321  TMMRSGTKQQPKLF  280
            TMMRSGT+Q  K F
Sbjct  525  TMMRSGTQQTGKPF  538



>ref|XP_010923909.1| PREDICTED: calcium-dependent protein kinase isoform 2-like isoform 
X1 [Elaeis guineensis]
Length=551

 Score =   226 bits (576),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 106/132 (80%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ L+EAEVKQLM+AADVDG+G+IDYIEFITATMH+H+LER
Sbjct  418  TDKSGTITYEELKSGLARLGSRLSEAEVKQLMDAADVDGDGTIDYIEFITATMHRHKLER  477

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+LYKAFQYFDKD+SGFITRDELE+AMKEHGI DA+TIKEIISEVD D+DGRINYEEFC
Sbjct  478  DEHLYKAFQYFDKDNSGFITRDELESAMKEHGIGDASTIKEIISEVDTDNDGRINYEEFC  537

Query  321  TMMRSGTKQQPK  286
             MM+ G +Q  K
Sbjct  538  AMMKGGIQQPVK  549



>ref|XP_006350481.1| PREDICTED: calcium-dependent protein kinase-like [Solanum tuberosum]
Length=545

 Score =   226 bits (576),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ L+EAEVKQLMEAADVDGNG+IDYIEF+TATMH+HRLER
Sbjct  412  TDNSGTITYEELKSGLARLGSKLSEAEVKQLMEAADVDGNGTIDYIEFVTATMHRHRLER  471

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +++L+KAFQYFD D SGFIT+DELE+AMKE+G+ D  TI+EII EVD DHDGRINYEEFC
Sbjct  472  DDDLFKAFQYFDTDHSGFITKDELESAMKEYGMGDEDTIREIIVEVDTDHDGRINYEEFC  531

Query  321  TMMRSGTKQQPKLF  280
             MMRSGT+ Q KLF
Sbjct  532  AMMRSGTQPQDKLF  545



>gb|AIO04122.1| calcium-dependent protein kinase [Hevea brasiliensis]
Length=556

 Score =   226 bits (576),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 106/134 (79%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ L+E EVKQLMEAADVDGNG+IDYIEFI+ATMH++RLER
Sbjct  423  TDKSGTITYEELKTGLARLGSRLSETEVKQLMEAADVDGNGTIDYIEFISATMHRYRLER  482

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+LYKAFQYFDKDSSG+ITRDELE+AM E+G+ D A+IKEIISEVD D+DG+INYEEFC
Sbjct  483  DEHLYKAFQYFDKDSSGYITRDELESAMMEYGMGDEASIKEIISEVDTDNDGKINYEEFC  542

Query  321  TMMRSGTKQQPKLF  280
            TMMRSG +Q  KLF
Sbjct  543  TMMRSGVQQPGKLF  556



>ref|XP_004491400.1| PREDICTED: calcium-dependent protein kinase 9-like [Cicer arietinum]
Length=559

 Score =   226 bits (576),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEEL+ GL +LG+ LTEAEV+QLM+AADVDGNG+IDYIEFITATMH+HRLER
Sbjct  426  TDKSGTITYEELRAGLQRLGSKLTEAEVQQLMDAADVDGNGTIDYIEFITATMHRHRLER  485

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +++LYKAFQYFD+D+SGFITRDELETAMKE+G+ D  TI+EIIS+VD D+DGRINYEEFC
Sbjct  486  DDHLYKAFQYFDRDNSGFITRDELETAMKEYGMGDEDTIREIISDVDKDNDGRINYEEFC  545

Query  321  TMMRSGTKQQPKLF  280
             MMRSG +QQ KLF
Sbjct  546  AMMRSGVQQQGKLF  559



>ref|XP_011037643.1| PREDICTED: calcium-dependent protein kinase-like [Populus euphratica]
 ref|XP_011037644.1| PREDICTED: calcium-dependent protein kinase-like [Populus euphratica]
 ref|XP_011037646.1| PREDICTED: calcium-dependent protein kinase-like [Populus euphratica]
Length=532

 Score =   225 bits (574),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ L+EAEV+ LMEAADVDGNGSIDYIEFI+ATMH+++LER
Sbjct  399  TDKSGTITYEELKTGLARLGSKLSEAEVENLMEAADVDGNGSIDYIEFISATMHRYKLER  458

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            EE+LYKAFQYFDKDSSG+ITRDELE AMKE+G+ D ++IKEII+EVDAD+DGRINYEEFC
Sbjct  459  EEHLYKAFQYFDKDSSGYITRDELELAMKEYGMGDESSIKEIIAEVDADNDGRINYEEFC  518

Query  321  TMMRSGTKQQPKLF  280
             MMRSGT   P L+
Sbjct  519  AMMRSGTPPAPSLY  532



>ref|XP_010461925.1| PREDICTED: calcium-dependent protein kinase 33 [Camelina sativa]
Length=521

 Score =   225 bits (573),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK+GLA+LG+ LTEAEVKQLM+AADVDGNGSIDYIEFITATMH+HRLE 
Sbjct  388  TDNSGTITYEELKEGLAKLGSKLTEAEVKQLMDAADVDGNGSIDYIEFITATMHRHRLES  447

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
             E+LYKAFQ+FDKD SG+IT DELE A+KE+G+ D ATIKEI+S+VD+D+DG+INY+EFC
Sbjct  448  NESLYKAFQHFDKDGSGYITIDELEAALKEYGMGDDATIKEILSDVDSDNDGKINYDEFC  507

Query  321  TMMRSGTKQQPKLF  280
             MMRSG  QQP+LF
Sbjct  508  AMMRSGNPQQPRLF  521



>ref|XP_010508871.1| PREDICTED: calcium-dependent protein kinase 9 [Camelina sativa]
 ref|XP_010508878.1| PREDICTED: calcium-dependent protein kinase 9 [Camelina sativa]
Length=541

 Score =   225 bits (573),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 106/136 (78%), Positives = 124/136 (91%), Gaps = 2/136 (1%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK+GLA+LG+ LTEAEVKQLM+AADVDGNGSIDYIEFITATMH+HRLE 
Sbjct  406  TDNSGTITYEELKEGLAKLGSKLTEAEVKQLMDAADVDGNGSIDYIEFITATMHRHRLES  465

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
             ENLYKAFQ+FDKDSSG+IT DELE A+KE+G+ D ATIKE++S+VD+D+DGRIN+EEFC
Sbjct  466  NENLYKAFQHFDKDSSGYITIDELEAALKEYGMGDDATIKEVLSDVDSDNDGRINHEEFC  525

Query  321  TMMRSGT--KQQPKLF  280
             MMRSG   +QQP+LF
Sbjct  526  AMMRSGNPQQQQPRLF  541



>ref|XP_010686845.1| PREDICTED: calcium-dependent protein kinase 2-like [Beta vulgaris 
subsp. vulgaris]
Length=589

 Score =   226 bits (576),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 108/134 (81%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SG+ITY+ELKKGLAQLG+ LTEAEVKQLMEAADVDGNG+IDY EFITATM++HRLE 
Sbjct  456  TDKSGSITYDELKKGLAQLGSKLTEAEVKQLMEAADVDGNGTIDYTEFITATMNRHRLET  515

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +ENL KAF+YFDKD+SGFIT DELE AM E+GIAD ++IKEI+SEVD D+DGRINYEEFC
Sbjct  516  DENLSKAFRYFDKDNSGFITMDELEVAMMEYGIADESSIKEILSEVDTDNDGRINYEEFC  575

Query  321  TMMRSGTKQQPKLF  280
            TMMRSGT QQ KLF
Sbjct  576  TMMRSGTTQQVKLF  589



>ref|XP_006297378.1| hypothetical protein CARUB_v10013403mg [Capsella rubella]
 gb|EOA30276.1| hypothetical protein CARUB_v10013403mg [Capsella rubella]
Length=540

 Score =   225 bits (573),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 106/136 (78%), Positives = 123/136 (90%), Gaps = 2/136 (1%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK+GLA+LG+ LTEAEVKQLM+AADVDGNGSIDYIEFITATMH+HRLE 
Sbjct  405  TDNSGTITYEELKEGLAKLGSKLTEAEVKQLMDAADVDGNGSIDYIEFITATMHRHRLES  464

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
             ENLYKAFQ+FDKD SG+IT DELE A+KE+G+ D ATIKE++S+VD+D+DGRINYEEFC
Sbjct  465  NENLYKAFQHFDKDGSGYITIDELEAALKEYGMGDDATIKEVLSDVDSDNDGRINYEEFC  524

Query  321  TMMRSGT--KQQPKLF  280
             MMRSG   +QQP+LF
Sbjct  525  AMMRSGNPQQQQPRLF  540



>ref|XP_009597333.1| PREDICTED: calcium-dependent protein kinase-like [Nicotiana tomentosiformis]
Length=539

 Score =   224 bits (572),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ L+E EVKQLMEAADVDGNG+IDYIEF+TATMH+HRLER
Sbjct  406  TDNSGTITYEELKSGLARLGSKLSEVEVKQLMEAADVDGNGTIDYIEFVTATMHRHRLER  465

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +++L+KAFQYFD D SGFIT+DELE+AMKE+G+ D ATIK+II+EVD DHDGRINYEEFC
Sbjct  466  DDHLFKAFQYFDTDHSGFITKDELESAMKEYGMGDEATIKDIIAEVDTDHDGRINYEEFC  525

Query  321  TMMRSGTKQQPKLF  280
             MMRSGT+ Q K F
Sbjct  526  AMMRSGTQPQEKKF  539



>gb|EAZ40006.1| hypothetical protein OsJ_24444 [Oryza sativa Japonica Group]
Length=454

 Score =   222 bits (566),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ L+EAEVKQLMEAADVDGNGSIDY+EFITATMH+H+LER
Sbjct  320  TDNSGTITYEELKAGLAKLGSKLSEAEVKQLMEAADVDGNGSIDYVEFITATMHRHKLER  379

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+L+KAFQYFDKD+SGFITRDELE+A+ EH + D +TIK+IISEVD D+DGRINYEEFC
Sbjct  380  DEHLFKAFQYFDKDNSGFITRDELESALIEHEMGDTSTIKDIISEVDTDNDGRINYEEFC  439

Query  321  TMMRSGTKQQP  289
             MMR G  QQP
Sbjct  440  AMMRGGGMQQP  450



>gb|EYU27336.1| hypothetical protein MIMGU_mgv1a004414mg [Erythranthe guttata]
Length=528

 Score =   224 bits (571),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 103/130 (79%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ L+E EV+QLM+AADVDG+G+IDYIEFITATMH+HRLER
Sbjct  392  TDKSGTITYEELKDGLARLGSKLSETEVRQLMDAADVDGDGTIDYIEFITATMHRHRLER  451

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            EENLYKAFQYFDKDSSGFITRDELE AM+EH + D +TIK+II+EVD D+DGRINYEEFC
Sbjct  452  EENLYKAFQYFDKDSSGFITRDELEAAMQEHNVGDQSTIKDIIAEVDTDNDGRINYEEFC  511

Query  321  TMMRSGTKQQ  292
             MMR+G+ QQ
Sbjct  512  NMMRTGSTQQ  521



>emb|CAN60225.1| hypothetical protein VITISV_039919 [Vitis vinifera]
Length=467

 Score =   223 bits (567),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ L+E EV+QLMEAADVDGNG+IDYIEFITATMH+HRLER
Sbjct  334  TDKSGTITYEELKSGLARLGSRLSETEVQQLMEAADVDGNGTIDYIEFITATMHRHRLER  393

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+LYKAF YFDKD+SGFITRDELE AMKE+G+ D  +IKEII+EVD D DGRINY+EFC
Sbjct  394  DEHLYKAFNYFDKDNSGFITRDELENAMKEYGMGDEDSIKEIINEVDTDKDGRINYKEFC  453

Query  321  TMMRSGTKQQPKLF  280
            TMMRSGT+   KLF
Sbjct  454  TMMRSGTQPPVKLF  467



>dbj|BAE71239.1| putative calcium dependent protein kinase [Trifolium pratense]
Length=558

 Score =   224 bits (572),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA++G+ L+E EVKQLMEAADVDGNGSIDY+EFI+ATMH+HRLER
Sbjct  425  TDGSGTITYEELKSGLARIGSRLSEPEVKQLMEAADVDGNGSIDYLEFISATMHRHRLER  484

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+LYKAFQYFDKD+SG ITR+ELETAM +HG+ D ATIKEIISEVD D+DGRINYEEFC
Sbjct  485  DEHLYKAFQYFDKDNSGHITREELETAMTKHGMGDEATIKEIISEVDTDNDGRINYEEFC  544

Query  321  TMMRSGTKQQPKLF  280
             MMRSG   Q +LF
Sbjct  545  AMMRSGMPHQAQLF  558



>ref|XP_003617547.1| Calcium dependent protein kinase [Medicago truncatula]
Length=1052

 Score =   230 bits (586),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEEL+ GL +LG+ LTEAEV+QLMEAADVDGNG+IDYIEFITATMH+HRLER
Sbjct  433  TDKSGTITYEELRAGLQRLGSKLTEAEVRQLMEAADVDGNGTIDYIEFITATMHRHRLER  492

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+LYKAFQYFDKD+SGFITRDELETAMKE+G+ D  TI+EIISEVD D+DGRINYEEFC
Sbjct  493  DEHLYKAFQYFDKDNSGFITRDELETAMKEYGMGDEETIREIISEVDTDNDGRINYEEFC  552

Query  321  TMMRSGTKQQPK  286
            TMMRSG +QQ K
Sbjct  553  TMMRSGVQQQGK  564



>ref|XP_009357448.1| PREDICTED: calcium-dependent protein kinase 2-like [Pyrus x bretschneideri]
Length=546

 Score =   224 bits (571),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA++G+ L+E EV+QLM+AADVDGNGSIDYIEFI+ATMH+ RLER
Sbjct  413  TDNSGTITYEELKTGLARIGSRLSETEVRQLMDAADVDGNGSIDYIEFISATMHRQRLER  472

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+LYKAFQYFDKDSSG+ITRDELE AMKEHG+ D  TI+EIISEVDAD+DG+INY EFC
Sbjct  473  DEHLYKAFQYFDKDSSGYITRDELEAAMKEHGMGDDNTIREIISEVDADNDGKINYSEFC  532

Query  321  TMMRSGTKQQPKLF  280
             MMRSGT+Q   LF
Sbjct  533  AMMRSGTQQPAMLF  546



>gb|ACB71246.2| calcium-dependent protein kinase 1 [Hevea brasiliensis]
Length=556

 Score =   224 bits (571),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ L+E EVKQLMEAADVDGNG+IDYIEFI+ATMH++RLER
Sbjct  423  TDKSGTITYEELKTGLARLGSRLSETEVKQLMEAADVDGNGAIDYIEFISATMHRYRLER  482

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+LYKAFQYFDKDSSG+ITRDELE+AM E+G+ D A+IKEIISEVD D+DG+INYEEFC
Sbjct  483  DEHLYKAFQYFDKDSSGYITRDELESAMMEYGMGDEASIKEIISEVDTDNDGKINYEEFC  542

Query  321  TMMRSGTKQQPKLF  280
            TMMR G +Q  KLF
Sbjct  543  TMMRRGVQQPGKLF  556



>gb|KCW66998.1| hypothetical protein EUGRSUZ_F007612, partial [Eucalyptus grandis]
Length=170

 Score =   213 bits (541),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 100/134 (75%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ LTEAEVKQLMEAADVDGNGSIDYIEFITATMH+H+LE 
Sbjct  37   TDKSGTITYEELKTGLARLGSKLTEAEVKQLMEAADVDGNGSIDYIEFITATMHRHKLET  96

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+LYKAFQ+FDKD+SGFIT DE+ETA++ +G+ D  TI++II+EVD D+DGRI+Y+EFC
Sbjct  97   DEHLYKAFQHFDKDNSGFITMDEIETALRGYGMGDEETIRDIIAEVDTDNDGRIDYQEFC  156

Query  321  TMMRSGTKQQPKLF  280
             MMRSG + Q KLF
Sbjct  157  AMMRSGNQHQGKLF  170



>ref|XP_004500067.1| PREDICTED: calcium-dependent protein kinase isoform 2-like [Cicer 
arietinum]
Length=548

 Score =   224 bits (570),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 122/141 (87%), Gaps = 7/141 (5%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GL +LG+ L+EAEVKQLMEAADVDGNG+ID IEFITATMH+H+LER
Sbjct  408  TDNSGTITYEELKAGLQRLGSKLSEAEVKQLMEAADVDGNGTIDCIEFITATMHRHKLER  467

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIIS-------EVDADHDGR  343
            +++LYKAFQYFDKD+SGFITRDELETAMKE+G+ D ATIKEIIS       EVD DHDGR
Sbjct  468  DDHLYKAFQYFDKDNSGFITRDELETAMKEYGMGDDATIKEIISEVDTIIFEVDTDHDGR  527

Query  342  INYEEFCTMMRSGTKQQPKLF  280
            INYEEFC MMRSG + Q KLF
Sbjct  528  INYEEFCAMMRSGNQPQVKLF  548



>ref|XP_010479536.1| PREDICTED: calcium-dependent protein kinase 33-like [Camelina 
sativa]
Length=521

 Score =   223 bits (568),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 103/134 (77%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK+GLA+LG+ LTE EVKQLM+AADVDGNGSIDYIEFITATMH+HRLE 
Sbjct  388  TDNSGTITYEELKEGLAKLGSKLTETEVKQLMDAADVDGNGSIDYIEFITATMHRHRLES  447

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
             E+LYKAFQ+FDKD SG+IT DELE A+KE+G+ D ATIKEI+S+VD+D+DG+INY+EFC
Sbjct  448  NESLYKAFQHFDKDGSGYITIDELEAALKEYGMGDDATIKEILSDVDSDNDGKINYDEFC  507

Query  321  TMMRSGTKQQPKLF  280
             MMRSG  QQP+LF
Sbjct  508  AMMRSGNPQQPRLF  521



>gb|KFK35914.1| hypothetical protein AALP_AA4G052700 [Arabis alpina]
Length=512

 Score =   223 bits (567),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK+GLA+LG+ LTE EVKQLM+AADVDGNGSIDYIEFITATMH+HRLE 
Sbjct  379  TDNSGTITYEELKEGLAKLGSKLTETEVKQLMDAADVDGNGSIDYIEFITATMHRHRLES  438

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
             ENL KAFQ+FDKD SG+IT DELE A+KE+G+ D  TIKEI+S+VDAD+DGRINYEEFC
Sbjct  439  NENLDKAFQHFDKDGSGYITIDELEAALKEYGMGDDTTIKEILSDVDADNDGRINYEEFC  498

Query  321  TMMRSGTKQQPKLF  280
             MMRSG  QQP+LF
Sbjct  499  AMMRSGNPQQPRLF  512



>ref|XP_004231610.1| PREDICTED: calcium-dependent protein kinase 2-like [Solanum lycopersicum]
Length=527

 Score =   223 bits (568),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ L+EAEVKQLMEAADVDGNG+IDYIEF+TATMH+HRLER
Sbjct  394  TDNSGTITYEELKSGLARLGSKLSEAEVKQLMEAADVDGNGTIDYIEFVTATMHRHRLER  453

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +++L+KAFQYFD D SGFIT+DELE+AMKE+G+ D  TI+EII EVD DHDGRINYEEFC
Sbjct  454  DDDLFKAFQYFDTDHSGFITKDELESAMKEYGMGDEDTIREIIVEVDTDHDGRINYEEFC  513

Query  321  TMMRSGTKQQPKLF  280
             MMRSGT+ Q K F
Sbjct  514  AMMRSGTQPQDKPF  527



>emb|CBI23246.3| unnamed protein product [Vitis vinifera]
Length=514

 Score =   223 bits (567),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ L+E EV+QLMEAADVDGNG+IDYIEFITATMH+HRLER
Sbjct  381  TDKSGTITYEELKSGLARLGSRLSETEVQQLMEAADVDGNGTIDYIEFITATMHRHRLER  440

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+LYKAF YFDKD+SGFITRDELE AMKE+G+ D  +IKEII+EVD D DGRINY+EFC
Sbjct  441  DEHLYKAFNYFDKDNSGFITRDELENAMKEYGMGDEDSIKEIINEVDTDKDGRINYKEFC  500

Query  321  TMMRSGTKQQPKLF  280
            TMMRSGT+   KLF
Sbjct  501  TMMRSGTQPPVKLF  514



>ref|XP_006600312.1| PREDICTED: calcium-dependent protein kinase isoform 2-like [Glycine 
max]
 gb|KHN03472.1| Calcium-dependent protein kinase 21 [Glycine soja]
Length=538

 Score =   223 bits (568),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA++G+ L+EAEVKQLM+AADVDGNGSIDY+EFI+ATMH+HRLER
Sbjct  405  TDNSGTITYEELKTGLARIGSKLSEAEVKQLMDAADVDGNGSIDYLEFISATMHRHRLER  464

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+LYKAFQYFDKD+SG+ITRDELE AM ++G+ D ATIKEIISEVDAD+DGRINYEEFC
Sbjct  465  DEHLYKAFQYFDKDNSGYITRDELEIAMTQNGMGDEATIKEIISEVDADNDGRINYEEFC  524

Query  321  TMMRSGTKQQPKLF  280
             MMRSG   Q +L 
Sbjct  525  AMMRSGMPHQGQLL  538



>ref|NP_001059775.1| Os07g0515100 [Oryza sativa Japonica Group]
 sp|P53683.2|CDPK2_ORYSJ RecName: Full=Calcium-dependent protein kinase isoform 2; Short=CDPK 
2 [Oryza sativa Japonica Group]
 dbj|BAC20693.1| CDP2_ORYSA Calcium-dependent protein kinase [Oryza sativa Japonica 
Group]
 dbj|BAF21689.1| Os07g0515100 [Oryza sativa Japonica Group]
Length=533

 Score =   222 bits (566),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ L+EAEVKQLMEAADVDGNGSIDY+EFITATMH+H+LER
Sbjct  399  TDNSGTITYEELKAGLAKLGSKLSEAEVKQLMEAADVDGNGSIDYVEFITATMHRHKLER  458

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+L+KAFQYFDKD+SGFITRDELE+A+ EH + D +TIK+IISEVD D+DGRINYEEFC
Sbjct  459  DEHLFKAFQYFDKDNSGFITRDELESALIEHEMGDTSTIKDIISEVDTDNDGRINYEEFC  518

Query  321  TMMRSGTKQQP  289
             MMR G  QQP
Sbjct  519  AMMRGGGMQQP  529



>gb|AAP03014.1| seed calcium dependent protein kinase c [Glycine max]
Length=537

 Score =   222 bits (566),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 122/141 (87%), Gaps = 7/141 (5%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GL +LG+ LTEAEVKQLMEAADVDGNGSIDYIEFITATMH+H+LER
Sbjct  397  TDKSGTITYEELKSGLHRLGSKLTEAEVKQLMEAADVDGNGSIDYIEFITATMHRHKLER  456

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKE-------IISEVDADHDGR  343
            ++ L+KAFQYFDKD+SGFITRDELE+AMKE+G+ D ATIKE       IISEVD DHDGR
Sbjct  457  DDQLFKAFQYFDKDNSGFITRDELESAMKEYGMGDDATIKEIISEVDTIISEVDTDHDGR  516

Query  342  INYEEFCTMMRSGTKQQPKLF  280
            INYEEF  MM+SG +QQ KLF
Sbjct  517  INYEEFSAMMKSGNQQQGKLF  537



>emb|CAA57157.1| calcium-dependent protein kinase [Oryza sativa Japonica Group]
 gb|EAZ04052.1| hypothetical protein OsI_26188 [Oryza sativa Indica Group]
Length=533

 Score =   222 bits (566),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ L+EAEVKQLMEAADVDGNGSIDY+EFITATMH+H+LER
Sbjct  399  TDNSGTITYEELKAGLAKLGSKLSEAEVKQLMEAADVDGNGSIDYVEFITATMHRHKLER  458

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+L+KAFQYFDKD+SGFITRDELE+A+ EH + D +TIK+IISEVD D+DGRINYEEFC
Sbjct  459  DEHLFKAFQYFDKDNSGFITRDELESALIEHEMGDTSTIKDIISEVDTDNDGRINYEEFC  518

Query  321  TMMRSGTKQQP  289
             MMR G  QQP
Sbjct  519  AMMRGGGMQQP  529



>ref|XP_002268814.1| PREDICTED: calcium-dependent protein kinase 2 [Vitis vinifera]
Length=545

 Score =   223 bits (567),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ L+E EV+QLMEAADVDGNG+IDYIEFITATMH+HRLER
Sbjct  412  TDKSGTITYEELKSGLARLGSRLSETEVQQLMEAADVDGNGTIDYIEFITATMHRHRLER  471

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+LYKAF YFDKD+SGFITRDELE AMKE+G+ D  +IKEII+EVD D DGRINY+EFC
Sbjct  472  DEHLYKAFNYFDKDNSGFITRDELENAMKEYGMGDEDSIKEIINEVDTDKDGRINYKEFC  531

Query  321  TMMRSGTKQQPKLF  280
            TMMRSGT+   KLF
Sbjct  532  TMMRSGTQPPVKLF  545



>ref|NP_001235641.1| calmodulin-like domain protein kinase isoenzyme gamma [Glycine 
max]
 gb|AAB80693.1| calmodulin-like domain protein kinase isoenzyme gamma [Glycine 
max]
Length=538

 Score =   222 bits (566),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 122/141 (87%), Gaps = 7/141 (5%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GL +LG+ LTEAEVKQLMEAADVDGNGSIDYIEFITATMH+H+LER
Sbjct  398  TDKSGTITYEELKSGLHRLGSKLTEAEVKQLMEAADVDGNGSIDYIEFITATMHRHKLER  457

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKE-------IISEVDADHDGR  343
            ++ L+KAFQYFDKD+SGFITRDELE+AMKE+G+ D ATIKE       IISEVD DHDGR
Sbjct  458  DDQLFKAFQYFDKDNSGFITRDELESAMKEYGMGDDATIKEIISEVDTIISEVDTDHDGR  517

Query  342  INYEEFCTMMRSGTKQQPKLF  280
            INYEEF  MM+SG +QQ KLF
Sbjct  518  INYEEFSAMMKSGNQQQGKLF  538



>ref|XP_006452371.1| hypothetical protein CICLE_v10007983mg [Citrus clementina]
 gb|ESR65611.1| hypothetical protein CICLE_v10007983mg [Citrus clementina]
Length=529

 Score =   222 bits (565),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ LTEAEV+QLMEAADVDGNG+IDYIEFITATMH+H+LER
Sbjct  396  TDNSGTITYEELKAGLARLGSKLTEAEVQQLMEAADVDGNGTIDYIEFITATMHRHKLER  455

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +++LYKAFQ+FDKD+SGFIT DELE AMK++G+ D  TIKEIISEVD D+DGRINY+EFC
Sbjct  456  DDHLYKAFQHFDKDNSGFITIDELEIAMKDYGMGDDDTIKEIISEVDTDNDGRINYDEFC  515

Query  321  TMMRSGTKQQPKLF  280
             MMRSGT+ Q KLF
Sbjct  516  AMMRSGTQPQAKLF  529



>gb|ACJ61504.1| calcium-dependent protein kinase [Glycine max]
 gb|KHM99562.1| Calcium-dependent protein kinase isoform 2 [Glycine soja]
Length=551

 Score =   222 bits (566),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 122/141 (87%), Gaps = 7/141 (5%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GL +LG+ LTEAEVKQLMEAADVDGNGSIDYIEFITATMH+H+LER
Sbjct  411  TDKSGTITYEELKSGLHRLGSKLTEAEVKQLMEAADVDGNGSIDYIEFITATMHRHKLER  470

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKE-------IISEVDADHDGR  343
            ++ L+KAFQYFDKD+SGFITRDELE+AMKE+G+ D ATIKE       IISEVD DHDGR
Sbjct  471  DDQLFKAFQYFDKDNSGFITRDELESAMKEYGMGDDATIKEIISEVDTIISEVDTDHDGR  530

Query  342  INYEEFCTMMRSGTKQQPKLF  280
            INYEEF  MM+SG +QQ KLF
Sbjct  531  INYEEFSAMMKSGNQQQGKLF  551



>ref|XP_004293286.1| PREDICTED: calcium-dependent protein kinase 2-like [Fragaria 
vesca subsp. vesca]
Length=543

 Score =   222 bits (565),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 103/129 (80%), Positives = 117/129 (91%), Gaps = 0/129 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA++G+ L+E EV+QLM+AADVDGNGSIDYIEFI+ATMH+ RLER
Sbjct  411  TDKSGTITYEELKTGLARIGSRLSETEVRQLMDAADVDGNGSIDYIEFISATMHRQRLER  470

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+LYKAFQYFDKDSSG+ITRDELE AMKEHG+ D  TIKEIISEVDAD+DGRINY EFC
Sbjct  471  DEHLYKAFQYFDKDSSGYITRDELEAAMKEHGMGDDNTIKEIISEVDADNDGRINYTEFC  530

Query  321  TMMRSGTKQ  295
            TMMRSG + 
Sbjct  531  TMMRSGNQP  539



>ref|XP_006657762.1| PREDICTED: calcium-dependent protein kinase isoform 2-like isoform 
X2 [Oryza brachyantha]
Length=531

 Score =   221 bits (564),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 120/133 (90%), Gaps = 1/133 (1%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ L+EAEVKQLMEAADVDGNGSIDY+EFITATMH+H+LER
Sbjct  399  TDNSGTITYEELKAGLAKLGSKLSEAEVKQLMEAADVDGNGSIDYVEFITATMHRHKLER  458

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+L+KAFQYFDKDSSGFITRDELE+A+ EH + D +TIK+IISEVD D+DGRINYEEFC
Sbjct  459  DEHLFKAFQYFDKDSSGFITRDELESALIEHEMGDTSTIKDIISEVDTDNDGRINYEEFC  518

Query  321  TMMRSGTKQQPKL  283
             MMR G  Q P+L
Sbjct  519  AMMRGGV-QPPRL  530



>ref|XP_007142270.1| hypothetical protein PHAVU_008G266600g [Phaseolus vulgaris]
 gb|ESW14264.1| hypothetical protein PHAVU_008G266600g [Phaseolus vulgaris]
Length=525

 Score =   221 bits (564),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 108/134 (81%), Positives = 122/134 (91%), Gaps = 1/134 (1%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEEL+ GL +LG+ LTEAEV+QLM+AADVDGNG+IDYIEFITATMH+HRLER
Sbjct  393  TDHSGTITYEELRAGLQRLGSKLTEAEVRQLMDAADVDGNGTIDYIEFITATMHRHRLER  452

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+LY AFQYFDKD SG+ITRDELETAMKE+G+ D ATIK+IISEVD D+DGRINYEEF 
Sbjct  453  DEHLYGAFQYFDKDGSGYITRDELETAMKENGMGDEATIKDIISEVDTDNDGRINYEEFS  512

Query  321  TMMRSGTKQQPKLF  280
            TMMRSGT QQ KLF
Sbjct  513  TMMRSGT-QQGKLF  525



>ref|XP_008651864.1| PREDICTED: calcium-dependent protein kinase 2 isoform X1 [Zea 
mays]
Length=531

 Score =   221 bits (563),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ L+EAEVKQLMEAADVDGNGSIDY+EFITATMH+H+LER
Sbjct  398  TDNSGTITYEELKAGLAKLGSKLSEAEVKQLMEAADVDGNGSIDYVEFITATMHRHKLER  457

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+L+KAFQYFDKD+SGFITRDELE+A+ EH + D +TIKEIISEVD D+DGRINYEEFC
Sbjct  458  DEHLFKAFQYFDKDNSGFITRDELESALIEHEMGDTSTIKEIISEVDTDNDGRINYEEFC  517

Query  321  TMMRSGTKQQPKL  283
             MMR G +Q  +L
Sbjct  518  AMMRGGMQQPMRL  530



>gb|ACR34538.1| unknown [Zea mays]
Length=531

 Score =   221 bits (563),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ L+EAEVKQLMEAADVDGNGSIDY+EFITATMH+H+LER
Sbjct  398  TDNSGTITYEELKAGLAKLGSKLSEAEVKQLMEAADVDGNGSIDYVEFITATMHRHKLER  457

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+L+KAFQYFDKD+SGFITRDELE+A+ EH + D +TIKEIISEVD D+DGRINYEEFC
Sbjct  458  DEHLFKAFQYFDKDNSGFITRDELESALIEHEMGDTSTIKEIISEVDTDNDGRINYEEFC  517

Query  321  TMMRSGTKQQPKL  283
             MMR G +Q  +L
Sbjct  518  AMMRGGMQQPMRL  530



>ref|NP_001105542.1| calcium-dependent protein kinase 2 [Zea mays]
 sp|P49101.1|CDPK2_MAIZE RecName: Full=Calcium-dependent protein kinase 2; Short=CDPK 
2 [Zea mays]
 gb|AAA69507.1| calcium-dependent protein kinase [Zea mays]
Length=513

 Score =   221 bits (562),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ L+EAEVKQLMEAADVDGNGSIDY+EFITATMH+H+LER
Sbjct  380  TDNSGTITYEELKAGLAKLGSKLSEAEVKQLMEAADVDGNGSIDYVEFITATMHRHKLER  439

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+L+KAFQYFDKD+SGFITRDELE+A+ EH + D +TI+EIISEVD D+DGRINYEEFC
Sbjct  440  DEHLFKAFQYFDKDNSGFITRDELESALIEHEMGDTSTIREIISEVDTDNDGRINYEEFC  499

Query  321  TMMRSGTKQQPKL  283
             MMR G +Q  +L
Sbjct  500  AMMRGGMQQPMRL  512



>gb|KHG10851.1| Calcium-dependent protein kinase 21 [Gossypium arboreum]
Length=552

 Score =   221 bits (564),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 103/134 (77%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ L+EAEVKQLMEAADVDGNG+IDYIEFI+ATM+++RL+R
Sbjct  410  TDKSGTITYEELKTGLARLGSKLSEAEVKQLMEAADVDGNGTIDYIEFISATMNRYRLDR  469

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E LYKAFQYFDKD+SG+IT+DELETAMKE+G+ D A+I+ +ISEVD D+DGRINYEEFC
Sbjct  470  DELLYKAFQYFDKDNSGYITKDELETAMKEYGMVDEASIRAVISEVDTDNDGRINYEEFC  529

Query  321  TMMRSGTKQQPKLF  280
            TMMRSGT+Q  K F
Sbjct  530  TMMRSGTQQTEKAF  543



>gb|KHN02836.1| Calcium-dependent protein kinase 9 [Glycine soja]
Length=551

 Score =   221 bits (563),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 121/141 (86%), Gaps = 7/141 (5%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SG ITYEELK GL +LG+ LTEAEVKQLMEAADVDGNGSIDYIEFITATMH+H+LER
Sbjct  411  TDKSGAITYEELKAGLHRLGSKLTEAEVKQLMEAADVDGNGSIDYIEFITATMHRHKLER  470

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKE-------IISEVDADHDGR  343
            ++ L+KAFQYFDKD+SGFITRDELETAMKE+G+ D ATIKE       IISEVD DHDGR
Sbjct  471  DDQLFKAFQYFDKDNSGFITRDELETAMKEYGMGDDATIKEIISEVDTIISEVDTDHDGR  530

Query  342  INYEEFCTMMRSGTKQQPKLF  280
            INYEEF  MM+SG +QQ KLF
Sbjct  531  INYEEFSAMMKSGNQQQGKLF  551



>emb|CBI26637.3| unnamed protein product [Vitis vinifera]
Length=331

 Score =   215 bits (548),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ LTEAEV+QLMEAADVDGNG+IDYIEFITAT+++H+LER
Sbjct  198  TDKSGTITYEELKSGLARLGSKLTEAEVQQLMEAADVDGNGTIDYIEFITATVNRHKLER  257

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+L+KAFQYFDKDSSGFITRDEL+ AMKEHG+ D  TI EIISEVD D+D +INY EFC
Sbjct  258  DEHLFKAFQYFDKDSSGFITRDELKAAMKEHGMGDDDTIAEIISEVDTDNDDKINYGEFC  317

Query  321  TMMRSGTKQQPKLF  280
            +MMR GT+Q  K+F
Sbjct  318  SMMRGGTQQGLKVF  331



>ref|XP_004957849.1| PREDICTED: calcium-dependent protein kinase isoform 2-like isoform 
X2 [Setaria italica]
 gb|AGG54988.1| CDPK1, partial [Setaria italica]
Length=531

 Score =   221 bits (562),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ L+EAEVKQLMEAADVDGNGSIDY+EFITATMH+H+LER
Sbjct  398  TDNSGTITYEELKAGLAKLGSKLSEAEVKQLMEAADVDGNGSIDYVEFITATMHRHKLER  457

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+L+KAFQYFDKD+SGFITRDELE+A+ EH + D +TIKEIISEVD D+DGRINYEEFC
Sbjct  458  DEHLFKAFQYFDKDNSGFITRDELESALIEHEMGDTSTIKEIISEVDTDNDGRINYEEFC  517

Query  321  TMMRSGTKQQPKL  283
             MMR G +Q  +L
Sbjct  518  AMMRGGMQQPMRL  530



>gb|KDP20751.1| hypothetical protein JCGZ_21222 [Jatropha curcas]
Length=562

 Score =   221 bits (564),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 102/128 (80%), Positives = 120/128 (94%), Gaps = 0/128 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ L+E EVKQLMEAADVDGNG+IDYIEFI+ATMH+++LER
Sbjct  435  TDKSGTITYEELKTGLARLGSKLSETEVKQLMEAADVDGNGTIDYIEFISATMHRYKLER  494

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+LYKAFQYFDKDSSG+ITRDELE++MKE+G+ D A+IKEIISEVD D+DGRINYEEFC
Sbjct  495  DEHLYKAFQYFDKDSSGYITRDELESSMKEYGMGDEASIKEIISEVDTDNDGRINYEEFC  554

Query  321  TMMRSGTK  298
            TMMRSG +
Sbjct  555  TMMRSGVQ  562



>ref|NP_001275456.1| calcium-dependent protein kinase 3 [Solanum tuberosum]
 gb|AAQ08324.2| calcium-dependent protein kinase 3 [Solanum tuberosum]
Length=558

 Score =   221 bits (563),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 119/135 (88%), Gaps = 1/135 (1%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ LT  EVKQLMEAADVDGNG+IDYIEFITATMH+HRLER
Sbjct  424  TDNSGTITYEELKSGLARLGSKLTGTEVKQLMEAADVDGNGTIDYIEFITATMHRHRLER  483

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+L+KAFQ FDKD SGFITRDELE AMKE+G+ D  TIKEII+EVD D+DGRINYEEFC
Sbjct  484  DEHLFKAFQNFDKDHSGFITRDELENAMKEYGMGDETTIKEIIAEVDTDNDGRINYEEFC  543

Query  321  TMMRSGTKQ-QPKLF  280
             MMRSGT Q Q KLF
Sbjct  544  AMMRSGTTQPQQKLF  558



>ref|NP_001105306.1| calcium-dependent protein kinase [Zea mays]
 dbj|BAA12715.1| calcium-dependent protein kinase [Zea mays]
 gb|ACN30810.1| unknown [Zea mays]
 gb|ACN34633.1| unknown [Zea mays]
 tpg|DAA40972.1| TPA: putative calcium-dependent protein kinase family protein 
isoform 1 [Zea mays]
 tpg|DAA40973.1| TPA: putative calcium-dependent protein kinase family protein 
isoform 2 [Zea mays]
 tpg|DAA40974.1| TPA: putative calcium-dependent protein kinase family protein 
isoform 3 [Zea mays]
 tpg|DAA40975.1| TPA: putative calcium-dependent protein kinase family protein 
isoform 4 [Zea mays]
Length=531

 Score =   220 bits (561),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ L+EAEVKQLMEAADVDGNGSIDY+EFITATMH+H+LER
Sbjct  398  TDNSGTITYEELKAGLAKLGSKLSEAEVKQLMEAADVDGNGSIDYVEFITATMHRHKLER  457

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E L+KAFQYFDKD+SGFITRDELE+A+ EH + D +TIKEIISEVD D+DGRINYEEFC
Sbjct  458  DEYLFKAFQYFDKDNSGFITRDELESALIEHEMGDTSTIKEIISEVDTDNDGRINYEEFC  517

Query  321  TMMRSGTKQQPKL  283
             MMR G +Q  +L
Sbjct  518  AMMRGGMQQPMRL  530



>ref|XP_003563028.1| PREDICTED: calcium-dependent protein kinase isoform 2 [Brachypodium 
distachyon]
Length=532

 Score =   220 bits (561),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ L+EAEVKQLM+AADVDG+GSIDY+EFITATMH+H+LER
Sbjct  398  TDNSGTITYEELKAGLAKLGSKLSEAEVKQLMDAADVDGSGSIDYVEFITATMHRHKLER  457

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+L+KAFQYFDKDSSGFITRDELETA+ EH + D  TIK+IISEVD D+DGRINY+EFC
Sbjct  458  DEHLFKAFQYFDKDSSGFITRDELETALIEHEMGDTDTIKDIISEVDTDNDGRINYDEFC  517

Query  321  TMMRSGTKQQP  289
             MMR G +QQP
Sbjct  518  AMMRGGIQQQP  528



>gb|ABC59620.1| calcium-dependent protein kinase [Triticum aestivum]
Length=532

 Score =   220 bits (560),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ L+EAEVKQLM+AADVDGNGSIDY+EFITATMH+H+LER
Sbjct  399  TDNSGTITYEELKAGLAKLGSKLSEAEVKQLMDAADVDGNGSIDYVEFITATMHRHKLER  458

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+L+KAFQYFDKD+SGFITRDELETA+ EH + DA TIK+IISEVD D+DGRINYEEFC
Sbjct  459  DEHLFKAFQYFDKDNSGFITRDELETALIEHEMGDADTIKDIISEVDTDNDGRINYEEFC  518

Query  321  TMMRSGTKQQPKL  283
             MMR G +Q  +L
Sbjct  519  AMMRGGMQQPIRL  531



>gb|ABD98803.1| calcium-dependent protein kinase [Triticum aestivum]
 gb|ABY59008.1| calcium-dependent protein kinase [Triticum aestivum]
 gb|EMS66675.1| Calcium-dependent protein kinase isoform 2 [Triticum urartu]
Length=532

 Score =   220 bits (560),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ L+EAEVKQLM+AADVDGNGSIDY+EFITATMH+H+LER
Sbjct  399  TDNSGTITYEELKAGLAKLGSKLSEAEVKQLMDAADVDGNGSIDYVEFITATMHRHKLER  458

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+L+KAFQYFDKD+SGFITRDELETA+ EH + DA TIK+IISEVD D+DGRINYEEFC
Sbjct  459  DEHLFKAFQYFDKDNSGFITRDELETALIEHEMGDADTIKDIISEVDTDNDGRINYEEFC  518

Query  321  TMMRSGTKQQPKL  283
             MMR G +Q  +L
Sbjct  519  AMMRGGMQQPIRL  531



>dbj|BAJ99143.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=532

 Score =   220 bits (560),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ L+EAEVKQLM+AADVDGNGSIDY+EFITATMH+H+LER
Sbjct  399  TDNSGTITYEELKAGLAKLGSKLSEAEVKQLMDAADVDGNGSIDYVEFITATMHRHKLER  458

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+L+KAFQYFDKD+SGFITRDELETA+ EH + DA TIK+IISEVD D+DGRINYEEFC
Sbjct  459  DEHLFKAFQYFDKDNSGFITRDELETALIEHEMGDADTIKDIISEVDTDNDGRINYEEFC  518

Query  321  TMMRSGTKQQPKL  283
             MMR G +Q  +L
Sbjct  519  AMMRGGMQQPIRL  531



>gb|ABC59619.1| calcium-dependent protein kinase [Triticum aestivum]
 gb|EMT05971.1| Calcium-dependent protein kinase isoform 2 [Aegilops tauschii]
Length=532

 Score =   220 bits (560),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ L+EAEVKQLM+AADVDGNGSIDY+EFITATMH+H+LER
Sbjct  399  TDNSGTITYEELKAGLAKLGSKLSEAEVKQLMDAADVDGNGSIDYVEFITATMHRHKLER  458

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+L+KAFQYFDKD+SGFITRDELETA+ EH + DA TIK+IISEVD D+DGRINYEEFC
Sbjct  459  DEHLFKAFQYFDKDNSGFITRDELETALIEHEMGDADTIKDIISEVDTDNDGRINYEEFC  518

Query  321  TMMRSGTKQQPKL  283
             MMR G +Q  +L
Sbjct  519  AMMRGGMQQPIRL  531



>ref|XP_007020820.1| Calmodulin-domain protein kinase 9 isoform 1 [Theobroma cacao]
 gb|EOY12345.1| Calmodulin-domain protein kinase 9 isoform 1 [Theobroma cacao]
Length=536

 Score =   220 bits (560),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 108/134 (81%), Positives = 123/134 (92%), Gaps = 1/134 (1%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITY+ELK GLA+LG+ LTEAEV+QLMEAADVDGNGSIDYIEFITATMH+HRLER
Sbjct  404  TDNSGTITYDELKNGLARLGSKLTEAEVQQLMEAADVDGNGSIDYIEFITATMHRHRLER  463

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+LYKAFQ+FDKD+SG+ITRDELETAMKE+G+ D  TIKEIISEVD D+DG+INYEEF 
Sbjct  464  DEHLYKAFQHFDKDNSGYITRDELETAMKEYGMGDNDTIKEIISEVDTDNDGKINYEEFR  523

Query  321  TMMRSGTKQQPKLF  280
             MMRSGT QQ +LF
Sbjct  524  DMMRSGT-QQGQLF  536



>gb|ABD98804.1| calcium-dependent protein kinase [Triticum aestivum]
Length=532

 Score =   220 bits (560),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG  L+EAEVKQLM+AADVDGNGSIDY+EFITATMH+H+LER
Sbjct  399  TDNSGTITYEELKAGLAKLGPKLSEAEVKQLMDAADVDGNGSIDYVEFITATMHRHKLER  458

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+L+KAFQYFDKD+SGFITRDELETA+ EH + DA TIK+IISEVD D+DGRINYEEFC
Sbjct  459  DEHLFKAFQYFDKDNSGFITRDELETALIEHEMGDADTIKDIISEVDTDNDGRINYEEFC  518

Query  321  TMMRSGTKQQPKL  283
             MMR G +Q  +L
Sbjct  519  AMMRGGMQQPIRL  531



>gb|AGJ83806.1| calcium-dependent protein kinase 1d [Vitis amurensis]
Length=545

 Score =   220 bits (560),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ L+E EV+QLMEAADVDGNG+IDYIEFITATM +HRLER
Sbjct  412  TDKSGTITYEELKSGLARLGSRLSETEVQQLMEAADVDGNGTIDYIEFITATMRRHRLER  471

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+LYKAF YFDKD+SGFITRDELE AMKE+G+ D  +IKEII+EVD D DGRINY+EFC
Sbjct  472  DEHLYKAFNYFDKDNSGFITRDELENAMKEYGMGDGDSIKEIINEVDTDKDGRINYKEFC  531

Query  321  TMMRSGTKQQPKLF  280
            TMMRSGT+   KLF
Sbjct  532  TMMRSGTQPPVKLF  545



>gb|ADM14342.1| calcium-dependent protein kinase 19 [Oryza sativa Japonica Group]
Length=533

 Score =   219 bits (558),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITY+ELK GLA+LG+ L+EAEVKQLMEAADVDGNGSIDY+EFITATMH+H+LER
Sbjct  399  TDNSGTITYDELKAGLAKLGSKLSEAEVKQLMEAADVDGNGSIDYVEFITATMHRHKLER  458

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+L+KAFQYFDKD+SGFITRDELE+A+ EH + D +TIK+IISEVD ++DGRINYEEFC
Sbjct  459  DEHLFKAFQYFDKDNSGFITRDELESALIEHEMGDTSTIKDIISEVDTNNDGRINYEEFC  518

Query  321  TMMRSGTKQQP  289
             MMR G  QQP
Sbjct  519  AMMRGGGMQQP  529



>gb|KJB69279.1| hypothetical protein B456_011G014200 [Gossypium raimondii]
Length=551

 Score =   219 bits (559),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ L+EAEVKQLMEAADVDGNG+IDYIEFI+ATM+++RL+R
Sbjct  409  TDKSGTITYEELKTGLARLGSKLSEAEVKQLMEAADVDGNGTIDYIEFISATMNRYRLDR  468

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E LYKAFQYFDKD+SG+IT+DELETAMKE+G+ D A+I+ +ISEVD D+DGRINYEEFC
Sbjct  469  DELLYKAFQYFDKDNSGYITKDELETAMKEYGMGDEASIRAVISEVDTDNDGRINYEEFC  528

Query  321  TMMRSGTKQQPKLF  280
            TMMR GT+Q  K F
Sbjct  529  TMMRGGTQQTEKAF  542



>gb|ABB54456.1| calcium-dependent protein kinase [Hordeum brevisubulatum]
Length=532

 Score =   219 bits (558),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGT TYEELK GLA+LG+ L+EAEVKQLM+AADVDGNGSIDY+EFITATMH+H+LER
Sbjct  399  TDNSGTFTYEELKAGLAKLGSKLSEAEVKQLMDAADVDGNGSIDYVEFITATMHRHKLER  458

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+L+KAFQYFDKD+SGFITRDELETA+ EH + DA TIK+IISEVD D+DGRINYEEFC
Sbjct  459  DEHLFKAFQYFDKDNSGFITRDELETALIEHEMGDADTIKDIISEVDTDNDGRINYEEFC  518

Query  321  TMMRSGTKQQPKL  283
             MMR G +Q  KL
Sbjct  519  AMMRGGIQQPIKL  531



>gb|KFK28778.1| hypothetical protein AALP_AA7G046400 [Arabis alpina]
Length=502

 Score =   218 bits (556),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 123/140 (88%), Gaps = 2/140 (1%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ L+E EVKQLMEAADVDGNG+IDYIEFI+ATM+++RL+R
Sbjct  361  TDKSGTITYEELKTGLAKLGSKLSETEVKQLMEAADVDGNGTIDYIEFISATMNRYRLDR  420

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +ENL+KAFQYFDKD+SGFIT DELE+ MKE+G+ D A+IKE+I+EVD D+DGRINYEEFC
Sbjct  421  DENLFKAFQYFDKDNSGFITMDELESTMKEYGMGDEASIKEVIAEVDTDNDGRINYEEFC  480

Query  321  TMMRSGT--KQQPKLFDLTL  268
             MMRSGT   QQ KLF   L
Sbjct  481  AMMRSGTTQPQQGKLFPSPL  500



>emb|CDY36037.1| BnaC03g41610D [Brassica napus]
Length=531

 Score =   219 bits (557),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 106/139 (76%), Positives = 123/139 (88%), Gaps = 5/139 (4%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK+GLA+LG+ LTEAEVKQLM+AADVDGNGSIDYIEFITATMH+HRLE 
Sbjct  393  TDNSGTITYEELKEGLAKLGSKLTEAEVKQLMDAADVDGNGSIDYIEFITATMHRHRLES  452

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +ENLYKAFQ+FDKD SG+IT DELE A+KE+G+ D ATIKE++S+VD+D+DGRINYEEFC
Sbjct  453  DENLYKAFQHFDKDGSGYITIDELEVALKEYGMGDDATIKEVLSDVDSDNDGRINYEEFC  512

Query  321  TMMRSGTK-----QQPKLF  280
             MMRSG       QQP+LF
Sbjct  513  AMMRSGNPQQQQQQQPRLF  531



>ref|XP_008463413.1| PREDICTED: calcium-dependent protein kinase-like [Cucumis melo]
Length=519

 Score =   218 bits (556),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 124/134 (93%), Gaps = 1/134 (1%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITY ELK GLA+LG+ L+EAEVKQLMEAADVDGNG+IDYIEFITATMH+++LE+
Sbjct  387  TDKSGTITYAELKSGLARLGSTLSEAEVKQLMEAADVDGNGTIDYIEFITATMHRYKLEK  446

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            EE+LYKAFQ+FDKD+SG+ITRDEL+ AMK++G+ D  TI+EIISEVDAD+DGRINY+EFC
Sbjct  447  EEHLYKAFQHFDKDNSGYITRDELKAAMKDYGMGDEETIREIISEVDADNDGRINYDEFC  506

Query  321  TMMRSGTKQQPKLF  280
            +MMRSGT QQ KLF
Sbjct  507  SMMRSGT-QQAKLF  519



>ref|XP_004152931.1| PREDICTED: calcium-dependent protein kinase-like [Cucumis sativus]
 ref|XP_004172987.1| PREDICTED: calcium-dependent protein kinase-like [Cucumis sativus]
 gb|KGN56125.1| hypothetical protein Csa_3G077600 [Cucumis sativus]
Length=519

 Score =   218 bits (556),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 124/134 (93%), Gaps = 1/134 (1%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITY ELK GLA+LG+ L+EAEVKQLMEAADVDGNG+IDYIEFITATMH+++LE+
Sbjct  387  TDKSGTITYAELKSGLARLGSTLSEAEVKQLMEAADVDGNGTIDYIEFITATMHRYKLEK  446

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            EE+LYKAFQ+FDKD+SG+ITRDEL+ AMK++G+ D  TI+EIISEVDAD+DGRINY+EFC
Sbjct  447  EEHLYKAFQHFDKDNSGYITRDELKAAMKDYGMGDEETIREIISEVDADNDGRINYDEFC  506

Query  321  TMMRSGTKQQPKLF  280
            +MMRSGT QQ KLF
Sbjct  507  SMMRSGT-QQAKLF  519



>gb|AGG35978.1| calcium-dependent protein kinase 9, partial [Brassica napus]
Length=539

 Score =   219 bits (557),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 106/139 (76%), Positives = 123/139 (88%), Gaps = 5/139 (4%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK+GLA+LG+ LTEAEVKQLM+AADVDGNGSIDYIEFITATMH+HRLE 
Sbjct  401  TDNSGTITYEELKEGLAKLGSKLTEAEVKQLMDAADVDGNGSIDYIEFITATMHRHRLES  460

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +ENLYKAFQ+FDKD SG+IT DELE A+KE+G+ D ATIKE++S+VD+D+DGRINYEEFC
Sbjct  461  DENLYKAFQHFDKDGSGYITIDELEVALKEYGMGDDATIKEVLSDVDSDNDGRINYEEFC  520

Query  321  TMMRSGTK-----QQPKLF  280
             MMRSG       QQP+LF
Sbjct  521  AMMRSGNPQQQQQQQPRLF  539



>gb|KHG26977.1| Calcium-dependent protein kinase 9 [Gossypium arboreum]
Length=524

 Score =   218 bits (555),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 108/134 (81%), Positives = 121/134 (90%), Gaps = 1/134 (1%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITY+ELK GLA+LG+ LTEAEVKQLMEAADVDGNGSIDYIEFITATMH+HRLER
Sbjct  392  TDNSGTITYDELKNGLARLGSKLTEAEVKQLMEAADVDGNGSIDYIEFITATMHRHRLER  451

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+LYKAFQ+FDKD+SG ITRDELE AMKE+G+ D  TIKEIISEVD D+DG+INYEEF 
Sbjct  452  DEHLYKAFQHFDKDNSGHITRDELEAAMKEYGMGDDDTIKEIISEVDTDNDGKINYEEFR  511

Query  321  TMMRSGTKQQPKLF  280
             MMRSGT QQ +LF
Sbjct  512  AMMRSGT-QQGQLF  524



>ref|XP_010529441.1| PREDICTED: calcium-dependent protein kinase 21 [Tarenaya hassleriana]
Length=544

 Score =   218 bits (556),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 124/137 (91%), Gaps = 1/137 (1%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ L+E EVKQLMEAADVDGNG+IDYIEFI+ATMH++RLER
Sbjct  407  TDKSGTITYEELKTGLARLGSRLSETEVKQLMEAADVDGNGTIDYIEFISATMHRYRLER  466

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+LYKAF++FDKDSSG+ITRDELETAMKE+G+ D  +I+E+I+EVD D+DGRINY+EFC
Sbjct  467  DEHLYKAFKHFDKDSSGYITRDELETAMKEYGMGDEDSIREVIAEVDTDNDGRINYQEFC  526

Query  321  TMMRSGTKQ-QPKLFDL  274
             MMRSGT Q Q KLF +
Sbjct  527  AMMRSGTTQPQGKLFPI  543



>ref|XP_010448965.1| PREDICTED: calcium-dependent protein kinase 15 [Camelina sativa]
Length=558

 Score =   218 bits (556),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/138 (75%), Positives = 123/138 (89%), Gaps = 2/138 (1%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ LTEAEVKQLMEAADVDGNG+IDYIEFI+ATMH++R +R
Sbjct  420  TDKSGTITYEELKTGLARLGSKLTEAEVKQLMEAADVDGNGTIDYIEFISATMHRYRFDR  479

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+++KAFQYFDKD+SGFIT DELE+AMKE+G+ D A+IKE+I+EVD D+DGRINYEEFC
Sbjct  480  DEHVFKAFQYFDKDNSGFITMDELESAMKEYGMGDEASIKEVIAEVDTDNDGRINYEEFC  539

Query  321  TMMRSGT--KQQPKLFDL  274
             MMRSGT   QQ KL  +
Sbjct  540  AMMRSGTTQPQQGKLLPI  557



>ref|XP_010439398.1| PREDICTED: calcium-dependent protein kinase 15-like [Camelina 
sativa]
Length=560

 Score =   218 bits (556),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/138 (75%), Positives = 123/138 (89%), Gaps = 2/138 (1%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ LTEAEVKQLMEAADVDGNG+IDYIEFI+ATMH++R +R
Sbjct  422  TDKSGTITYEELKTGLARLGSKLTEAEVKQLMEAADVDGNGTIDYIEFISATMHRYRFDR  481

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+++KAFQYFDKD+SGFIT DELE+AMKE+G+ D A+IKE+I+EVD D+DGRINYEEFC
Sbjct  482  DEHVFKAFQYFDKDNSGFITMDELESAMKEYGMGDEASIKEVIAEVDTDNDGRINYEEFC  541

Query  321  TMMRSGT--KQQPKLFDL  274
             MMRSGT   QQ KL  +
Sbjct  542  AMMRSGTTQPQQGKLLPI  559



>ref|NP_001266075.1| calcium-dependent protein kinase 21-like [Cicer arietinum]
 gb|AAP72281.2| calcium-dependent calmodulin-independent protein kinase isoform 
1 [Cicer arietinum]
Length=556

 Score =   218 bits (555),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA++G+ L+E EVKQLME ADVDGNGSIDY+EFI+ATMH+HRLER
Sbjct  407  TDNSGTITYEELKTGLARIGSRLSETEVKQLMELADVDGNGSIDYLEFISATMHRHRLER  466

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+LYKAFQYFDKD+SG ITR+ELETAM +HG+ D ATIK+IISEVD DHDGRINYEEFC
Sbjct  467  DEHLYKAFQYFDKDNSGHITREELETAMTQHGMGDEATIKDIISEVDTDHDGRINYEEFC  526

Query  321  TMMRSG  304
             MMRSG
Sbjct  527  AMMRSG  532



>gb|KJB62816.1| hypothetical protein B456_009G438300 [Gossypium raimondii]
Length=524

 Score =   217 bits (552),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 121/134 (90%), Gaps = 1/134 (1%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITY+ELK GLA+LG+ LTEAEVKQLMEAADVDGNG+IDYIEFITATMH+HRLER
Sbjct  392  TDNSGTITYDELKNGLARLGSKLTEAEVKQLMEAADVDGNGTIDYIEFITATMHRHRLER  451

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+LYKAFQ+FDKD+SG ITRDELE AMKE+G+ D  TIKEIISEVD D+DG+INYEEF 
Sbjct  452  DEHLYKAFQHFDKDNSGHITRDELEAAMKEYGMGDDDTIKEIISEVDTDNDGKINYEEFR  511

Query  321  TMMRSGTKQQPKLF  280
             MMRSGT QQ +LF
Sbjct  512  AMMRSGT-QQGQLF  524



>gb|KJB13679.1| hypothetical protein B456_002G088800 [Gossypium raimondii]
 gb|KJB13680.1| hypothetical protein B456_002G088800 [Gossypium raimondii]
 gb|KJB13682.1| hypothetical protein B456_002G088800 [Gossypium raimondii]
Length=537

 Score =   217 bits (553),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 121/134 (90%), Gaps = 1/134 (1%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ LTEAEV+QLMEAADVDGNGSIDYIEFITATMH+HRLER
Sbjct  405  TDNSGTITYEELKTGLARLGSKLTEAEVQQLMEAADVDGNGSIDYIEFITATMHRHRLER  464

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+LYKAFQ+FDKD+SG+ITRDELE AMKE+G+ D  TIKEIISEVD D+DG+INYEEF 
Sbjct  465  DEHLYKAFQHFDKDNSGYITRDELEAAMKEYGMGDDDTIKEIISEVDTDNDGKINYEEFR  524

Query  321  TMMRSGTKQQPKLF  280
             MMRSGT Q  +LF
Sbjct  525  DMMRSGT-QHTQLF  537



>ref|XP_007146477.1| hypothetical protein PHAVU_006G0437000g, partial [Phaseolus vulgaris]
 gb|ESW18471.1| hypothetical protein PHAVU_006G0437000g, partial [Phaseolus vulgaris]
Length=459

 Score =   215 bits (548),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 121/141 (86%), Gaps = 8/141 (6%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GL +LG+ LTEAEVKQLMEAADVDGNGSIDYIEFITATMH+H+LER
Sbjct  320  TDKSGTITYEELKAGLHRLGSKLTEAEVKQLMEAADVDGNGSIDYIEFITATMHRHKLER  379

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKE-------IISEVDADHDGR  343
            ++ L+KAFQYFDKD+SG+ITRDELE+AMKE+G+ D ATIKE       IISEVD DHDGR
Sbjct  380  DDQLFKAFQYFDKDNSGYITRDELESAMKEYGMGDDATIKEIISEVDTIISEVDTDHDGR  439

Query  342  INYEEFCTMMRSGTKQQPKLF  280
            INYEEF  MM+SG  QQ KLF
Sbjct  440  INYEEFSAMMKSGN-QQCKLF  459



>gb|KHG28675.1| Calcium-dependent protein kinase 9 [Gossypium arboreum]
Length=537

 Score =   217 bits (553),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 121/134 (90%), Gaps = 1/134 (1%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ LTEAEV+QLMEAADVDGNGSIDYIEFITATMH+HRLER
Sbjct  405  TDNSGTITYEELKTGLARLGSKLTEAEVQQLMEAADVDGNGSIDYIEFITATMHRHRLER  464

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+LYKAFQ+FDKD+SG+ITRDELE AMKE+G+ D  TIKEIISEVD D+DG+INYEEF 
Sbjct  465  DEHLYKAFQHFDKDNSGYITRDELEAAMKEYGMGDDDTIKEIISEVDTDNDGKINYEEFR  524

Query  321  TMMRSGTKQQPKLF  280
             MMRSGT Q  +LF
Sbjct  525  DMMRSGT-QHTQLF  537



>emb|CDX82244.1| BnaA03g35770D [Brassica napus]
Length=534

 Score =   217 bits (552),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 101/127 (80%), Positives = 117/127 (92%), Gaps = 0/127 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK+GLA+LG+ LTEAEVKQLM+AADVDGNGSIDYIEFITATMH+HRLE 
Sbjct  395  TDNSGTITYEELKEGLAKLGSKLTEAEVKQLMDAADVDGNGSIDYIEFITATMHRHRLES  454

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +ENLYKAFQ+FDKD SG+IT DELE A+KE+G+ D ATIKE++S+VD+D+DGRINYEEFC
Sbjct  455  DENLYKAFQHFDKDGSGYITIDELEVALKEYGMGDDATIKEVLSDVDSDNDGRINYEEFC  514

Query  321  TMMRSGT  301
             MMRSG 
Sbjct  515  AMMRSGN  521



>ref|XP_009135689.1| PREDICTED: calcium-dependent protein kinase 9 [Brassica rapa]
Length=542

 Score =   217 bits (553),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 101/127 (80%), Positives = 117/127 (92%), Gaps = 0/127 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK+GLA+LG+ LTEAEVKQLM+AADVDGNGSIDYIEFITATMH+HRLE 
Sbjct  403  TDNSGTITYEELKEGLAKLGSKLTEAEVKQLMDAADVDGNGSIDYIEFITATMHRHRLES  462

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +ENLYKAFQ+FDKD SG+IT DELE A+KE+G+ D ATIKE++S+VD+D+DGRINYEEFC
Sbjct  463  DENLYKAFQHFDKDGSGYITIDELEVALKEYGMGDDATIKEVLSDVDSDNDGRINYEEFC  522

Query  321  TMMRSGT  301
             MMRSG 
Sbjct  523  AMMRSGN  529



>ref|XP_010538709.1| PREDICTED: calcium-dependent protein kinase 21-like [Tarenaya 
hassleriana]
Length=545

 Score =   217 bits (552),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 101/135 (75%), Positives = 124/135 (92%), Gaps = 1/135 (1%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ L+E+EVKQLMEAADVDGNG+IDYIEFI+AT H++R+ER
Sbjct  408  TDKSGTITYEELKTGLARLGSKLSESEVKQLMEAADVDGNGTIDYIEFISATTHRYRMER  467

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +++LYKAFQYFDKD+SG+ITRDELETAMKE+G+ D A+I+E+I+EVD D+DGRINYEEFC
Sbjct  468  DDHLYKAFQYFDKDNSGYITRDELETAMKEYGMGDEASIREVIAEVDTDNDGRINYEEFC  527

Query  321  TMMRSGTKQ-QPKLF  280
             MMRSG+ Q + KLF
Sbjct  528  AMMRSGSTQPEGKLF  542



>ref|XP_010434101.1| PREDICTED: LOW QUALITY PROTEIN: calcium-dependent protein kinase 
15-like [Camelina sativa]
Length=556

 Score =   217 bits (552),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 103/138 (75%), Positives = 122/138 (88%), Gaps = 2/138 (1%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ LTEAEVKQLMEAADVDGNG+IDYIEFI+ATMH++R +R
Sbjct  418  TDKSGTITYEELKTGLARLGSKLTEAEVKQLMEAADVDGNGTIDYIEFISATMHRYRFDR  477

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+++KAFQYFDKD+SGFIT DELE+AMK++G+ D A+IKEII+EVD D+DGRINYEEFC
Sbjct  478  DEHVFKAFQYFDKDNSGFITMDELESAMKKYGMGDEASIKEIIAEVDTDNDGRINYEEFC  537

Query  321  TMMRSGT--KQQPKLFDL  274
             MMRSGT   QQ KL   
Sbjct  538  AMMRSGTTQPQQGKLLPF  555



>emb|CAD70165.1| calcium-dependent protein kinase [Landoltia punctata]
Length=548

 Score =   216 bits (551),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 100/127 (79%), Positives = 117/127 (92%), Gaps = 0/127 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ L+EAEVKQLM+AADVDGNGSIDYIEFITATMH+H+LER
Sbjct  416  TDQSGTITYEELKTGLARLGSRLSEAEVKQLMDAADVDGNGSIDYIEFITATMHRHKLER  475

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            EE+LY AF YFDKD+SG+ITRDEL+ A++EHG+ DA +I+EIISEVD D+DGRINY+EFC
Sbjct  476  EEHLYSAFSYFDKDNSGYITRDELKQALEEHGMGDADSIREIISEVDTDNDGRINYDEFC  535

Query  321  TMMRSGT  301
             MMRSGT
Sbjct  536  AMMRSGT  542



>ref|XP_009135461.1| PREDICTED: calcium-dependent protein kinase 15 [Brassica rapa]
Length=573

 Score =   217 bits (552),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ L+EAEVKQLMEAADVDGNG+IDYIEFI+ATMH++RL+R
Sbjct  432  TDQSGTITYEELKTGLARLGSKLSEAEVKQLMEAADVDGNGTIDYIEFISATMHRYRLDR  491

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+L+KAFQYFDKD+SGFIT DELE+AMKE+G+ D  +IKE+I+EVD D+DGRINYEEFC
Sbjct  492  DEHLFKAFQYFDKDNSGFITMDELESAMKEYGMGDETSIKEVIAEVDTDNDGRINYEEFC  551

Query  321  TMMRSGTKQ  295
             MMRSGT Q
Sbjct  552  AMMRSGTTQ  560



>ref|XP_002869852.1| hypothetical protein ARALYDRAFT_354567 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46111.1| hypothetical protein ARALYDRAFT_354567 [Arabidopsis lyrata subsp. 
lyrata]
Length=396

 Score =   213 bits (541),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ LTEAEVKQLMEAADVDGNG+IDYIEFI+ATMH++R +R
Sbjct  258  TDKSGTITYEELKTGLAKLGSKLTEAEVKQLMEAADVDGNGTIDYIEFISATMHRYRFDR  317

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+++KAFQYFDKD+SGFIT DELE+AMKE+G+ D A+IKE+I+EVD D+DGRINYEEFC
Sbjct  318  DEHVFKAFQYFDKDNSGFITMDELESAMKEYGMGDEASIKEVIAEVDTDNDGRINYEEFC  377

Query  321  TMMRSG  304
             MMRSG
Sbjct  378  AMMRSG  383



>ref|XP_010057925.1| PREDICTED: calcium-dependent protein kinase 2-like [Eucalyptus 
grandis]
 gb|KCW75311.1| hypothetical protein EUGRSUZ_E04057 [Eucalyptus grandis]
Length=546

 Score =   216 bits (550),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 101/134 (75%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTIT+EELK GLA+LG+ LTE EVKQLMEAADVDGNGSIDYIEFI+ATMH+H+LER
Sbjct  413  TDNSGTITFEELKSGLARLGSRLTETEVKQLMEAADVDGNGSIDYIEFISATMHRHKLER  472

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +++L+KAFQYFDKD SG+IT+DELE AMKEH I D A IKEII+EVD D+DGRI+Y+EFC
Sbjct  473  DDHLHKAFQYFDKDGSGYITKDELEAAMKEHAIGDEANIKEIIAEVDKDNDGRIDYDEFC  532

Query  321  TMMRSGTKQQPKLF  280
            TMMRS ++   KLF
Sbjct  533  TMMRSKSQHPEKLF  546



>gb|KJB68586.1| hypothetical protein B456_010G252400 [Gossypium raimondii]
Length=527

 Score =   216 bits (549),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 101/134 (75%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SG+ITYEELK+GLA+LG+ LTEAEVKQLMEAADVDGNG+IDYIEFI+ATMH++RLER
Sbjct  394  TDESGSITYEELKEGLARLGSKLTEAEVKQLMEAADVDGNGTIDYIEFISATMHRYRLER  453

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+LYKAFQYFDKD+SGFIT DELE AMK++ + D A+IK+IISEVD D+DG+INY+EFC
Sbjct  454  DEDLYKAFQYFDKDNSGFITMDELEAAMKDYRMGDEASIKQIISEVDTDNDGKINYDEFC  513

Query  321  TMMRSGTKQQPKLF  280
             MMR G  Q  KLF
Sbjct  514  AMMRGGAPQTAKLF  527



>gb|EYU33891.1| hypothetical protein MIMGU_mgv1a004201mg [Erythranthe guttata]
Length=539

 Score =   216 bits (550),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 103/135 (76%), Positives = 122/135 (90%), Gaps = 1/135 (1%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ L+E EVKQLMEAADVDGNG+IDYIEFITATMH+H+LE+
Sbjct  405  TDKSGTITYEELKSGLARLGSKLSETEVKQLMEAADVDGNGTIDYIEFITATMHRHKLEK  464

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+L+ AFQ+FDKDSSG+ITRDEL++AMKE+G+ D ATI+EIISEVD D+DG+INYEEFC
Sbjct  465  DEHLFGAFQFFDKDSSGYITRDELKSAMKEYGMGDEATIEEIISEVDTDNDGKINYEEFC  524

Query  321  TMMRSGTKQQP-KLF  280
             MMRSGT Q   KLF
Sbjct  525  AMMRSGTTQPAVKLF  539



>emb|CDX79112.1| BnaA01g11790D [Brassica napus]
Length=563

 Score =   216 bits (551),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ L+EAEVKQLMEAADVDGNG+IDYIEFI+ATMH++RL+R
Sbjct  422  TDQSGTITYEELKTGLARLGSKLSEAEVKQLMEAADVDGNGTIDYIEFISATMHRYRLDR  481

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+L+KAFQYFDKD+SGFIT DELE+AMKE+G+ D  +IKE+I+EVD D+DGRINYEEFC
Sbjct  482  DEHLFKAFQYFDKDNSGFITMDELESAMKEYGMGDETSIKEVIAEVDTDNDGRINYEEFC  541

Query  321  TMMRSGTKQ  295
             MMRSGT Q
Sbjct  542  AMMRSGTTQ  550



>ref|XP_006283446.1| hypothetical protein CARUB_v10004493mg [Capsella rubella]
 gb|EOA16344.1| hypothetical protein CARUB_v10004493mg [Capsella rubella]
Length=559

 Score =   216 bits (549),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 103/136 (76%), Positives = 121/136 (89%), Gaps = 2/136 (1%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ LTEAEVKQLMEAADVDGNG+IDYIEFI+ATMH++R +R
Sbjct  412  TDKSGTITYEELKTGLAKLGSKLTEAEVKQLMEAADVDGNGTIDYIEFISATMHRYRFDR  471

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E++ KAFQYFDKD+SGFIT DELE+AMKE+G+ D A+IKE+I+EVD D+DGRINYEEFC
Sbjct  472  DEHVSKAFQYFDKDNSGFITMDELESAMKEYGMGDEASIKEVIAEVDTDNDGRINYEEFC  531

Query  321  TMMRSGT--KQQPKLF  280
             MMRSGT   QQ KL 
Sbjct  532  AMMRSGTTQPQQGKLL  547



>gb|AGG35967.1| calcium-dependent protein kinase 15, partial [Brassica napus]
Length=570

 Score =   216 bits (549),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/129 (77%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ L+EAEVKQLMEAADVDGNG+IDYIEFI+ATMH++RL+R
Sbjct  431  TDQSGTITYEELKTGLARLGSKLSEAEVKQLMEAADVDGNGTIDYIEFISATMHRYRLDR  490

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+L+KAFQYFDKD+SGFIT DEL++AMKE+G+ D  +IKE+I+EVD D+DGRINYEEFC
Sbjct  491  DEHLFKAFQYFDKDNSGFITMDELKSAMKEYGMGDETSIKEVIAEVDTDNDGRINYEEFC  550

Query  321  TMMRSGTKQ  295
             MMRSGT Q
Sbjct  551  AMMRSGTTQ  559



>ref|XP_006475136.1| PREDICTED: calcium-dependent protein kinase 9-like [Citrus sinensis]
Length=680

 Score =   218 bits (554),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 103/132 (78%), Positives = 120/132 (91%), Gaps = 0/132 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ LTEAEV+QLMEAADVDGNG+IDYIEFITATMH+H+LER
Sbjct  396  TDNSGTITYEELKAGLARLGSKLTEAEVQQLMEAADVDGNGTIDYIEFITATMHRHKLER  455

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +++LYKAFQ+FDKD+SGFIT DELE AMK++G+ D  TIKEIISEVD D+DGRINY+EFC
Sbjct  456  DDHLYKAFQHFDKDNSGFITIDELEIAMKDYGMGDDDTIKEIISEVDTDNDGRINYDEFC  515

Query  321  TMMRSGTKQQPK  286
             MMRSGT+ Q K
Sbjct  516  AMMRSGTQPQAK  527


 Score = 95.1 bits (235),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 65/99 (66%), Gaps = 2/99 (2%)
 Frame = -3

Query  570  DGNGSIDYIEFITATMHKHRLEREEN--LYKAFQYFDKDSSGFITRDELETAMKEHGIAD  397
            D +G I Y EF      +   +R++   + + F +  +    FIT DELE AMK++G+ D
Sbjct  582  DSDGRISYEEFCATIAMRLAFDRDQRFKVTELFSFSLQCLYRFITIDELEIAMKDYGMGD  641

Query  396  AATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKLF  280
              TIKEIISEVD D+DGRINY+EFC MMRSGT+ Q KLF
Sbjct  642  DDTIKEIISEVDTDNDGRINYDEFCAMMRSGTQPQAKLF  680



>emb|CDX82886.1| BnaC01g13360D [Brassica napus]
Length=557

 Score =   215 bits (548),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/129 (77%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ L+EAEVKQLMEAADVDGNG+IDYIEFI+ATMH++RL+R
Sbjct  416  TDQSGTITYEELKTGLARLGSKLSEAEVKQLMEAADVDGNGTIDYIEFISATMHRYRLDR  475

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+L+KAFQYFDKD+SGFIT DEL++AMKE+G+ D  +IKE+I+EVD D+DGRINYEEFC
Sbjct  476  DEHLFKAFQYFDKDNSGFITMDELKSAMKEYGMGDETSIKEVIAEVDTDNDGRINYEEFC  535

Query  321  TMMRSGTKQ  295
             MMRSGT Q
Sbjct  536  AMMRSGTTQ  544



>ref|XP_002278179.1| PREDICTED: calcium-dependent protein kinase 2 [Vitis vinifera]
Length=536

 Score =   215 bits (547),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ LTEAEV+QLMEAADVDGNG+IDYIEFITAT+++H+LER
Sbjct  403  TDKSGTITYEELKSGLARLGSKLTEAEVQQLMEAADVDGNGTIDYIEFITATVNRHKLER  462

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+L+KAFQYFDKDSSGFITRDEL+ AMKEHG+ D  TI EIISEVD D+D +INY EFC
Sbjct  463  DEHLFKAFQYFDKDSSGFITRDELKAAMKEHGMGDDDTIAEIISEVDTDNDDKINYGEFC  522

Query  321  TMMRSGTKQQPKLF  280
            +MMR GT+Q  K+F
Sbjct  523  SMMRGGTQQGLKVF  536



>ref|NP_193925.1| calcium-dependent protein kinase 15 [Arabidopsis thaliana]
 sp|O49717.1|CDPKF_ARATH RecName: Full=Calcium-dependent protein kinase 15 [Arabidopsis 
thaliana]
 emb|CAA17161.1| calcium-dependent protein kinase - like protein [Arabidopsis 
thaliana]
 emb|CAB79149.1| calcium-dependent protein kinase-like protein [Arabidopsis thaliana]
 gb|AAK59500.1| putative calcium-dependent protein kinase [Arabidopsis thaliana]
 gb|AAL34178.1| putative calcium-dependent protein kinase [Arabidopsis thaliana]
 gb|AEE84532.1| calcium-dependent protein kinase 15 [Arabidopsis thaliana]
Length=554

 Score =   215 bits (548),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 101/138 (73%), Positives = 122/138 (88%), Gaps = 2/138 (1%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ LTEAEVKQLMEAADVDGNG+IDYIEFI+ATMH++R +R
Sbjct  416  TDKSGTITYEELKNGLAKLGSKLTEAEVKQLMEAADVDGNGTIDYIEFISATMHRYRFDR  475

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+++KAFQYFDKD+SGFIT DELE+AMKE+G+ D A+IKE+I+EVD D+DGRINYEEFC
Sbjct  476  DEHVFKAFQYFDKDNSGFITMDELESAMKEYGMGDEASIKEVIAEVDTDNDGRINYEEFC  535

Query  321  TMMRSGT--KQQPKLFDL  274
             MMRSG    QQ K+  +
Sbjct  536  AMMRSGITLPQQGKILPV  553



>gb|KCW67039.1| hypothetical protein EUGRSUZ_F00807 [Eucalyptus grandis]
Length=492

 Score =   213 bits (542),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 100/134 (75%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ LTEAEVKQLMEAADVDGNGSIDYIEFITATMH+H+LE 
Sbjct  359  TDKSGTITYEELKTGLARLGSKLTEAEVKQLMEAADVDGNGSIDYIEFITATMHRHKLET  418

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+LYKAFQ+FDKD+SGFIT DE+ETA++ +G+ D  TI++II+EVD D+DGRI+Y+EFC
Sbjct  419  DEHLYKAFQHFDKDNSGFITMDEIETALRGYGMGDEETIRDIIAEVDTDNDGRIDYQEFC  478

Query  321  TMMRSGTKQQPKLF  280
             MMRSG + Q KLF
Sbjct  479  AMMRSGNQHQGKLF  492



>ref|NP_001190794.1| calcium-dependent protein kinase 15 [Arabidopsis thaliana]
 gb|AEE84533.1| calcium-dependent protein kinase 15 [Arabidopsis thaliana]
Length=561

 Score =   214 bits (546),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 101/137 (74%), Positives = 121/137 (88%), Gaps = 2/137 (1%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ LTEAEVKQLMEAADVDGNG+IDYIEFI+ATMH++R +R
Sbjct  416  TDKSGTITYEELKNGLAKLGSKLTEAEVKQLMEAADVDGNGTIDYIEFISATMHRYRFDR  475

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+++KAFQYFDKD+SGFIT DELE+AMKE+G+ D A+IKE+I+EVD D+DGRINYEEFC
Sbjct  476  DEHVFKAFQYFDKDNSGFITMDELESAMKEYGMGDEASIKEVIAEVDTDNDGRINYEEFC  535

Query  321  TMMRSGT--KQQPKLFD  277
             MMRSG    QQ K+  
Sbjct  536  AMMRSGITLPQQGKILP  552



>ref|XP_006413708.1| hypothetical protein EUTSA_v100267671mg, partial [Eutrema salsugineum]
 gb|ESQ55161.1| hypothetical protein EUTSA_v100267671mg, partial [Eutrema salsugineum]
Length=218

 Score =   205 bits (521),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 119/131 (91%), Gaps = 2/131 (2%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ L+EAEVKQLMEAADVDGNG+IDYIEF++ATMH++ ++R
Sbjct  60   TDQSGTITYEELKTGLAKLGSKLSEAEVKQLMEAADVDGNGTIDYIEFMSATMHRY-IDR  118

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+L+KAFQYFDKD+SGFIT DELE+AMKE+ + D A+IKEII+EVD D+DGRINYEEFC
Sbjct  119  DEHLFKAFQYFDKDNSGFITMDELESAMKEYDMGDEASIKEIIAEVDTDNDGRINYEEFC  178

Query  321  TMMRSG-TKQQ  292
             MMRSG TK Q
Sbjct  179  AMMRSGNTKPQ  189



>gb|AGJ83807.1| calcium-dependent protein kinase 1e [Vitis amurensis]
Length=536

 Score =   213 bits (543),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 101/134 (75%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ LTEAEV+QLMEAADVDGNG+IDYIEFITAT+++H+LER
Sbjct  403  TDKSGTITYEELKSGLARLGSKLTEAEVQQLMEAADVDGNGTIDYIEFITATVNRHKLER  462

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+L+K FQYFDKDSSGFITRDEL+ AMKEHG+ D  TI EIISEVD D+D +INY EFC
Sbjct  463  DEHLFKPFQYFDKDSSGFITRDELKAAMKEHGMGDDDTIAEIISEVDTDNDDKINYGEFC  522

Query  321  TMMRSGTKQQPKLF  280
            +MMR GT+Q  K+F
Sbjct  523  SMMRGGTQQGLKVF  536



>ref|XP_010060380.1| PREDICTED: calcium-dependent protein kinase 2-like [Eucalyptus 
grandis]
 gb|KCW67038.1| hypothetical protein EUGRSUZ_F00807 [Eucalyptus grandis]
Length=543

 Score =   213 bits (543),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 100/134 (75%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ LTEAEVKQLMEAADVDGNGSIDYIEFITATMH+H+LE 
Sbjct  410  TDKSGTITYEELKTGLARLGSKLTEAEVKQLMEAADVDGNGSIDYIEFITATMHRHKLET  469

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+LYKAFQ+FDKD+SGFIT DE+ETA++ +G+ D  TI++II+EVD D+DGRI+Y+EFC
Sbjct  470  DEHLYKAFQHFDKDNSGFITMDEIETALRGYGMGDEETIRDIIAEVDTDNDGRIDYQEFC  529

Query  321  TMMRSGTKQQPKLF  280
             MMRSG + Q KLF
Sbjct  530  AMMRSGNQHQGKLF  543



>ref|XP_010060346.1| PREDICTED: calcium-dependent protein kinase 2-like isoform X1 
[Eucalyptus grandis]
Length=535

 Score =   213 bits (543),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 100/134 (75%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ LTEAEVKQLMEAADVDGNGSIDYIEFITATMH+H+LE 
Sbjct  402  TDKSGTITYEELKTGLARLGSKLTEAEVKQLMEAADVDGNGSIDYIEFITATMHRHKLET  461

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+LYKAFQ+FDKD+SGFIT DE+ETA++ +G+ D  TI++II+EVD D+DGRI+Y+EFC
Sbjct  462  DEHLYKAFQHFDKDNSGFITMDEIETALRGYGMGDEETIRDIIAEVDTDNDGRIDYQEFC  521

Query  321  TMMRSGTKQQPKLF  280
             MMRSG + Q KLF
Sbjct  522  AMMRSGNQHQGKLF  535



>ref|XP_010060348.1| PREDICTED: calcium-dependent protein kinase 2-like isoform X2 
[Eucalyptus grandis]
Length=550

 Score =   213 bits (543),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 100/134 (75%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ LTEAEVKQLMEAADVDGNGSIDYIEFITATMH+H+LE 
Sbjct  417  TDKSGTITYEELKTGLARLGSKLTEAEVKQLMEAADVDGNGSIDYIEFITATMHRHKLET  476

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+LYKAFQ+FDKD+SGFIT DE+ETA++ +G+ D  TI++II+EVD D+DGRI+Y+EFC
Sbjct  477  DEHLYKAFQHFDKDNSGFITMDEIETALRGYGMGDEETIRDIIAEVDTDNDGRIDYQEFC  536

Query  321  TMMRSGTKQQPKLF  280
             MMRSG + Q KLF
Sbjct  537  AMMRSGNQHQGKLF  550



>ref|XP_002869856.1| calcium-dependent protein kinase 15 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46115.1| calcium-dependent protein kinase 15 [Arabidopsis lyrata subsp. 
lyrata]
Length=550

 Score =   213 bits (542),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ L EAEVKQLMEAADVDGNG+IDYIEFI+ TMH++RL+R
Sbjct  412  TDKSGTITYEELKTGLAKLGSKLNEAEVKQLMEAADVDGNGTIDYIEFISVTMHRYRLDR  471

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+L+KAFQYFDKD+SGFIT DELE+AMKE+G+ D A+IKE+I+EVD D+DGRINYEEFC
Sbjct  472  DEHLFKAFQYFDKDNSGFITMDELESAMKEYGMGDEASIKEVIAEVDTDNDGRINYEEFC  531

Query  321  TMMRSG  304
             MMRSG
Sbjct  532  AMMRSG  537



>gb|AGG35970.1| calcium-dependent protein kinase 21 [Brassica napus]
Length=525

 Score =   212 bits (539),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/137 (73%), Positives = 121/137 (88%), Gaps = 1/137 (1%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GL +LG+ L+E EVKQLMEAADVDGNG+IDY EFI+ATMH+++L+R
Sbjct  388  TDKSGTITYEELKTGLTRLGSKLSETEVKQLMEAADVDGNGTIDYFEFISATMHRYKLDR  447

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E++YKAFQ+FDKD+SG ITRDELE+AMKE+G+ D A+IKE+ISEVD D+DGRIN+EEFC
Sbjct  448  DEHVYKAFQHFDKDNSGHITRDELESAMKEYGMGDEASIKEVISEVDTDNDGRINFEEFC  507

Query  321  TMMRSGTKQ-QPKLFDL  274
             MMRSGT Q Q KLF  
Sbjct  508  AMMRSGTTQPQGKLFPF  524



>gb|AFR11230.1| calcium dependent protein kinase 1 [Chenopodium album]
Length=543

 Score =   212 bits (539),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 100/134 (75%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SG+ITY+ELKKGLA+LG+ LTE EVKQLMEAADVDGNG+IDY EFITATM++HRLE 
Sbjct  410  TDNSGSITYDELKKGLAELGSKLTETEVKQLMEAADVDGNGTIDYTEFITATMNRHRLET  469

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +ENL KAF+YFDKD+SGFIT DELE+ M E+GIAD ++IKEI+SEVD D+DG+INY+EFC
Sbjct  470  DENLLKAFRYFDKDNSGFITMDELESEMMEYGIADESSIKEILSEVDTDNDGKINYDEFC  529

Query  321  TMMRSGTKQQPKLF  280
             MM+SGT  Q KLF
Sbjct  530  AMMKSGTTAQVKLF  543



>gb|AAQ17506.1| calcium dependent protein kinase 3 [Oryza sativa Japonica Group]
Length=527

 Score =   211 bits (537),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 98/123 (80%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ L+EAEVKQLMEAADVDGNGSIDY+EFITATMH+H+LER
Sbjct  399  TDNSGTITYEELKAGLAKLGSKLSEAEVKQLMEAADVDGNGSIDYVEFITATMHRHKLER  458

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+L+KAFQYFDKD+SGFITRDELE+A+ EH + D +TIK+IISEVD D+DGRINYEEFC
Sbjct  459  DEHLFKAFQYFDKDNSGFITRDELESALIEHEMGDTSTIKDIISEVDTDNDGRINYEEFC  518

Query  321  TMM  313
             MM
Sbjct  519  AMM  521



>gb|KJB81727.1| hypothetical protein B456_013G159300 [Gossypium raimondii]
Length=536

 Score =   211 bits (536),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 119/134 (89%), Gaps = 1/134 (1%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITY+ELK GLA+LG+ LTE EV+QLMEAADVDGNG+IDYIEFITATMH+HRLER
Sbjct  404  TDNSGTITYDELKTGLARLGSKLTETEVQQLMEAADVDGNGTIDYIEFITATMHRHRLER  463

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+LYKAFQ+FDKD+SG ITRDELE AMKE+G+ D  TIKEIISEVD D+DG+INYEEF 
Sbjct  464  DEDLYKAFQHFDKDNSGHITRDELEAAMKEYGMGDDDTIKEIISEVDTDNDGKINYEEFR  523

Query  321  TMMRSGTKQQPKLF  280
             MMRSGT Q  +LF
Sbjct  524  DMMRSGT-QHGQLF  536



>gb|KHG17079.1| Calcium-dependent protein kinase 9 [Gossypium arboreum]
Length=536

 Score =   211 bits (536),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 119/134 (89%), Gaps = 1/134 (1%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITY+ELK GLA+LG+ LTE EV+QLMEAADVDGNG+IDYIEFITATMH+HRLER
Sbjct  404  TDNSGTITYDELKTGLARLGSKLTETEVQQLMEAADVDGNGTIDYIEFITATMHRHRLER  463

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+LYKAFQ+FDKD+SG ITRDELE AMKE+G+ D  TIKEIISEVD D+DG+INYEEF 
Sbjct  464  DEDLYKAFQHFDKDNSGHITRDELEAAMKEYGMGDDDTIKEIISEVDTDNDGKINYEEFR  523

Query  321  TMMRSGTKQQPKLF  280
             MMRSGT Q  +LF
Sbjct  524  DMMRSGT-QHGQLF  536



>gb|KCW75309.1| hypothetical protein EUGRSUZ_E04057 [Eucalyptus grandis]
Length=536

 Score =   211 bits (536),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTIT+EELK GLA+LG+ LTE EVKQLMEAADVDGNGSIDYIEFI+ATMH+H+LER
Sbjct  406  TDNSGTITFEELKSGLARLGSRLTETEVKQLMEAADVDGNGSIDYIEFISATMHRHKLER  465

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +++L+KAFQYFDKD SG+IT+DELE AMKEH I D A IKEII+EVD D+DGRI+Y+EFC
Sbjct  466  DDHLHKAFQYFDKDGSGYITKDELEAAMKEHAIGDEANIKEIIAEVDKDNDGRIDYDEFC  525

Query  321  TMMRS  307
            TMMRS
Sbjct  526  TMMRS  530



>gb|KCW75310.1| hypothetical protein EUGRSUZ_E04057 [Eucalyptus grandis]
Length=543

 Score =   211 bits (536),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTIT+EELK GLA+LG+ LTE EVKQLMEAADVDGNGSIDYIEFI+ATMH+H+LER
Sbjct  413  TDNSGTITFEELKSGLARLGSRLTETEVKQLMEAADVDGNGSIDYIEFISATMHRHKLER  472

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +++L+KAFQYFDKD SG+IT+DELE AMKEH I D A IKEII+EVD D+DGRI+Y+EFC
Sbjct  473  DDHLHKAFQYFDKDGSGYITKDELEAAMKEHAIGDEANIKEIIAEVDKDNDGRIDYDEFC  532

Query  321  TMMRS  307
            TMMRS
Sbjct  533  TMMRS  537



>ref|XP_009144515.1| PREDICTED: calcium-dependent protein kinase 21 [Brassica rapa]
 emb|CDX97315.1| BnaA02g21060D [Brassica napus]
Length=520

 Score =   209 bits (533),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/137 (72%), Positives = 120/137 (88%), Gaps = 1/137 (1%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GL +LG+ L+E EVKQLMEAADVDGNG+IDY EFI+ATMH+++L+R
Sbjct  383  TDKSGTITYEELKTGLTRLGSKLSETEVKQLMEAADVDGNGTIDYFEFISATMHRYKLDR  442

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E++YKAFQ+FDKD+SG ITRDELE+AMKE+G+ D A+IKE+ISEVD D+DGRIN+EEFC
Sbjct  443  DEHVYKAFQHFDKDNSGHITRDELESAMKEYGMGDEASIKEVISEVDTDNDGRINFEEFC  502

Query  321  TMMRSGTKQ-QPKLFDL  274
             MMRSGT Q Q KL   
Sbjct  503  AMMRSGTTQPQGKLLPF  519



>gb|AAK92828.1| putative calcium dependent protein kinase [Arabidopsis thaliana]
Length=531

 Score =   209 bits (533),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/137 (72%), Positives = 120/137 (88%), Gaps = 1/137 (1%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GL +LG+ L+E EVKQLMEAADVDGNG+IDY EFI+ATMH+++L+R
Sbjct  394  TDKSGTITYEELKTGLTRLGSRLSETEVKQLMEAADVDGNGTIDYYEFISATMHRYKLDR  453

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E++YKAFQ+FDKDSSG ITRDELE+AMKE+G+ D A+IKE+ISEVD D+DGRIN+EEFC
Sbjct  454  DEHVYKAFQHFDKDSSGHITRDELESAMKEYGMGDEASIKEVISEVDTDNDGRINFEEFC  513

Query  321  TMMRSG-TKQQPKLFDL  274
             MMRSG T+ Q KL   
Sbjct  514  AMMRSGSTQPQGKLLPF  530



>ref|XP_006396672.1| hypothetical protein EUTSA_v10028567mg [Eutrema salsugineum]
 gb|ESQ38125.1| hypothetical protein EUTSA_v10028567mg [Eutrema salsugineum]
Length=535

 Score =   209 bits (533),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/137 (72%), Positives = 120/137 (88%), Gaps = 1/137 (1%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GL +LG+ L+E EVKQLMEAADVDGNG+IDY EFI+ATMH+++L+R
Sbjct  398  TDKSGTITYEELKTGLTRLGSKLSETEVKQLMEAADVDGNGTIDYFEFISATMHRYKLDR  457

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E++YKAFQ+FDKD+SG ITRDELE+AMKE+G+ D A+IKE+ISEVD D+DGRIN+EEFC
Sbjct  458  DEHVYKAFQHFDKDNSGHITRDELESAMKEYGMGDEASIKEVISEVDTDNDGRINFEEFC  517

Query  321  TMMRSGTKQ-QPKLFDL  274
             MMRSGT Q Q KL   
Sbjct  518  AMMRSGTTQPQGKLLPF  534



>ref|XP_006289661.1| hypothetical protein CARUB_v10003219mg [Capsella rubella]
 gb|EOA22559.1| hypothetical protein CARUB_v10003219mg [Capsella rubella]
Length=534

 Score =   209 bits (532),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 99/137 (72%), Positives = 120/137 (88%), Gaps = 1/137 (1%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GL +LG+ L+E EVKQLMEAADVDGNG+IDY EFI+ATMH+++L+R
Sbjct  397  TDKSGTITYEELKTGLTRLGSRLSETEVKQLMEAADVDGNGTIDYYEFISATMHRYKLDR  456

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E++YKAFQ+FDKD+SG ITRDELE+AMKE+G+ D A+IKE+ISEVD D+DGRIN+EEFC
Sbjct  457  DEHVYKAFQHFDKDNSGHITRDELESAMKEYGMGDEASIKEVISEVDTDNDGRINFEEFC  516

Query  321  TMMRSGTKQ-QPKLFDL  274
             MMRSGT Q Q KL   
Sbjct  517  AMMRSGTTQPQGKLLPF  533



>ref|XP_002874811.1| calcium-dependent protein kinase 21 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51070.1| calcium-dependent protein kinase 21 [Arabidopsis lyrata subsp. 
lyrata]
Length=534

 Score =   209 bits (532),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 99/137 (72%), Positives = 120/137 (88%), Gaps = 1/137 (1%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GL +LG+ L+E EVKQLMEAADVDGNG+IDY EFI+ATMH+++L+R
Sbjct  397  TDKSGTITYEELKTGLTRLGSRLSETEVKQLMEAADVDGNGTIDYYEFISATMHRYKLDR  456

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E++YKAFQ+FDKD+SG ITRDELE+AMKE+G+ D A+IKE+ISEVD D+DGRIN+EEFC
Sbjct  457  DEHVYKAFQHFDKDNSGHITRDELESAMKEYGMGDEASIKEVISEVDTDNDGRINFEEFC  516

Query  321  TMMRSGTKQ-QPKLFDL  274
             MMRSGT Q Q KL   
Sbjct  517  AMMRSGTTQPQGKLLPF  533



>gb|KFK30982.1| hypothetical protein AALP_AA6G053400 [Arabis alpina]
Length=481

 Score =   208 bits (529),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 100/137 (73%), Positives = 118/137 (86%), Gaps = 1/137 (1%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SG+ITYEELK GLA+LG+ L+E EVKQLMEAADVDGNG+IDYIEFI+ATMH+HRLER
Sbjct  344  TDNSGSITYEELKTGLAKLGSKLSEDEVKQLMEAADVDGNGTIDYIEFISATMHRHRLER  403

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+LYKAFQYFDKD+SG IT++ELE AMKEHG+ D A  KEIISEVD D+DG+I+YEEFC
Sbjct  404  DEHLYKAFQYFDKDNSGHITKEELEIAMKEHGMGDEANAKEIISEVDKDNDGKIDYEEFC  463

Query  321  TMMRSGT-KQQPKLFDL  274
             MMR+G    Q KL  +
Sbjct  464  AMMRNGNLHPQGKLLGM  480



>gb|KFK30983.1| hypothetical protein AALP_AA6G053500 [Arabis alpina]
Length=538

 Score =   208 bits (530),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 120/137 (88%), Gaps = 1/137 (1%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GL +LG+ L+E EVKQLMEAADVDGNG+IDY EFI+ATMH+++L+R
Sbjct  401  TDKSGTITYEELKTGLTRLGSKLSETEVKQLMEAADVDGNGTIDYFEFISATMHRYKLDR  460

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E++YKAFQ+FDKD+SG ITRDELE+AMKE+G+ D A+IKE+ISEVD D+DGRIN+EEFC
Sbjct  461  DEHVYKAFQHFDKDNSGHITRDELESAMKEYGMGDEASIKEVISEVDTDNDGRINFEEFC  520

Query  321  TMMRSG-TKQQPKLFDL  274
             MMRSG T+ Q KL   
Sbjct  521  AMMRSGSTQPQNKLLPF  537



>ref|NP_192381.1| calcium-dependent protein kinase 21 [Arabidopsis thaliana]
 sp|Q9ZSA2.1|CDPKL_ARATH RecName: Full=Calcium-dependent protein kinase 21 [Arabidopsis 
thaliana]
 gb|AAD03453.1| contains similarity to eukaryotic protein kinase domains (Pfam: 
PF00069, score=312.6, E=4.7e-90, N=1) and EF hand domains 
(Pfam: PF00036, score=131, E=2.1e-35, N=4) [Arabidopsis thaliana]
 emb|CAB80837.1| putative calcium dependent protein kinase [Arabidopsis thaliana]
 gb|AAN13018.1| putative calcium-dependent protein kinase [Arabidopsis thaliana]
 gb|AEE82416.1| calcium-dependent protein kinase 21 [Arabidopsis thaliana]
Length=531

 Score =   208 bits (529),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 120/137 (88%), Gaps = 1/137 (1%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GL +LG+ L+E EVKQLMEAADVDGNG+IDY EFI+ATMH+++L+R
Sbjct  394  TDKSGTITYEELKTGLTRLGSRLSETEVKQLMEAADVDGNGTIDYYEFISATMHRYKLDR  453

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E++YKAFQ+FDKD+SG ITRDELE+AMKE+G+ D A+IKE+ISEVD D+DGRIN+EEFC
Sbjct  454  DEHVYKAFQHFDKDNSGHITRDELESAMKEYGMGDEASIKEVISEVDTDNDGRINFEEFC  513

Query  321  TMMRSG-TKQQPKLFDL  274
             MMRSG T+ Q KL   
Sbjct  514  AMMRSGSTQPQGKLLPF  530



>ref|XP_002869854.1| hypothetical protein ARALYDRAFT_914449 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46113.1| hypothetical protein ARALYDRAFT_914449 [Arabidopsis lyrata subsp. 
lyrata]
Length=865

 Score =   212 bits (539),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ LTEAEVKQLMEAADVDGNG+IDYIEFI+ATMH++R +R
Sbjct  726  TDKSGTITYEELKTGLAKLGSKLTEAEVKQLMEAADVDGNGTIDYIEFISATMHRYRFDR  785

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+++KAFQYFDKD+S FIT DELE+AMKE+G+ D A+IKE+I+EVD D+DGRINYEEFC
Sbjct  786  DEHVFKAFQYFDKDNSWFITMDELESAMKEYGMGDEASIKEVIAEVDTDNDGRINYEEFC  845

Query  321  TMMRSG  304
             MMRSG
Sbjct  846  AMMRSG  851


 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADV  571
            TD SGTI+YEELK GLA+LG+ LTEAEVKQLMEA  +
Sbjct  522  TDKSGTISYEELKTGLAKLGSKLTEAEVKQLMEAVSI  558



>ref|XP_006828852.1| hypothetical protein AMTR_s00001p00158780 [Amborella trichopoda]
 gb|ERM96268.1| hypothetical protein AMTR_s00001p00158780 [Amborella trichopoda]
Length=532

 Score =   207 bits (527),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 97/124 (78%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEEL+ GL +LG+ L+EAEVKQLM+AADVD +GSIDYIEFITATMH+HRLER
Sbjct  408  TDGSGTITYEELRAGLNRLGSRLSEAEVKQLMDAADVDRSGSIDYIEFITATMHRHRLER  467

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            EENLYKAFQYFD D+SGFITRDELE AMK++G+ D ATIKE+I EVD D+DGRINY+EF 
Sbjct  468  EENLYKAFQYFDTDNSGFITRDELEIAMKDYGMGDDATIKEVIQEVDTDNDGRINYQEFV  527

Query  321  TMMR  310
             MMR
Sbjct  528  AMMR  531



>ref|XP_010455773.1| PREDICTED: calcium-dependent protein kinase 21-like [Camelina 
sativa]
Length=536

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/137 (71%), Positives = 120/137 (88%), Gaps = 1/137 (1%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GL +LG+ L+E EVKQLMEAADVDGNG+IDY EFI+ATMH+++L+R
Sbjct  399  TDKSGTITYEELKTGLTRLGSRLSETEVKQLMEAADVDGNGTIDYYEFISATMHRYKLDR  458

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E++YKAFQ+FDKD+SG ITRDELE+AMKE+G+ D A+IKE+ISEVD D+DG+IN+EEFC
Sbjct  459  DEHVYKAFQHFDKDNSGHITRDELESAMKEYGMGDEASIKEVISEVDTDNDGKINFEEFC  518

Query  321  TMMRSG-TKQQPKLFDL  274
             MMRSG T+ Q KL   
Sbjct  519  AMMRSGSTQPQGKLLPF  535



>ref|XP_010100127.1| Calcium-dependent protein kinase 29 [Morus notabilis]
 gb|EXB81510.1| Calcium-dependent protein kinase 29 [Morus notabilis]
Length=526

 Score =   206 bits (525),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/128 (75%), Positives = 112/128 (88%), Gaps = 0/128 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTIT+EELK GL++LG+ L+EAE++QLMEAADVD NGSIDYIEFITATMH+HRLER
Sbjct  395  TDGSGTITFEELKTGLSKLGSKLSEAEIRQLMEAADVDHNGSIDYIEFITATMHRHRLER  454

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +ENL+KAFQYFDKD SGFITR+EL  AM +HG+ D ATI EII++VD D DGRINYEEF 
Sbjct  455  DENLFKAFQYFDKDGSGFITREELRQAMTQHGMGDEATIDEIINDVDTDKDGRINYEEFV  514

Query  321  TMMRSGTK  298
             MMR GT+
Sbjct  515  AMMRKGTQ  522



>ref|XP_010422295.1| PREDICTED: calcium-dependent protein kinase 21 [Camelina sativa]
Length=534

 Score =   206 bits (525),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 97/137 (71%), Positives = 120/137 (88%), Gaps = 1/137 (1%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GL +LG+ L+E EVKQLMEAADVDGNG+IDY EFI+ATMH+++L+R
Sbjct  397  TDKSGTITYEELKTGLTRLGSRLSETEVKQLMEAADVDGNGTIDYYEFISATMHRYKLDR  456

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E++YKAFQ+FDKD+SG ITRDELE+AMKE+G+ D A+IKE+ISEVD D+DG+IN+EEFC
Sbjct  457  DEHVYKAFQHFDKDNSGHITRDELESAMKEYGMGDEASIKEVISEVDTDNDGKINFEEFC  516

Query  321  TMMRSG-TKQQPKLFDL  274
             MMRSG T+ Q KL   
Sbjct  517  AMMRSGSTQPQGKLLPF  533



>ref|XP_003610425.1| Calcium-dependent protein kinase [Medicago truncatula]
 gb|AES92622.1| calcium-dependent kinase [Medicago truncatula]
Length=543

 Score =   206 bits (525),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/134 (72%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD+SGTITYEELK GLAQ+G+ L+EAE  QLM+AADVDG GSIDY+EFI+ATMH++RLER
Sbjct  410  TDSSGTITYEELKTGLAQIGSELSEAEENQLMKAADVDGKGSIDYLEFISATMHRYRLER  469

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +EN++KAFQYFDKDSSG ITR+ELETA+ +HGI+D A IKEI++EV  D+DG+INY+EFC
Sbjct  470  DENIHKAFQYFDKDSSGHITREELETALTKHGISDEAKIKEIVTEVYTDNDGKINYDEFC  529

Query  321  TMMRSGTKQQPKLF  280
             MMRSG   Q  LF
Sbjct  530  AMMRSGMPHQGPLF  543



>ref|XP_006657761.1| PREDICTED: calcium-dependent protein kinase isoform 2-like isoform 
X1 [Oryza brachyantha]
Length=559

 Score =   206 bits (525),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 104/161 (65%), Positives = 120/161 (75%), Gaps = 29/161 (18%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEA--------------------------  580
            TD SGTITYEELK GLA+LG+ L+EAEVKQLMEA                          
Sbjct  399  TDNSGTITYEELKAGLAKLGSKLSEAEVKQLMEAVWHQSWTISISLNHHLLTFYANLLVH  458

Query  579  --ADVDGNGSIDYIEFITATMHKHRLEREENLYKAFQYFDKDSSGFITRDELETAMKEHG  406
              ADVDGNGSIDY+EFITATMH+H+LER+E+L+KAFQYFDKDSSGFITRDELE+A+ EH 
Sbjct  459  FQADVDGNGSIDYVEFITATMHRHKLERDEHLFKAFQYFDKDSSGFITRDELESALIEHE  518

Query  405  IADAATIKEIISEVDADHDGRINYEEFCTMMRSGTKQQPKL  283
            + D +TIK+IISEVD D+DGRINYEEFC MMR G  Q P+L
Sbjct  519  MGDTSTIKDIISEVDTDNDGRINYEEFCAMMRGGV-QPPRL  558



>ref|XP_004957848.1| PREDICTED: calcium-dependent protein kinase isoform 2-like isoform 
X1 [Setaria italica]
Length=559

 Score =   205 bits (522),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 103/161 (64%), Positives = 120/161 (75%), Gaps = 28/161 (17%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GLA+LG+ L+EAEVKQLMEAADVDGNGSIDY+EFITATMH+H+LER
Sbjct  398  TDNSGTITYEELKAGLAKLGSKLSEAEVKQLMEAADVDGNGSIDYVEFITATMHRHKLER  457

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADH----------  352
            +E+L+KAFQYFDKD+SGFITRDELE+A+ EH + D +TIKEIISEVD D+          
Sbjct  458  DEHLFKAFQYFDKDNSGFITRDELESALIEHEMGDTSTIKEIISEVDTDNVSCLHYRLFC  517

Query  351  ------------------DGRINYEEFCTMMRSGTKQQPKL  283
                              DGRINYEEFC MMR G +Q  +L
Sbjct  518  CITCIPSIFLMLVICLSQDGRINYEEFCAMMRGGMQQPMRL  558



>emb|CDX94570.1| BnaC09g22660D [Brassica napus]
Length=742

 Score =   207 bits (526),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 96/125 (77%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SG+ITYEELK GL +LG+ L EAEVKQLMEAADVDGNG+IDY EFITATMH+HRLER
Sbjct  332  TDKSGSITYEELKTGLNRLGSKLPEAEVKQLMEAADVDGNGTIDYTEFITATMHRHRLER  391

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+L+KAF +FDKD+SG+IT+DEL+ AMKEHG+ D A +KEIISEVD D+DGRINYEEFC
Sbjct  392  DEHLHKAFLHFDKDNSGYITKDELDIAMKEHGMGDEACVKEIISEVDKDNDGRINYEEFC  451

Query  321  TMMRS  307
             MMRS
Sbjct  452  AMMRS  456



>ref|XP_010501945.1| PREDICTED: calcium-dependent protein kinase 33-like [Camelina 
sativa]
Length=582

 Score =   204 bits (520),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK+GLA+LG+ LTEAEVKQLM+AADVDGNGSIDYIEFITATMH+HRLE 
Sbjct  388  TDNSGTITYEELKEGLAKLGSKLTEAEVKQLMDAADVDGNGSIDYIEFITATMHRHRLES  447

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
             E+LYKAFQ+FDKD SG+IT DELE A+KE+G+ D ATIKEI+S+VD+D+DG+INY+EFC
Sbjct  448  NESLYKAFQHFDKDGSGYITIDELEAALKEYGMGDDATIKEILSDVDSDNDGKINYDEFC  507

Query  321  TMMR  310
             M R
Sbjct  508  AMXR  511



>ref|XP_011083439.1| PREDICTED: calcium-dependent protein kinase 29 [Sesamum indicum]
Length=524

 Score =   202 bits (513),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/127 (73%), Positives = 112/127 (88%), Gaps = 0/127 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEEL+ GL++LG+ L+EAE+KQLMEAADVD NG+IDYIEFITATMH+HRLE+
Sbjct  387  TDGSGTITYEELRTGLSKLGSKLSEAEIKQLMEAADVDKNGTIDYIEFITATMHRHRLEK  446

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            EENLYKAFQYFDKD+SG+ITRDEL  AM+++G+ D ATI E++ +VD D DGRINYEEF 
Sbjct  447  EENLYKAFQYFDKDNSGYITRDELRHAMQQYGMGDEATIDEVLDDVDTDKDGRINYEEFA  506

Query  321  TMMRSGT  301
             MM+ GT
Sbjct  507  AMMKKGT  513



>gb|AAD17800.1| Ca2+-dependent protein kinase [Mesembryanthemum crystallinum]
Length=534

 Score =   202 bits (514),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 114/131 (87%), Gaps = 1/131 (1%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SG+ITYEEL++GLA+LG+ LTE EVK LMEAAD DG+GSIDY EFITATMH++RLER
Sbjct  400  TDGSGSITYEELREGLARLGSKLTETEVKALMEAADQDGSGSIDYYEFITATMHRYRLER  459

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+LYKAFQYFDKD+SGFIT DELETAMKE+GIAD   I EI+ EVD D+DGRINY+EF 
Sbjct  460  DEHLYKAFQYFDKDNSGFITTDELETAMKEYGIADENCIAEILLEVDTDNDGRINYDEFS  519

Query  321  TMMRSGTKQQP  289
             MMRSGT Q P
Sbjct  520  AMMRSGT-QNP  529



>ref|XP_004164365.1| PREDICTED: calcium-dependent protein kinase 3-like [Cucumis sativus]
Length=304

 Score =   195 bits (496),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 112/129 (87%), Gaps = 0/129 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTIT+EELK GL +LG  L+E+EV+QLMEAADVDGNGSIDYIEFITATMH +R+ER
Sbjct  168  TDNSGTITFEELKAGLPKLGTKLSESEVRQLMEAADVDGNGSIDYIEFITATMHMNRVER  227

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            E++L+KAF+YFDKD SG+IT +ELETA+K++ + D  TIKEII+EVD D+DGRINY+EF 
Sbjct  228  EDHLFKAFEYFDKDKSGYITMEELETALKKYNMGDETTIKEIIAEVDTDNDGRINYDEFV  287

Query  321  TMMRSGTKQ  295
             MMR G ++
Sbjct  288  AMMRKGNQE  296



>ref|XP_002888057.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64316.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=553

 Score =   201 bits (512),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 95/128 (74%), Positives = 112/128 (88%), Gaps = 0/128 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GL +LG+ LTE EVKQL+E ADVDGNG+IDYIEFI+ATM++ R+ER
Sbjct  416  TDKSGTITYEELKTGLEKLGSRLTETEVKQLLEDADVDGNGTIDYIEFISATMNRFRVER  475

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            EENL+KAFQ+FDKD+SGFI+R ELETAMKE+ + D   IKEIISEVDAD+DG INY+EFC
Sbjct  476  EENLFKAFQHFDKDNSGFISRQELETAMKEYNMGDDTMIKEIISEVDADNDGSINYQEFC  535

Query  321  TMMRSGTK  298
             MMRS +K
Sbjct  536  NMMRSCSK  543



>emb|CDP12100.1| unnamed protein product [Coffea canephora]
Length=400

 Score =   197 bits (502),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 91/132 (69%), Positives = 112/132 (85%), Gaps = 0/132 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTIT+EELK GL +LG  L+E+EV+QLMEAADVDGNG+IDYIEFITATMH +R+ER
Sbjct  264  TDNSGTITFEELKAGLPKLGTKLSESEVRQLMEAADVDGNGTIDYIEFITATMHMNRVER  323

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            E++LY+AF+YFDKD SG+IT +ELE A+KE+ + D  TIKEII+EVD DHDGRINY+EF 
Sbjct  324  EDHLYRAFEYFDKDKSGYITMEELEHALKEYNMGDEKTIKEIIAEVDTDHDGRINYDEFV  383

Query  321  TMMRSGTKQQPK  286
             MMR G  + P+
Sbjct  384  AMMRKGQPEMPQ  395



>ref|XP_002509886.1| calcium-dependent protein kinase, putative [Ricinus communis]
 gb|EEF51273.1| calcium-dependent protein kinase, putative [Ricinus communis]
Length=528

 Score =   201 bits (510),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD +GTITYEELK GL +LG  L+E+EVKQLMEAADVDGNG+IDYIEFITATMH +R+ER
Sbjct  392  TDNNGTITYEELKAGLPKLGTKLSESEVKQLMEAADVDGNGTIDYIEFITATMHMNRMER  451

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            E++LYKAF+YFDKD SG+IT +ELE A+KE+ + DA TIKEII+EVD DHDGRINYEEF 
Sbjct  452  EDHLYKAFEYFDKDKSGYITMEELEHALKEYNMGDARTIKEIIAEVDTDHDGRINYEEFV  511

Query  321  TMMRSGTKQ  295
             MMR G  +
Sbjct  512  AMMRKGNPE  520



>ref|NP_177731.2| calcium-dependent protein kinase 29 [Arabidopsis thaliana]
 gb|AAM13021.1| calcium-dependent protein kinase, putative [Arabidopsis thaliana]
 gb|AAN15720.1| calcium-dependent protein kinase, putative [Arabidopsis thaliana]
 gb|AEE35788.1| calcium-dependent protein kinase 29 [Arabidopsis thaliana]
Length=323

 Score =   195 bits (496),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 92/135 (68%), Positives = 114/135 (84%), Gaps = 1/135 (1%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTIT++EL+ GL +LG+ LTE+E+KQLMEAADVD +G+IDYIEF+TATMH+HRLE+
Sbjct  188  TDESGTITFDELRNGLHRLGSKLTESEIKQLMEAADVDKSGTIDYIEFVTATMHRHRLEK  247

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            EENL +AF+YFDKD SGFITRDEL+ +M E+G+ D ATI E+I++VD D+DGRINYEEF 
Sbjct  248  EENLIEAFKYFDKDRSGFITRDELKHSMTEYGMGDDATIDEVINDVDTDNDGRINYEEFV  307

Query  321  TMMRSGTK-QQPKLF  280
             MMR GT    PKL 
Sbjct  308  AMMRKGTTDSDPKLI  322



>ref|XP_011003084.1| PREDICTED: calcium-dependent protein kinase 29-like isoform X1 
[Populus euphratica]
Length=523

 Score =   200 bits (509),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 91/127 (72%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GL++LG+ LTE E+KQLM+ ADVD +G+IDY+EFITATMH+HRLE+
Sbjct  397  TDRSGTITYEELKSGLSRLGSKLTEVEIKQLMDGADVDNSGTIDYVEFITATMHRHRLEK  456

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            EENLYKAFQYFDKD++GFITRDEL  AM ++G+ D ATI E+I +VD D DG INYEEF 
Sbjct  457  EENLYKAFQYFDKDNNGFITRDELRQAMSQYGMGDEATIDEVIKDVDTDKDGNINYEEFA  516

Query  321  TMMRSGT  301
            TMMR G+
Sbjct  517  TMMRKGS  523



>ref|XP_006391947.1| hypothetical protein EUTSA_v10023804mg [Eutrema salsugineum]
 gb|ESQ29233.1| hypothetical protein EUTSA_v10023804mg [Eutrema salsugineum]
Length=553

 Score =   200 bits (509),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 97/134 (72%), Positives = 117/134 (87%), Gaps = 1/134 (1%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GL +LG+ LTE EVKQL+E ADVDGNG+IDYIEFI+ATM+++R+ER
Sbjct  416  TDKSGTITYEELKTGLEKLGSRLTETEVKQLLEDADVDGNGTIDYIEFISATMNRYRVER  475

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            EENL+KAFQ+FDKD+SGFITR ELETAMKE+ + D A IKEII EVDAD+DG INY+EFC
Sbjct  476  EENLFKAFQHFDKDNSGFITRQELETAMKEYNMGDDAMIKEIILEVDADNDGSINYQEFC  535

Query  321  TMMRSGTK-QQPKL  283
             MM+S ++ +Q KL
Sbjct  536  NMMKSCSQSRQSKL  549



>ref|XP_006301218.1| hypothetical protein CARUB_v10021616mg [Capsella rubella]
 gb|EOA34116.1| hypothetical protein CARUB_v10021616mg [Capsella rubella]
Length=547

 Score =   200 bits (509),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 94/128 (73%), Positives = 114/128 (89%), Gaps = 0/128 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GL +LG+ LTE EVKQL+E ADVDGNG+IDYIEFI+ATM+++R+ER
Sbjct  410  TDKSGTITYEELKSGLEKLGSRLTETEVKQLLEDADVDGNGTIDYIEFISATMNRYRVER  469

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            EENL+KAFQ+FDKD+SGFI+R ELETAMKE+ + D A IKEIISEVDAD+DG INY+EFC
Sbjct  470  EENLFKAFQHFDKDNSGFISRLELETAMKEYNMGDDAMIKEIISEVDADNDGSINYQEFC  529

Query  321  TMMRSGTK  298
             MM+S ++
Sbjct  530  NMMKSCSQ  537



>ref|XP_010467929.1| PREDICTED: calcium-dependent protein kinase 21-like [Camelina 
sativa]
Length=873

 Score =   203 bits (517),  Expect = 9e-57, Method: Composition-based stats.
 Identities = 96/135 (71%), Positives = 120/135 (89%), Gaps = 1/135 (1%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GL +LG+ L+E EVKQLMEAADVDGNG+IDY EFI+ATMH+++L+R
Sbjct  736  TDKSGTITYEELKTGLTRLGSRLSETEVKQLMEAADVDGNGTIDYYEFISATMHRYKLDR  795

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E++YKAFQ+FDKD+SG ITRDELE+AMKE+G+ D A+I+E+ISEVD D+DG+IN+EEFC
Sbjct  796  DEHVYKAFQHFDKDNSGHITRDELESAMKEYGMGDEASIREVISEVDTDNDGKINFEEFC  855

Query  321  TMMRSGTKQ-QPKLF  280
             MMRSG+ Q Q KL 
Sbjct  856  AMMRSGSTQPQGKLL  870



>ref|XP_002306955.1| hypothetical protein POPTR_0005s26640g [Populus trichocarpa]
 gb|EEE93951.1| hypothetical protein POPTR_0005s26640g [Populus trichocarpa]
Length=513

 Score =   199 bits (505),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GL +LG+ LTE E+KQLM+ ADVD NG+IDY+EFITATMH+HRLE+
Sbjct  389  TDRSGTITYEELKSGLLRLGSKLTEVEIKQLMDGADVDNNGTIDYVEFITATMHRHRLEK  448

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            EENLYKAFQYFDKD+SGFITRDEL  AM ++G+ D ATI E+I +VD D DG INYEEF 
Sbjct  449  EENLYKAFQYFDKDNSGFITRDELRQAMSQYGMGDEATIDEVIEDVDTDKDGNINYEEFA  508

Query  321  TMMR  310
            TMMR
Sbjct  509  TMMR  512



>ref|XP_002874810.1| hypothetical protein ARALYDRAFT_490109 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51069.1| hypothetical protein ARALYDRAFT_490109 [Arabidopsis lyrata subsp. 
lyrata]
Length=495

 Score =   198 bits (504),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 117/135 (87%), Gaps = 1/135 (1%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD +G+ITYEELK GL + G+ L+E EV+QLMEAADVDGNG+IDYIEFI+ATM +HRLER
Sbjct  358  TDKNGSITYEELKTGLNRHGSKLSETEVRQLMEAADVDGNGTIDYIEFISATMQRHRLER  417

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+L+KAFQ+FDKD+SG+IT+DELE AMKEHG+ D A  KEIISEVD ++DG+I+YEEFC
Sbjct  418  DEHLHKAFQHFDKDNSGYITKDELEIAMKEHGMGDEANAKEIISEVDKNNDGKIDYEEFC  477

Query  321  TMMRSGTKQ-QPKLF  280
            TMMR+G  Q Q KL 
Sbjct  478  TMMRNGNLQPQGKLL  492



>gb|KFK40633.1| hypothetical protein AALP_AA2G022000 [Arabis alpina]
Length=551

 Score =   199 bits (507),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/134 (72%), Positives = 117/134 (87%), Gaps = 1/134 (1%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITY+ELK GL +LG+ LTE EVKQL+E ADVDGNG+IDYIEFI+ATM+++R+ER
Sbjct  417  TDKSGTITYDELKTGLEKLGSRLTETEVKQLLEDADVDGNGTIDYIEFISATMNRYRVER  476

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            E+NL+KAFQ+FDKD+SGFITR ELETAMKE+ + D A I+EIISEVDAD+DG INY+EFC
Sbjct  477  EDNLFKAFQHFDKDNSGFITRQELETAMKEYNMGDDAMIREIISEVDADNDGSINYQEFC  536

Query  321  TMMRSGTK-QQPKL  283
             MM+S +K  Q KL
Sbjct  537  NMMKSCSKSHQSKL  550



>gb|KHN16773.1| Calcium-dependent protein kinase 3 [Glycine soja]
Length=249

 Score =   192 bits (487),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 110/128 (86%), Gaps = 0/128 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTIT+EELK GL +LG+ L+E+EV+QLMEAAD+DGNG+IDYIEFITATMH +R+ER
Sbjct  111  TDNSGTITFEELKAGLPKLGSKLSESEVRQLMEAADIDGNGTIDYIEFITATMHMNRMER  170

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            E+ LYKAF+YFD D SG+IT +ELE+A+K++ + D  TIKEII+EVD+D+DGRINY+EF 
Sbjct  171  EDRLYKAFEYFDNDKSGYITMEELESALKKYNMGDEKTIKEIIAEVDSDNDGRINYDEFV  230

Query  321  TMMRSGTK  298
             MMR G  
Sbjct  231  AMMRKGNP  238



>ref|XP_010675716.1| PREDICTED: calcium-dependent protein kinase 33-like [Beta vulgaris 
subsp. vulgaris]
Length=536

 Score =   199 bits (506),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 98/136 (72%), Positives = 116/136 (85%), Gaps = 3/136 (2%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SG+ITYEELK+GLA+LG+ L+E EVK LM+AAD DG+GSIDYIEFIT TMH++RLER
Sbjct  402  TDGSGSITYEELKEGLARLGSKLSETEVKALMDAADQDGSGSIDYIEFITVTMHRYRLER  461

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            ++ LYKAFQYFDKD+SGFIT DELE AM+E+GIAD   IK+I+ EVD D+DGRIN+EEF 
Sbjct  462  DDQLYKAFQYFDKDNSGFITTDELEAAMREYGIADENCIKDILMEVDTDNDGRINFEEFV  521

Query  321  TMMRSGTKQQP--KLF  280
             MMRSGT Q P  KLF
Sbjct  522  AMMRSGT-QNPGAKLF  536



>ref|XP_011003085.1| PREDICTED: calcium-dependent protein kinase 29-like isoform X2 
[Populus euphratica]
Length=523

 Score =   199 bits (505),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GL++LG+ LTE E+KQLM+ ADVD +G+IDY+EFITATMH+HRLE+
Sbjct  397  TDRSGTITYEELKSGLSRLGSKLTEVEIKQLMDGADVDNSGTIDYVEFITATMHRHRLEK  456

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            EENLYKAFQYFDKD++G+ITRDEL  AM ++G+ D ATI E+I +VD D DG INYEEF 
Sbjct  457  EENLYKAFQYFDKDNNGYITRDELRQAMSQYGMGDEATIDEVIKDVDTDKDGNINYEEFA  516

Query  321  TMMRSGT  301
            TMMR G+
Sbjct  517  TMMRKGS  523



>ref|XP_009114553.1| PREDICTED: calcium-dependent protein kinase 22 [Brassica rapa]
Length=480

 Score =   198 bits (503),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 112/129 (87%), Gaps = 0/129 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SG+ITYEELK GL +LG+ L EAEVKQLMEAADVDGNG+IDYIEFI+ATM +HRLER
Sbjct  346  TDKSGSITYEELKTGLNRLGSKLPEAEVKQLMEAADVDGNGTIDYIEFISATMQRHRLER  405

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+L+KAF +FDKD+SG+IT+DELE AMKEHG+ D A  KEIISE+D ++DG+I+YEEFC
Sbjct  406  DEHLHKAFLHFDKDNSGYITKDELEIAMKEHGMGDEACAKEIISEIDKNNDGKIDYEEFC  465

Query  321  TMMRSGTKQ  295
             MMRS   Q
Sbjct  466  AMMRSVNLQ  474



>ref|XP_004238385.1| PREDICTED: calcium-dependent protein kinase 29 [Solanum lycopersicum]
Length=521

 Score =   199 bits (505),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/127 (73%), Positives = 111/127 (87%), Gaps = 0/127 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GL++LG+ LTE+E+KQLM+AADVD +G+IDYIEFITATMH+H+LER
Sbjct  388  TDGSGTITYEELKTGLSRLGSKLTESEIKQLMDAADVDNSGTIDYIEFITATMHRHKLER  447

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            EENLYKAFQ+FDKDSSGFITRDEL  AM+E+G+ D ATI EI+ +VD + DG INY+EF 
Sbjct  448  EENLYKAFQFFDKDSSGFITRDELRHAMEEYGMGDEATIDEILDDVDTNKDGLINYDEFV  507

Query  321  TMMRSGT  301
             MMR GT
Sbjct  508  AMMRRGT  514



>gb|KHG01345.1| Calcium-dependent protein kinase 29 [Gossypium arboreum]
Length=298

 Score =   192 bits (488),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 88/128 (69%), Positives = 108/128 (84%), Gaps = 0/128 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTIT EEL+ GLA+LG+ LTE E+KQLM+AADVD +G+IDYIEF+TATMH+HRL+R
Sbjct  166  TDGSGTITLEELRDGLARLGSKLTEPEIKQLMDAADVDKSGTIDYIEFVTATMHRHRLDR  225

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            E+N+ KAF YFDKDS+GFITRDEL  AM ++G+ D ATI E+I +VD D DGRINYEEF 
Sbjct  226  EDNIRKAFNYFDKDSNGFITRDELRQAMTQYGMGDEATIDEVIEDVDTDKDGRINYEEFV  285

Query  321  TMMRSGTK  298
             MM+ GT+
Sbjct  286  AMMKRGTQ  293



>ref|XP_006396673.1| hypothetical protein EUTSA_v10028617mg [Eutrema salsugineum]
 gb|ESQ38126.1| hypothetical protein EUTSA_v10028617mg [Eutrema salsugineum]
Length=485

 Score =   197 bits (500),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 112/130 (86%), Gaps = 0/130 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD +G+ITYEELK GL +LG+ L+EAEVK+LMEAADVD NG+IDYIEFI+ATMH+HRLER
Sbjct  349  TDKNGSITYEELKTGLHRLGSKLSEAEVKELMEAADVDRNGTIDYIEFISATMHRHRLER  408

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            +E+L+KAF YFDKD SG IT++ELE AMKEHG+ D A  KEIISEVD D+DGRI+Y EFC
Sbjct  409  DEHLHKAFLYFDKDGSGHITKEELEIAMKEHGMGDEACAKEIISEVDKDNDGRIDYAEFC  468

Query  321  TMMRSGTKQQ  292
            +MMR+G  Q 
Sbjct  469  SMMRNGNLQP  478



>ref|XP_006342079.1| PREDICTED: calcium-dependent protein kinase 29-like [Solanum 
tuberosum]
Length=540

 Score =   197 bits (502),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 92/127 (72%), Positives = 111/127 (87%), Gaps = 0/127 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITY+ELK GL++LG+ L+E+E+KQLM+AADVD +G+IDYIEFITATMH+H+LER
Sbjct  407  TDGSGTITYDELKTGLSRLGSKLSESEIKQLMDAADVDNSGTIDYIEFITATMHRHKLER  466

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            EENLYKAFQ+FDKDSSGFITRDEL  AM+E+G+ D ATI EI+ +VD + DG INYEEF 
Sbjct  467  EENLYKAFQFFDKDSSGFITRDELRHAMEEYGMGDEATIDEILDDVDTNKDGLINYEEFA  526

Query  321  TMMRSGT  301
             MMR GT
Sbjct  527  AMMRRGT  533



>emb|CBI34415.3| unnamed protein product [Vitis vinifera]
Length=399

 Score =   194 bits (492),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 108/128 (84%), Gaps = 0/128 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GL +LG  L+E+EV+QLMEAADVDGNG+IDYIEFI+ATMH +R+ER
Sbjct  263  TDNSGTITYEELKNGLPKLGTKLSESEVRQLMEAADVDGNGTIDYIEFISATMHMNRMER  322

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            E++LY+AF+YFDKD SG+IT +ELE A+K + + D  TIKEII+EVD DHDGRINYEEF 
Sbjct  323  EDHLYRAFEYFDKDKSGYITMEELEHALKRYNMGDEKTIKEIIAEVDTDHDGRINYEEFA  382

Query  321  TMMRSGTK  298
             MMR G  
Sbjct  383  AMMRKGNP  390



>sp|Q9ZSA3.2|CDPKM_ARATH RecName: Full=Calcium-dependent protein kinase 22 [Arabidopsis 
thaliana]
Length=498

 Score =   196 bits (497),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = -3

Query  678  DTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLERE  499
            D SG+ITYEELK GL + G+ L+E EVKQLMEAADVDGNG+IDYIEFI+ATMH+HRLER+
Sbjct  361  DKSGSITYEELKMGLNRHGSKLSETEVKQLMEAADVDGNGTIDYIEFISATMHRHRLERD  420

Query  498  ENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFCT  319
            E+LYKAFQYFDKD SG IT++E+E AMKEHG+ D A  K++ISE D ++DG+I+YEEFCT
Sbjct  421  EHLYKAFQYFDKDGSGHITKEEVEIAMKEHGMGDEANAKDLISEFDKNNDGKIDYEEFCT  480

Query  318  MMRSGTKQQ  292
            MMR+G  Q 
Sbjct  481  MMRNGILQP  489



>gb|KHN35055.1| Calcium-dependent protein kinase 3 [Glycine soja]
Length=373

 Score =   192 bits (489),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 111/128 (87%), Gaps = 0/128 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTIT+EELK GL +LG  ++E+EV+QLMEAADVDGNG+IDYIEFITATMH +R+ER
Sbjct  237  TDNSGTITFEELKAGLPKLGTKVSESEVRQLMEAADVDGNGTIDYIEFITATMHMNRMER  296

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            E++LYKAF+YFDKD SG+IT +ELE+A+K++ + D  TIKEII+EVDAD+DGRINY+EF 
Sbjct  297  EDHLYKAFEYFDKDRSGYITVEELESALKKYNMGDEKTIKEIIAEVDADNDGRINYDEFV  356

Query  321  TMMRSGTK  298
             MMR G  
Sbjct  357  AMMRKGNP  364



>ref|XP_007017899.1| Calcium-dependent protein kinase 29 [Theobroma cacao]
 gb|EOY15124.1| Calcium-dependent protein kinase 29 [Theobroma cacao]
Length=516

 Score =   195 bits (496),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 92/128 (72%), Positives = 110/128 (86%), Gaps = 0/128 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTIT EEL+ GLA+LG+ LTEAE++QLM+AADVD +GSIDYIEFITATM +HRLER
Sbjct  385  TDGSGTITIEELRVGLARLGSKLTEAEIQQLMDAADVDRSGSIDYIEFITATMPRHRLER  444

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            E+N+YKAFQ+FDKD+SGFITRDEL  AM E+G+ D ATI E+I +VD D DGRINYEEF 
Sbjct  445  EDNIYKAFQFFDKDNSGFITRDELRQAMTEYGMGDEATIDEVIEDVDTDKDGRINYEEFV  504

Query  321  TMMRSGTK  298
             MM+ GT+
Sbjct  505  AMMKRGTQ  512



>ref|XP_010430219.1| PREDICTED: calcium-dependent protein kinase 19 [Camelina sativa]
Length=482

 Score =   194 bits (494),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITY+ELK GL +LG+ LTE EVKQL+E ADVDGNG+IDYIEFI+ATM++ R+ER
Sbjct  343  TDKSGTITYDELKSGLEKLGSRLTETEVKQLLEDADVDGNGTIDYIEFISATMNRFRVER  402

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            EENL+KAFQ+FDKD+SGFI+R ELETAMKE+ + D A IKEIISEVDAD+DG INY+EFC
Sbjct  403  EENLFKAFQHFDKDNSGFISRHELETAMKEYNMGDDAMIKEIISEVDADNDGSINYQEFC  462

Query  321  TMM  313
             MM
Sbjct  463  NMM  465



>ref|XP_006439443.1| hypothetical protein CICLE_v10019724mg [Citrus clementina]
 gb|ESR52683.1| hypothetical protein CICLE_v10019724mg [Citrus clementina]
Length=520

 Score =   195 bits (496),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 92/128 (72%), Positives = 111/128 (87%), Gaps = 0/128 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTIT+EELK GL +LG  L+E+EV+QLMEAADVDGNG+IDYIEFITATMH +R+ER
Sbjct  384  TDNSGTITFEELKAGLPKLGTRLSESEVRQLMEAADVDGNGTIDYIEFITATMHMNRVER  443

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            EE+LYKAF+YFDKD+SG+IT +ELE A+K++ + DA TIKEII+EVD D+DGRINYEEF 
Sbjct  444  EEHLYKAFEYFDKDNSGYITMEELEHALKKYNMGDAKTIKEIIAEVDIDNDGRINYEEFA  503

Query  321  TMMRSGTK  298
             MMR G  
Sbjct  504  AMMRKGNP  511



>gb|KDO76376.1| hypothetical protein CISIN_1g010013mg [Citrus sinensis]
Length=520

 Score =   195 bits (496),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 92/128 (72%), Positives = 111/128 (87%), Gaps = 0/128 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTIT+EELK GL +LG  L+E+EV+QLMEAADVDGNG+IDYIEFITATMH +R+ER
Sbjct  384  TDNSGTITFEELKAGLPKLGTRLSESEVRQLMEAADVDGNGTIDYIEFITATMHMNRVER  443

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            EE+LYKAF+YFDKD+SG+IT +ELE A+K++ + DA TIKEII+EVD D+DGRINYEEF 
Sbjct  444  EEHLYKAFEYFDKDNSGYITMEELEHALKKYNMGDAKTIKEIIAEVDIDNDGRINYEEFA  503

Query  321  TMMRSGTK  298
             MMR G  
Sbjct  504  AMMRKGNP  511



>ref|XP_006476469.1| PREDICTED: calcium-dependent protein kinase 3-like [Citrus sinensis]
Length=520

 Score =   195 bits (496),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 92/128 (72%), Positives = 111/128 (87%), Gaps = 0/128 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTIT+EELK GL +LG  L+E+EV+QLMEAADVDGNG+IDYIEFITATMH +R+ER
Sbjct  384  TDNSGTITFEELKAGLPKLGTRLSESEVRQLMEAADVDGNGTIDYIEFITATMHMNRVER  443

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            EE+LYKAF+YFDKD+SG+IT +ELE A+K++ + DA TIKEII+EVD D+DGRINYEEF 
Sbjct  444  EEHLYKAFEYFDKDNSGYITMEELEHALKKYNMGDAKTIKEIIAEVDIDNDGRINYEEFA  503

Query  321  TMMRSGTK  298
             MMR G  
Sbjct  504  AMMRKGNP  511



>gb|EYU17566.1| hypothetical protein MIMGU_mgv1a004597mg [Erythranthe guttata]
Length=518

 Score =   195 bits (495),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 110/127 (87%), Gaps = 0/127 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEEL+ GL++LG+ L+E+E++QLMEAADVD NG+IDYIEFITATMH+HRL++
Sbjct  382  TDGSGTITYEELRTGLSKLGSKLSESEIQQLMEAADVDKNGTIDYIEFITATMHRHRLDK  441

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            EENLYKAFQYFDKD+SGFITRDEL  AM ++GI D  TI E++ +VD D DGRINY+EF 
Sbjct  442  EENLYKAFQYFDKDNSGFITRDELRQAMTQYGIGDEETIDEVLDDVDIDKDGRINYDEFK  501

Query  321  TMMRSGT  301
             MM+ GT
Sbjct  502  AMMKKGT  508



>gb|AAC28510.1| Similar to gb|AF072908 calcium-dependent protein kinase from 
Nicotiana tabacum [Arabidopsis thaliana]
Length=553

 Score =   196 bits (497),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 112/128 (88%), Gaps = 0/128 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITY+ELK GL +LG+ LTE EVKQL+E ADVDGNG+IDYIEFI+ATM++ R+ER
Sbjct  416  TDKSGTITYDELKSGLEKLGSRLTETEVKQLLEDADVDGNGTIDYIEFISATMNRFRVER  475

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            E+NL+KAFQ+FDKD+SGFI+R ELETAMKE+ + D   IKEIISEVDAD+DG INY+EFC
Sbjct  476  EDNLFKAFQHFDKDNSGFISRQELETAMKEYNMGDDIMIKEIISEVDADNDGSINYQEFC  535

Query  321  TMMRSGTK  298
             MM+S ++
Sbjct  536  NMMKSCSQ  543



>ref|NP_176386.2| calcium-dependent protein kinase 19 [Arabidopsis thaliana]
 sp|Q1PFH8.1|CDPKJ_ARATH RecName: Full=Calcium-dependent protein kinase 19 [Arabidopsis 
thaliana]
 gb|ABE65733.1| calcium-dependent protein kinase/CDPK [Arabidopsis thaliana]
 gb|AEE33906.1| calcium-dependent protein kinase 19 [Arabidopsis thaliana]
Length=551

 Score =   196 bits (497),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 112/128 (88%), Gaps = 0/128 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITY+ELK GL +LG+ LTE EVKQL+E ADVDGNG+IDYIEFI+ATM++ R+ER
Sbjct  414  TDKSGTITYDELKSGLEKLGSRLTETEVKQLLEDADVDGNGTIDYIEFISATMNRFRVER  473

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            E+NL+KAFQ+FDKD+SGFI+R ELETAMKE+ + D   IKEIISEVDAD+DG INY+EFC
Sbjct  474  EDNLFKAFQHFDKDNSGFISRQELETAMKEYNMGDDIMIKEIISEVDADNDGSINYQEFC  533

Query  321  TMMRSGTK  298
             MM+S ++
Sbjct  534  NMMKSCSQ  541



>emb|CAN61364.1| hypothetical protein VITISV_032639 [Vitis vinifera]
Length=482

 Score =   194 bits (493),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 108/128 (84%), Gaps = 0/128 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GL +LG  L+E+EV+QLMEAADVDGNG+IDYIEFI+ATMH +R+ER
Sbjct  346  TDNSGTITYEELKNGLPKLGTKLSESEVRQLMEAADVDGNGTIDYIEFISATMHMNRMER  405

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            E++LY+AF+YFDKD SG+IT +ELE A+K + + D  TIKEII+EVD DHDGRINYEEF 
Sbjct  406  EDHLYRAFEYFDKDKSGYITMEELEHALKRYNMGDEKTIKEIIAEVDTDHDGRINYEEFA  465

Query  321  TMMRSGTK  298
             MMR G  
Sbjct  466  AMMRKGNP  473



>ref|XP_010251583.1| PREDICTED: calcium-dependent protein kinase 3-like [Nelumbo nucifera]
Length=522

 Score =   195 bits (495),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 110/129 (85%), Gaps = 0/129 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTIT+EELK GL +LG  ++E+EVKQLMEAADVDGNG+IDYIEFITATMH +R+E+
Sbjct  386  TDNSGTITFEELKVGLPKLGTKVSESEVKQLMEAADVDGNGTIDYIEFITATMHMNRMEK  445

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            EE+LYKAF+YFDKD SG+IT +ELE A+K++ + D  TIKEII+EVD DHDGRINY+EF 
Sbjct  446  EEHLYKAFEYFDKDKSGYITMEELEQALKKYNMGDTKTIKEIIAEVDTDHDGRINYDEFV  505

Query  321  TMMRSGTKQ  295
             MMR G  +
Sbjct  506  AMMRKGNPE  514



>ref|XP_009798869.1| PREDICTED: calcium-dependent protein kinase 29 [Nicotiana sylvestris]
Length=549

 Score =   195 bits (496),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 108/126 (86%), Gaps = 0/126 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GL++LG+ LTE E+KQLM+AADVD +G+IDYIEFITATMH+H+LER
Sbjct  412  TDGSGTITYEELKTGLSRLGSKLTETEIKQLMDAADVDNSGTIDYIEFITATMHRHKLER  471

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            EENLYKAFQ+FDKD+SGFITRDEL  AM E+G+ D ATI EI+ +VD + DG INYEEF 
Sbjct  472  EENLYKAFQFFDKDNSGFITRDELRHAMSEYGMGDEATIDEILDDVDTNKDGLINYEEFV  531

Query  321  TMMRSG  304
             MMR G
Sbjct  532  AMMRRG  537



>sp|Q8RWL2.2|CDPKT_ARATH RecName: Full=Calcium-dependent protein kinase 29 [Arabidopsis 
thaliana]
Length=534

 Score =   195 bits (495),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 92/135 (68%), Positives = 114/135 (84%), Gaps = 1/135 (1%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTIT++EL+ GL +LG+ LTE+E+KQLMEAADVD +G+IDYIEF+TATMH+HRLE+
Sbjct  399  TDESGTITFDELRNGLHRLGSKLTESEIKQLMEAADVDKSGTIDYIEFVTATMHRHRLEK  458

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            EENL +AF+YFDKD SGFITRDEL+ +M E+G+ D ATI E+I++VD D+DGRINYEEF 
Sbjct  459  EENLIEAFKYFDKDRSGFITRDELKHSMTEYGMGDDATIDEVINDVDTDNDGRINYEEFV  518

Query  321  TMMRSGTK-QQPKLF  280
             MMR GT    PKL 
Sbjct  519  AMMRKGTTDSDPKLI  533



>ref|XP_007017897.1| Calcium-dependent protein kinase 29 [Theobroma cacao]
 gb|EOY15122.1| Calcium-dependent protein kinase 29 [Theobroma cacao]
Length=527

 Score =   194 bits (494),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 92/128 (72%), Positives = 108/128 (84%), Gaps = 0/128 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTIT EEL+ GLA+LG+ LTEAE +QLM+AADVD NG +DYIEFITATMH+H LER
Sbjct  393  TDGSGTITLEELRVGLARLGSKLTEAETQQLMDAADVDKNGIVDYIEFITATMHRHWLER  452

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            E+N+YKAFQ+FDKD+SGFITRDEL  AM E+G+ D ATI E+I +VD D DGRINYEEF 
Sbjct  453  EDNIYKAFQFFDKDNSGFITRDELRHAMTEYGMGDEATIDEVIEDVDIDKDGRINYEEFV  512

Query  321  TMMRSGTK  298
             MMR GT+
Sbjct  513  AMMRRGTQ  520



>ref|XP_002298000.1| calcium-dependent protein kinase 1 [Populus trichocarpa]
 gb|EEE82805.1| calcium-dependent protein kinase 1 [Populus trichocarpa]
Length=515

 Score =   194 bits (493),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 110/129 (85%), Gaps = 0/129 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD +GTIT+EELK GL +LG  L+E+EV+QLMEAADVDGNG+IDYIEFITATMH +R+ER
Sbjct  379  TDNNGTITFEELKAGLPKLGTKLSESEVRQLMEAADVDGNGTIDYIEFITATMHMNRMER  438

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            E++LYKAF+YFDKD SG+IT +ELE A+ ++ + D+ TIKEII+EVD DHDGRINYEEF 
Sbjct  439  EDHLYKAFEYFDKDKSGYITMEELEQALMKYNMGDSKTIKEIIAEVDTDHDGRINYEEFV  498

Query  321  TMMRSGTKQ  295
             MMR G  +
Sbjct  499  AMMRKGNPE  507



>ref|XP_011026960.1| PREDICTED: calcium-dependent protein kinase 3 [Populus euphratica]
Length=515

 Score =   194 bits (493),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 110/129 (85%), Gaps = 0/129 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD +GTIT+EELK GL +LG  L+E+EV+QLMEAADVDGNG+IDYIEFITATMH +R+ER
Sbjct  379  TDNNGTITFEELKAGLPKLGTKLSESEVRQLMEAADVDGNGTIDYIEFITATMHMNRMER  438

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            E++LYKAF+YFDKD SG+IT +ELE A+ ++ + D+ TIKEII+EVD DHDGRINYEEF 
Sbjct  439  EDHLYKAFEYFDKDKSGYITMEELEQALMKYNMGDSKTIKEIIAEVDTDHDGRINYEEFV  498

Query  321  TMMRSGTKQ  295
             MMR G  +
Sbjct  499  AMMRKGNPE  507



>emb|CDY16652.1| BnaA09g20300D [Brassica napus]
Length=471

 Score =   193 bits (490),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 94/134 (70%), Positives = 112/134 (84%), Gaps = 5/134 (4%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SG+ITYEELK GL +LG+ L EAEVKQLMEAADVDGNG+IDYIEFITATM +HRLER
Sbjct  332  TDKSGSITYEELKTGLNRLGSKLPEAEVKQLMEAADVDGNGTIDYIEFITATMQRHRLER  391

Query  501  EENLYKAFQYFDKDSSG-----FITRDELETAMKEHGIADAATIKEIISEVDADHDGRIN  337
            +E+L+KAF +FDKD+SG     +IT+DELE AMKEHG+ D A  KEIISE+D ++DG+I+
Sbjct  392  DEHLHKAFLHFDKDNSGQRDKIYITKDELEIAMKEHGMGDEACAKEIISEIDKNYDGKID  451

Query  336  YEEFCTMMRSGTKQ  295
            YEEFC MMRS   Q
Sbjct  452  YEEFCAMMRSVNLQ  465



>ref|XP_010055801.1| PREDICTED: calcium-dependent protein kinase 3 [Eucalyptus grandis]
 gb|KCW72352.1| hypothetical protein EUGRSUZ_E00806 [Eucalyptus grandis]
Length=539

 Score =   194 bits (494),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 109/128 (85%), Gaps = 0/128 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GL +LG  L+E+EVKQLMEAADVDGNG+IDY+EFITATMH +R+ER
Sbjct  398  TDNSGTITYEELKAGLPKLGTKLSESEVKQLMEAADVDGNGTIDYLEFITATMHLNRVER  457

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            E++LYKAF+YFDKD SG+IT +ELE A+K++ + D  TIKEII+EVD DHDGRINY+EF 
Sbjct  458  EDHLYKAFEYFDKDKSGYITMEELEHALKKYNMGDEKTIKEIIAEVDTDHDGRINYDEFV  517

Query  321  TMMRSGTK  298
             MMR G  
Sbjct  518  AMMRKGNP  525



>ref|XP_011073451.1| PREDICTED: calcium-dependent protein kinase 3-like [Sesamum indicum]
Length=517

 Score =   194 bits (492),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 110/128 (86%), Gaps = 0/128 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTIT+EELK GL +LG  L+E+EV+QLMEAADVDGNG+IDYIEFITATMH +R+ER
Sbjct  381  TDNSGTITFEELKAGLPKLGTRLSESEVRQLMEAADVDGNGTIDYIEFITATMHMNRVER  440

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            E++LYKAF+YFDKD SG+IT +ELE A+KE+ + DA TIKEI++EVD DHDG+INY+EF 
Sbjct  441  EDHLYKAFEYFDKDKSGYITMEELEHALKEYNMGDAKTIKEILAEVDTDHDGKINYDEFV  500

Query  321  TMMRSGTK  298
             MMR G  
Sbjct  501  AMMRKGNP  508



>gb|AGS15000.1| calcium-dependent protein kinase 3 [Vitis amurensis]
Length=528

 Score =   194 bits (493),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 108/128 (84%), Gaps = 0/128 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GL +LG  L+E+EV+QLMEAADVDGNG+IDYIEFI+ATMH +R+ER
Sbjct  392  TDNSGTITYEELKNGLPKLGTKLSESEVRQLMEAADVDGNGTIDYIEFISATMHMNRMER  451

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            E++LY+AF+YFDKD SG+IT +ELE A+K + + D  TIKEII+EVD DHDGRINYEEF 
Sbjct  452  EDHLYRAFEYFDKDKSGYITMEELEHALKRYNMGDEKTIKEIIAEVDTDHDGRINYEEFA  511

Query  321  TMMRSGTK  298
             MMR G  
Sbjct  512  AMMRKGNP  519



>ref|XP_002272270.1| PREDICTED: calcium-dependent protein kinase 3 [Vitis vinifera]
 ref|XP_010658560.1| PREDICTED: calcium-dependent protein kinase 3 [Vitis vinifera]
Length=528

 Score =   194 bits (493),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 108/128 (84%), Gaps = 0/128 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTITYEELK GL +LG  L+E+EV+QLMEAADVDGNG+IDYIEFI+ATMH +R+ER
Sbjct  392  TDNSGTITYEELKNGLPKLGTKLSESEVRQLMEAADVDGNGTIDYIEFISATMHMNRMER  451

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            E++LY+AF+YFDKD SG+IT +ELE A+K + + D  TIKEII+EVD DHDGRINYEEF 
Sbjct  452  EDHLYRAFEYFDKDKSGYITMEELEHALKRYNMGDEKTIKEIIAEVDTDHDGRINYEEFA  511

Query  321  TMMRSGTK  298
             MMR G  
Sbjct  512  AMMRKGNP  519



>gb|KGN53365.1| hypothetical protein Csa_4G050200 [Cucumis sativus]
Length=527

 Score =   194 bits (493),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 112/129 (87%), Gaps = 0/129 (0%)
 Frame = -3

Query  681  TDTSGTITYEELKKGLAQLGANLTEAEVKQLMEAADVDGNGSIDYIEFITATMHKHRLER  502
            TD SGTIT+EELK GL +LG  L+E+EV+QLMEAADVDGNGSIDYIEFITATMH +R+ER
Sbjct  391  TDNSGTITFEELKAGLPKLGTKLSESEVRQLMEAADVDGNGSIDYIEFITATMHMNRVER  450

Query  501  EENLYKAFQYFDKDSSGFITRDELETAMKEHGIADAATIKEIISEVDADHDGRINYEEFC  322
            E++L+KAF+YFDKD SG+IT +ELETA+K++ + D  TIKEII+EVD D+DGRINY+EF 
Sbjct  451  EDHLFKAFEYFDKDKSGYITMEELETALKKYNMGDETTIKEIIAEVDTDNDGRINYDEFV  510

Query  321  TMMRSGTKQ  295
             MMR G ++
Sbjct  511  AMMRKGNQE  519



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1117974212060