BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF001H13

Length=695
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006878664.1|  hypothetical protein AMTR_s00011p00266820          201   1e-58   Amborella trichopoda
ref|XP_010244169.1|  PREDICTED: protein notum homolog                   199   1e-57   Nelumbo nucifera [Indian lotus]
emb|CDP15690.1|  unnamed protein product                                197   7e-57   Coffea canephora [robusta coffee]
gb|ACF05806.1|  PAE                                                     197   9e-57   Litchi chinensis [litchi]
ref|XP_010244170.1|  PREDICTED: uncharacterized protein LOC104588061    196   1e-56   Nelumbo nucifera [Indian lotus]
ref|XP_010644665.1|  PREDICTED: uncharacterized protein LOC100245856    195   3e-56   Vitis vinifera
ref|XP_006432879.1|  hypothetical protein CICLE_v100013711mg            186   5e-56   
gb|KEH20327.1|  pectinacetylesterase family protein                     192   3e-55   Medicago truncatula
ref|XP_003628995.1|  Notum-like protein                                 192   3e-55   
gb|KDO40415.1|  hypothetical protein CISIN_1g013734mg                   187   5e-55   Citrus sinensis [apfelsine]
gb|AET03471.2|  pectinacetylesterase family protein                     192   6e-55   Medicago truncatula
ref|XP_004244443.1|  PREDICTED: uncharacterized protein LOC101251798    191   7e-55   Solanum lycopersicum
ref|XP_010677538.1|  PREDICTED: protein notum homolog isoform X1        191   8e-55   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010677539.1|  PREDICTED: protein notum homolog isoform X2        191   9e-55   Beta vulgaris subsp. vulgaris [field beet]
gb|KDO40411.1|  hypothetical protein CISIN_1g013734mg                   187   1e-54   Citrus sinensis [apfelsine]
gb|KDO40412.1|  hypothetical protein CISIN_1g013734mg                   190   2e-54   Citrus sinensis [apfelsine]
gb|KCW72720.1|  hypothetical protein EUGRSUZ_E01169                     191   2e-54   Eucalyptus grandis [rose gum]
ref|XP_011073252.1|  PREDICTED: protein notum homolog isoform X2        191   2e-54   Sesamum indicum [beniseed]
gb|KDO40414.1|  hypothetical protein CISIN_1g013734mg                   188   2e-54   Citrus sinensis [apfelsine]
ref|XP_010056136.1|  PREDICTED: protein notum homolog                   190   3e-54   Eucalyptus grandis [rose gum]
ref|XP_011082149.1|  PREDICTED: protein notum homolog isoform X1        190   4e-54   
ref|XP_011082152.1|  PREDICTED: protein notum homolog isoform X2        189   4e-54   
ref|XP_010111521.1|  hypothetical protein L484_021346                   189   4e-54   
ref|XP_011073171.1|  PREDICTED: protein notum homolog isoform X1        190   6e-54   
gb|KCW72718.1|  hypothetical protein EUGRSUZ_E01169                     189   6e-54   Eucalyptus grandis [rose gum]
ref|XP_010056132.1|  PREDICTED: protein notum homolog isoform X3        190   6e-54   Eucalyptus grandis [rose gum]
ref|XP_010056131.1|  PREDICTED: protein notum homolog isoform X2        190   6e-54   Eucalyptus grandis [rose gum]
ref|XP_010056129.1|  PREDICTED: protein notum homolog isoform X1        190   7e-54   Eucalyptus grandis [rose gum]
ref|XP_004172255.1|  PREDICTED: protein notum homolog                   189   1e-53   
gb|AAP72959.1|  pectin acetylesterase                                   188   2e-53   Lactuca sativa [cultivated lettuce]
ref|XP_006471634.1|  PREDICTED: uncharacterized protein LOC102628021    188   2e-53   Citrus sinensis [apfelsine]
ref|XP_008451860.1|  PREDICTED: protein notum homolog isoform X1        188   2e-53   Cucumis melo [Oriental melon]
ref|XP_008451861.1|  PREDICTED: protein notum homolog isoform X2        187   3e-53   Cucumis melo [Oriental melon]
ref|XP_009627060.1|  PREDICTED: uncharacterized protein LOC104117690    187   4e-53   Nicotiana tomentosiformis
gb|KDO40410.1|  hypothetical protein CISIN_1g013734mg                   187   8e-53   Citrus sinensis [apfelsine]
ref|XP_009771151.1|  PREDICTED: uncharacterized protein LOC104221730    186   8e-53   Nicotiana sylvestris
ref|XP_004512351.1|  PREDICTED: protein notum homolog isoform X3        187   8e-53   Cicer arietinum [garbanzo]
ref|XP_004150551.1|  PREDICTED: protein notum homolog                   189   9e-53   
ref|XP_010325633.1|  PREDICTED: uncharacterized protein LOC101257...    186   1e-52   Solanum lycopersicum
ref|XP_010942978.1|  PREDICTED: uncharacterized protein LOC105060...    185   1e-52   Elaeis guineensis
gb|ACJ85294.1|  unknown                                                 186   1e-52   Medicago truncatula
ref|XP_010325632.1|  PREDICTED: protein notum homolog isoform X1        186   1e-52   Solanum lycopersicum
ref|XP_008808358.1|  PREDICTED: protein notum homolog                   186   1e-52   Phoenix dactylifera
ref|XP_004512349.1|  PREDICTED: protein notum homolog isoform X1        187   2e-52   
ref|XP_010942979.1|  PREDICTED: uncharacterized protein LOC105060...    184   2e-52   Elaeis guineensis
emb|CAA67728.1|  pectinacetylesterase precursor                         185   2e-52   Vigna radiata var. radiata [golden gram]
ref|XP_009794297.1|  PREDICTED: protein notum homolog                   185   3e-52   Nicotiana sylvestris
ref|XP_004509522.1|  PREDICTED: uncharacterized protein LOC101493...    185   4e-52   Cicer arietinum [garbanzo]
ref|XP_010942975.1|  PREDICTED: protein notum homolog isoform X1        184   6e-52   Elaeis guineensis
ref|XP_010266384.1|  PREDICTED: uncharacterized protein LOC104603...    184   6e-52   Nelumbo nucifera [Indian lotus]
ref|XP_010266381.1|  PREDICTED: uncharacterized protein LOC104603...    184   7e-52   Nelumbo nucifera [Indian lotus]
ref|XP_010266380.1|  PREDICTED: uncharacterized protein LOC104603...    184   1e-51   
ref|XP_006363875.1|  PREDICTED: protein notum homolog                   183   1e-51   Solanum tuberosum [potatoes]
ref|XP_010266383.1|  PREDICTED: uncharacterized protein LOC104603...    184   1e-51   Nelumbo nucifera [Indian lotus]
gb|AFK45147.1|  unknown                                                 183   1e-51   Lotus japonicus
gb|EYU29131.1|  hypothetical protein MIMGU_mgv1a007782mg                182   2e-51   Erythranthe guttata [common monkey flower]
ref|XP_008238011.1|  PREDICTED: protein notum homolog isoform X1        181   7e-51   Prunus mume [ume]
ref|XP_008238012.1|  PREDICTED: protein notum homolog isoform X2        181   7e-51   Prunus mume [ume]
gb|ACR35075.1|  unknown                                                 177   8e-51   Zea mays [maize]
ref|XP_010248193.1|  PREDICTED: uncharacterized protein LOC104591101    181   1e-50   
ref|XP_007209211.1|  hypothetical protein PRUPE_ppa006668mg             181   1e-50   Prunus persica
gb|KCW72723.1|  hypothetical protein EUGRSUZ_E01170                     180   2e-50   Eucalyptus grandis [rose gum]
ref|XP_006573492.1|  PREDICTED: protein notum homolog isoform X2        179   4e-50   
ref|XP_006587657.1|  PREDICTED: protein notum homolog isoform X3        179   6e-50   
ref|XP_006573491.1|  PREDICTED: protein notum homolog isoform X1        180   7e-50   Glycine max [soybeans]
gb|KHN41756.1|  Protein notum like                                      179   8e-50   Glycine soja [wild soybean]
ref|XP_006587655.1|  PREDICTED: protein notum homolog isoform X1        179   9e-50   Glycine max [soybeans]
ref|XP_006587656.1|  PREDICTED: protein notum homolog isoform X2        179   1e-49   Glycine max [soybeans]
ref|XP_008373439.1|  PREDICTED: protein notum homolog isoform X2        179   1e-49   Malus domestica [apple tree]
gb|EYU29130.1|  hypothetical protein MIMGU_mgv1a007782mg                178   1e-49   Erythranthe guttata [common monkey flower]
ref|XP_009616254.1|  PREDICTED: protein notum homolog                   178   1e-49   Nicotiana tomentosiformis
ref|XP_008373438.1|  PREDICTED: protein notum homolog isoform X1        179   2e-49   Malus domestica [apple tree]
ref|NP_001151183.1|  LOC100284816 precursor                             177   3e-49   Zea mays [maize]
gb|KHN41567.1|  Protein notum like                                      177   3e-49   Glycine soja [wild soybean]
gb|ACG39759.1|  carboxylic ester hydrolase                              177   3e-49   Zea mays [maize]
ref|XP_007156330.1|  hypothetical protein PHAVU_003G277500g             177   4e-49   Phaseolus vulgaris [French bean]
ref|XP_007156331.1|  hypothetical protein PHAVU_003G277500g             177   6e-49   Phaseolus vulgaris [French bean]
ref|XP_010056135.1|  PREDICTED: protein notum homolog                   175   1e-48   Eucalyptus grandis [rose gum]
gb|KCW72721.1|  hypothetical protein EUGRSUZ_E01170                     175   1e-48   Eucalyptus grandis [rose gum]
ref|XP_007158098.1|  hypothetical protein PHAVU_002G123900g             175   1e-48   Phaseolus vulgaris [French bean]
ref|XP_006599203.1|  PREDICTED: uncharacterized protein LOC100781...    175   2e-48   Glycine max [soybeans]
ref|XP_004953590.1|  PREDICTED: protein notum homolog isoform X1        173   9e-48   Setaria italica
ref|XP_006361581.1|  PREDICTED: protein notum homolog                   172   2e-47   Solanum tuberosum [potatoes]
gb|KCW72722.1|  hypothetical protein EUGRSUZ_E01170                     171   3e-47   Eucalyptus grandis [rose gum]
gb|EPS71696.1|  hypothetical protein M569_03061                         171   4e-47   Genlisea aurea
gb|AGT16732.1|  carboxylic ester hydrolase                              171   4e-47   Saccharum hybrid cultivar R570
gb|EYU37455.1|  hypothetical protein MIMGU_mgv1a007934mg                170   1e-46   Erythranthe guttata [common monkey flower]
ref|XP_002454426.1|  hypothetical protein SORBIDRAFT_04g030720          170   2e-46   Sorghum bicolor [broomcorn]
ref|XP_004300391.1|  PREDICTED: pectin acetylesterase 8-like            169   3e-46   Fragaria vesca subsp. vesca
ref|XP_009413211.1|  PREDICTED: protein notum homolog                   169   3e-46   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008246070.1|  PREDICTED: uncharacterized protein LOC103344226    162   5e-46   Prunus mume [ume]
ref|NP_001047850.1|  Os02g0702400                                       168   9e-46   
ref|XP_008808370.1|  PREDICTED: uncharacterized protein LOC103720...    167   1e-45   
ref|XP_003547731.1|  PREDICTED: protein notum homolog isoform X1        167   2e-45   Glycine max [soybeans]
gb|KHG23649.1|  Notum                                                   167   2e-45   Gossypium arboreum [tree cotton]
gb|KHG23648.1|  Notum                                                   167   2e-45   Gossypium arboreum [tree cotton]
gb|KHN27509.1|  Protein notum like                                      167   2e-45   Glycine soja [wild soybean]
gb|ABK24433.1|  unknown                                                 166   4e-45   Picea sitchensis
gb|ABK24994.1|  unknown                                                 166   4e-45   Picea sitchensis
ref|XP_002519911.1|  pectin acetylesterase, putative                    166   5e-45   
ref|XP_007040902.1|  Pectinacetylesterase family protein                166   6e-45   
ref|XP_006647750.1|  PREDICTED: uncharacterized protein LOC102707556    162   1e-44   
ref|XP_009398466.1|  PREDICTED: protein notum homolog                   164   2e-44   
gb|EEC73846.1|  hypothetical protein OsI_08601                          162   2e-44   Oryza sativa Indica Group [Indian rice]
ref|XP_010676220.1|  PREDICTED: uncharacterized protein LOC104892094    164   6e-44   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAD94548.1|  pectinacetylesterase like protein                      157   7e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008372432.1|  PREDICTED: uncharacterized protein LOC103435796    156   7e-44   
emb|CDY09288.1|  BnaC03g63180D                                          157   9e-44   Brassica napus [oilseed rape]
gb|KJB24941.1|  hypothetical protein B456_004G175900                    162   9e-44   Gossypium raimondii
gb|AFK37852.1|  unknown                                                 162   1e-43   Lotus japonicus
ref|XP_006385135.1|  hypothetical protein POPTR_0004s24220g             161   2e-43   
ref|XP_010054028.1|  PREDICTED: uncharacterized protein LOC104442...    162   2e-43   Eucalyptus grandis [rose gum]
dbj|BAH57249.1|  AT4G19420                                              157   2e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010054026.1|  PREDICTED: uncharacterized protein LOC104442...    162   3e-43   Eucalyptus grandis [rose gum]
ref|XP_006282674.1|  hypothetical protein CARUB_v10005284mg             159   4e-43   
ref|XP_007209217.1|  hypothetical protein PRUPE_ppa006718mg             160   6e-43   Prunus persica
ref|XP_006385137.1|  hypothetical protein POPTR_0004s24220g             160   6e-43   
ref|XP_006385138.1|  hypothetical protein POPTR_0004s24220g             160   6e-43   
ref|XP_010439718.1|  PREDICTED: protein notum homolog                   159   7e-43   Camelina sativa [gold-of-pleasure]
dbj|BAH20235.1|  AT4G19420                                              158   8e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011028483.1|  PREDICTED: uncharacterized protein LOC105128...    160   8e-43   Populus euphratica
ref|XP_006385134.1|  hypothetical protein POPTR_0004s24220g             160   8e-43   
ref|XP_010434420.1|  PREDICTED: protein notum homolog                   159   9e-43   Camelina sativa [gold-of-pleasure]
ref|XP_003547822.1|  PREDICTED: protein notum homolog                   160   1e-42   Glycine max [soybeans]
ref|XP_011028482.1|  PREDICTED: uncharacterized protein LOC105128...    161   1e-42   Populus euphratica
ref|XP_011028479.1|  PREDICTED: uncharacterized protein LOC105128...    161   1e-42   Populus euphratica
ref|XP_010449357.1|  PREDICTED: protein notum homolog                   158   1e-42   Camelina sativa [gold-of-pleasure]
ref|NP_193677.2|  putative pectinacetylesterase                         158   2e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002867938.1|  pectinacetylesterase family protein                158   2e-42   
ref|XP_006413980.1|  hypothetical protein EUTSA_v10025385mg             158   2e-42   
ref|XP_009108427.1|  PREDICTED: protein notum homolog                   159   2e-42   Brassica rapa
ref|XP_010529277.1|  PREDICTED: protein notum homolog                   156   2e-42   Tarenaya hassleriana [spider flower]
emb|CDY67801.1|  BnaAnng25210D                                          158   3e-42   Brassica napus [oilseed rape]
emb|CDX78933.1|  BnaA01g10000D                                          158   3e-42   
ref|XP_003548585.1|  PREDICTED: protein notum homolog                   158   3e-42   
gb|KHN27511.1|  Protein notum like                                      158   3e-42   Glycine soja [wild soybean]
emb|CDX99377.1|  BnaC01g11750D                                          158   3e-42   
ref|XP_006494119.1|  PREDICTED: protein notum homolog isoform X1        158   3e-42   
ref|NP_974575.2|  putative pectinacetylesterase                         157   4e-42   
emb|CDY09289.1|  BnaC03g63190D                                          158   4e-42   Brassica napus [oilseed rape]
ref|XP_007156332.1|  hypothetical protein PHAVU_003G277600g             158   4e-42   Phaseolus vulgaris [French bean]
gb|KDO56390.1|  hypothetical protein CISIN_1g026241mg                   154   4e-42   Citrus sinensis [apfelsine]
gb|EYU29129.1|  hypothetical protein MIMGU_mgv1a023759mg                157   5e-42   Erythranthe guttata [common monkey flower]
ref|XP_010235850.1|  PREDICTED: protein notum homolog isoform X1        156   5e-42   Brachypodium distachyon [annual false brome]
ref|XP_008378614.1|  PREDICTED: uncharacterized protein LOC103441693    157   7e-42   
ref|XP_010235852.1|  PREDICTED: protein notum homolog isoform X2        156   7e-42   Brachypodium distachyon [annual false brome]
ref|XP_009132797.1|  PREDICTED: protein notum homolog                   157   7e-42   Brassica rapa
ref|XP_006432880.1|  hypothetical protein CICLE_v10001467mg             157   8e-42   Citrus clementina [clementine]
ref|XP_010536220.1|  PREDICTED: protein notum homolog isoform X1        155   1e-41   Tarenaya hassleriana [spider flower]
ref|XP_009350399.1|  PREDICTED: protein notum homolog                   157   1e-41   Pyrus x bretschneideri [bai li]
gb|KDO40409.1|  hypothetical protein CISIN_1g016608mg                   156   1e-41   Citrus sinensis [apfelsine]
ref|XP_008355284.1|  PREDICTED: uncharacterized protein LOC103418943    157   1e-41   
ref|XP_003628996.1|  Carboxylic ester hydrolase                         155   1e-41   Medicago truncatula
ref|XP_010536228.1|  PREDICTED: protein notum homolog isoform X2        155   2e-41   Tarenaya hassleriana [spider flower]
ref|XP_008808368.1|  PREDICTED: uncharacterized protein LOC103720...    156   2e-41   
ref|XP_008808367.1|  PREDICTED: uncharacterized protein LOC103720...    156   2e-41   
ref|XP_003547821.1|  PREDICTED: protein notum homolog                   156   2e-41   Glycine max [soybeans]
ref|XP_006494125.1|  PREDICTED: uncharacterized protein LOC102621758    155   4e-41   
ref|XP_006432881.1|  hypothetical protein CICLE_v10001426mg             154   2e-40   Citrus clementina [clementine]
ref|XP_006423959.1|  hypothetical protein CICLE_v10028674mg             151   2e-40   
gb|EYU35369.1|  hypothetical protein MIMGU_mgv1a0197532mg               146   5e-40   Erythranthe guttata [common monkey flower]
ref|XP_006423958.1|  hypothetical protein CICLE_v10028674mg             151   1e-39   
ref|XP_006480336.1|  PREDICTED: protein notum homolog                   151   2e-39   Citrus sinensis [apfelsine]
ref|XP_003555771.1|  PREDICTED: uncharacterized protein LOC100793403    151   2e-39   Glycine max [soybeans]
gb|KHN13972.1|  hypothetical protein glysoja_043167                     149   3e-39   Glycine soja [wild soybean]
emb|CBI37039.3|  unnamed protein product                                149   4e-39   Vitis vinifera
ref|NP_974837.1|  pectinacetylesterase family protein                   148   4e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004509558.1|  PREDICTED: protein notum homolog                   149   5e-39   Cicer arietinum [garbanzo]
ref|XP_004300392.1|  PREDICTED: pectin acetylesterase 8-like            148   5e-39   Fragaria vesca subsp. vesca
emb|CDP15161.1|  unnamed protein product                                149   6e-39   Coffea canephora [robusta coffee]
gb|KJB81156.1|  hypothetical protein B456_013G131600                    149   6e-39   Gossypium raimondii
emb|CDX80575.1|  BnaC07g28690D                                          149   8e-39   
ref|XP_009151150.1|  PREDICTED: protein notum homolog                   149   8e-39   Brassica rapa
ref|XP_002280816.3|  PREDICTED: protein notum homolog                   149   1e-38   Vitis vinifera
gb|KJB81153.1|  hypothetical protein B456_013G131600                    149   1e-38   Gossypium raimondii
ref|XP_002318919.2|  hypothetical protein POPTR_0013s00280g             149   1e-38   
ref|XP_010327278.1|  PREDICTED: uncharacterized protein LOC101257...    145   1e-38   
gb|KDP28068.1|  hypothetical protein JCGZ_19476                         147   2e-38   Jatropha curcas
ref|XP_010942974.1|  PREDICTED: protein notum homolog                   148   2e-38   Elaeis guineensis
ref|XP_007031285.1|  Pectinacetylesterase family protein                149   2e-38   
gb|ACA61623.1|  hypothetical protein AP8_E07.1                          145   2e-38   Arabidopsis lyrata subsp. petraea
ref|XP_008246334.1|  PREDICTED: protein notum homolog isoform X2        148   2e-38   Prunus mume [ume]
ref|XP_008797988.1|  PREDICTED: protein notum homolog isoform X2        146   3e-38   
ref|XP_011023896.1|  PREDICTED: protein notum homolog                   148   3e-38   Populus euphratica
gb|AFK35535.1|  unknown                                                 148   3e-38   Lotus japonicus
gb|KHG26188.1|  Protein notum                                           148   3e-38   Gossypium arboreum [tree cotton]
gb|AAC13595.1|  similar to Vigna radiata pectinacetylesterase pre...    148   3e-38   Arabidopsis thaliana [mouse-ear cress]
ref|NP_850878.2|  pectinacetylesterase family protein                   148   4e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008347803.1|  PREDICTED: uncharacterized protein LOC103410929    147   4e-38   
dbj|BAH19826.1|  AT5G26670                                              148   4e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002519912.1|  pectin acetylesterase, putative                    144   6e-38   
emb|CBI39680.3|  unnamed protein product                                146   8e-38   Vitis vinifera
ref|XP_008797987.1|  PREDICTED: protein notum homolog isoform X1        146   8e-38   Phoenix dactylifera
ref|XP_008365263.1|  PREDICTED: protein notum homolog                   144   8e-38   
ref|XP_009129612.1|  PREDICTED: protein notum homolog                   146   1e-37   Brassica rapa
gb|AAF26093.1|AC012393_19  putative pectinacetylesterase                145   1e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003613922.1|  Notum-like protein                                 146   1e-37   Medicago truncatula
ref|XP_009111712.1|  PREDICTED: protein notum homolog                   146   1e-37   Brassica rapa
gb|KJB82697.1|  hypothetical protein B456_013G211000                    146   1e-37   Gossypium raimondii
emb|CDY19761.1|  BnaA09g04140D                                          146   1e-37   Brassica napus [oilseed rape]
emb|CDY27732.1|  BnaA05g31410D                                          146   2e-37   Brassica napus [oilseed rape]
ref|XP_002279030.1|  PREDICTED: protein notum homolog                   146   2e-37   Vitis vinifera
ref|XP_007040900.1|  Pectinacetylesterase family protein                144   2e-37   
emb|CAN62190.1|  hypothetical protein VITISV_020113                     146   2e-37   Vitis vinifera
emb|CDY49986.1|  BnaC03g34430D                                          150   2e-37   Brassica napus [oilseed rape]
gb|KJB82696.1|  hypothetical protein B456_013G211000                    145   2e-37   Gossypium raimondii
ref|XP_009610135.1|  PREDICTED: protein notum homolog                   146   2e-37   Nicotiana tomentosiformis
ref|XP_010524828.1|  PREDICTED: protein notum homolog                   146   2e-37   Tarenaya hassleriana [spider flower]
ref|XP_010094916.1|  hypothetical protein L484_022666                   145   2e-37   
ref|NP_566263.1|  pectinacetylesterase family protein                   145   2e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003536006.1|  PREDICTED: uncharacterized protein LOC100810716    145   2e-37   Glycine max [soybeans]
gb|KJB82695.1|  hypothetical protein B456_013G211000                    145   3e-37   Gossypium raimondii
ref|XP_010433795.1|  PREDICTED: protein notum homolog                   144   3e-37   
gb|ABG34280.1|  pectin acetylesterase                                   144   3e-37   Eucalyptus globulus subsp. globulus
ref|XP_002872227.1|  hypothetical protein ARALYDRAFT_489494             145   3e-37   
emb|CDY05211.1|  BnaC05g45920D                                          145   3e-37   
gb|ABK26312.1|  unknown                                                 145   3e-37   Picea sitchensis
ref|XP_004248530.1|  PREDICTED: protein notum homolog isoform X2        145   3e-37   Solanum lycopersicum
gb|KFK26428.1|  hypothetical protein AALP_AA8G247000                    145   4e-37   Arabis alpina [alpine rockcress]
ref|XP_006338905.1|  PREDICTED: protein notum homolog isoform X2        143   4e-37   Solanum tuberosum [potatoes]
ref|XP_010464149.1|  PREDICTED: protein notum homolog                   145   4e-37   Camelina sativa [gold-of-pleasure]
ref|XP_010327277.1|  PREDICTED: protein notum homolog isoform X1        145   4e-37   Solanum lycopersicum
ref|XP_010240825.1|  PREDICTED: protein notum homolog                   145   4e-37   Nelumbo nucifera [Indian lotus]
ref|XP_011039059.1|  PREDICTED: uncharacterized protein LOC105135...    142   6e-37   Populus euphratica
ref|XP_002884540.1|  hypothetical protein ARALYDRAFT_477888             144   6e-37   Arabidopsis lyrata subsp. lyrata
ref|XP_009779872.1|  PREDICTED: protein notum homolog                   145   6e-37   Nicotiana sylvestris
ref|XP_008363955.1|  PREDICTED: protein notum homolog                   144   6e-37   
gb|KCW58690.1|  hypothetical protein EUGRSUZ_H01338                     144   7e-37   Eucalyptus grandis [rose gum]
gb|ABR16604.1|  unknown                                                 144   7e-37   Picea sitchensis
ref|XP_009366012.1|  PREDICTED: protein notum homolog                   144   8e-37   
ref|XP_009600844.1|  PREDICTED: protein notum homolog                   142   1e-36   Nicotiana tomentosiformis
ref|XP_010911666.1|  PREDICTED: protein notum homolog                   143   1e-36   Elaeis guineensis
ref|XP_010070108.1|  PREDICTED: protein notum homolog                   144   1e-36   Eucalyptus grandis [rose gum]
ref|XP_010489689.1|  PREDICTED: protein notum homolog                   144   1e-36   
ref|XP_006408013.1|  hypothetical protein EUTSA_v10020818mg             143   1e-36   Eutrema salsugineum [saltwater cress]
ref|XP_009805042.1|  PREDICTED: protein notum homolog                   141   2e-36   Nicotiana sylvestris
ref|XP_006394896.1|  hypothetical protein EUTSA_v10004301mg             143   2e-36   Eutrema salsugineum [saltwater cress]
ref|XP_010042504.1|  PREDICTED: protein notum homolog isoform X2        141   2e-36   
ref|XP_006338904.1|  PREDICTED: protein notum homolog isoform X1        143   2e-36   Solanum tuberosum [potatoes]
emb|CDX74124.1|  BnaA03g29230D                                          143   2e-36   
ref|XP_009134857.1|  PREDICTED: protein notum homolog                   143   2e-36   Brassica rapa
ref|XP_008807933.1|  PREDICTED: protein notum homolog                   143   2e-36   Phoenix dactylifera
ref|XP_009397056.1|  PREDICTED: protein notum homolog                   143   2e-36   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG09455.1|  Protein notum                                           139   2e-36   Gossypium arboreum [tree cotton]
gb|EPS60657.1|  hypothetical protein M569_14145                         139   2e-36   Genlisea aurea
gb|KCW85006.1|  hypothetical protein EUGRSUZ_B01828                     140   2e-36   Eucalyptus grandis [rose gum]
ref|XP_006286504.1|  hypothetical protein CARUB_v10001019mg             143   2e-36   
ref|XP_002280865.3|  PREDICTED: protein notum homolog                   143   2e-36   Vitis vinifera
ref|XP_006359968.1|  PREDICTED: protein notum homolog                   134   2e-36   
ref|XP_003591264.1|  Pectin acetylesterase                              142   3e-36   
gb|KFK38001.1|  hypothetical protein AALP_AA3G057300                    142   3e-36   Arabis alpina [alpine rockcress]
ref|XP_010325631.1|  PREDICTED: protein notum homolog isoform X2        136   3e-36   Solanum lycopersicum
ref|XP_006297778.1|  hypothetical protein CARUB_v10013814mg             142   4e-36   Capsella rubella
gb|AFK38038.1|  unknown                                                 142   4e-36   Medicago truncatula
ref|XP_004230372.1|  PREDICTED: protein notum homolog                   142   4e-36   Solanum lycopersicum
ref|XP_010325630.1|  PREDICTED: protein notum homolog isoform X1        136   4e-36   
ref|XP_006358515.1|  PREDICTED: protein notum homolog                   142   4e-36   Solanum tuberosum [potatoes]
ref|XP_003521640.1|  PREDICTED: protein notum homolog                   142   4e-36   Glycine max [soybeans]
gb|KHN14201.1|  Protein notum like                                      142   4e-36   Glycine soja [wild soybean]
ref|XP_011039993.1|  PREDICTED: uncharacterized protein LOC105136378    142   5e-36   Populus euphratica
ref|XP_006382250.1|  hypothetical protein POPTR_0005s00330g             142   5e-36   Populus trichocarpa [western balsam poplar]
ref|XP_011039058.1|  PREDICTED: protein notum homolog isoform X1        142   6e-36   Populus euphratica
ref|XP_010546781.1|  PREDICTED: protein notum homolog                   142   6e-36   Tarenaya hassleriana [spider flower]
ref|XP_010649713.1|  PREDICTED: uncharacterized protein LOC100251...    139   6e-36   Vitis vinifera
ref|XP_006604777.1|  PREDICTED: protein notum homolog isoform X2        139   6e-36   
ref|XP_004494501.1|  PREDICTED: uncharacterized protein LOC101497...    141   8e-36   Cicer arietinum [garbanzo]
ref|XP_002320250.2|  hypothetical protein POPTR_0014s10650g             142   9e-36   
emb|CBI37040.3|  unnamed protein product                                142   9e-36   Vitis vinifera
ref|XP_010914810.1|  PREDICTED: protein notum homolog isoform X4        139   9e-36   
ref|XP_003626125.1|  Notum-like protein                                 141   1e-35   Medicago truncatula
ref|XP_009116880.1|  PREDICTED: protein notum homolog                   141   1e-35   Brassica rapa
gb|KDO86757.1|  hypothetical protein CISIN_1g014548mg                   139   1e-35   Citrus sinensis [apfelsine]
ref|XP_010421519.1|  PREDICTED: protein notum homolog                   141   1e-35   Camelina sativa [gold-of-pleasure]
gb|KJB25081.1|  hypothetical protein B456_004G176200                    136   1e-35   Gossypium raimondii
gb|KDP23324.1|  hypothetical protein JCGZ_23157                         141   1e-35   Jatropha curcas
gb|KJB25075.1|  hypothetical protein B456_004G176200                    136   1e-35   Gossypium raimondii
emb|CDX87039.1|  BnaC09g03540D                                          141   1e-35   
emb|CDY11398.1|  BnaA09g39640D                                          140   1e-35   Brassica napus [oilseed rape]
ref|XP_010455015.1|  PREDICTED: protein notum homolog                   140   2e-35   Camelina sativa [gold-of-pleasure]
ref|XP_010493919.1|  PREDICTED: protein notum homolog                   140   2e-35   
gb|KJB25078.1|  hypothetical protein B456_004G176200                    135   2e-35   
emb|CDX76613.1|  BnaC08g31990D                                          140   2e-35   
gb|KEH43169.1|  pectinacetylesterase family protein                     138   2e-35   
ref|XP_008800308.1|  PREDICTED: protein notum homolog isoform X1        140   2e-35   
ref|XP_010914805.1|  PREDICTED: protein notum homolog                   140   2e-35   
ref|XP_010914803.1|  PREDICTED: protein notum homolog isoform X1        140   2e-35   
ref|XP_007145058.1|  hypothetical protein PHAVU_007G206300g             140   2e-35   
emb|CBI26039.3|  unnamed protein product                                139   3e-35   
gb|ABG34282.1|  pectin acetylesterase                                   135   3e-35   
ref|XP_004135578.1|  PREDICTED: protein notum homolog                   140   3e-35   
ref|XP_008450496.1|  PREDICTED: protein notum homolog                   140   3e-35   
ref|XP_011092213.1|  PREDICTED: protein notum homolog                   140   4e-35   
ref|XP_010914809.1|  PREDICTED: uncharacterized protein LOC105040...    139   4e-35   
ref|XP_009353455.1|  PREDICTED: protein notum homolog                   139   4e-35   
ref|XP_004495819.1|  PREDICTED: uncharacterized protein LOC101503...    139   4e-35   
ref|XP_006604776.1|  PREDICTED: protein notum homolog isoform X1        139   5e-35   
ref|XP_007163281.1|  hypothetical protein PHAVU_001G221400g             139   7e-35   
ref|XP_002275616.1|  PREDICTED: protein notum homolog isoform X1        139   7e-35   
ref|XP_010914808.1|  PREDICTED: uncharacterized protein LOC105040...    138   7e-35   
ref|XP_010914807.1|  PREDICTED: protein notum homolog isoform X1        139   7e-35   
ref|XP_006444639.1|  hypothetical protein CICLE_v10020385mg             138   9e-35   
gb|EMT14315.1|  hypothetical protein F775_08483                         138   1e-34   
gb|KEH43170.1|  pectinacetylesterase family protein                     137   2e-34   
ref|XP_009797415.1|  PREDICTED: uncharacterized protein LOC104243851    135   2e-34   
ref|XP_006492439.1|  PREDICTED: protein notum homolog                   138   2e-34   
ref|XP_007222070.1|  hypothetical protein PRUPE_ppa007506mg             137   2e-34   
ref|XP_007222071.1|  hypothetical protein PRUPE_ppa007506mg             137   2e-34   
ref|XP_010544127.1|  PREDICTED: protein notum homolog isoform X2        137   2e-34   
ref|XP_008807934.1|  PREDICTED: protein notum homolog                   135   3e-34   
ref|XP_010544126.1|  PREDICTED: protein notum homolog isoform X1        137   3e-34   
gb|KHG13045.1|  Protein notum                                           138   3e-34   
ref|XP_009592441.1|  PREDICTED: uncharacterized protein LOC104089292    135   3e-34   
ref|XP_011012520.1|  PREDICTED: protein notum homolog                   132   3e-34   
ref|XP_010060898.1|  PREDICTED: uncharacterized protein LOC104448...    137   4e-34   
gb|KDP28066.1|  hypothetical protein JCGZ_19474                         130   4e-34   
ref|XP_010042497.1|  PREDICTED: protein notum homolog isoform X1        137   4e-34   
gb|KDP28067.1|  hypothetical protein JCGZ_19475                         134   4e-34   
ref|XP_008381630.1|  PREDICTED: uncharacterized protein LOC103444483    137   4e-34   
ref|XP_010060906.1|  PREDICTED: uncharacterized protein LOC104448...    137   4e-34   
ref|XP_009388128.1|  PREDICTED: protein notum homolog                   136   5e-34   
ref|XP_007163258.1|  hypothetical protein PHAVU_001G219200g             136   6e-34   
ref|XP_008807936.1|  PREDICTED: protein notum homolog isoform X2        136   7e-34   
ref|XP_008807935.1|  PREDICTED: protein notum homolog isoform X1        136   7e-34   
ref|XP_007163257.1|  hypothetical protein PHAVU_001G219200g             136   9e-34   
ref|XP_009405450.1|  PREDICTED: protein notum homolog                   134   1e-33   
gb|AGT17273.1|  hypothetical protein SHCRBa_020_L15_F_100               131   1e-33   
ref|XP_007051327.1|  Pectinacetylesterase family protein                136   1e-33   
ref|XP_010506714.1|  PREDICTED: protein notum homolog isoform X2        134   1e-33   
ref|XP_010674458.1|  PREDICTED: protein notum homolog                   134   1e-33   
ref|XP_004495849.1|  PREDICTED: protein notum homolog isoform X1        135   1e-33   
ref|XP_010413312.1|  PREDICTED: protein notum homolog                   134   1e-33   
ref|XP_009359821.1|  PREDICTED: protein notum homolog                   135   1e-33   
ref|XP_008369575.1|  PREDICTED: protein notum homolog isoform X2        135   2e-33   
gb|KCW90689.1|  hypothetical protein EUGRSUZ_A02777                     137   2e-33   
ref|XP_006652763.1|  PREDICTED: protein notum homolog                   131   2e-33   
gb|KCW90690.1|  hypothetical protein EUGRSUZ_A02777                     137   2e-33   
ref|XP_002447050.1|  hypothetical protein SORBIDRAFT_06g027560          130   2e-33   
ref|XP_009363058.1|  PREDICTED: LOW QUALITY PROTEIN: protein notu...    135   2e-33   
ref|NP_191765.2|  pectinacetylesterase family protein                   135   2e-33   
ref|XP_002303225.2|  pectinacetylesterase family protein                129   2e-33   
ref|XP_008369574.1|  PREDICTED: protein notum homolog isoform X1        135   2e-33   
ref|XP_008360208.1|  PREDICTED: protein notum homolog isoform X3        134   2e-33   
ref|XP_010506713.1|  PREDICTED: protein notum homolog isoform X1        134   2e-33   
emb|CAB71866.1|  pectinacetylesterase precursor-like protein            134   3e-33   
ref|XP_010240371.1|  PREDICTED: uncharacterized protein LOC100827...    132   3e-33   
ref|XP_003626089.1|  Pectin acetylesterase                              134   3e-33   
ref|XP_009344788.1|  PREDICTED: protein notum homolog                   135   3e-33   
ref|XP_004496556.1|  PREDICTED: protein notum homolog                   134   3e-33   
gb|AFK42918.1|  unknown                                                 134   3e-33   
ref|XP_003580427.1|  PREDICTED: uncharacterized protein LOC100827...    132   3e-33   
gb|KCW72726.1|  hypothetical protein EUGRSUZ_E01170                     127   3e-33   
ref|XP_008222318.1|  PREDICTED: protein notum homolog                   134   3e-33   
ref|XP_010507953.1|  PREDICTED: protein notum homolog                   134   4e-33   
ref|XP_011087573.1|  PREDICTED: protein notum homolog isoform X2        133   4e-33   
gb|KDP28360.1|  hypothetical protein JCGZ_14131                         134   4e-33   
gb|EYU19372.1|  hypothetical protein MIMGU_mgv1a006907mg                133   4e-33   
ref|XP_003626088.1|  Pectin acetylesterase                              134   4e-33   
ref|XP_010518382.1|  PREDICTED: protein notum homolog isoform X1        134   5e-33   
gb|KJB41749.1|  hypothetical protein B456_007G118400                    134   5e-33   
ref|XP_004296984.1|  PREDICTED: pectin acetylesterase 10-like           134   6e-33   
ref|XP_006293476.1|  hypothetical protein CARUB_v10023292mg             134   6e-33   
ref|XP_006291204.1|  hypothetical protein CARUB_v10017332mg             133   7e-33   
ref|XP_010544918.1|  PREDICTED: protein notum homolog isoform X2        133   7e-33   
ref|XP_008227765.1|  PREDICTED: protein notum homolog isoform X2        133   7e-33   
gb|EYU19373.1|  hypothetical protein MIMGU_mgv1a006907mg                133   7e-33   
ref|XP_010468989.1|  PREDICTED: protein notum homolog                   134   8e-33   
gb|KJB41748.1|  hypothetical protein B456_007G118400                    134   8e-33   
ref|XP_011087572.1|  PREDICTED: protein notum homolog isoform X1        133   8e-33   
ref|XP_010045528.1|  PREDICTED: protein notum homolog                   131   9e-33   
ref|XP_010544917.1|  PREDICTED: protein notum homolog isoform X1        134   9e-33   
ref|XP_002876658.1|  pectinacetylesterase family protein                133   9e-33   
ref|XP_008667853.1|  PREDICTED: hypothetical protein isoform X1         128   1e-32   
ref|XP_006604768.1|  PREDICTED: protein notum homolog isoform X2        133   1e-32   
tpg|DAA36176.1|  TPA: pectinacetylesterase                              128   1e-32   
ref|XP_008806800.1|  PREDICTED: uncharacterized protein LOC103719...    130   1e-32   
ref|XP_008227764.1|  PREDICTED: protein notum homolog isoform X1        133   1e-32   
ref|NP_001146615.1|  hypothetical protein                               128   1e-32   
gb|KHN43400.1|  Protein notum like                                      133   1e-32   
ref|XP_003554582.1|  PREDICTED: protein notum homolog isoform X1        133   1e-32   
gb|ABG34283.1|  pectin acetylesterase                                   131   2e-32   
ref|XP_004302322.1|  PREDICTED: pectin acetylesterase 12-like           132   2e-32   
ref|XP_009138739.1|  PREDICTED: protein notum homolog isoform X2        132   2e-32   
dbj|BAF46305.1|  pectinacetylesterase family protein                    130   2e-32   
ref|XP_003521625.1|  PREDICTED: protein notum homolog isoformX1         132   2e-32   
gb|KHG30410.1|  Protein notum                                           132   2e-32   
ref|XP_007221559.1|  hypothetical protein PRUPE_ppa006038mg             132   2e-32   
ref|XP_002512590.1|  pectin acetylesterase, putative                    132   2e-32   
ref|XP_010512591.1|  PREDICTED: protein notum homolog                   132   3e-32   
ref|XP_006577186.1|  PREDICTED: protein notum homolog isoform X2        132   3e-32   
ref|XP_006840405.1|  hypothetical protein AMTR_s00045p00148030          132   3e-32   
gb|KJB49685.1|  hypothetical protein B456_008G133500                    131   4e-32   
gb|KHN14181.1|  Protein notum like                                      131   4e-32   
ref|XP_009113357.1|  PREDICTED: protein notum homolog                   131   4e-32   
gb|EEC77932.1|  hypothetical protein OsI_17271                          128   4e-32   
ref|NP_001053773.1|  Os04g0602500                                       128   4e-32   
ref|NP_182216.1|  pectinacetylesterase-like protein                     131   4e-32   
ref|XP_008806798.1|  PREDICTED: uncharacterized protein LOC103719...    130   4e-32   
ref|XP_004494487.1|  PREDICTED: protein notum homolog isoform X3        131   5e-32   
gb|EEE61621.1|  hypothetical protein OsJ_16047                          127   5e-32   
ref|XP_008806797.1|  PREDICTED: uncharacterized protein LOC103719...    130   5e-32   
emb|CAD41867.2|  OSJNBa0041A02.14                                       128   5e-32   
ref|XP_004494486.1|  PREDICTED: protein notum homolog isoform X2        131   5e-32   
ref|XP_004494485.1|  PREDICTED: protein notum homolog isoform X1        131   6e-32   
ref|XP_002515160.1|  pectin acetylesterase, putative                    131   6e-32   
ref|XP_006402417.1|  hypothetical protein EUTSA_v10005997mg             129   6e-32   
ref|XP_006397884.1|  hypothetical protein EUTSA_v10001449mg             131   6e-32   
emb|CDY58759.1|  BnaA04g27440D                                          131   7e-32   
ref|XP_009138738.1|  PREDICTED: protein notum homolog isoform X1        131   7e-32   
ref|XP_011028476.1|  PREDICTED: protein notum homolog                   124   7e-32   
emb|CDY39939.1|  BnaA09g15210D                                          130   8e-32   
emb|CDX93989.1|  BnaC04g21480D                                          130   9e-32   
ref|XP_010662731.1|  PREDICTED: uncharacterized protein LOC100247...    128   1e-31   
ref|XP_004288665.1|  PREDICTED: pectin acetylesterase 3 isoform X2      130   1e-31   
ref|XP_008390267.1|  PREDICTED: uncharacterized protein LOC103452547    124   2e-31   
gb|KHN14241.1|  Protein notum like                                      129   2e-31   
dbj|BAJ97261.1|  predicted protein                                      129   2e-31   
ref|XP_009121169.1|  PREDICTED: protein notum homolog isoform X2        129   2e-31   
ref|XP_003518126.1|  PREDICTED: protein notum homolog                   129   2e-31   
ref|XP_007145083.1|  hypothetical protein PHAVU_007G208200g             129   2e-31   
ref|XP_003536008.1|  PREDICTED: protein notum homolog isoform X1        129   2e-31   
gb|AAM74495.1|  At1g57590/T8L23_6                                       129   2e-31   
ref|XP_002880274.1|  hypothetical protein ARALYDRAFT_483863             129   2e-31   
ref|NP_176072.3|  pectinacetylesterase family protein                   129   2e-31   
gb|AAG50747.1|AC079733_15  pectinacetylesterase precursor, putative     129   2e-31   
ref|XP_007143429.1|  hypothetical protein PHAVU_007G071700g             129   2e-31   
ref|XP_011030127.1|  PREDICTED: uncharacterized protein LOC105129...    126   2e-31   
gb|KJB52759.1|  hypothetical protein B456_008G276500                    127   2e-31   
ref|XP_007038709.1|  Pectinacetylesterase family protein isoform 1      129   2e-31   
gb|KHG08983.1|  Protein notum                                           129   3e-31   
ref|XP_009617653.1|  PREDICTED: uncharacterized protein LOC104109954    126   3e-31   
gb|KHN17784.1|  hypothetical protein glysoja_005981                     127   3e-31   
ref|XP_010327577.1|  PREDICTED: uncharacterized protein LOC101244626    122   3e-31   
ref|XP_006302295.1|  hypothetical protein CARUB_v10020343mg             129   3e-31   
ref|XP_006606122.1|  PREDICTED: protein notum homolog isoform X1        128   4e-31   
gb|KHN12141.1|  Protein notum like                                      128   4e-31   
ref|XP_010999344.1|  PREDICTED: protein notum homolog isoform X1        129   4e-31   
ref|XP_010999345.1|  PREDICTED: protein notum homolog isoform X2        129   4e-31   
emb|CAN83189.1|  hypothetical protein VITISV_037040                     128   4e-31   
ref|XP_009121168.1|  PREDICTED: protein notum homolog isoform X1        128   4e-31   
emb|CDY54427.1|  BnaCnng26950D                                          128   4e-31   
ref|XP_006392395.1|  hypothetical protein EUTSA_v10023485mg             127   4e-31   
ref|XP_009382365.1|  PREDICTED: uncharacterized protein LOC103970...    128   4e-31   
ref|XP_009382362.1|  PREDICTED: uncharacterized protein LOC103970...    129   4e-31   
ref|XP_009382364.1|  PREDICTED: uncharacterized protein LOC103970...    128   4e-31   
ref|XP_002271673.1|  PREDICTED: uncharacterized protein LOC100247...    128   5e-31   
ref|XP_009382361.1|  PREDICTED: uncharacterized protein LOC103970...    128   5e-31   
gb|KJB52760.1|  hypothetical protein B456_008G276500                    127   6e-31   
ref|XP_009382363.1|  PREDICTED: protein notum homolog isoform X3        128   6e-31   
ref|XP_002894676.1|  hypothetical protein ARALYDRAFT_474842             128   6e-31   
gb|ADR82372.1|  pectin acetylesterase                                   120   6e-31   
ref|XP_006385133.1|  pectinacetylesterase family protein                120   6e-31   
emb|CDY66251.1|  BnaC04g52030D                                          127   7e-31   
ref|XP_009388076.1|  PREDICTED: protein notum homolog                   128   7e-31   
ref|XP_008366797.1|  PREDICTED: protein notum homolog                   128   7e-31   
ref|XP_006378039.1|  hypothetical protein POPTR_0010s00700g             128   7e-31   
ref|XP_003551008.1|  PREDICTED: protein notum homolog                   127   8e-31   
gb|KDP22266.1|  hypothetical protein JCGZ_26097                         127   8e-31   
ref|XP_004983742.1|  PREDICTED: protein notum homolog isoform X2        127   8e-31   
ref|XP_008376614.1|  PREDICTED: uncharacterized protein LOC103439...    126   8e-31   
ref|XP_008234234.1|  PREDICTED: protein notum homolog                   127   9e-31   
ref|XP_008360207.1|  PREDICTED: protein notum homolog isoform X2        125   9e-31   
gb|KFK37453.1|  hypothetical protein AALP_AA4G259200                    127   9e-31   
gb|KJB52757.1|  hypothetical protein B456_008G276500                    127   9e-31   
ref|XP_008360206.1|  PREDICTED: protein notum homolog isoform X1        125   9e-31   
gb|KJB52758.1|  hypothetical protein B456_008G276500                    127   9e-31   
ref|XP_009142580.1|  PREDICTED: protein notum homolog                   127   9e-31   
gb|AFW82856.1|  hypothetical protein ZEAMMB73_240371                    122   1e-30   
ref|XP_004983741.1|  PREDICTED: protein notum homolog isoform X1        127   1e-30   
dbj|BAK07864.1|  predicted protein                                      121   1e-30   
ref|XP_010918537.1|  PREDICTED: protein notum homolog isoform X2        127   1e-30   
ref|XP_008374078.1|  PREDICTED: uncharacterized protein LOC103437389    124   1e-30   
ref|XP_007220399.1|  hypothetical protein PRUPE_ppa006446mg             127   1e-30   
ref|XP_008376613.1|  PREDICTED: protein notum homolog isoform X2        127   2e-30   
ref|XP_010918536.1|  PREDICTED: protein notum homolog isoform X1        127   2e-30   
ref|XP_010511331.1|  PREDICTED: protein notum homolog                   126   2e-30   
gb|KFK35390.1|  hypothetical protein AALP_AA5G279000                    126   2e-30   
ref|XP_011030125.1|  PREDICTED: uncharacterized protein LOC105129...    126   2e-30   
tpg|DAA63795.1|  TPA: hypothetical protein ZEAMMB73_008026              123   2e-30   
ref|XP_008376612.1|  PREDICTED: protein notum homolog isoform X1        126   2e-30   
ref|XP_006589537.1|  PREDICTED: protein notum homolog isoform X2        126   2e-30   
ref|XP_002513692.1|  pectin acetylesterase, putative                    127   2e-30   
gb|KHN21754.1|  Protein notum like                                      126   2e-30   
ref|XP_011030123.1|  PREDICTED: uncharacterized protein LOC105129...    126   2e-30   
ref|XP_003535610.2|  PREDICTED: protein notum homolog isoform X1        126   2e-30   
ref|XP_003542396.2|  PREDICTED: protein notum homolog isoform X1        126   3e-30   
dbj|BAJ92718.1|  predicted protein                                      122   3e-30   
ref|XP_010536197.1|  PREDICTED: protein notum homolog isoform X2        121   3e-30   
ref|XP_009794027.1|  PREDICTED: uncharacterized protein LOC104240572    119   3e-30   
ref|NP_001042886.1|  Os01g0319000                                       126   3e-30   
gb|EMS45878.1|  hypothetical protein TRIUR3_35256                       125   3e-30   
ref|XP_010536189.1|  PREDICTED: uncharacterized protein LOC104811...    121   3e-30   
gb|EEC70519.1|  hypothetical protein OsI_01625                          126   4e-30   
ref|XP_011470038.1|  PREDICTED: pectin acetylesterase 3 isoform X1      126   4e-30   
ref|XP_007154511.1|  hypothetical protein PHAVU_003G124700g             125   4e-30   
gb|EMT21027.1|  hypothetical protein F775_18206                         125   4e-30   
ref|XP_010694126.1|  PREDICTED: protein notum homolog                   125   5e-30   
gb|ACN26616.1|  unknown                                                 122   5e-30   
ref|NP_001142008.1|  hypothetical protein precursor                     122   5e-30   
ref|XP_006658006.1|  PREDICTED: protein notum homolog                   125   6e-30   
ref|XP_009342963.1|  PREDICTED: protein notum homolog isoform X2        125   6e-30   



>ref|XP_006878664.1| hypothetical protein AMTR_s00011p00266820 [Amborella trichopoda]
 gb|ERM94809.1| hypothetical protein AMTR_s00011p00266820 [Amborella trichopoda]
Length=398

 Score =   201 bits (512),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            + +  PGVADPHGTWH+CKLDI KC+ SQL  +Q FR+EFL AL  V +SPS G FINSC
Sbjct  274  KNTLAPGVADPHGTWHNCKLDIKKCTASQLQTLQDFRLEFLSALKGVGSSPSIGMFINSC  333

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            YAHCQ+EVQETWLRDDSPVL GTSIAKAVGDW+YDRSPFQKIDC YPCD SCHNR+F+
Sbjct  334  YAHCQSEVQETWLRDDSPVLGGTSIAKAVGDWFYDRSPFQKIDCAYPCDSSCHNRIFD  391



>ref|XP_010244169.1| PREDICTED: protein notum homolog [Nelumbo nucifera]
Length=401

 Score =   199 bits (506),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 89/113 (79%), Positives = 96/113 (85%), Gaps = 0/113 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            PGVADPHGTWH CKLDI KCS SQL IMQGFRMEFL  L  +  SP++  FINSCY+HCQ
Sbjct  283  PGVADPHGTWHDCKLDITKCSSSQLQIMQGFRMEFLSTLTRLMGSPTKALFINSCYSHCQ  342

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            T  QETWLRDDSPVL  TSI+KAVGDWY+DRS FQKIDCPYPCDKSCHNRVF+
Sbjct  343  TGTQETWLRDDSPVLDKTSISKAVGDWYFDRSGFQKIDCPYPCDKSCHNRVFD  395



>emb|CDP15690.1| unnamed protein product [Coffea canephora]
Length=399

 Score =   197 bits (500),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            PGVADPHG WH+CKLDI +CS SQL I+QGFR+EFL A+  +  S SRG+FIN CYAHCQ
Sbjct  280  PGVADPHGLWHNCKLDITRCSASQLQIIQGFRLEFLSAVNGLGTSSSRGYFINGCYAHCQ  339

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            TE+QETWLRDDSP L   +IAKAVGDW+YDRSPFQ IDCPYPCDK+CHNRVFE
Sbjct  340  TEMQETWLRDDSPRLNDKTIAKAVGDWFYDRSPFQTIDCPYPCDKTCHNRVFE  392



>gb|ACF05806.1| PAE [Litchi chinensis]
Length=399

 Score =   197 bits (500),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            PGVADPHGTWHSCKLDI  CS +QL  MQ FR++FL AL  + NS S+G FI+SCYAHCQ
Sbjct  280  PGVADPHGTWHSCKLDINNCSPNQLQTMQSFRLQFLDALSGLGNSTSKGLFIDSCYAHCQ  339

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            TE+QETWLRDDSPVL  T+IAKAVGDWYYDRSPFQKIDCPYPC+ +CHNRVF+
Sbjct  340  TEMQETWLRDDSPVLGKTTIAKAVGDWYYDRSPFQKIDCPYPCNPTCHNRVFD  392



>ref|XP_010244170.1| PREDICTED: uncharacterized protein LOC104588061 [Nelumbo nucifera]
Length=399

 Score =   196 bits (499),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 96/113 (85%), Gaps = 0/113 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            PGVADPHG WH+CKLDI  CS SQ+  MQGFR+EFL AL  + NS  RG FINSCYAHCQ
Sbjct  280  PGVADPHGYWHNCKLDIKNCSPSQIQTMQGFRVEFLNALSGLGNSSPRGMFINSCYAHCQ  339

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +E+QETWLRDDSPVL  T IAKAVGDWYYDRSPFQKIDCPYPCD +CHNR+F+
Sbjct  340  SEMQETWLRDDSPVLDKTPIAKAVGDWYYDRSPFQKIDCPYPCDATCHNRIFD  392



>ref|XP_010644665.1| PREDICTED: uncharacterized protein LOC100245856 [Vitis vinifera]
 emb|CBI29219.3| unnamed protein product [Vitis vinifera]
Length=399

 Score =   195 bits (496),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 96/113 (85%), Gaps = 0/113 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            PGVADPHGTWH CKLDI  CS SQL  MQ FR++FL A+  +  SPS+G FINSCYAHCQ
Sbjct  280  PGVADPHGTWHYCKLDIKDCSSSQLEAMQDFRVQFLSAIKGLIGSPSKGMFINSCYAHCQ  339

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            TE+QETWLRDDSPVL  T+IAKAVGDWYYDRSPFQKIDC YPCD +CHNRVF+
Sbjct  340  TEMQETWLRDDSPVLGKTTIAKAVGDWYYDRSPFQKIDCAYPCDSTCHNRVFD  392



>ref|XP_006432879.1| hypothetical protein CICLE_v100013711mg, partial [Citrus clementina]
 gb|ESR46119.1| hypothetical protein CICLE_v100013711mg, partial [Citrus clementina]
Length=124

 Score =   186 bits (473),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 93/113 (82%), Gaps = 0/113 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            PGVADPHGTWHSCKLDI  CS +QL  MQ FR +FL AL  +  S SRG FI++CYAHCQ
Sbjct  5    PGVADPHGTWHSCKLDINNCSPTQLQTMQSFRTQFLNALAGLGISSSRGMFIDACYAHCQ  64

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            TE+QETWLR DSPVL   SIAKAVGDWYYDRSPFQKIDC YPC+ +CHNRVF+
Sbjct  65   TEMQETWLRTDSPVLGKMSIAKAVGDWYYDRSPFQKIDCAYPCNPTCHNRVFD  117



>gb|KEH20327.1| pectinacetylesterase family protein [Medicago truncatula]
Length=393

 Score =   192 bits (489),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            PGVADPHGTW +CKLDI  CS +QL  MQGFR EFLKA+  V+NSPS+G FI+ CY+HCQ
Sbjct  281  PGVADPHGTWRNCKLDIKSCSANQLSTMQGFRTEFLKAISVVSNSPSKGMFIDGCYSHCQ  340

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            T +QETW+R DSPVLA T+IAKAVGDWYYDRS FQ+IDCPYPC+ +CHNRVFE
Sbjct  341  TGMQETWMRTDSPVLAKTTIAKAVGDWYYDRSTFQQIDCPYPCNPTCHNRVFE  393



>ref|XP_003628995.1| Notum-like protein [Medicago truncatula]
Length=396

 Score =   192 bits (489),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            PGVADPHGTW +CKLDI  CS +QL  MQGFR EFLKA+  V+NSPS+G FI+ CY+HCQ
Sbjct  284  PGVADPHGTWRNCKLDIKSCSANQLSTMQGFRTEFLKAISVVSNSPSKGMFIDGCYSHCQ  343

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            T +QETW+R DSPVLA T+IAKAVGDWYYDRS FQ+IDCPYPC+ +CHNRVFE
Sbjct  344  TGMQETWMRTDSPVLAKTTIAKAVGDWYYDRSTFQQIDCPYPCNPTCHNRVFE  396



>gb|KDO40415.1| hypothetical protein CISIN_1g013734mg [Citrus sinensis]
Length=246

 Score =   187 bits (476),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 93/113 (82%), Gaps = 0/113 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            PGVADPHGTWHSCKLDI  CS +QL  MQ FR +FL AL  +  S SRG FI++CYAHCQ
Sbjct  127  PGVADPHGTWHSCKLDINNCSPTQLQTMQSFRTQFLNALAGLGISSSRGMFIDACYAHCQ  186

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            TE+QETWLR DSPVL   SIAKAVGDWYYDRSPFQKIDC YPC+ +CHNRVF+
Sbjct  187  TEMQETWLRTDSPVLGKMSIAKAVGDWYYDRSPFQKIDCAYPCNPTCHNRVFD  239



>gb|AET03471.2| pectinacetylesterase family protein [Medicago truncatula]
Length=424

 Score =   192 bits (489),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            PGVADPHGTW +CKLDI  CS +QL  MQGFR EFLKA+  V+NSPS+G FI+ CY+HCQ
Sbjct  312  PGVADPHGTWRNCKLDIKSCSANQLSTMQGFRTEFLKAISVVSNSPSKGMFIDGCYSHCQ  371

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            T +QETW+R DSPVLA T+IAKAVGDWYYDRS FQ+IDCPYPC+ +CHNRVFE
Sbjct  372  TGMQETWMRTDSPVLAKTTIAKAVGDWYYDRSTFQQIDCPYPCNPTCHNRVFE  424



>ref|XP_004244443.1| PREDICTED: uncharacterized protein LOC101251798 [Solanum lycopersicum]
Length=392

 Score =   191 bits (486),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            PGVADPHGTW +CKLDILKCS +QL  MQ FR EFLKAL ++  S +RG++INSCYAHCQ
Sbjct  280  PGVADPHGTWRNCKLDILKCSSAQLQTMQAFRSEFLKALNSLGPSSTRGYYINSCYAHCQ  339

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            T  QETWLRDDSPVL+GT+IAKAVGDWYY+R  FQ+IDCPYPC+K+C NR FE
Sbjct  340  TGTQETWLRDDSPVLSGTTIAKAVGDWYYERKRFQEIDCPYPCNKTCKNRNFE  392



>ref|XP_010677538.1| PREDICTED: protein notum homolog isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=389

 Score =   191 bits (486),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 83/118 (70%), Positives = 99/118 (84%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            + +  PGVAD HGTWH CK DI+KCS+SQ+ IM GFR +FL AL ++ NS SRGF+INSC
Sbjct  272  KNTLAPGVADRHGTWHDCKSDIIKCSNSQIQIMHGFRQDFLAALSSLGNSNSRGFYINSC  331

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            Y+HCQ+  QETWLRDDSP+L  T+I KAVGDW+YDR PFQKIDCPYPC+K+CHNRVFE
Sbjct  332  YSHCQSGTQETWLRDDSPLLDNTTICKAVGDWFYDRKPFQKIDCPYPCNKTCHNRVFE  389



>ref|XP_010677539.1| PREDICTED: protein notum homolog isoform X2 [Beta vulgaris subsp. 
vulgaris]
Length=388

 Score =   191 bits (485),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 83/118 (70%), Positives = 99/118 (84%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            + +  PGVAD HGTWH CK DI+KCS+SQ+ IM GFR +FL AL ++ NS SRGF+INSC
Sbjct  271  KNTLAPGVADRHGTWHDCKSDIIKCSNSQIQIMHGFRQDFLAALSSLGNSNSRGFYINSC  330

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            Y+HCQ+  QETWLRDDSP+L  T+I KAVGDW+YDR PFQKIDCPYPC+K+CHNRVFE
Sbjct  331  YSHCQSGTQETWLRDDSPLLDNTTICKAVGDWFYDRKPFQKIDCPYPCNKTCHNRVFE  388



>gb|KDO40411.1| hypothetical protein CISIN_1g013734mg [Citrus sinensis]
Length=248

 Score =   187 bits (474),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 93/113 (82%), Gaps = 0/113 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            PGVADPHGTWHSCKLDI  CS +QL  MQ FR +FL AL  +  S SRG FI++CYAHCQ
Sbjct  129  PGVADPHGTWHSCKLDINNCSPTQLQTMQSFRTQFLNALAGLGISSSRGMFIDACYAHCQ  188

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            TE+QETWLR DSPVL   SIAKAVGDWYYDRSPFQKIDC YPC+ +CHNRVF+
Sbjct  189  TEMQETWLRTDSPVLGKMSIAKAVGDWYYDRSPFQKIDCAYPCNPTCHNRVFD  241



>gb|KDO40412.1| hypothetical protein CISIN_1g013734mg [Citrus sinensis]
Length=373

 Score =   190 bits (482),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/122 (70%), Positives = 96/122 (79%), Gaps = 0/122 (0%)
 Frame = -2

Query  655  PGR*RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFF  476
            PG  +    PGVADPHGTWHSCKLDI  CS +QL  MQ FR +FL AL  +  S SRG F
Sbjct  245  PGLIKNILAPGVADPHGTWHSCKLDINNCSPTQLQTMQSFRTQFLNALAGLGISSSRGMF  304

Query  475  INSCYAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRV  296
            I++CYAHCQTE+QETWLR DSPVL   SIAKAVGDWYYDRSPFQKIDC YPC+ +CHNRV
Sbjct  305  IDACYAHCQTEMQETWLRTDSPVLGKMSIAKAVGDWYYDRSPFQKIDCAYPCNPTCHNRV  364

Query  295  FE  290
            F+
Sbjct  365  FD  366



>gb|KCW72720.1| hypothetical protein EUGRSUZ_E01169 [Eucalyptus grandis]
Length=420

 Score =   191 bits (485),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 94/113 (83%), Gaps = 0/113 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            PGVADPHGTWHSCKLDI  CS  QL IMQ FR +FL AL  V  SPSRG FI+SCYAHCQ
Sbjct  289  PGVADPHGTWHSCKLDINNCSLDQLQIMQDFRQQFLDALSRVGTSPSRGIFIDSCYAHCQ  348

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +E+QETWLRDDSPVL  TSIAKAVGDWYYDR PFQKIDC YPC+ +CHN VF+
Sbjct  349  SEMQETWLRDDSPVLIETSIAKAVGDWYYDRRPFQKIDCAYPCNPTCHNMVFD  401



>ref|XP_011073252.1| PREDICTED: protein notum homolog isoform X2 [Sesamum indicum]
Length=398

 Score =   191 bits (484),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            PGVADPHG WH CK DI+KCS +QL  MQ FR++FL AL  + +S SRG+FIN CYAHCQ
Sbjct  279  PGVADPHGLWHDCKTDIVKCSTTQLQTMQEFRLQFLNALSGLGSSTSRGYFINGCYAHCQ  338

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            TE+QETW R DSP+L   +IAKAVGDW+YDRSPFQKIDCPYPCDK+CHNRVF+
Sbjct  339  TEMQETWFRGDSPLLYNKTIAKAVGDWFYDRSPFQKIDCPYPCDKTCHNRVFD  391



>gb|KDO40414.1| hypothetical protein CISIN_1g013734mg [Citrus sinensis]
Length=307

 Score =   188 bits (477),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 93/113 (82%), Gaps = 0/113 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            PGVADPHGTWHSCKLDI  CS +QL  MQ FR +FL AL  +  S SRG FI++CYAHCQ
Sbjct  188  PGVADPHGTWHSCKLDINNCSPTQLQTMQSFRTQFLNALAGLGISSSRGMFIDACYAHCQ  247

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            TE+QETWLR DSPVL   SIAKAVGDWYYDRSPFQKIDC YPC+ +CHNRVF+
Sbjct  248  TEMQETWLRTDSPVLGKMSIAKAVGDWYYDRSPFQKIDCAYPCNPTCHNRVFD  300



>ref|XP_010056136.1| PREDICTED: protein notum homolog [Eucalyptus grandis]
 gb|KCW72724.1| hypothetical protein EUGRSUZ_E01170 [Eucalyptus grandis]
 gb|KCW72725.1| hypothetical protein EUGRSUZ_E01170 [Eucalyptus grandis]
Length=399

 Score =   190 bits (482),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 96/113 (85%), Gaps = 0/113 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            PGVAD HGTW SCKLDI KCS +QL IMQ FR+EFL+AL AV  SPSRG FI+SCYAHCQ
Sbjct  280  PGVADRHGTWRSCKLDIKKCSPNQLKIMQDFRLEFLRALSAVGTSPSRGMFIDSCYAHCQ  339

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
               QETWLR+DSPV+A TSIAKAVGDWYY+R  FQKIDCPYPC+ +CHNR+F+
Sbjct  340  AGTQETWLRNDSPVVAKTSIAKAVGDWYYERLTFQKIDCPYPCNPTCHNRIFD  392



>ref|XP_011082149.1| PREDICTED: protein notum homolog isoform X1 [Sesamum indicum]
 ref|XP_011082150.1| PREDICTED: protein notum homolog isoform X1 [Sesamum indicum]
 ref|XP_011082151.1| PREDICTED: protein notum homolog isoform X1 [Sesamum indicum]
Length=398

 Score =   190 bits (482),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 96/113 (85%), Gaps = 0/113 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            PGVADPHGTWH+CK DI KCS +QL  MQGFR+EF++AL  +  S SRG+FINSCYAHCQ
Sbjct  279  PGVADPHGTWHNCKTDINKCSATQLQTMQGFRLEFIRALYGLGVSTSRGYFINSCYAHCQ  338

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            TE+QETW R DSP L   +IAKAVGDW+YDRSPFQK DCPYPCD++CHNRVF+
Sbjct  339  TEMQETWYRSDSPKLNNKTIAKAVGDWFYDRSPFQKGDCPYPCDRTCHNRVFD  391



>ref|XP_011082152.1| PREDICTED: protein notum homolog isoform X2 [Sesamum indicum]
Length=378

 Score =   189 bits (480),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 96/113 (85%), Gaps = 0/113 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            PGVADPHGTWH+CK DI KCS +QL  MQGFR+EF++AL  +  S SRG+FINSCYAHCQ
Sbjct  259  PGVADPHGTWHNCKTDINKCSATQLQTMQGFRLEFIRALYGLGVSTSRGYFINSCYAHCQ  318

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            TE+QETW R DSP L   +IAKAVGDW+YDRSPFQK DCPYPCD++CHNRVF+
Sbjct  319  TEMQETWYRSDSPKLNNKTIAKAVGDWFYDRSPFQKGDCPYPCDRTCHNRVFD  371



>ref|XP_010111521.1| hypothetical protein L484_021346 [Morus notabilis]
 gb|EXC31044.1| hypothetical protein L484_021346 [Morus notabilis]
Length=386

 Score =   189 bits (481),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            PGVADPHGTWH CKLDI KCS  QL  MQ FR+EFLKA+  V NS S+G FI+SCYAHCQ
Sbjct  268  PGVADPHGTWHYCKLDITKCSSIQLKTMQDFRLEFLKAISVVGNSLSKGLFIDSCYAHCQ  327

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            TE+QETWLR +SP L  T+IAKAVGDW+YDRS FQKIDCPYPC+ +CHNRVF+
Sbjct  328  TEMQETWLRANSPRLGATTIAKAVGDWFYDRSAFQKIDCPYPCNPTCHNRVFD  380



>ref|XP_011073171.1| PREDICTED: protein notum homolog isoform X1 [Sesamum indicum]
Length=422

 Score =   190 bits (482),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            PGVADPHG WH CK DI+KCS +QL  MQ FR++FL AL  + +S SRG+FIN CYAHCQ
Sbjct  303  PGVADPHGLWHDCKTDIVKCSTTQLQTMQEFRLQFLNALSGLGSSTSRGYFINGCYAHCQ  362

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            TE+QETW R DSP+L   +IAKAVGDW+YDRSPFQKIDCPYPCDK+CHNRVF+
Sbjct  363  TEMQETWFRGDSPLLYNKTIAKAVGDWFYDRSPFQKIDCPYPCDKTCHNRVFD  415



>gb|KCW72718.1| hypothetical protein EUGRSUZ_E01169 [Eucalyptus grandis]
 gb|KCW72719.1| hypothetical protein EUGRSUZ_E01169 [Eucalyptus grandis]
Length=403

 Score =   189 bits (481),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 94/113 (83%), Gaps = 0/113 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            PGVADPHGTWHSCKLDI  CS  QL IMQ FR +FL AL  V  SPSRG FI+SCYAHCQ
Sbjct  244  PGVADPHGTWHSCKLDINNCSLDQLQIMQDFRQQFLDALSRVGTSPSRGIFIDSCYAHCQ  303

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +E+QETWLRDDSPVL  TSIAKAVGDWYYDR PFQKIDC YPC+ +CHN VF+
Sbjct  304  SEMQETWLRDDSPVLIETSIAKAVGDWYYDRRPFQKIDCAYPCNPTCHNMVFD  356



>ref|XP_010056132.1| PREDICTED: protein notum homolog isoform X3 [Eucalyptus grandis]
 gb|KCW72716.1| hypothetical protein EUGRSUZ_E01169 [Eucalyptus grandis]
 gb|KCW72717.1| hypothetical protein EUGRSUZ_E01169 [Eucalyptus grandis]
Length=439

 Score =   190 bits (483),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 94/113 (83%), Gaps = 0/113 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            PGVADPHGTWHSCKLDI  CS  QL IMQ FR +FL AL  V  SPSRG FI+SCYAHCQ
Sbjct  280  PGVADPHGTWHSCKLDINNCSLDQLQIMQDFRQQFLDALSRVGTSPSRGIFIDSCYAHCQ  339

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +E+QETWLRDDSPVL  TSIAKAVGDWYYDR PFQKIDC YPC+ +CHN VF+
Sbjct  340  SEMQETWLRDDSPVLIETSIAKAVGDWYYDRRPFQKIDCAYPCNPTCHNMVFD  392



>ref|XP_010056131.1| PREDICTED: protein notum homolog isoform X2 [Eucalyptus grandis]
Length=448

 Score =   190 bits (483),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 94/113 (83%), Gaps = 0/113 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            PGVADPHGTWHSCKLDI  CS  QL IMQ FR +FL AL  V  SPSRG FI+SCYAHCQ
Sbjct  289  PGVADPHGTWHSCKLDINNCSLDQLQIMQDFRQQFLDALSRVGTSPSRGIFIDSCYAHCQ  348

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +E+QETWLRDDSPVL  TSIAKAVGDWYYDR PFQKIDC YPC+ +CHN VF+
Sbjct  349  SEMQETWLRDDSPVLIETSIAKAVGDWYYDRRPFQKIDCAYPCNPTCHNMVFD  401



>ref|XP_010056129.1| PREDICTED: protein notum homolog isoform X1 [Eucalyptus grandis]
 ref|XP_010056130.1| PREDICTED: protein notum homolog isoform X1 [Eucalyptus grandis]
Length=445

 Score =   190 bits (483),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 94/113 (83%), Gaps = 0/113 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            PGVADPHGTWHSCKLDI  CS  QL IMQ FR +FL AL  V  SPSRG FI+SCYAHCQ
Sbjct  286  PGVADPHGTWHSCKLDINNCSLDQLQIMQDFRQQFLDALSRVGTSPSRGIFIDSCYAHCQ  345

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +E+QETWLRDDSPVL  TSIAKAVGDWYYDR PFQKIDC YPC+ +CHN VF+
Sbjct  346  SEMQETWLRDDSPVLIETSIAKAVGDWYYDRRPFQKIDCAYPCNPTCHNMVFD  398



>ref|XP_004172255.1| PREDICTED: protein notum homolog [Cucumis sativus]
 gb|KGN53459.1| hypothetical protein Csa_4G056500 [Cucumis sativus]
Length=398

 Score =   189 bits (479),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 96/113 (85%), Gaps = 0/113 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            PGVADPHGTWH CKLDI  CS  QL  MQ FR++FL AL  V +S SRG FI+SCYAHCQ
Sbjct  280  PGVADPHGTWHECKLDIKNCSPIQLRTMQDFRVQFLSALNGVGSSLSRGLFIDSCYAHCQ  339

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            TE+QETWLR DSPVL+ T+IAKAVGDW++DR+PFQKIDCPYPC+ +CHNR+FE
Sbjct  340  TEMQETWLRTDSPVLSKTTIAKAVGDWFFDRAPFQKIDCPYPCNPTCHNRIFE  392



>gb|AAP72959.1| pectin acetylesterase [Lactuca sativa]
Length=395

 Score =   188 bits (477),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 96/115 (83%), Gaps = 2/115 (2%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVAN--SPSRGFFINSCYAH  455
            PGVAD  GTW  CKLDI KCS +QL ++QG+R+EFLKAL    N  SPSRG FINSCY+H
Sbjct  281  PGVADRKGTWRECKLDITKCSSAQLNVLQGYRLEFLKALNGFGNGNSPSRGMFINSCYSH  340

Query  454  CQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            CQT +QETWLR+DSP+L  T+IAKAVGDWYY+R+ FQKIDC YPCDK+CHNRVFE
Sbjct  341  CQTGIQETWLRNDSPLLGNTTIAKAVGDWYYERNTFQKIDCAYPCDKTCHNRVFE  395



>ref|XP_006471634.1| PREDICTED: uncharacterized protein LOC102628021 [Citrus sinensis]
 gb|KDO40413.1| hypothetical protein CISIN_1g013734mg [Citrus sinensis]
Length=399

 Score =   188 bits (477),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 93/113 (82%), Gaps = 0/113 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            PGVADPHGTWHSCKLDI  CS +QL  MQ FR +FL AL  +  S SRG FI++CYAHCQ
Sbjct  280  PGVADPHGTWHSCKLDINNCSPTQLQTMQSFRTQFLNALAGLGISSSRGMFIDACYAHCQ  339

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            TE+QETWLR DSPVL   SIAKAVGDWYYDRSPFQKIDC YPC+ +CHNRVF+
Sbjct  340  TEMQETWLRTDSPVLGKMSIAKAVGDWYYDRSPFQKIDCAYPCNPTCHNRVFD  392



>ref|XP_008451860.1| PREDICTED: protein notum homolog isoform X1 [Cucumis melo]
Length=401

 Score =   188 bits (477),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 96/113 (85%), Gaps = 0/113 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            PGVADPHGTWH CKLDI  CS  QL IMQ FR++FL AL  V +S SRG FI+SCYAHCQ
Sbjct  283  PGVADPHGTWHECKLDIKNCSPIQLRIMQDFRVQFLSALTGVGSSLSRGLFIDSCYAHCQ  342

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            TE+QETWLR DSP+L+ T IAKAVGDW++DR+PFQKIDCPYPC+ +CHNR+FE
Sbjct  343  TEMQETWLRSDSPMLSKTPIAKAVGDWFFDRAPFQKIDCPYPCNPTCHNRIFE  395



>ref|XP_008451861.1| PREDICTED: protein notum homolog isoform X2 [Cucumis melo]
Length=398

 Score =   187 bits (476),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 96/113 (85%), Gaps = 0/113 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            PGVADPHGTWH CKLDI  CS  QL IMQ FR++FL AL  V +S SRG FI+SCYAHCQ
Sbjct  280  PGVADPHGTWHECKLDIKNCSPIQLRIMQDFRVQFLSALTGVGSSLSRGLFIDSCYAHCQ  339

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            TE+QETWLR DSP+L+ T IAKAVGDW++DR+PFQKIDCPYPC+ +CHNR+FE
Sbjct  340  TEMQETWLRSDSPMLSKTPIAKAVGDWFFDRAPFQKIDCPYPCNPTCHNRIFE  392



>ref|XP_009627060.1| PREDICTED: uncharacterized protein LOC104117690 [Nicotiana tomentosiformis]
 ref|XP_009627061.1| PREDICTED: uncharacterized protein LOC104117690 [Nicotiana tomentosiformis]
Length=402

 Score =   187 bits (475),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            PGVADP GTW +CKLDILKCS +QL  MQG+R EFLKAL  +  S +RG++INSCYAHCQ
Sbjct  280  PGVADPRGTWRNCKLDILKCSSAQLETMQGYRTEFLKALNGLGPSSTRGYYINSCYAHCQ  339

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            T  QETWLRDDSP LA T+IAKAVGDW+YDR+ FQ+IDCPYPCDK+C NR FE
Sbjct  340  TGTQETWLRDDSPRLASTTIAKAVGDWFYDRNQFQEIDCPYPCDKTCKNRNFE  392



>gb|KDO40410.1| hypothetical protein CISIN_1g013734mg [Citrus sinensis]
Length=437

 Score =   187 bits (475),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 93/113 (82%), Gaps = 0/113 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            PGVADPHGTWHSCKLDI  CS +QL  MQ FR +FL AL  +  S SRG FI++CYAHCQ
Sbjct  318  PGVADPHGTWHSCKLDINNCSPTQLQTMQSFRTQFLNALAGLGISSSRGMFIDACYAHCQ  377

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            TE+QETWLR DSPVL   SIAKAVGDWYYDRSPFQKIDC YPC+ +CHNRVF+
Sbjct  378  TEMQETWLRTDSPVLGKMSIAKAVGDWYYDRSPFQKIDCAYPCNPTCHNRVFD  430



>ref|XP_009771151.1| PREDICTED: uncharacterized protein LOC104221730 [Nicotiana sylvestris]
Length=402

 Score =   186 bits (473),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            PGVADP GTW +CKLDILKCS +QL  MQG+R EFLKAL  +  S +RG++INSCYAHCQ
Sbjct  280  PGVADPRGTWRNCKLDILKCSSAQLETMQGYRNEFLKALNGLGPSSTRGYYINSCYAHCQ  339

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            T  QETWLRDDSP LA T+IAKAVGDW+YDR+ FQ+IDCPYPCDK+C NR FE
Sbjct  340  TGTQETWLRDDSPRLASTTIAKAVGDWFYDRNRFQEIDCPYPCDKTCKNRNFE  392



>ref|XP_004512351.1| PREDICTED: protein notum homolog isoform X3 [Cicer arietinum]
Length=448

 Score =   187 bits (476),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            PGVADPHG WHSCK+DI  CS +QL +MQGFR EFL+AL  + NSPS+G FI+SCYAHCQ
Sbjct  282  PGVADPHGHWHSCKMDINNCSSNQLDLMQGFRTEFLRALTVLGNSPSKGMFIDSCYAHCQ  341

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            TE+QETW R DSP+LA T+IAKAV DW+Y+R  F +IDCPYPC+ SCHNRVFE
Sbjct  342  TEMQETWFRSDSPLLAKTTIAKAVADWFYERRLFHQIDCPYPCNPSCHNRVFE  394



>ref|XP_004150551.1| PREDICTED: protein notum homolog [Cucumis sativus]
Length=539

 Score =   189 bits (481),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 96/113 (85%), Gaps = 0/113 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            PGVADPHGTWH CKLDI  CS  QL  MQ FR++FL AL  V +S SRG FI+SCYAHCQ
Sbjct  280  PGVADPHGTWHECKLDIKNCSPIQLRTMQDFRVQFLSALNGVGSSLSRGLFIDSCYAHCQ  339

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            TE+QETWLR DSPVL+ T+IAKAVGDW++DR+PFQKIDCPYPC+ +CHNR+FE
Sbjct  340  TEMQETWLRTDSPVLSKTTIAKAVGDWFFDRAPFQKIDCPYPCNPTCHNRIFE  392



>ref|XP_010325633.1| PREDICTED: uncharacterized protein LOC101257588 isoform X2 [Solanum 
lycopersicum]
Length=397

 Score =   186 bits (472),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 96/113 (85%), Gaps = 0/113 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            P VADP+G W +CKLDILKCS  QL IM G+R+ FL+AL A+  S SRG+FINSCYAHCQ
Sbjct  275  PDVADPYGVWLNCKLDILKCSSRQLQIMHGYRLLFLRALNALGPSSSRGYFINSCYAHCQ  334

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            TEVQETW R DSP LA  +IAKA+GDW+YD++PFQKIDCPYPCDK+CHNRVF+
Sbjct  335  TEVQETWYRADSPKLANKTIAKALGDWFYDKNPFQKIDCPYPCDKTCHNRVFD  387



>ref|XP_010942978.1| PREDICTED: uncharacterized protein LOC105060830 isoform X2 [Elaeis 
guineensis]
Length=371

 Score =   185 bits (470),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 92/123 (75%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  MIPGR*RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRG  482
            + P   R   +PGVADPHGTWH CKLDI +CS  QL IMQGFR EFL AL     S S G
Sbjct  243  LTPSMIRNILVPGVADPHGTWHYCKLDIQQCSSPQLQIMQGFRTEFLNALAGFGRSSSTG  302

Query  481  FFINSCYAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHN  302
             FINSCYAHCQ+E+QETWL  DSPVL    IAKAVGDW+YDR  FQKIDCPYPCD +CHN
Sbjct  303  MFINSCYAHCQSEMQETWLSSDSPVLEKMPIAKAVGDWFYDRIAFQKIDCPYPCDSTCHN  362

Query  301  RVF  293
            R+F
Sbjct  363  RIF  365



>gb|ACJ85294.1| unknown [Medicago truncatula]
 gb|AFK37076.1| unknown [Medicago truncatula]
Length=393

 Score =   186 bits (471),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            PGVADPHGTW +CKLDI  CS +QL  MQGFR EFLKA+  V+NSPS+G FI+ CY+H Q
Sbjct  281  PGVADPHGTWRNCKLDIKSCSANQLSTMQGFRTEFLKAISVVSNSPSKGMFIDGCYSHRQ  340

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            T +QETW+R D PVLA T+IAKAVGDWYYDRS FQ+IDCPYPC+ +CHNRVFE
Sbjct  341  TGMQETWMRTDFPVLAKTTIAKAVGDWYYDRSTFQQIDCPYPCNPTCHNRVFE  393



>ref|XP_010325632.1| PREDICTED: protein notum homolog isoform X1 [Solanum lycopersicum]
Length=402

 Score =   186 bits (472),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 96/113 (85%), Gaps = 0/113 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            P VADP+G W +CKLDILKCS  QL IM G+R+ FL+AL A+  S SRG+FINSCYAHCQ
Sbjct  280  PDVADPYGVWLNCKLDILKCSSRQLQIMHGYRLLFLRALNALGPSSSRGYFINSCYAHCQ  339

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            TEVQETW R DSP LA  +IAKA+GDW+YD++PFQKIDCPYPCDK+CHNRVF+
Sbjct  340  TEVQETWYRADSPKLANKTIAKALGDWFYDKNPFQKIDCPYPCDKTCHNRVFD  392



>ref|XP_008808358.1| PREDICTED: protein notum homolog [Phoenix dactylifera]
Length=397

 Score =   186 bits (471),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 92/114 (81%), Gaps = 0/114 (0%)
 Frame = -2

Query  631  LPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHC  452
            +PGVADPHGTWH CKLDI +CS SQL IMQGFR +FL AL    +S S G FINSCYAHC
Sbjct  279  VPGVADPHGTWHDCKLDIQQCSSSQLQIMQGFRTQFLNALAGFGSSSSTGMFINSCYAHC  338

Query  451  QTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            Q+E+QETWL  +SPVL    IAKAVGDW+YDR  FQKIDCPYPCD +CHNR+FE
Sbjct  339  QSEMQETWLSSNSPVLEKIPIAKAVGDWFYDRIAFQKIDCPYPCDSTCHNRIFE  392



>ref|XP_004512349.1| PREDICTED: protein notum homolog isoform X1 [Cicer arietinum]
 ref|XP_004512350.1| PREDICTED: protein notum homolog isoform X2 [Cicer arietinum]
Length=487

 Score =   187 bits (476),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            PGVADPHG WHSCK+DI  CS +QL +MQGFR EFL+AL  + NSPS+G FI+SCYAHCQ
Sbjct  321  PGVADPHGHWHSCKMDINNCSSNQLDLMQGFRTEFLRALTVLGNSPSKGMFIDSCYAHCQ  380

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            TE+QETW R DSP+LA T+IAKAV DW+Y+R  F +IDCPYPC+ SCHNRVFE
Sbjct  381  TEMQETWFRSDSPLLAKTTIAKAVADWFYERRLFHQIDCPYPCNPSCHNRVFE  433



>ref|XP_010942979.1| PREDICTED: uncharacterized protein LOC105060830 isoform X3 [Elaeis 
guineensis]
Length=353

 Score =   184 bits (467),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 90/117 (77%), Gaps = 0/117 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            R   +PGVADPHGTWH CKLDI +CS  QL IMQGFR EFL AL     S S G FINSC
Sbjct  231  RNILVPGVADPHGTWHYCKLDIQQCSSPQLQIMQGFRTEFLNALAGFGRSSSTGMFINSC  290

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVF  293
            YAHCQ+E+QETWL  DSPVL    IAKAVGDW+YDR  FQKIDCPYPCD +CHNR+F
Sbjct  291  YAHCQSEMQETWLSSDSPVLEKMPIAKAVGDWFYDRIAFQKIDCPYPCDSTCHNRIF  347



>emb|CAA67728.1| pectinacetylesterase precursor [Vigna radiata var. radiata]
Length=399

 Score =   185 bits (470),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 93/113 (82%), Gaps = 0/113 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            PG ADPHGTW  CKLDI KCS +QL  MQ FR +FL+A GAV NSPS+G FI+ CYAHCQ
Sbjct  280  PGAADPHGTWRECKLDIKKCSSNQLSAMQVFRTDFLRAFGAVGNSPSKGHFIDGCYAHCQ  339

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            T  QETWLR+DSPVL  T+IAKAVGDWYYDR PF++IDC YPC+ +CHNR+F+
Sbjct  340  TGTQETWLRNDSPVLGSTTIAKAVGDWYYDRKPFKQIDCAYPCNPTCHNRIFD  392



>ref|XP_009794297.1| PREDICTED: protein notum homolog [Nicotiana sylvestris]
Length=402

 Score =   185 bits (470),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            P VADP G W +CKLDIL+CS  QL  MQGFR+ FL+AL A+  S SRG+FINSCYAHCQ
Sbjct  280  PSVADPRGVWRNCKLDILRCSSRQLQTMQGFRLGFLRALYALGPSSSRGYFINSCYAHCQ  339

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            TEVQETW R DSP LA  +IAKA+GDW++D++PFQKIDCPYPCDK+CHNRVF+
Sbjct  340  TEVQETWFRADSPKLANKTIAKALGDWFFDKNPFQKIDCPYPCDKTCHNRVFD  392



>ref|XP_004509522.1| PREDICTED: uncharacterized protein LOC101493258 isoform X1 [Cicer 
arietinum]
 ref|XP_004509523.1| PREDICTED: uncharacterized protein LOC101493258 isoform X2 [Cicer 
arietinum]
Length=400

 Score =   185 bits (469),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            PGVADPHGTW +CKLDI  CS +QL  MQGFR +FL+A+  ++NSPS+G FI+ CYAHCQ
Sbjct  281  PGVADPHGTWRNCKLDINNCSPNQLTTMQGFRTQFLQAISGLSNSPSKGLFIDGCYAHCQ  340

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            T +QETW+R DSPVLA T+IAKAVGDWYYDR  F +IDCPYPC+ +CHNRVF+
Sbjct  341  TGMQETWMRSDSPVLANTTIAKAVGDWYYDRKTFHQIDCPYPCNPTCHNRVFD  393



>ref|XP_010942975.1| PREDICTED: protein notum homolog isoform X1 [Elaeis guineensis]
 ref|XP_010942976.1| PREDICTED: protein notum homolog isoform X1 [Elaeis guineensis]
Length=397

 Score =   184 bits (467),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 90/117 (77%), Gaps = 0/117 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            R   +PGVADPHGTWH CKLDI +CS  QL IMQGFR EFL AL     S S G FINSC
Sbjct  275  RNILVPGVADPHGTWHYCKLDIQQCSSPQLQIMQGFRTEFLNALAGFGRSSSTGMFINSC  334

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVF  293
            YAHCQ+E+QETWL  DSPVL    IAKAVGDW+YDR  FQKIDCPYPCD +CHNR+F
Sbjct  335  YAHCQSEMQETWLSSDSPVLEKMPIAKAVGDWFYDRIAFQKIDCPYPCDSTCHNRIF  391



>ref|XP_010266384.1| PREDICTED: uncharacterized protein LOC104603916 isoform X2 [Nelumbo 
nucifera]
 ref|XP_010266385.1| PREDICTED: uncharacterized protein LOC104603916 isoform X2 [Nelumbo 
nucifera]
Length=391

 Score =   184 bits (466),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 92/117 (79%), Gaps = 1/117 (1%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            R   +PGVADPHG W SCKLDI  CS  QL  MQGFRMEFL AL     S SRG FINSC
Sbjct  273  RNILVPGVADPHGYWLSCKLDIKNCSSIQLQTMQGFRMEFLSALLG-QRSSSRGMFINSC  331

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVF  293
            YAHCQ+E+QETWL+DDSPVL  T IAKAVGDWYYDR  FQKIDCPYPCDKSCHN VF
Sbjct  332  YAHCQSEMQETWLQDDSPVLDNTPIAKAVGDWYYDRRSFQKIDCPYPCDKSCHNHVF  388



>ref|XP_010266381.1| PREDICTED: uncharacterized protein LOC104603915 isoform X2 [Nelumbo 
nucifera]
Length=399

 Score =   184 bits (466),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 93/117 (79%), Gaps = 0/117 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            + +  PGVADPHG WH CKLDI  CS SQL  MQGFR EFL ++G + +S  +G FINSC
Sbjct  275  KNTLAPGVADPHGHWHYCKLDIKNCSSSQLQTMQGFRSEFLNSVGELMSSSMKGMFINSC  334

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVF  293
            YAHCQ+EVQETWLR DSPVL  T IAKAVGDWY DRS F+KIDCPYPCD SCHNRVF
Sbjct  335  YAHCQSEVQETWLRADSPVLDKTPIAKAVGDWYNDRSDFKKIDCPYPCDGSCHNRVF  391



>ref|XP_010266380.1| PREDICTED: uncharacterized protein LOC104603915 isoform X1 [Nelumbo 
nucifera]
Length=412

 Score =   184 bits (466),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 93/117 (79%), Gaps = 0/117 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            + +  PGVADPHG WH CKLDI  CS SQL  MQGFR EFL ++G + +S  +G FINSC
Sbjct  288  KNTLAPGVADPHGHWHYCKLDIKNCSSSQLQTMQGFRSEFLNSVGELMSSSMKGMFINSC  347

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVF  293
            YAHCQ+EVQETWLR DSPVL  T IAKAVGDWY DRS F+KIDCPYPCD SCHNRVF
Sbjct  348  YAHCQSEVQETWLRADSPVLDKTPIAKAVGDWYNDRSDFKKIDCPYPCDGSCHNRVF  404



>ref|XP_006363875.1| PREDICTED: protein notum homolog [Solanum tuberosum]
Length=402

 Score =   183 bits (465),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 96/113 (85%), Gaps = 0/113 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            PGVADP+G W +CKLDILKCS  QL IM G+R+ FL+AL A+  S SRG+FINSC+AHCQ
Sbjct  280  PGVADPYGFWLNCKLDILKCSSRQLQIMHGYRLLFLRALNALGPSSSRGYFINSCFAHCQ  339

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            TEVQETW R DSP LA  +IAKA+GDW+YD++PFQKIDCPYPCDK+CHNR F+
Sbjct  340  TEVQETWYRADSPKLANKTIAKALGDWFYDKNPFQKIDCPYPCDKTCHNRGFD  392



>ref|XP_010266383.1| PREDICTED: uncharacterized protein LOC104603916 isoform X1 [Nelumbo 
nucifera]
Length=434

 Score =   184 bits (467),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 92/117 (79%), Gaps = 1/117 (1%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            R   +PGVADPHG W SCKLDI  CS  QL  MQGFRMEFL AL     S SRG FINSC
Sbjct  316  RNILVPGVADPHGYWLSCKLDIKNCSSIQLQTMQGFRMEFLSALLG-QRSSSRGMFINSC  374

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVF  293
            YAHCQ+E+QETWL+DDSPVL  T IAKAVGDWYYDR  FQKIDCPYPCDKSCHN VF
Sbjct  375  YAHCQSEMQETWLQDDSPVLDNTPIAKAVGDWYYDRRSFQKIDCPYPCDKSCHNHVF  431



>gb|AFK45147.1| unknown [Lotus japonicus]
Length=394

 Score =   183 bits (465),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 94/113 (83%), Gaps = 0/113 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            PGVADPHGTW  CKLDI KCS +QL +MQGFR EFLKA+  V NSPS+G F++ CY+HCQ
Sbjct  280  PGVADPHGTWRDCKLDIKKCSSNQLTVMQGFRTEFLKAISVVENSPSKGMFVDGCYSHCQ  339

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            T +QETW+R DSPVLA T+IAKAVGDW+Y+R  F +IDC YPC+ +CHNRVF+
Sbjct  340  TGMQETWMRSDSPVLANTTIAKAVGDWFYERRSFSQIDCSYPCNPTCHNRVFD  392



>gb|EYU29131.1| hypothetical protein MIMGU_mgv1a007782mg [Erythranthe guttata]
Length=394

 Score =   182 bits (463),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            PGVADPHG WH+CK DI KCS +QL  MQ +R+EFLKAL  + ++ S+G+FINSCYAHCQ
Sbjct  275  PGVADPHGLWHNCKTDIKKCSTTQLQTMQEYRLEFLKALSGLMSAKSKGYFINSCYAHCQ  334

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            TE QETW  + SP+L   +IAKAVGDW+Y+RSPF+KIDCPYPCDK+CHNR+F+
Sbjct  335  TETQETWSTNISPMLNNKTIAKAVGDWFYERSPFEKIDCPYPCDKTCHNRIFD  387



>ref|XP_008238011.1| PREDICTED: protein notum homolog isoform X1 [Prunus mume]
Length=401

 Score =   181 bits (460),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 93/113 (82%), Gaps = 0/113 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            PGVADPHGTWH CKLDI  CS +QL  MQ FR++FL A+G +   P +G FI+SCYAHCQ
Sbjct  281  PGVADPHGTWHECKLDIKNCSPTQLKAMQDFRVQFLSAIGGMTGCPLKGMFIDSCYAHCQ  340

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            TE+QETWL  DSPVL  T+IA+AVGDW+Y R+PFQKIDCPYPC+ SCHNRVF+
Sbjct  341  TELQETWLMADSPVLNKTTIAQAVGDWFYGRTPFQKIDCPYPCNPSCHNRVFD  393



>ref|XP_008238012.1| PREDICTED: protein notum homolog isoform X2 [Prunus mume]
Length=400

 Score =   181 bits (460),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 93/113 (82%), Gaps = 0/113 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            PGVADPHGTWH CKLDI  CS +QL  MQ FR++FL A+G +   P +G FI+SCYAHCQ
Sbjct  280  PGVADPHGTWHECKLDIKNCSPTQLKAMQDFRVQFLSAIGGMTGCPLKGMFIDSCYAHCQ  339

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            TE+QETWL  DSPVL  T+IA+AVGDW+Y R+PFQKIDCPYPC+ SCHNRVF+
Sbjct  340  TELQETWLMADSPVLNKTTIAQAVGDWFYGRTPFQKIDCPYPCNPSCHNRVFD  392



>gb|ACR35075.1| unknown [Zea mays]
Length=271

 Score =   177 bits (450),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 93/118 (79%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            R   +PGVADPHG WHSCK DI +CS SQL ++QGFR +FLK +  + NS SRG FINSC
Sbjct  149  RNILVPGVADPHGKWHSCKHDIDQCSASQLRVLQGFRGDFLKEVAELGNSDSRGLFINSC  208

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            + HCQ+E+QE W   DSPVL  T++A AVGDW++DRS FQKIDCPYPCD +CHNR+++
Sbjct  209  FVHCQSEIQELWFSSDSPVLGNTTVANAVGDWFFDRSSFQKIDCPYPCDSTCHNRIYD  266



>ref|XP_010248193.1| PREDICTED: uncharacterized protein LOC104591101 [Nelumbo nucifera]
Length=394

 Score =   181 bits (458),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 93/113 (82%), Gaps = 1/113 (1%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            PG+ADPHGTWH CKLDI KCSD+QL  +QGFR EFL A+  V  SP++G FINSCY+HCQ
Sbjct  280  PGIADPHGTWHDCKLDITKCSDTQLQAIQGFRKEFLNAIKGVEGSPTKGLFINSCYSHCQ  339

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKID-CPYPCDKSCHNRVF  293
            + +QETWLR+DSPVL   SI+KAVGDWY+DR   QKI+ C YPCDKSCHNRVF
Sbjct  340  SGMQETWLREDSPVLDNMSISKAVGDWYFDRGTVQKIEQCEYPCDKSCHNRVF  392



>ref|XP_007209211.1| hypothetical protein PRUPE_ppa006668mg [Prunus persica]
 ref|XP_007209212.1| hypothetical protein PRUPE_ppa006668mg [Prunus persica]
 gb|EMJ10410.1| hypothetical protein PRUPE_ppa006668mg [Prunus persica]
 gb|EMJ10411.1| hypothetical protein PRUPE_ppa006668mg [Prunus persica]
Length=400

 Score =   181 bits (459),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 93/113 (82%), Gaps = 0/113 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            PGVADPHGTWH CKLDI  CS +QL  MQ FR++FL A+G +   P +G FI+SCYAHCQ
Sbjct  280  PGVADPHGTWHECKLDIKNCSPTQLKAMQDFRVQFLSAVGGMTGCPLKGMFIDSCYAHCQ  339

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            TE+QETWL  DSPVL  T+IA+AVGDW+Y R+PFQKIDCPYPC+ SCHNRVF+
Sbjct  340  TEMQETWLMADSPVLNKTTIAQAVGDWFYGRTPFQKIDCPYPCNPSCHNRVFD  392



>gb|KCW72723.1| hypothetical protein EUGRSUZ_E01170 [Eucalyptus grandis]
Length=392

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 93/113 (82%), Gaps = 0/113 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            PGVAD HGTW SCKLDI KCS +QL IMQ FR+EFL+AL AV  SPSRG FI+SCYAHCQ
Sbjct  280  PGVADRHGTWRSCKLDIKKCSPNQLKIMQDFRLEFLRALSAVGTSPSRGMFIDSCYAHCQ  339

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
               QETWLR+DSPV+A TSIAKAVGDWYY+R   QKIDC YPC+ +CHN +F+
Sbjct  340  AGTQETWLRNDSPVVAKTSIAKAVGDWYYERITSQKIDCAYPCNPTCHNGMFD  392



>ref|XP_006573492.1| PREDICTED: protein notum homolog isoform X2 [Glycine max]
Length=400

 Score =   179 bits (455),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 92/113 (81%), Gaps = 0/113 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            PGVADP G WHSCKLDI  CS  QL +MQGFR EFL+A+  + NS S+G FI+SCYAHCQ
Sbjct  280  PGVADPEGHWHSCKLDINNCSPDQLDLMQGFRTEFLRAITVLGNSSSKGMFIDSCYAHCQ  339

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            TE+QETWLR DSP L  T+IAKAV DW+Y+R PF +IDCPYPC+ +CHNRVF+
Sbjct  340  TEMQETWLRSDSPELKKTTIAKAVADWFYERRPFHQIDCPYPCNPTCHNRVFD  392



>ref|XP_006587657.1| PREDICTED: protein notum homolog isoform X3 [Glycine max]
 gb|KHN11801.1| Protein notum like [Glycine soja]
Length=400

 Score =   179 bits (453),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 92/113 (81%), Gaps = 0/113 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            PGVADP G WHSCKLDI  CS  QL +MQGFR EFL+A+  + NS S+G FI+SCYAHCQ
Sbjct  280  PGVADPEGHWHSCKLDINNCSPDQLDLMQGFRTEFLRAITVLGNSSSKGMFIDSCYAHCQ  339

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            TE+QETWLR DSP L  T+IAKAV DW+Y+R PF +IDCPYPC+ +CHNRVF+
Sbjct  340  TEMQETWLRSDSPELKKTTIAKAVADWFYERRPFHQIDCPYPCNPTCHNRVFD  392



>ref|XP_006573491.1| PREDICTED: protein notum homolog isoform X1 [Glycine max]
Length=447

 Score =   180 bits (456),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 92/113 (81%), Gaps = 0/113 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            PGVADP G WHSCKLDI  CS  QL +MQGFR EFL+A+  + NS S+G FI+SCYAHCQ
Sbjct  280  PGVADPEGHWHSCKLDINNCSPDQLDLMQGFRTEFLRAITVLGNSSSKGMFIDSCYAHCQ  339

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            TE+QETWLR DSP L  T+IAKAV DW+Y+R PF +IDCPYPC+ +CHNRVF+
Sbjct  340  TEMQETWLRSDSPELKKTTIAKAVADWFYERRPFHQIDCPYPCNPTCHNRVFD  392



>gb|KHN41756.1| Protein notum like [Glycine soja]
Length=449

 Score =   179 bits (455),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 92/113 (81%), Gaps = 0/113 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            PGVADP G WHSCKLDI  CS  QL +MQGFR EFL+A+  + NS S+G FI+SCYAHCQ
Sbjct  280  PGVADPEGHWHSCKLDINNCSPDQLDLMQGFRTEFLRAITVLGNSSSKGMFIDSCYAHCQ  339

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            TE+QETWLR DSP L  T+IAKAV DW+Y+R PF +IDCPYPC+ +CHNRVF+
Sbjct  340  TEMQETWLRSDSPELKKTTIAKAVADWFYERRPFHQIDCPYPCNPTCHNRVFD  392



>ref|XP_006587655.1| PREDICTED: protein notum homolog isoform X1 [Glycine max]
Length=453

 Score =   179 bits (455),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 92/113 (81%), Gaps = 0/113 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            PGVADP G WHSCKLDI  CS  QL +MQGFR EFL+A+  + NS S+G FI+SCYAHCQ
Sbjct  283  PGVADPEGHWHSCKLDINNCSPDQLDLMQGFRTEFLRAITVLGNSSSKGMFIDSCYAHCQ  342

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            TE+QETWLR DSP L  T+IAKAV DW+Y+R PF +IDCPYPC+ +CHNRVF+
Sbjct  343  TEMQETWLRSDSPELKKTTIAKAVADWFYERRPFHQIDCPYPCNPTCHNRVFD  395



>ref|XP_006587656.1| PREDICTED: protein notum homolog isoform X2 [Glycine max]
Length=450

 Score =   179 bits (455),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 92/113 (81%), Gaps = 0/113 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            PGVADP G WHSCKLDI  CS  QL +MQGFR EFL+A+  + NS S+G FI+SCYAHCQ
Sbjct  280  PGVADPEGHWHSCKLDINNCSPDQLDLMQGFRTEFLRAITVLGNSSSKGMFIDSCYAHCQ  339

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            TE+QETWLR DSP L  T+IAKAV DW+Y+R PF +IDCPYPC+ +CHNRVF+
Sbjct  340  TEMQETWLRSDSPELKKTTIAKAVADWFYERRPFHQIDCPYPCNPTCHNRVFD  392



>ref|XP_008373439.1| PREDICTED: protein notum homolog isoform X2 [Malus domestica]
 ref|XP_008373440.1| PREDICTED: protein notum homolog isoform X2 [Malus domestica]
Length=438

 Score =   179 bits (454),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 93/113 (82%), Gaps = 0/113 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            PGVADPHGTW +CKLDI  C  +QL  MQ FR +FL A+G V+ S S+G FI+SCYAHCQ
Sbjct  280  PGVADPHGTWQNCKLDITHCKPTQLKTMQDFRAQFLSAIGGVSGSRSKGMFIDSCYAHCQ  339

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            TE+QETWL  DSPVL  T+IAKAVGDW+YDR+PFQKIDCPYPC+ +CHNR F+
Sbjct  340  TELQETWLMPDSPVLNKTTIAKAVGDWFYDRTPFQKIDCPYPCNPTCHNRNFD  392



>gb|EYU29130.1| hypothetical protein MIMGU_mgv1a007782mg [Erythranthe guttata]
Length=395

 Score =   178 bits (451),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 95/114 (83%), Gaps = 1/114 (1%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            PGVADPHG WH+CK DI KCS +QL  MQ +R+EFLKAL  + ++ S+G+FINSCYAHCQ
Sbjct  275  PGVADPHGLWHNCKTDIKKCSTTQLQTMQEYRLEFLKALSGLMSAKSKGYFINSCYAHCQ  334

Query  448  TEVQETWLRDDSPVLAG-TSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            TE QETW  + SP+L    +IAKAVGDW+Y+RSPF+KIDCPYPCDK+CHNR+F+
Sbjct  335  TETQETWSTNISPMLNNKVTIAKAVGDWFYERSPFEKIDCPYPCDKTCHNRIFD  388



>ref|XP_009616254.1| PREDICTED: protein notum homolog [Nicotiana tomentosiformis]
Length=404

 Score =   178 bits (452),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 92/113 (81%), Gaps = 0/113 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            P VADP G W +CKLDIL+CS  QL  MQGFR+ FL+AL  +  S SRG+FINSCYAHCQ
Sbjct  282  PSVADPRGVWRNCKLDILRCSSRQLQTMQGFRLGFLRALITLGPSSSRGYFINSCYAHCQ  341

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            TEVQETW R DSP LA  +IA A+GDW++D++ FQKIDCPYPCDK+CHNRVF+
Sbjct  342  TEVQETWFRADSPKLANKTIAIALGDWFFDKNSFQKIDCPYPCDKTCHNRVFD  394



>ref|XP_008373438.1| PREDICTED: protein notum homolog isoform X1 [Malus domestica]
Length=466

 Score =   179 bits (454),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 93/113 (82%), Gaps = 0/113 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            PGVADPHGTW +CKLDI  C  +QL  MQ FR +FL A+G V+ S S+G FI+SCYAHCQ
Sbjct  308  PGVADPHGTWQNCKLDITHCKPTQLKTMQDFRAQFLSAIGGVSGSRSKGMFIDSCYAHCQ  367

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            TE+QETWL  DSPVL  T+IAKAVGDW+YDR+PFQKIDCPYPC+ +CHNR F+
Sbjct  368  TELQETWLMPDSPVLNKTTIAKAVGDWFYDRTPFQKIDCPYPCNPTCHNRNFD  420



>ref|NP_001151183.1| LOC100284816 precursor [Zea mays]
 gb|ACG41900.1| carboxylic ester hydrolase [Zea mays]
Length=398

 Score =   177 bits (449),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 93/118 (79%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            R   +PGVADPHG WHSCK DI +CS SQL ++QGFR +FLK +  + NS SRG FINSC
Sbjct  276  RNILVPGVADPHGKWHSCKHDIDQCSASQLRVLQGFRGDFLKEVAELGNSDSRGLFINSC  335

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            + HCQ+E+QE W   DSPVL  T++A AVGDW++DRS FQKIDCPYPCD +CHNR+++
Sbjct  336  FVHCQSEIQELWFSSDSPVLGNTTVANAVGDWFFDRSSFQKIDCPYPCDSTCHNRIYD  393



>gb|KHN41567.1| Protein notum like [Glycine soja]
Length=399

 Score =   177 bits (449),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 91/113 (81%), Gaps = 0/113 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            PG ADPHG W  CKLDI  CS +QL +MQGFR +FL+A   V N  S+G FI+ CYAHCQ
Sbjct  280  PGAADPHGQWRECKLDIKNCSPNQLSVMQGFRTDFLRAFSVVGNGASKGHFIDGCYAHCQ  339

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            T +QETWLR+DSPV+A TSIAKAVGDW+YDR PF++IDC YPC+ +CHNR+F+
Sbjct  340  TGIQETWLRNDSPVVAKTSIAKAVGDWFYDRRPFREIDCAYPCNPTCHNRIFD  392



>gb|ACG39759.1| carboxylic ester hydrolase [Zea mays]
Length=398

 Score =   177 bits (449),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 93/118 (79%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            R   +PGVADPHG WHSCK DI +CS SQL ++QGFR +FLK +  + NS SRG FINSC
Sbjct  276  RNILVPGVADPHGKWHSCKHDIDQCSASQLRVLQGFRGDFLKEVAELGNSDSRGLFINSC  335

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            + HCQ+E+QE W   DSPVL  T++A AVGDW++DRS FQKIDCPYPCD +CHNR+++
Sbjct  336  FVHCQSEIQELWFSSDSPVLGNTTVANAVGDWFFDRSSFQKIDCPYPCDSTCHNRIYD  393



>ref|XP_007156330.1| hypothetical protein PHAVU_003G277500g [Phaseolus vulgaris]
 gb|ESW28324.1| hypothetical protein PHAVU_003G277500g [Phaseolus vulgaris]
Length=397

 Score =   177 bits (448),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 90/113 (80%), Gaps = 0/113 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            PG ADPHG W  CKLDI  CS +QL +MQ FR +FL+A GAV NSPS+G FI+ CYAHCQ
Sbjct  278  PGAADPHGQWRECKLDIKNCSPNQLSVMQVFRTDFLRAFGAVGNSPSKGHFIDGCYAHCQ  337

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            T  QETWLR+DSPVL  T+IA+AVGDW+YDR  F +IDC YPC+ +CHNR+F+
Sbjct  338  TGTQETWLRNDSPVLGNTTIARAVGDWFYDRRAFHQIDCAYPCNPTCHNRIFD  390



>ref|XP_007156331.1| hypothetical protein PHAVU_003G277500g [Phaseolus vulgaris]
 gb|ESW28325.1| hypothetical protein PHAVU_003G277500g [Phaseolus vulgaris]
Length=417

 Score =   177 bits (448),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 90/113 (80%), Gaps = 0/113 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            PG ADPHG W  CKLDI  CS +QL +MQ FR +FL+A GAV NSPS+G FI+ CYAHCQ
Sbjct  298  PGAADPHGQWRECKLDIKNCSPNQLSVMQVFRTDFLRAFGAVGNSPSKGHFIDGCYAHCQ  357

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            T  QETWLR+DSPVL  T+IA+AVGDW+YDR  F +IDC YPC+ +CHNR+F+
Sbjct  358  TGTQETWLRNDSPVLGNTTIARAVGDWFYDRRAFHQIDCAYPCNPTCHNRIFD  410



>ref|XP_010056135.1| PREDICTED: protein notum homolog [Eucalyptus grandis]
Length=392

 Score =   175 bits (444),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 92/113 (81%), Gaps = 0/113 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            PGVADPHGTW+SCKLDI KCS +QL IMQ FR+EFL+AL AV  SPSRG FI+SC  HCQ
Sbjct  280  PGVADPHGTWNSCKLDIKKCSPNQLKIMQDFRLEFLRALSAVGTSPSRGMFIDSCNTHCQ  339

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
               + TWLR+DSP++A TSIAKAVGDWYY+R   QKIDC YPC+ +CHN +F+
Sbjct  340  AGTEATWLRNDSPIVAKTSIAKAVGDWYYERITSQKIDCAYPCNPTCHNGMFD  392



>gb|KCW72721.1| hypothetical protein EUGRSUZ_E01170 [Eucalyptus grandis]
Length=392

 Score =   175 bits (444),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 92/113 (81%), Gaps = 0/113 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            PGVADPHGTW+SCKLDI KCS +QL IMQ FR+EFL+AL AV  SPSRG FI+SC  HCQ
Sbjct  280  PGVADPHGTWNSCKLDIKKCSPNQLKIMQDFRLEFLRALSAVGTSPSRGMFIDSCNTHCQ  339

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
               + TWLR+DSP++A TSIAKAVGDWYY+R   QKIDC YPC+ +CHN +F+
Sbjct  340  AGTEATWLRNDSPIVAKTSIAKAVGDWYYERITSQKIDCAYPCNPTCHNGMFD  392



>ref|XP_007158098.1| hypothetical protein PHAVU_002G123900g [Phaseolus vulgaris]
 gb|ESW30092.1| hypothetical protein PHAVU_002G123900g [Phaseolus vulgaris]
Length=400

 Score =   175 bits (444),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 90/113 (80%), Gaps = 0/113 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            PGVADP G WHSCKLDI  CS  QL +MQGFR EFL+AL  + NS  +G FI+SCYAHCQ
Sbjct  280  PGVADPEGHWHSCKLDINNCSPDQLDLMQGFRTEFLRALTVLGNSSYKGMFIDSCYAHCQ  339

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            TE+QETWLR+DSP L  T+IAKAV DW+Y+R  F +IDCPYPC+ +CHNRV E
Sbjct  340  TEMQETWLRNDSPELEKTTIAKAVADWFYERRTFHQIDCPYPCNPTCHNRVLE  392



>ref|XP_006599203.1| PREDICTED: uncharacterized protein LOC100781246 isoform X1 [Glycine 
max]
 ref|XP_006599204.1| PREDICTED: uncharacterized protein LOC100781246 isoform X2 [Glycine 
max]
 ref|XP_006599205.1| PREDICTED: uncharacterized protein LOC100781246 isoform X3 [Glycine 
max]
Length=399

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 91/113 (81%), Gaps = 0/113 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            PG ADP G W  CKLDI  CS +QL +MQGFR +FL+A   V N+ S+G FI+ CYAHCQ
Sbjct  280  PGAADPRGQWRECKLDIKNCSPNQLSVMQGFRTDFLRAFSVVGNAASKGHFIDGCYAHCQ  339

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            T +QETWLR+DSPV+A TSIAKAVGDW+YDR PF++IDC YPC+ +CHNR+F+
Sbjct  340  TGIQETWLRNDSPVVAKTSIAKAVGDWFYDRRPFREIDCAYPCNPTCHNRIFD  392



>ref|XP_004953590.1| PREDICTED: protein notum homolog isoform X1 [Setaria italica]
Length=401

 Score =   173 bits (439),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 92/118 (78%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            R   +PGVAD  GTWHSCK DI +CS +QL ++QGFR +FLKA+    NS SRG FINSC
Sbjct  279  RNILVPGVADRRGTWHSCKHDIDQCSAAQLRVLQGFRDDFLKAVAEQGNSTSRGLFINSC  338

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            + HCQ+E+QE W   DSP+L  T+IA AVGDW++DRSPFQKIDCPYPCD +CHNR+ +
Sbjct  339  FVHCQSEIQELWFSSDSPMLGNTTIAAAVGDWFFDRSPFQKIDCPYPCDSTCHNRIHD  396



>ref|XP_006361581.1| PREDICTED: protein notum homolog [Solanum tuberosum]
Length=387

 Score =   172 bits (436),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 89/107 (83%), Gaps = 0/107 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            P VADPHGTW +CKLDIL CS +QL  MQ FR EFLKAL ++  S +RG++INSCYAHCQ
Sbjct  280  PEVADPHGTWRNCKLDILNCSSTQLQTMQAFRSEFLKALNSLGPSSTRGYYINSCYAHCQ  339

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSC  308
            T  QETWL DDS VL+GT+IAKAVGDWYY+R  FQ+IDCPYPC+K+C
Sbjct  340  TGTQETWLMDDSLVLSGTTIAKAVGDWYYERKRFQEIDCPYPCNKTC  386



>gb|KCW72722.1| hypothetical protein EUGRSUZ_E01170 [Eucalyptus grandis]
Length=392

 Score =   171 bits (434),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 90/113 (80%), Gaps = 0/113 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            PGVAD HGTW SCKLDI KCS +QL IMQ FR+EFL+AL AV  SPSRG FI+SC  HCQ
Sbjct  280  PGVADRHGTWRSCKLDIKKCSPNQLKIMQDFRLEFLRALSAVGTSPSRGMFIDSCNTHCQ  339

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
               + TWLR+DSP++A TSIAKAVGDWYY+R   QKIDC YPC+ +CHN +F+
Sbjct  340  AGTEATWLRNDSPIVAKTSIAKAVGDWYYERITSQKIDCAYPCNPTCHNGMFD  392



>gb|EPS71696.1| hypothetical protein M569_03061, partial [Genlisea aurea]
Length=395

 Score =   171 bits (434),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 95/119 (80%), Gaps = 6/119 (5%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALG-----AVANSPS-RGFFINS  467
            PGVADPHGTWH CK DI KCS SQL  MQ FR +FLK+L      ++ ++PS +G+FINS
Sbjct  271  PGVADPHGTWHDCKTDITKCSKSQLQTMQDFRTQFLKSLNDGVGSSLTSTPSSKGYFINS  330

Query  466  CYAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            CYAHCQTE+QETW R DSP+L   +IA+A+GDW++DR+ FQ IDC YPCDK+CHNR+F+
Sbjct  331  CYAHCQTEMQETWFRSDSPLLNDKTIAEAIGDWFFDRNSFQHIDCAYPCDKTCHNRIFD  389



>gb|AGT16732.1| carboxylic ester hydrolase [Saccharum hybrid cultivar R570]
Length=398

 Score =   171 bits (434),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 91/118 (77%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            R   +PGVADPHG WHSCK DI +CS SQL ++QGFR +FLK +     S SRG FINSC
Sbjct  276  RNILVPGVADPHGQWHSCKHDIGQCSASQLRVLQGFRGDFLKEVSEQWISDSRGLFINSC  335

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            + HCQ+E QE WL  DSP+L  T+IA AVGDW++DRS FQKIDCPYPCD +CHNR++E
Sbjct  336  FVHCQSESQELWLSSDSPMLGNTTIANAVGDWFFDRSTFQKIDCPYPCDSTCHNRIYE  393



>gb|EYU37455.1| hypothetical protein MIMGU_mgv1a007934mg [Erythranthe guttata]
Length=390

 Score =   170 bits (430),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 81/118 (69%), Positives = 91/118 (77%), Gaps = 7/118 (6%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKA----LGAVANSPSRGFFINSCY  461
            PGVADPHG WH CK DI KCS  QL  MQGFR+EFLKA    LG + N+  RG+FINSCY
Sbjct  274  PGVADPHGIWHDCKTDITKCSTDQLRTMQGFRLEFLKAISSGLGPLINT--RGYFINSCY  331

Query  460  AHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRS-PFQKIDCPYPCDKSCHNRVFE  290
            AHCQTE+QE W   DSP L   +IAKAVGDW+YD S PFQ+ DCPYPCDK+CHNRVF+
Sbjct  332  AHCQTEMQENWFAIDSPKLNNKTIAKAVGDWFYDTSEPFQRGDCPYPCDKTCHNRVFD  389



>ref|XP_002454426.1| hypothetical protein SORBIDRAFT_04g030720 [Sorghum bicolor]
 gb|EES07402.1| hypothetical protein SORBIDRAFT_04g030720 [Sorghum bicolor]
Length=398

 Score =   170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 89/118 (75%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            R   +PGVADPHG WHSCK DI +CS SQL ++QGFR +FLK +   ANS SRG FINSC
Sbjct  276  RNILVPGVADPHGKWHSCKHDIGQCSASQLRVLQGFRGDFLKEVSEQANSDSRGLFINSC  335

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            + HCQ+E QE W   DSP L  T+IA AVGDW++ RS FQKIDCPYPCD +CHN ++E
Sbjct  336  FVHCQSESQELWFSSDSPKLGNTTIANAVGDWFFGRSSFQKIDCPYPCDSTCHNGIYE  393



>ref|XP_004300391.1| PREDICTED: pectin acetylesterase 8-like [Fragaria vesca subsp. 
vesca]
 ref|XP_011465290.1| PREDICTED: pectin acetylesterase 8-like [Fragaria vesca subsp. 
vesca]
 ref|XP_011465291.1| PREDICTED: pectin acetylesterase 8-like [Fragaria vesca subsp. 
vesca]
Length=399

 Score =   169 bits (428),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 92/114 (81%), Gaps = 0/114 (0%)
 Frame = -2

Query  631  LPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHC  452
            +PGVADPHGTW +CKLDI  CS +QL  MQ FR++FL A+G V+NS  +G FI+SCY HC
Sbjct  280  VPGVADPHGTWRNCKLDIKNCSPTQLKTMQNFRLQFLSAIGGVSNSAVKGMFIDSCYLHC  339

Query  451  QTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            QTE+QETW   +SP+L  T+IA+AVGDW+YDR+ FQKIDCPYPC+ +CH  +F+
Sbjct  340  QTELQETWSMPNSPLLNKTTIARAVGDWFYDRTSFQKIDCPYPCNPTCHAPIFD  393



>ref|XP_009413211.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
Length=397

 Score =   169 bits (428),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 86/113 (76%), Gaps = 0/113 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            P  ADPH TW+ CKLDI +CS  QL IMQGFR EFL AL A+ NS +RG FINSCYAHCQ
Sbjct  285  PSAADPHKTWNDCKLDIKQCSSDQLQIMQGFRSEFLNALAALGNSSARGMFINSCYAHCQ  344

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +  Q+TWL  DSP L    I KAVGDW+YDRS F+KIDCPYPCD SC NRV++
Sbjct  345  SGSQDTWLAADSPALDNIPIGKAVGDWFYDRSAFRKIDCPYPCDSSCRNRVYD  397



>ref|XP_008246070.1| PREDICTED: uncharacterized protein LOC103344226, partial [Prunus 
mume]
Length=161

 Score =   162 bits (409),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 86/113 (76%), Gaps = 0/113 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            PG+ADP G W  CKLDI  CS SQL  MQ +R++FL AL   ++S S G FI+SCYAHCQ
Sbjct  43   PGIADPKGAWKKCKLDIKNCSPSQLQTMQEYRLQFLGALSQASSSTSHGLFIDSCYAHCQ  102

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
               QETWL  DSPVL+ T+I KAVGDWY+DR+PFQKIDC YPC+ +C NRVF+
Sbjct  103  IGTQETWLAADSPVLSKTTIGKAVGDWYHDRTPFQKIDCAYPCNPTCKNRVFD  155



>ref|NP_001047850.1| Os02g0702400 [Oryza sativa Japonica Group]
 dbj|BAD07550.1| putative pectin acetylesterase [Oryza sativa Japonica Group]
 dbj|BAD08059.1| putative pectin acetylesterase [Oryza sativa Japonica Group]
 dbj|BAF09764.1| Os02g0702400 [Oryza sativa Japonica Group]
 dbj|BAG91018.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57637.1| hypothetical protein OsJ_08062 [Oryza sativa Japonica Group]
Length=397

 Score =   168 bits (425),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 88/118 (75%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            R   +PG ADPHG WHSCK DI +C  SQL I+QGFR +FLKAL       +RG FINSC
Sbjct  275  RNILVPGFADPHGKWHSCKHDIDQCPASQLQILQGFRDDFLKALKEQGTPSTRGLFINSC  334

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            + HCQ+E QETW    SP+L   +IA AVGDW+YDR+PFQKIDCPYPCD +CHNR+++
Sbjct  335  FVHCQSETQETWFASGSPMLETKTIADAVGDWFYDRNPFQKIDCPYPCDSTCHNRIYD  392



>ref|XP_008808370.1| PREDICTED: uncharacterized protein LOC103720446 isoform X3 [Phoenix 
dactylifera]
Length=401

 Score =   167 bits (424),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 85/113 (75%), Gaps = 0/113 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            P  +DP   W  CKLDI KCS +QL +MQGFR +FL AL    +S S G FINSCYAHCQ
Sbjct  284  PSPSDPRKVWGECKLDIKKCSSNQLQVMQGFRTQFLNALAGFGSSSSTGMFINSCYAHCQ  343

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +E+QETWL  +SPVL    IAKAVGDW+YDR  FQKIDCPYPCD +CHNR+FE
Sbjct  344  SEMQETWLSSNSPVLEKIPIAKAVGDWFYDRIAFQKIDCPYPCDSTCHNRIFE  396



>ref|XP_003547731.1| PREDICTED: protein notum homolog isoform X1 [Glycine max]
 ref|XP_006599118.1| PREDICTED: protein notum homolog isoform X2 [Glycine max]
Length=398

 Score =   167 bits (423),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 91/118 (77%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            R  ++PG ADP  +WHSCK++I  CS  QL  +QGF+ EF +AL  V +SPS+G FI+SC
Sbjct  274  RNIFIPGSADPSNSWHSCKINISNCSTDQLSKIQGFKSEFERALSEVGDSPSKGMFIDSC  333

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            YAHCQTE+QETWL+ DSP LA T+IAKAVGDW+Y RS F  +DC +PC+ +CHNRVF 
Sbjct  334  YAHCQTELQETWLKSDSPQLANTTIAKAVGDWFYGRSSFHHVDCNFPCNPTCHNRVFN  391



>gb|KHG23649.1| Notum [Gossypium arboreum]
Length=381

 Score =   167 bits (422),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 89/118 (75%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            R    PG+ADPHG W SCKLDI  C  SQ+ +MQ FR++FL AL  +  S SRG FI+SC
Sbjct  257  RNILAPGIADPHGHWESCKLDIKNCLPSQIKVMQDFRLQFLVALLRLGKSASRGMFIDSC  316

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +AHCQTE+QE W   DSP+L  T I KAVGDW+YDR+PFQKIDC YPC+ +CHNRV++
Sbjct  317  FAHCQTEMQELWFMQDSPLLNKTKIGKAVGDWFYDRNPFQKIDCAYPCNPTCHNRVYD  374



>gb|KHG23648.1| Notum [Gossypium arboreum]
Length=395

 Score =   167 bits (422),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 89/118 (75%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            R    PG+ADPHG W SCKLDI  C  SQ+ +MQ FR++FL AL  +  S SRG FI+SC
Sbjct  271  RNILAPGIADPHGHWESCKLDIKNCLPSQIKVMQDFRLQFLVALLRLGKSASRGMFIDSC  330

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +AHCQTE+QE W   DSP+L  T I KAVGDW+YDR+PFQKIDC YPC+ +CHNRV++
Sbjct  331  FAHCQTEMQELWFMQDSPLLNKTKIGKAVGDWFYDRNPFQKIDCAYPCNPTCHNRVYD  388



>gb|KHN27509.1| Protein notum like [Glycine soja]
Length=398

 Score =   167 bits (422),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 91/118 (77%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            R  ++PG ADP  +WHSCK++I  CS  QL  +QGF+ EF +AL  V +SPS+G FI+SC
Sbjct  274  RNIFIPGSADPSNSWHSCKINISNCSTDQLSKIQGFKSEFERALSEVGDSPSKGVFIDSC  333

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            YAHCQTE+QETWL+ DSP LA T+IAKAVGDW+Y RS F  +DC +PC+ +CHNRVF 
Sbjct  334  YAHCQTELQETWLKSDSPQLANTTIAKAVGDWFYGRSSFHHVDCNFPCNPTCHNRVFN  391



>gb|ABK24433.1| unknown [Picea sitchensis]
Length=399

 Score =   166 bits (420),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 87/112 (78%), Gaps = 0/112 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            PGVADPHG WH+CKLDI KCS +QL  MQGFR+E L AL    NS S G FINSCYAHCQ
Sbjct  283  PGVADPHGLWHNCKLDIKKCSPNQLETMQGFRLEMLNALKIFQNSASGGMFINSCYAHCQ  342

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVF  293
            +E+QETWL +DSP L G SIA+AV +WY+ +   ++ DCPYPCD +CHNRVF
Sbjct  343  SEMQETWLANDSPKLNGLSIAEAVQNWYFGQGIVKETDCPYPCDSTCHNRVF  394



>gb|ABK24994.1| unknown [Picea sitchensis]
Length=399

 Score =   166 bits (420),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 87/112 (78%), Gaps = 0/112 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            PGVADPHG WH+CKLDI KCS +QL  MQGFR+E L AL    NS S G FINSCYAHCQ
Sbjct  283  PGVADPHGLWHNCKLDIKKCSPNQLETMQGFRLEMLNALKIFQNSASGGMFINSCYAHCQ  342

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVF  293
            +E+QETWL +DSP L G SIA+AV +WY+ +   ++ DCPYPCD +CHNRVF
Sbjct  343  SEMQETWLANDSPKLNGLSIAEAVQNWYFGQGIVKETDCPYPCDSTCHNRVF  394



>ref|XP_002519911.1| pectin acetylesterase, putative [Ricinus communis]
 gb|EEF42515.1| pectin acetylesterase, putative [Ricinus communis]
Length=399

 Score =   166 bits (420),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 76/109 (70%), Positives = 85/109 (78%), Gaps = 0/109 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            PGVADP G+W+SCKLDI  CS  QL  MQ FRM FL AL   ANS S+G +I+SCYAHCQ
Sbjct  280  PGVADPRGSWNSCKLDINNCSPIQLKTMQDFRMRFLSALYRSANSSSKGLYIDSCYAHCQ  339

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHN  302
            TE QETW   DSPVL+ T IAKAVGDW+YDR PFQKIDCPYPC+ +C N
Sbjct  340  TETQETWFMADSPVLSKTKIAKAVGDWFYDRIPFQKIDCPYPCNPTCSN  388



>ref|XP_007040902.1| Pectinacetylesterase family protein [Theobroma cacao]
 gb|EOY25403.1| Pectinacetylesterase family protein [Theobroma cacao]
Length=401

 Score =   166 bits (419),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 89/118 (75%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            R    PG+ADP G W SCKLDI  C  SQ+  MQ FR++FL AL  +  S SRG FI+SC
Sbjct  275  RNILAPGIADPRGYWESCKLDIKNCLPSQIKTMQDFRLQFLVALLRLGKSSSRGMFIDSC  334

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            YAHCQTE+Q  WL  DSP+L  TSIAKAVGDW+YDR+PFQKIDC YPC+ +CHNR++E
Sbjct  335  YAHCQTEMQGLWLMPDSPLLNKTSIAKAVGDWFYDRNPFQKIDCAYPCNPTCHNRIYE  392



>ref|XP_006647750.1| PREDICTED: uncharacterized protein LOC102707556 [Oryza brachyantha]
Length=304

 Score =   162 bits (411),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 87/118 (74%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            R    PG ADPHG WHSCK DI +C  SQL I+QGFR +FL+AL    +  +RG FINSC
Sbjct  183  RNILAPGFADPHGKWHSCKGDIEQCPASQLQILQGFRNDFLEALEEQGSPSTRGLFINSC  242

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            + HCQ+E+QE W    +P+L   +IA AVGDW+YDRSPFQKIDC YPCD +CHNR+++
Sbjct  243  FVHCQSEMQEIWFASGAPMLGNKTIADAVGDWFYDRSPFQKIDCAYPCDSTCHNRIYD  300



>ref|XP_009398466.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
 ref|XP_009398467.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
 ref|XP_009398468.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
 ref|XP_009398469.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
Length=395

 Score =   164 bits (416),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = -2

Query  631  LPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHC  452
            +P VAD HG+WH+CKLDI  CS +QL IMQ FR+EFL A+  +    SRG FINSCYAHC
Sbjct  277  VPTVADRHGSWHNCKLDIKLCSSAQLQIMQEFRLEFLNAVNGLGTPSSRGLFINSCYAHC  336

Query  451  QTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHN  302
            Q+E+QETWL  +SP+L    IA+AVGDW+Y+RS FQKIDCPYPCD +CHN
Sbjct  337  QSEMQETWLLPNSPMLDKIPIAEAVGDWFYNRSAFQKIDCPYPCDSTCHN  386



>gb|EEC73846.1| hypothetical protein OsI_08601 [Oryza sativa Indica Group]
Length=291

 Score =   162 bits (409),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 87/118 (74%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            R   +PG ADPHG WHSCK DI +C  SQL I+QGFR +FLKAL       +RG FINSC
Sbjct  169  RNILVPGFADPHGKWHSCKHDIDQCPASQLQILQGFRDDFLKALKEQGTPSTRGLFINSC  228

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            + HCQ+E QETW    SP+L   +IA AVGD +Y+R+PFQKIDCPYPCD +CHNR+++
Sbjct  229  FVHCQSETQETWFASGSPMLETKTIADAVGDRFYERNPFQKIDCPYPCDSTCHNRIYD  286



>ref|XP_010676220.1| PREDICTED: uncharacterized protein LOC104892094 [Beta vulgaris 
subsp. vulgaris]
Length=439

 Score =   164 bits (414),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 83/113 (73%), Gaps = 0/113 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            P VADP G W  CK+DI  CS +QL +MQ FR EFL A+  +  SPSRG FINSCYAHCQ
Sbjct  280  PVVADPRGLWSDCKIDIKNCSTNQLSVMQDFRSEFLNAISKLGKSPSRGLFINSCYAHCQ  339

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            TE+QETW    SPVL  T+IAKAVGDW+Y+R   Q IDC YPCD SC NR+FE
Sbjct  340  TEMQETWFSHHSPVLHKTTIAKAVGDWFYNRRQLQMIDCAYPCDGSCQNRIFE  392



>dbj|BAD94548.1| pectinacetylesterase like protein [Arabidopsis thaliana]
Length=195

 Score =   157 bits (397),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 84/112 (75%), Gaps = 0/112 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            P  ADP+G W SC+LDI  C  SQ+ +MQ FR+EFL A+  +  S SRG FI+SCY HCQ
Sbjct  76   PRAADPYGKWQSCQLDIKNCHPSQIKVMQDFRLEFLSAVIGLGRSSSRGMFIDSCYTHCQ  135

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVF  293
            TE Q +W   DSP+L  T+IAKAVGDW YDR+ FQKIDCPYPC+ +CH+RVF
Sbjct  136  TETQTSWFWQDSPILNRTTIAKAVGDWVYDRTLFQKIDCPYPCNPTCHHRVF  187



>ref|XP_008372432.1| PREDICTED: uncharacterized protein LOC103435796 [Malus domestica]
Length=156

 Score =   156 bits (394),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 86/113 (76%), Gaps = 0/113 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            PGVADP G W +CKL I  CS SQL  MQ +R++FL A+   ++S S G FI+SCYAHCQ
Sbjct  38   PGVADPKGAWKNCKLSIKNCSPSQLQTMQEYRLQFLNAVAGASSSSSNGLFIDSCYAHCQ  97

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
               QETWL  DSP+L+ T+IAKAVGDWYYDR+PF+ IDCPYPC+ +C NR F+
Sbjct  98   IGTQETWLATDSPMLSKTTIAKAVGDWYYDRTPFKNIDCPYPCNPTCKNREFD  150



>emb|CDY09288.1| BnaC03g63180D [Brassica napus]
Length=186

 Score =   157 bits (396),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 83/112 (74%), Gaps = 0/112 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            P  ADP+G W SC+LDI  C  +QL +MQ FR+EFL A+  +  S SRG FI+SCY HCQ
Sbjct  67   PRAADPYGKWQSCQLDIKNCQPNQLKVMQDFRLEFLSAVIGLGRSSSRGMFIDSCYTHCQ  126

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVF  293
            TE Q +W   DSP+L  T+IAKAVGDW YDR  FQKIDCPYPC+ +CH+RVF
Sbjct  127  TETQTSWFWQDSPILNRTTIAKAVGDWVYDRKLFQKIDCPYPCNPTCHHRVF  178



>gb|KJB24941.1| hypothetical protein B456_004G175900 [Gossypium raimondii]
Length=400

 Score =   162 bits (411),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 87/118 (74%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            R    PG+ADPHG W SCKLDI  C  SQ+ +MQ FR++FL AL  +  S SRG FI+SC
Sbjct  276  RNILAPGIADPHGHWESCKLDIKNCLPSQIKVMQDFRLQFLVALLRLGKSASRGMFIDSC  335

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +AHCQTE+Q  W   DSP+L  T I KAVGDW+YD+ PFQKIDC YPC+ +CHNRV++
Sbjct  336  FAHCQTEMQGLWFMQDSPLLNKTKIGKAVGDWFYDKKPFQKIDCAYPCNPTCHNRVYD  393



>gb|AFK37852.1| unknown [Lotus japonicus]
Length=399

 Score =   162 bits (409),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 83/112 (74%), Gaps = 0/112 (0%)
 Frame = -2

Query  625  GVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQT  446
            G ADPHG WH+CKLDI  CS  QL  +QGFR EF+KAL    NS S G FI+SCY HCQT
Sbjct  281  GSADPHGIWHNCKLDINNCSPDQLTAIQGFRTEFIKALSVTENSRSEGMFIDSCYVHCQT  340

Query  445  EVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            E QE+WL  DSP LA T + KAVGDW+Y+RSPFQKIDC +PC+ +C N  F+
Sbjct  341  ETQESWLSSDSPQLANTKLGKAVGDWFYERSPFQKIDCSFPCNPTCRNLAFD  392



>ref|XP_006385135.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa]
 gb|ERP62932.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa]
Length=367

 Score =   161 bits (407),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/114 (64%), Positives = 82/114 (72%), Gaps = 0/114 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            R    P +ADP G W SCKLDI  CS  QL  MQ FR++FL AL    NS SRG +I+SC
Sbjct  243  RNILAPSIADPLGVWKSCKLDINNCSPLQLKSMQDFRLQFLNALNKSTNSSSRGLYIDSC  302

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHN  302
            YAHCQTE QE W  +DSPVL    IAKAVGDW+YDR+PFQKIDCPYPC+ SC N
Sbjct  303  YAHCQTETQEKWFMEDSPVLGKKKIAKAVGDWFYDRNPFQKIDCPYPCNPSCQN  356



>ref|XP_010054028.1| PREDICTED: uncharacterized protein LOC104442333 isoform X2 [Eucalyptus 
grandis]
 gb|KCW78411.1| hypothetical protein EUGRSUZ_D02577 [Eucalyptus grandis]
Length=400

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 94/113 (83%), Gaps = 0/113 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            PGVADP GTWH C+LDI  CS +QL +MQ FR+EF+ +LG + +S SRG FI+SCYAHCQ
Sbjct  281  PGVADPQGTWHGCELDINNCSPNQLKVMQDFRLEFMYSLGRLGSSSSRGLFIDSCYAHCQ  340

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +E QETWL  DSPVLA TSIA+AVGDW++DR PFQKIDC YPC+ +CHNRVF+
Sbjct  341  SETQETWLWGDSPVLAKTSIARAVGDWFFDRKPFQKIDCAYPCNPTCHNRVFD  393



>dbj|BAH57249.1| AT4G19420 [Arabidopsis thaliana]
Length=246

 Score =   157 bits (398),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 84/112 (75%), Gaps = 0/112 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            P  ADP+G W SC+LDI  C  SQ+ +MQ FR+EFL A+  +  S SRG FI+SCY HCQ
Sbjct  127  PRAADPYGKWQSCQLDIKNCHPSQIKVMQDFRLEFLSAVIGLGRSSSRGMFIDSCYTHCQ  186

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVF  293
            TE Q +W   DSP+L  T+IAKAVGDW YDR+ FQKIDCPYPC+ +CH+RVF
Sbjct  187  TETQTSWFWQDSPILNRTTIAKAVGDWVYDRTLFQKIDCPYPCNPTCHHRVF  238



>ref|XP_010054026.1| PREDICTED: uncharacterized protein LOC104442333 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010054027.1| PREDICTED: uncharacterized protein LOC104442333 isoform X1 [Eucalyptus 
grandis]
Length=434

 Score =   162 bits (409),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 94/113 (83%), Gaps = 0/113 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            PGVADP GTWH C+LDI  CS +QL +MQ FR+EF+ +LG + +S SRG FI+SCYAHCQ
Sbjct  315  PGVADPQGTWHGCELDINNCSPNQLKVMQDFRLEFMYSLGRLGSSSSRGLFIDSCYAHCQ  374

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +E QETWL  DSPVLA TSIA+AVGDW++DR PFQKIDC YPC+ +CHNRVF+
Sbjct  375  SETQETWLWGDSPVLAKTSIARAVGDWFFDRKPFQKIDCAYPCNPTCHNRVFD  427



>ref|XP_006282674.1| hypothetical protein CARUB_v10005284mg [Capsella rubella]
 gb|EOA15572.1| hypothetical protein CARUB_v10005284mg [Capsella rubella]
Length=317

 Score =   159 bits (402),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 84/112 (75%), Gaps = 0/112 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            P  ADP+G W SC+LDI  C  SQL +MQ FR+EFL A+  +  S SRG FI+SCY HCQ
Sbjct  198  PRAADPYGKWQSCQLDIKNCHPSQLKVMQDFRLEFLSAVIGLGRSSSRGMFIDSCYTHCQ  257

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVF  293
            TE Q +W   DSP+L  T+IAKAVGDW YDR+ FQKIDCPYPC+ +CH+RVF
Sbjct  258  TETQTSWFWQDSPILNRTTIAKAVGDWVYDRTLFQKIDCPYPCNPTCHHRVF  309



>ref|XP_007209217.1| hypothetical protein PRUPE_ppa006718mg [Prunus persica]
 gb|EMJ10416.1| hypothetical protein PRUPE_ppa006718mg [Prunus persica]
 gb|AIA21744.1| pectin acetylesterase [Prunus persica]
Length=398

 Score =   160 bits (405),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 85/113 (75%), Gaps = 0/113 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            PG+ADP G W  CKLDI  CS SQL  MQ +R++FL AL   ++S + G FI+SCYAHCQ
Sbjct  280  PGIADPKGAWKKCKLDIKNCSPSQLQTMQEYRLQFLGALSHASSSTTHGLFIDSCYAHCQ  339

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
               QETWL  DSPVL+ T+I KAVGDWY DR+PFQKIDC YPC+ +C NRVF+
Sbjct  340  IGTQETWLAADSPVLSKTTIGKAVGDWYTDRTPFQKIDCAYPCNPTCKNRVFD  392



>ref|XP_006385137.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa]
 ref|XP_006385139.1| pectinacetylesterase family protein [Populus trichocarpa]
 gb|ERP62934.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa]
 gb|ERP62936.1| pectinacetylesterase family protein [Populus trichocarpa]
Length=399

 Score =   160 bits (405),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 73/114 (64%), Positives = 82/114 (72%), Gaps = 0/114 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            R    P +ADP G W SCKLDI  CS  QL  MQ FR++FL AL    NS SRG +I+SC
Sbjct  275  RNILAPSIADPLGVWKSCKLDINNCSPLQLKSMQDFRLQFLNALNKSTNSSSRGLYIDSC  334

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHN  302
            YAHCQTE QE W  +DSPVL    IAKAVGDW+YDR+PFQKIDCPYPC+ SC N
Sbjct  335  YAHCQTETQEKWFMEDSPVLGKKKIAKAVGDWFYDRNPFQKIDCPYPCNPSCQN  388



>ref|XP_006385138.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa]
 gb|ERP62935.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa]
Length=402

 Score =   160 bits (405),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 73/114 (64%), Positives = 82/114 (72%), Gaps = 0/114 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            R    P +ADP G W SCKLDI  CS  QL  MQ FR++FL AL    NS SRG +I+SC
Sbjct  278  RNILAPSIADPLGVWKSCKLDINNCSPLQLKSMQDFRLQFLNALNKSTNSSSRGLYIDSC  337

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHN  302
            YAHCQTE QE W  +DSPVL    IAKAVGDW+YDR+PFQKIDCPYPC+ SC N
Sbjct  338  YAHCQTETQEKWFMEDSPVLGKKKIAKAVGDWFYDRNPFQKIDCPYPCNPSCQN  391



>ref|XP_010439718.1| PREDICTED: protein notum homolog [Camelina sativa]
Length=397

 Score =   159 bits (402),  Expect(2) = 7e-43, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 85/112 (76%), Gaps = 0/112 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            P  ADP+G W SC+LDI  C  SQL +MQ FR+EFL A+ ++  S SRG FI+SCY HCQ
Sbjct  278  PRAADPYGKWQSCQLDIKNCHPSQLKVMQDFRLEFLSAVISLGRSSSRGMFIDSCYTHCQ  337

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVF  293
            TE Q +W   DSP+L  T+IAKAVGDW YDR+ FQKIDCPYPC+ +CH+RVF
Sbjct  338  TETQTSWFWQDSPILNRTTIAKAVGDWVYDRTLFQKIDCPYPCNPTCHHRVF  389


 Score = 42.4 bits (98),  Expect(2) = 7e-43, Method: Compositional matrix adjust.
 Identities = 17/26 (65%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = -1

Query  695  IQTXLFLVNSAYDSWQVKNILAXRGS  618
            I+T LF++N+AYDSWQ+KNILA R +
Sbjct  256  IRTPLFILNAAYDSWQIKNILAPRAA  281



>dbj|BAH20235.1| AT4G19420 [Arabidopsis thaliana]
Length=305

 Score =   158 bits (399),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 84/112 (75%), Gaps = 0/112 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            P  ADP+G W SC+LDI  C  SQ+ +MQ FR+EFL A+  +  S SRG FI+SCY HCQ
Sbjct  186  PRAADPYGKWQSCQLDIKNCHPSQIKVMQDFRLEFLSAVIGLGRSSSRGMFIDSCYTHCQ  245

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVF  293
            TE Q +W   DSP+L  T+IAKAVGDW YDR+ FQKIDCPYPC+ +CH+RVF
Sbjct  246  TETQTSWFWQDSPILNRTTIAKAVGDWVYDRTLFQKIDCPYPCNPTCHHRVF  297



>ref|XP_011028483.1| PREDICTED: uncharacterized protein LOC105128479 isoform X3 [Populus 
euphratica]
 ref|XP_011028484.1| PREDICTED: uncharacterized protein LOC105128479 isoform X3 [Populus 
euphratica]
Length=427

 Score =   160 bits (406),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 73/114 (64%), Positives = 82/114 (72%), Gaps = 0/114 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            R    P +ADP G W SCKLDI  CS  QL  MQ FR++FL AL    NS SRG +I+SC
Sbjct  275  RNILAPSIADPLGVWKSCKLDINNCSPLQLKSMQDFRLQFLNALKTSTNSSSRGLYIDSC  334

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHN  302
            YAHCQTE QE W  +DSPVL    IAKAVGDW+YDR+PFQKIDCPYPC+ SC N
Sbjct  335  YAHCQTETQEKWFMEDSPVLGKKKIAKAVGDWFYDRNPFQKIDCPYPCNPSCQN  388



>ref|XP_006385134.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa]
 gb|ERP62931.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa]
Length=430

 Score =   160 bits (406),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 73/114 (64%), Positives = 82/114 (72%), Gaps = 0/114 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            R    P +ADP G W SCKLDI  CS  QL  MQ FR++FL AL    NS SRG +I+SC
Sbjct  278  RNILAPSIADPLGVWKSCKLDINNCSPLQLKSMQDFRLQFLNALNKSTNSSSRGLYIDSC  337

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHN  302
            YAHCQTE QE W  +DSPVL    IAKAVGDW+YDR+PFQKIDCPYPC+ SC N
Sbjct  338  YAHCQTETQEKWFMEDSPVLGKKKIAKAVGDWFYDRNPFQKIDCPYPCNPSCQN  391



>ref|XP_010434420.1| PREDICTED: protein notum homolog [Camelina sativa]
 ref|XP_010434421.1| PREDICTED: protein notum homolog [Camelina sativa]
Length=397

 Score =   159 bits (402),  Expect(2) = 9e-43, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 84/112 (75%), Gaps = 0/112 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            P  ADP+G W SC+LDI  C  SQL +MQ FR+EFL A+  +  S SRG FI+SCY HCQ
Sbjct  278  PRAADPYGKWQSCQLDIKNCHPSQLKVMQDFRLEFLSAVIGLGRSSSRGMFIDSCYTHCQ  337

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVF  293
            TE Q +W   DSP+L  T+IAKAVGDW YDR+ FQKIDCPYPC+ +CH+RVF
Sbjct  338  TETQTSWFWQDSPILNRTTIAKAVGDWVYDRTLFQKIDCPYPCNPTCHHRVF  389


 Score = 42.0 bits (97),  Expect(2) = 9e-43, Method: Compositional matrix adjust.
 Identities = 17/26 (65%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = -1

Query  695  IQTXLFLVNSAYDSWQVKNILAXRGS  618
            I+T LF++N+AYDSWQ+KNILA R +
Sbjct  256  IRTPLFILNAAYDSWQIKNILAPRAA  281



>ref|XP_003547822.1| PREDICTED: protein notum homolog [Glycine max]
 gb|KHN26082.1| Protein notum like [Glycine soja]
Length=398

 Score =   160 bits (404),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 87/115 (76%), Gaps = 0/115 (0%)
 Frame = -2

Query  634  WLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAH  455
            ++PG ADP  +WHSCKLDI  CS  QL  MQ F+ EF KA+  V +S S+G FI+SCYAH
Sbjct  277  FVPGSADPSDSWHSCKLDISNCSPDQLSKMQDFKSEFEKAVSVVGDSSSKGMFIDSCYAH  336

Query  454  CQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            CQTE QETW + DSP LA T+IAKAVGDW+Y RS F+ +DC YPC+ SC NRVF+
Sbjct  337  CQTESQETWYKSDSPQLANTTIAKAVGDWFYGRSSFRHVDCNYPCNPSCQNRVFD  391



>ref|XP_011028482.1| PREDICTED: uncharacterized protein LOC105128479 isoform X2 [Populus 
euphratica]
Length=481

 Score =   161 bits (407),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/114 (64%), Positives = 82/114 (72%), Gaps = 0/114 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            R    P +ADP G W SCKLDI  CS  QL  MQ FR++FL AL    NS SRG +I+SC
Sbjct  357  RNILAPSIADPLGVWKSCKLDINNCSPLQLKSMQDFRLQFLNALKTSTNSSSRGLYIDSC  416

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHN  302
            YAHCQTE QE W  +DSPVL    IAKAVGDW+YDR+PFQKIDCPYPC+ SC N
Sbjct  417  YAHCQTETQEKWFMEDSPVLGKKKIAKAVGDWFYDRNPFQKIDCPYPCNPSCQN  470



>ref|XP_011028479.1| PREDICTED: uncharacterized protein LOC105128479 isoform X1 [Populus 
euphratica]
 ref|XP_011028480.1| PREDICTED: uncharacterized protein LOC105128479 isoform X1 [Populus 
euphratica]
 ref|XP_011028481.1| PREDICTED: uncharacterized protein LOC105128479 isoform X1 [Populus 
euphratica]
Length=509

 Score =   161 bits (407),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/114 (64%), Positives = 82/114 (72%), Gaps = 0/114 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            R    P +ADP G W SCKLDI  CS  QL  MQ FR++FL AL    NS SRG +I+SC
Sbjct  357  RNILAPSIADPLGVWKSCKLDINNCSPLQLKSMQDFRLQFLNALKTSTNSSSRGLYIDSC  416

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHN  302
            YAHCQTE QE W  +DSPVL    IAKAVGDW+YDR+PFQKIDCPYPC+ SC N
Sbjct  417  YAHCQTETQEKWFMEDSPVLGKKKIAKAVGDWFYDRNPFQKIDCPYPCNPSCQN  470



>ref|XP_010449357.1| PREDICTED: protein notum homolog [Camelina sativa]
Length=397

 Score =   158 bits (400),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 83/112 (74%), Gaps = 0/112 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            P  ADP+G W SC+LDI  C  SQL +MQ FR+EFL A+  +  S SRG FI+SCY HCQ
Sbjct  278  PRAADPYGKWQSCQLDIKNCHPSQLKVMQDFRLEFLSAVIGLGRSSSRGMFIDSCYTHCQ  337

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVF  293
            TE Q +W   DSP+L  T+IAKAVGDW YDR  FQKIDCPYPC+ +CH+RVF
Sbjct  338  TETQTSWFWQDSPILNRTTIAKAVGDWVYDRKLFQKIDCPYPCNPTCHHRVF  389


 Score = 42.4 bits (98),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 17/26 (65%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = -1

Query  695  IQTXLFLVNSAYDSWQVKNILAXRGS  618
            I+T LF++N+AYDSWQ+KNILA R +
Sbjct  256  IRTPLFILNAAYDSWQIKNILAPRAA  281



>ref|NP_193677.2| putative pectinacetylesterase [Arabidopsis thaliana]
 sp|Q6DBP4.1|PAE8_ARATH RecName: Full=Pectin acetylesterase 8; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAT70429.1| At4g19420 [Arabidopsis thaliana]
 gb|AAU45212.1| At4g19420 [Arabidopsis thaliana]
 gb|AEE84180.1| putative pectinacetylesterase [Arabidopsis thaliana]
Length=397

 Score =   158 bits (399),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 84/112 (75%), Gaps = 0/112 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            P  ADP+G W SC+LDI  C  SQ+ +MQ FR+EFL A+  +  S SRG FI+SCY HCQ
Sbjct  278  PRAADPYGKWQSCQLDIKNCHPSQIKVMQDFRLEFLSAVIGLGRSSSRGMFIDSCYTHCQ  337

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVF  293
            TE Q +W   DSP+L  T+IAKAVGDW YDR+ FQKIDCPYPC+ +CH+RVF
Sbjct  338  TETQTSWFWQDSPILNRTTIAKAVGDWVYDRTLFQKIDCPYPCNPTCHHRVF  389


 Score = 42.4 bits (98),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 17/26 (65%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = -1

Query  695  IQTXLFLVNSAYDSWQVKNILAXRGS  618
            I+T LF++N+AYDSWQ+KNILA R +
Sbjct  256  IRTPLFILNAAYDSWQIKNILAPRAA  281



>ref|XP_002867938.1| pectinacetylesterase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44197.1| pectinacetylesterase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=380

 Score =   158 bits (399),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 84/112 (75%), Gaps = 0/112 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            P  ADP+G W SC+LDI  C  SQ+ +MQ FR+EFL A+  +  S SRG FI+SCY HCQ
Sbjct  261  PRAADPYGKWQSCQLDIKNCHPSQIKVMQDFRLEFLSAVIGLGRSSSRGMFIDSCYTHCQ  320

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVF  293
            TE Q +W   DSP+L  T+IAKAVGDW YDR+ FQKIDCPYPC+ +CH+RVF
Sbjct  321  TETQTSWFWQDSPILNRTTIAKAVGDWVYDRTLFQKIDCPYPCNPTCHHRVF  372


 Score = 42.4 bits (98),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 17/26 (65%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = -1

Query  695  IQTXLFLVNSAYDSWQVKNILAXRGS  618
            I+T LF++N+AYDSWQ+KNILA R +
Sbjct  239  IRTPLFILNAAYDSWQIKNILAPRAA  264



>ref|XP_006413980.1| hypothetical protein EUTSA_v10025385mg [Eutrema salsugineum]
 gb|ESQ55433.1| hypothetical protein EUTSA_v10025385mg [Eutrema salsugineum]
Length=397

 Score =   158 bits (399),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 85/112 (76%), Gaps = 0/112 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            P  ADP+G W SC+LDI  C  +QL +MQ FR+EFL+A+  +  S SRG FI+SCY HCQ
Sbjct  278  PRAADPYGKWQSCQLDIKNCQPNQLKVMQDFRLEFLRAVIGLGRSSSRGMFIDSCYTHCQ  337

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVF  293
            TE Q +W   DSP+L  T+IAKAVGDW YDR+ FQKIDCPYPC+ +CH++VF
Sbjct  338  TETQTSWFWQDSPILNRTTIAKAVGDWVYDRTLFQKIDCPYPCNPTCHHKVF  389


 Score = 42.0 bits (97),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 17/26 (65%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = -1

Query  695  IQTXLFLVNSAYDSWQVKNILAXRGS  618
            I+T LF++N+AYDSWQ+KNILA R +
Sbjct  256  IRTPLFILNAAYDSWQIKNILAPRAA  281



>ref|XP_009108427.1| PREDICTED: protein notum homolog [Brassica rapa]
Length=397

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 83/112 (74%), Gaps = 0/112 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            P  ADP G W SC+LDI  C  SQL +MQ FR+EFL A+  +  S SRG FI+SCY HCQ
Sbjct  278  PRAADPEGKWQSCQLDIKNCQRSQLKVMQDFRLEFLSAVIGLGRSASRGMFIDSCYTHCQ  337

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVF  293
            TE Q +W   DSP+L  T+IAKAVGDW YDR+ FQKIDCPYPC+ +CH+RVF
Sbjct  338  TETQTSWFWQDSPILNRTTIAKAVGDWVYDRNLFQKIDCPYPCNPTCHHRVF  389



>ref|XP_010529277.1| PREDICTED: protein notum homolog [Tarenaya hassleriana]
Length=401

 Score =   156 bits (395),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 82/112 (73%), Gaps = 0/112 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            P  ADP+G W SC+LDI  C  +Q+ +MQ FR++FL A+  +  SPSRG FI SCY HCQ
Sbjct  280  PRAADPNGKWQSCELDIKNCQPNQIKVMQDFRLQFLSAVTGLGKSPSRGMFIVSCYTHCQ  339

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVF  293
            TE Q +W   DSP L  T+IA+AVGDW YDR  FQKIDCPYPC+ +CHNRVF
Sbjct  340  TETQTSWFWTDSPRLNRTTIARAVGDWVYDRKLFQKIDCPYPCNPTCHNRVF  391


 Score = 43.1 bits (100),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 18/26 (69%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = -1

Query  695  IQTXLFLVNSAYDSWQVKNILAXRGS  618
            I+T LFL+N+AYDSWQ+KNILA R +
Sbjct  258  IRTPLFLLNAAYDSWQIKNILAPRAA  283



>emb|CDY67801.1| BnaAnng25210D, partial [Brassica napus]
Length=383

 Score =   158 bits (400),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 83/112 (74%), Gaps = 0/112 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            P  ADP G W SC+LDI  C  SQL +MQ FR+EFL A+  +  S SRG FI+SCY HCQ
Sbjct  264  PRAADPEGKWQSCQLDIKNCQRSQLKVMQDFRLEFLSAVIGLGRSASRGMFIDSCYTHCQ  323

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVF  293
            TE Q +W   DSP+L  T+IAKAVGDW YDR+ FQKIDCPYPC+ +CH+RVF
Sbjct  324  TETQTSWFWQDSPILNRTTIAKAVGDWVYDRNLFQKIDCPYPCNPTCHHRVF  375



>emb|CDX78933.1| BnaA01g10000D [Brassica napus]
Length=452

 Score =   158 bits (400),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 83/112 (74%), Gaps = 0/112 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            P  ADP+G W SC+LDI  C  +QL +MQ FR+EFL A+  +  S SRG FI+SCY HCQ
Sbjct  333  PRAADPYGKWQSCQLDIKNCQPNQLKVMQDFRLEFLSAVIGLGRSSSRGMFIDSCYTHCQ  392

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVF  293
            TE Q +W   DSP+L  T+IAKAVGDW YDR  FQKIDCPYPC+ +CH+RVF
Sbjct  393  TETQTSWFWQDSPILNRTTIAKAVGDWVYDRKLFQKIDCPYPCNPTCHHRVF  444


 Score = 40.8 bits (94),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 16/26 (62%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = -1

Query  695  IQTXLFLVNSAYDSWQVKNILAXRGS  618
            I+T +F++N+AYDSWQ+KNILA R +
Sbjct  311  IRTPVFILNAAYDSWQIKNILAPRAA  336



>ref|XP_003548585.1| PREDICTED: protein notum homolog [Glycine max]
Length=398

 Score =   158 bits (400),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 87/115 (76%), Gaps = 0/115 (0%)
 Frame = -2

Query  634  WLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAH  455
            ++P  ADP  +WHSCKL++  CS  QL  +QGF+ EF +AL  V +SPS+G FI+SCYAH
Sbjct  277  FVPSSADPSNSWHSCKLNLSNCSPDQLSKLQGFKSEFQRALSEVGDSPSKGMFIDSCYAH  336

Query  454  CQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            CQTE QETW +  S +LA  +IAKAVGDW+Y RSPF  IDC +PC+ +CHNRVF+
Sbjct  337  CQTETQETWFKSGSQLLANKTIAKAVGDWFYGRSPFHHIDCNFPCNPTCHNRVFQ  391



>gb|KHN27511.1| Protein notum like [Glycine soja]
Length=398

 Score =   158 bits (400),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 87/115 (76%), Gaps = 0/115 (0%)
 Frame = -2

Query  634  WLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAH  455
            ++P  ADP  +WHSCKL++  CS  QL  +QGF+ EF +AL  V +SPS+G FI+SCYAH
Sbjct  277  FVPSSADPSNSWHSCKLNLSNCSPDQLSKLQGFKSEFQRALSEVGDSPSKGMFIDSCYAH  336

Query  454  CQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            CQTE QETW +  S +LA  +IAKAVGDW+Y RSPF  IDC +PC+ +CHNRVF+
Sbjct  337  CQTETQETWFKSGSQLLANKTIAKAVGDWFYGRSPFHHIDCNFPCNPTCHNRVFQ  391



>emb|CDX99377.1| BnaC01g11750D [Brassica napus]
Length=452

 Score =   158 bits (400),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 83/112 (74%), Gaps = 0/112 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            P  ADP+G W SC+LDI  C  +QL +MQ FR+EFL A+  +  S SRG FI+SCY HCQ
Sbjct  333  PRAADPYGKWQSCQLDIKNCQPNQLKVMQDFRLEFLSAVIGLGRSSSRGMFIDSCYTHCQ  392

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVF  293
            TE Q +W   DSP+L  T+IAKAVGDW YDR  FQKIDCPYPC+ +CH+RVF
Sbjct  393  TETQTSWFWQDSPILNRTTIAKAVGDWVYDRKLFQKIDCPYPCNPTCHHRVF  444


 Score = 41.2 bits (95),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 16/26 (62%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = -1

Query  695  IQTXLFLVNSAYDSWQVKNILAXRGS  618
            I+T +F++N+AYDSWQ+KNILA R +
Sbjct  311  IRTPVFILNAAYDSWQIKNILAPRAA  336



>ref|XP_006494119.1| PREDICTED: protein notum homolog isoform X1 [Citrus sinensis]
 ref|XP_006494120.1| PREDICTED: protein notum homolog isoform X2 [Citrus sinensis]
Length=392

 Score =   158 bits (400),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 81/105 (77%), Gaps = 0/105 (0%)
 Frame = -2

Query  631  LPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHC  452
            +P  ADP GTW SCK+DI  CS +QL  MQGFR++FL AL  + NS SRG  I+SCY HC
Sbjct  281  VPDDADPKGTWSSCKVDIKTCSSTQLQTMQGFRVQFLNALAELGNSSSRGMLIDSCYTHC  340

Query  451  QTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCD  317
            +TE QE WL  DSPVL  T IAKAVGDWYYDRSPFQKIDCPYPC+
Sbjct  341  RTEYQEAWLSADSPVLDKTPIAKAVGDWYYDRSPFQKIDCPYPCN  385



>ref|NP_974575.2| putative pectinacetylesterase [Arabidopsis thaliana]
 gb|AEE84179.1| putative pectinacetylesterase [Arabidopsis thaliana]
Length=365

 Score =   157 bits (398),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 84/112 (75%), Gaps = 0/112 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            P  ADP+G W SC+LDI  C  SQ+ +MQ FR+EFL A+  +  S SRG FI+SCY HCQ
Sbjct  246  PRAADPYGKWQSCQLDIKNCHPSQIKVMQDFRLEFLSAVIGLGRSSSRGMFIDSCYTHCQ  305

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVF  293
            TE Q +W   DSP+L  T+IAKAVGDW YDR+ FQKIDCPYPC+ +CH+RVF
Sbjct  306  TETQTSWFWQDSPILNRTTIAKAVGDWVYDRTLFQKIDCPYPCNPTCHHRVF  357



>emb|CDY09289.1| BnaC03g63190D [Brassica napus]
Length=397

 Score =   158 bits (399),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 83/112 (74%), Gaps = 0/112 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            P  ADP G W SC+LDI  C  SQL +MQ FR+EFL A+  +  S SRG FI+SCY HCQ
Sbjct  278  PRAADPDGKWQSCQLDIKNCQRSQLKVMQDFRLEFLSAVIGLGRSASRGMFIDSCYTHCQ  337

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVF  293
            TE Q +W   DSP+L  T+IAKAVGDW YDR+ FQKIDCPYPC+ +CH+RVF
Sbjct  338  TETQTSWFWQDSPILNRTTIAKAVGDWVYDRNLFQKIDCPYPCNPTCHHRVF  389



>ref|XP_007156332.1| hypothetical protein PHAVU_003G277600g [Phaseolus vulgaris]
 gb|ESW28326.1| hypothetical protein PHAVU_003G277600g [Phaseolus vulgaris]
Length=399

 Score =   158 bits (400),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 84/116 (72%), Gaps = 0/116 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            R    PG ADP   WHSCKLD+ KCS  QL I+QGF+ EF KA+  V +S S G FINSC
Sbjct  275  RNILAPGAADPSDNWHSCKLDLAKCSPDQLSIVQGFKKEFEKAVSVVGDSSSNGMFINSC  334

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRV  296
            Y HCQTE QETW + DSP LA T+I+KAVG+W+YDRSPF  +DC YPC+ +C N V
Sbjct  335  YDHCQTESQETWSKSDSPHLANTTISKAVGNWFYDRSPFHHVDCNYPCNPTCQNTV  390



>gb|KDO56390.1| hypothetical protein CISIN_1g026241mg [Citrus sinensis]
Length=241

 Score =   154 bits (389),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 86/118 (73%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            ++S  P  ADPHG WH C+L+  KCS SQ+  +QGFR + LKA+   + S   G FINSC
Sbjct  122  QSSLAPPSADPHGHWHDCRLNHAKCSASQIRFLQGFRNQVLKAVRGFSMSKQNGLFINSC  181

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +AHCQTE Q+TW  DDSPV+   +IA AVGDWY+DRS  + +DCPYPCDK+CHN VF+
Sbjct  182  FAHCQTERQDTWFADDSPVVGNKAIAIAVGDWYFDRSGIKIVDCPYPCDKTCHNLVFQ  239



>gb|EYU29129.1| hypothetical protein MIMGU_mgv1a023759mg [Erythranthe guttata]
Length=384

 Score =   157 bits (398),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 84/113 (74%), Gaps = 0/113 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            P +ADP G W++C  DI  CS +QL  + GFR EFL    A+  S +RG+FINSC+AHCQ
Sbjct  265  PAIADPSGIWYNCTTDIRNCSTAQLQTLHGFRKEFLNEFSAIGTSITRGYFINSCFAHCQ  324

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            TE+Q TW + +SP L   +IAKAVGDW++DRSPFQ IDCPYPCDK+C+N V +
Sbjct  325  TEMQITWFKPNSPKLNNKTIAKAVGDWFFDRSPFQTIDCPYPCDKTCNNLVLQ  377



>ref|XP_010235850.1| PREDICTED: protein notum homolog isoform X1 [Brachypodium distachyon]
 ref|XP_010235851.1| PREDICTED: protein notum homolog isoform X1 [Brachypodium distachyon]
Length=395

 Score =   156 bits (395),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 84/113 (74%), Gaps = 2/113 (2%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            R   +PG +DPH  W SCK DI +CS+ QL  +QGFR +FLKAL    +S SRG FINSC
Sbjct  277  RNILVPGGSDPH--WRSCKHDINQCSEKQLKTLQGFRDDFLKALEEQGSSSSRGLFINSC  334

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCH  305
            +AHCQ+E+QE W   DSPVL    IA A+GDW+YDRSPFQ+IDCPYPCD SCH
Sbjct  335  FAHCQSEIQEIWFAPDSPVLGNKKIANAIGDWFYDRSPFQEIDCPYPCDSSCH  387


 Score = 42.0 bits (97),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 18/26 (69%), Positives = 22/26 (85%), Gaps = 0/26 (0%)
 Frame = -1

Query  695  IQTXLFLVNSAYDSWQVKNILAXRGS  618
            IQT LF++N+AYDSWQV+NIL   GS
Sbjct  260  IQTPLFILNAAYDSWQVRNILVPGGS  285



>ref|XP_008378614.1| PREDICTED: uncharacterized protein LOC103441693 [Malus domestica]
 ref|XP_008347801.1| PREDICTED: uncharacterized protein LOC103410927 [Malus domestica]
Length=393

 Score =   157 bits (398),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 86/113 (76%), Gaps = 0/113 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            P VADP G W  CKL+I  CS SQL  MQ FR++FLK +   +NS S G+FI+SCYAHCQ
Sbjct  280  PDVADPEGAWKKCKLNIKNCSPSQLQTMQEFRLQFLKTITGASNSSSHGWFIHSCYAHCQ  339

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
             E+QETWL  DSP+L  T+IA+AVGDWYYD +PF+KIDCPYPC+ +C N  F+
Sbjct  340  IEMQETWLAADSPMLCKTTIAEAVGDWYYDLTPFRKIDCPYPCNPTCKNAEFD  392



>ref|XP_010235852.1| PREDICTED: protein notum homolog isoform X2 [Brachypodium distachyon]
Length=353

 Score =   156 bits (395),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 84/113 (74%), Gaps = 2/113 (2%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            R   +PG +DPH  W SCK DI +CS+ QL  +QGFR +FLKAL    +S SRG FINSC
Sbjct  235  RNILVPGGSDPH--WRSCKHDINQCSEKQLKTLQGFRDDFLKALEEQGSSSSRGLFINSC  292

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCH  305
            +AHCQ+E+QE W   DSPVL    IA A+GDW+YDRSPFQ+IDCPYPCD SCH
Sbjct  293  FAHCQSEIQEIWFAPDSPVLGNKKIANAIGDWFYDRSPFQEIDCPYPCDSSCH  345



>ref|XP_009132797.1| PREDICTED: protein notum homolog [Brassica rapa]
Length=397

 Score =   157 bits (398),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 83/112 (74%), Gaps = 0/112 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            P  ADP+G W SC+LDI  C  +QL +MQ FR+EFL A+  +  S SRG FI+SCY HCQ
Sbjct  278  PRAADPYGKWQSCQLDIKNCQPNQLKVMQDFRLEFLSAVIGLGRSSSRGMFIDSCYTHCQ  337

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVF  293
            TE Q +W   DSP+L  T+IAKAVGDW YDR  FQKIDCPYPC+ +CH+RVF
Sbjct  338  TETQTSWFWQDSPILNRTTIAKAVGDWVYDRKLFQKIDCPYPCNPTCHHRVF  389



>ref|XP_006432880.1| hypothetical protein CICLE_v10001467mg [Citrus clementina]
 ref|XP_006471635.1| PREDICTED: protein notum homolog isoform X1 [Citrus sinensis]
 ref|XP_006471636.1| PREDICTED: protein notum homolog isoform X2 [Citrus sinensis]
 gb|ESR46120.1| hypothetical protein CICLE_v10001467mg [Citrus clementina]
 gb|KDO40407.1| hypothetical protein CISIN_1g016608mg [Citrus sinensis]
 gb|KDO40408.1| hypothetical protein CISIN_1g016608mg [Citrus sinensis]
Length=386

 Score =   157 bits (397),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 81/105 (77%), Gaps = 0/105 (0%)
 Frame = -2

Query  631  LPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHC  452
            +P  ADP G W SCK+DI  CS +QL  MQGFR++FL AL  + NS SRG F++SCY HC
Sbjct  275  VPEDADPKGAWSSCKVDIKTCSSTQLQTMQGFRVQFLNALAGLGNSSSRGMFVDSCYTHC  334

Query  451  QTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCD  317
            +T+ QETW   DSPVL  T IAKAVGDWYYDRSPFQKIDCPYPC+
Sbjct  335  RTDYQETWFSADSPVLDKTPIAKAVGDWYYDRSPFQKIDCPYPCN  379



>ref|XP_010536220.1| PREDICTED: protein notum homolog isoform X1 [Tarenaya hassleriana]
Length=399

 Score =   155 bits (393),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 83/112 (74%), Gaps = 0/112 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            P  ADP+G W SC+LDI  C  +QL +MQ FR+EFL A+  +  S SRG FI+SCYAHCQ
Sbjct  280  PRAADPNGKWQSCQLDIKNCQPNQLKVMQDFRLEFLSAVIGLGKSSSRGMFIDSCYAHCQ  339

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVF  293
            TE Q +W   DSP L   +IAKAVGDW YDR+ FQKIDCPYPC+ +CHNRVF
Sbjct  340  TESQTSWFWPDSPRLDRVTIAKAVGDWVYDRTLFQKIDCPYPCNPTCHNRVF  391


 Score = 42.0 bits (97),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 17/26 (65%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = -1

Query  695  IQTXLFLVNSAYDSWQVKNILAXRGS  618
            I+T LF++N+AYDSWQ+KNILA R +
Sbjct  258  IRTPLFVLNAAYDSWQIKNILAPRAA  283



>ref|XP_009350399.1| PREDICTED: protein notum homolog [Pyrus x bretschneideri]
Length=398

 Score =   157 bits (396),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 86/113 (76%), Gaps = 0/113 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            PGVADP G W +CKL I  CS SQL  MQ +R++FL A+   ++S S G FI+SCYAHCQ
Sbjct  280  PGVADPKGAWKNCKLSIKNCSPSQLQTMQEYRLQFLNAIAGASSSSSNGLFIDSCYAHCQ  339

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
               QETWL  DSP+L+ T+IAKAVGDWYYDR+PF+ IDCPYPC+ +C NR F+
Sbjct  340  IGTQETWLATDSPMLSKTTIAKAVGDWYYDRTPFKNIDCPYPCNPTCKNREFD  392



>gb|KDO40409.1| hypothetical protein CISIN_1g016608mg [Citrus sinensis]
Length=372

 Score =   156 bits (395),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 81/105 (77%), Gaps = 0/105 (0%)
 Frame = -2

Query  631  LPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHC  452
            +P  ADP G W SCK+DI  CS +QL  MQGFR++FL AL  + NS SRG F++SCY HC
Sbjct  261  VPEDADPKGAWSSCKVDIKTCSSTQLQTMQGFRVQFLNALAGLGNSSSRGMFVDSCYTHC  320

Query  451  QTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCD  317
            +T+ QETW   DSPVL  T IAKAVGDWYYDRSPFQKIDCPYPC+
Sbjct  321  RTDYQETWFSADSPVLDKTPIAKAVGDWYYDRSPFQKIDCPYPCN  365



>ref|XP_008355284.1| PREDICTED: uncharacterized protein LOC103418943 [Malus domestica]
Length=398

 Score =   157 bits (396),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 86/113 (76%), Gaps = 0/113 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            PGVADP G W +CKL I  CS SQL  MQ +R++FL A+   ++S S G FI+SCYAHCQ
Sbjct  280  PGVADPKGAWKNCKLSIKNCSPSQLQTMQEYRLQFLNAVAGASSSSSNGLFIDSCYAHCQ  339

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
               QETWL  DSP+L+ T+IAKAVGDWYYDR+PF+ IDCPYPC+ +C NR F+
Sbjct  340  IGTQETWLATDSPMLSKTTIAKAVGDWYYDRTPFKNIDCPYPCNPTCKNREFD  392



>ref|XP_003628996.1| Carboxylic ester hydrolase [Medicago truncatula]
 gb|AET03472.1| pectinacetylesterase family protein [Medicago truncatula]
Length=406

 Score =   155 bits (393),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 86/113 (76%), Gaps = 0/113 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            PG ADP G W SCK ++  CS  QL IMQ +R +FL+AL  ++NSPS G FI+SCY HCQ
Sbjct  280  PGDADPDGQWRSCKTNLNNCSPEQLNIMQDYRTQFLEALSPISNSPSNGMFIDSCYVHCQ  339

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            TE QETW + DSP++   ++AKAVGDW+Y+RSP ++IDC YPC+ +C NRV+E
Sbjct  340  TEPQETWFKSDSPMVGNKTVAKAVGDWFYERSPSREIDCTYPCNPTCQNRVWE  392


 Score = 41.6 bits (96),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -1

Query  695  IQTXLFLVNSAYDSWQVKNILA  630
            IQT +F+VN+AYDSWQ+KNILA
Sbjct  258  IQTPIFIVNAAYDSWQIKNILA  279



>ref|XP_010536228.1| PREDICTED: protein notum homolog isoform X2 [Tarenaya hassleriana]
Length=397

 Score =   155 bits (391),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 83/112 (74%), Gaps = 0/112 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            P  ADP+G W SC+LDI  C  +QL +MQ FR+EFL A+  +  S SRG FI+SCYAHCQ
Sbjct  278  PRAADPNGKWQSCQLDIKNCQPNQLKVMQDFRLEFLSAVIGLGKSSSRGMFIDSCYAHCQ  337

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVF  293
            TE Q +W   DSP L   +IAKAVGDW YDR+ FQKIDCPYPC+ +CHNRVF
Sbjct  338  TESQTSWFWPDSPRLDRVTIAKAVGDWVYDRTLFQKIDCPYPCNPTCHNRVF  389


 Score = 42.0 bits (97),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 17/26 (65%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = -1

Query  695  IQTXLFLVNSAYDSWQVKNILAXRGS  618
            I+T LF++N+AYDSWQ+KNILA R +
Sbjct  256  IRTPLFVLNAAYDSWQIKNILAPRAA  281



>ref|XP_008808368.1| PREDICTED: uncharacterized protein LOC103720446 isoform X2 [Phoenix 
dactylifera]
 ref|XP_008808369.1| PREDICTED: uncharacterized protein LOC103720446 isoform X2 [Phoenix 
dactylifera]
Length=396

 Score =   156 bits (395),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 85/113 (75%), Gaps = 2/113 (2%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            P  +DP   W  CKLDI KCS +QL +MQGFR EF++AL   ANS S G FI+SCY+HCQ
Sbjct  281  PSPSDPRKVWGECKLDIKKCSSNQLQVMQGFRSEFMRAL--PANSSSIGMFIDSCYSHCQ  338

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +  QETWLR DSPV+    IAKAVGDWY+ R+  +KIDCPYPCD +CHNR+FE
Sbjct  339  SGAQETWLRSDSPVIDKMPIAKAVGDWYFGRTSMRKIDCPYPCDSTCHNRIFE  391



>ref|XP_008808367.1| PREDICTED: uncharacterized protein LOC103720446 isoform X1 [Phoenix 
dactylifera]
Length=399

 Score =   156 bits (395),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 85/113 (75%), Gaps = 2/113 (2%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            P  +DP   W  CKLDI KCS +QL +MQGFR EF++AL   ANS S G FI+SCY+HCQ
Sbjct  284  PSPSDPRKVWGECKLDIKKCSSNQLQVMQGFRSEFMRAL--PANSSSIGMFIDSCYSHCQ  341

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +  QETWLR DSPV+    IAKAVGDWY+ R+  +KIDCPYPCD +CHNR+FE
Sbjct  342  SGAQETWLRSDSPVIDKMPIAKAVGDWYFGRTSMRKIDCPYPCDSTCHNRIFE  394



>ref|XP_003547821.1| PREDICTED: protein notum homolog [Glycine max]
 gb|KHN26083.1| Protein notum like [Glycine soja]
Length=398

 Score =   156 bits (394),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 89/118 (75%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            R  ++PG ADP  +W+SCK+++  CS  QL  +QGF+ EF +AL  V +SPS+G FI+SC
Sbjct  274  RYIFVPGSADPSDSWNSCKVNMSNCSPDQLSKLQGFKSEFERALSEVGDSPSKGMFIDSC  333

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            YAHCQTE QETW + DSP LA T+IAKAV DW+Y RS F+ +DC YPC+ SC NRVF+
Sbjct  334  YAHCQTEPQETWFKTDSPKLANTTIAKAVADWFYGRSSFRHVDCNYPCNPSCQNRVFD  391



>ref|XP_006494125.1| PREDICTED: uncharacterized protein LOC102621758 [Citrus sinensis]
Length=382

 Score =   155 bits (392),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 78/105 (74%), Gaps = 0/105 (0%)
 Frame = -2

Query  631  LPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHC  452
            +P  ADP GTW  CK DI  CS +QL  MQGFR++FL AL  + NS SRG  I+SCY HC
Sbjct  271  VPDNADPKGTWRRCKKDIKTCSSTQLQTMQGFRVQFLNALAGLGNSSSRGMLIDSCYTHC  330

Query  451  QTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCD  317
            +T  QE WL  DSPVL  T IAKAVGDWYYDR+PFQKIDCPYPC+
Sbjct  331  RTVFQEAWLSADSPVLDKTPIAKAVGDWYYDRNPFQKIDCPYPCN  375



>ref|XP_006432881.1| hypothetical protein CICLE_v10001426mg [Citrus clementina]
 gb|ESR46121.1| hypothetical protein CICLE_v10001426mg [Citrus clementina]
Length=392

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 79/109 (72%), Gaps = 0/109 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            R   +P  ADP GTW  CK DI  CS +QL  MQGFR++FL AL  + NS SRG  I+SC
Sbjct  277  RNILVPDNADPKGTWRRCKKDIKTCSSTQLQTMQGFRVQFLNALAGLGNSSSRGMLIDSC  336

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCD  317
            Y HC+T  QE WL  DSPVL  T IAKAVGDWYYDR+PFQKIDCPYPC+
Sbjct  337  YTHCRTVFQEAWLSADSPVLDKTPIAKAVGDWYYDRNPFQKIDCPYPCN  385



>ref|XP_006423959.1| hypothetical protein CICLE_v10028674mg [Citrus clementina]
 gb|ESR37199.1| hypothetical protein CICLE_v10028674mg [Citrus clementina]
Length=300

 Score =   151 bits (382),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 85/118 (72%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            ++S  P  AD HG WH C+L+  KCS SQ+  +QGFR + LKA+   + S   G FINSC
Sbjct  181  QSSLAPPSADRHGHWHDCRLNHAKCSASQIRFLQGFRNQVLKAVRGFSMSKQNGLFINSC  240

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +AHCQTE Q+TW  DDSPV+   +IA AVGDWY+DRS  + +DCPYPCDK+CHN VF+
Sbjct  241  FAHCQTERQDTWFADDSPVVGNKAIAIAVGDWYFDRSGIKIVDCPYPCDKTCHNLVFQ  298



>gb|EYU35369.1| hypothetical protein MIMGU_mgv1a0197532mg, partial [Erythranthe 
guttata]
Length=167

 Score =   146 bits (369),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 80/118 (68%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            + S  P  ADPHG WH CKL+  +CS +Q+  +QGFR E L A+     S   G FINSC
Sbjct  46   QASLAPPTADPHGNWHDCKLNNERCSATQIQFLQGFRNEMLNAVKGFGTSKQNGLFINSC  105

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +AHCQ+E Q+TW  DDSP++    +A AVGDWY+DR+  + IDC YPCD +CHN VF+
Sbjct  106  FAHCQSERQDTWFADDSPIINNKPVAIAVGDWYFDRASVKAIDCAYPCDTTCHNLVFK  163



>ref|XP_006423958.1| hypothetical protein CICLE_v10028674mg [Citrus clementina]
 gb|ESR37198.1| hypothetical protein CICLE_v10028674mg [Citrus clementina]
Length=375

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 85/118 (72%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            ++S  P  AD HG WH C+L+  KCS SQ+  +QGFR + LKA+   + S   G FINSC
Sbjct  256  QSSLAPPSADRHGHWHDCRLNHAKCSASQIRFLQGFRNQVLKAVRGFSMSKQNGLFINSC  315

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +AHCQTE Q+TW  DDSPV+   +IA AVGDWY+DRS  + +DCPYPCDK+CHN VF+
Sbjct  316  FAHCQTERQDTWFADDSPVVGNKAIAIAVGDWYFDRSGIKIVDCPYPCDKTCHNLVFQ  373



>ref|XP_006480336.1| PREDICTED: protein notum homolog [Citrus sinensis]
Length=423

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 85/118 (72%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            ++S  P  AD HG WH C+L+  KCS SQ+  +QGFR + LKA+   + S   G FINSC
Sbjct  304  QSSLAPPSADRHGHWHDCRLNHAKCSASQIRFLQGFRNQVLKAVRGFSMSKQNGLFINSC  363

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +AHCQTE Q+TW  DDSPV+   +IA AVGDWY+DRS  + +DCPYPCDK+CHN VF+
Sbjct  364  FAHCQTERQDTWFADDSPVVGNKAIAIAVGDWYFDRSGIKIVDCPYPCDKTCHNLVFQ  421



>ref|XP_003555771.1| PREDICTED: uncharacterized protein LOC100793403 [Glycine max]
Length=424

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 84/118 (71%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            +TS  P  ADPHG WH C+L+  KC+ SQ+  +QGFR + L A+   + SP  G FINSC
Sbjct  307  QTSLAPSSADPHGFWHDCRLNHAKCTSSQIQYLQGFRNQMLNAIKGFSRSPQNGLFINSC  366

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +AHCQ+E Q+TW  D+SPV+   +IA AVGDWY+DR+  + IDCPYPCD +CH+ VF 
Sbjct  367  FAHCQSERQDTWFADNSPVIGNKAIALAVGDWYFDRAVVKAIDCPYPCDNTCHHLVFR  424



>gb|KHN13972.1| hypothetical protein glysoja_043167 [Glycine soja]
Length=321

 Score =   149 bits (375),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 84/118 (71%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            ++S  P  ADPHG WH C+L+  KC+ SQ+  +QGFR + L A+   + SP  G FINSC
Sbjct  204  QSSLAPSSADPHGFWHDCRLNHAKCTSSQIQYLQGFRNQMLNAIKGFSRSPQNGLFINSC  263

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +AHCQ+E Q+TW  D+SPV+   +IA +VGDWY+DR+  + IDCPYPCD +CH+ VF 
Sbjct  264  FAHCQSERQDTWFADNSPVIGNKAIALSVGDWYFDRAVVKAIDCPYPCDNTCHHLVFR  321



>emb|CBI37039.3| unnamed protein product [Vitis vinifera]
Length=365

 Score =   149 bits (377),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 81/118 (69%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            + S +P  ADPHG W  CKL+ + C+ +Q+  +Q FRME L  +   A     G FINSC
Sbjct  248  QESLVPSSADPHGEWKGCKLNHVNCNSTQIQFLQDFRMEMLDDVKGFARDDQNGLFINSC  307

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +AHCQTE+Q+TW  DDSP L    IA++VGDWY+DR P + IDCPYPCD +CHN VF+
Sbjct  308  FAHCQTELQDTWFADDSPFLGKRKIAESVGDWYFDRRPVKAIDCPYPCDNTCHNLVFK  365



>ref|NP_974837.1| pectinacetylesterase family protein [Arabidopsis thaliana]
 dbj|BAF00247.1| pectin acetylesterase precursor - like protein [Arabidopsis thaliana]
 gb|ABK32181.1| At5g26670 [Arabidopsis thaliana]
 gb|AED93579.1| pectinacetylesterase family protein [Arabidopsis thaliana]
Length=298

 Score =   148 bits (373),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 85/118 (72%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            ++S  P  ADP G WH C+L+  +C+ +Q+  +QGFR + L+A+   +NS   G FINSC
Sbjct  181  QSSIAPPSADPSGYWHECRLNHGRCTPAQIRFLQGFRNQMLRAVSGFSNSKKNGLFINSC  240

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +AHCQTE Q+TW  DDSPV+   ++A AVGDWY+DR+  + IDCPYPCD+SCHN VF 
Sbjct  241  FAHCQTERQDTWFADDSPVIHKKAVAIAVGDWYFDRAEVKLIDCPYPCDRSCHNLVFR  298



>ref|XP_004509558.1| PREDICTED: protein notum homolog [Cicer arietinum]
Length=397

 Score =   149 bits (375),  Expect(2) = 5e-39, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 82/111 (74%), Gaps = 0/111 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            PG ADP+G W SCK +++ CS  QL IMQ +R +FLKAL  V NS S G FI+SCY HCQ
Sbjct  278  PGAADPNGQWRSCKTNLINCSPKQLNIMQDYRSQFLKALSVVGNSSSNGMFIDSCYIHCQ  337

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRV  296
            TE QETWL+ DSP +A  +IA AV DW+Y+RS  ++IDC YPC+ +C +RV
Sbjct  338  TEPQETWLQSDSPTVANKTIAGAVADWFYERSASREIDCSYPCNPTCQDRV  388


 Score = 40.0 bits (92),  Expect(2) = 5e-39, Method: Compositional matrix adjust.
 Identities = 16/22 (73%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -1

Query  695  IQTXLFLVNSAYDSWQVKNILA  630
            I+T +F+VN+AYDSWQ+KNILA
Sbjct  256  IKTPIFIVNAAYDSWQIKNILA  277



>ref|XP_004300392.1| PREDICTED: pectin acetylesterase 8-like [Fragaria vesca subsp. 
vesca]
 ref|XP_011465292.1| PREDICTED: pectin acetylesterase 8-like [Fragaria vesca subsp. 
vesca]
 ref|XP_011465293.1| PREDICTED: pectin acetylesterase 8-like [Fragaria vesca subsp. 
vesca]
Length=394

 Score =   148 bits (374),  Expect(2) = 5e-39, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 79/112 (71%), Gaps = 0/112 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            P  ADP G+W SCK+ I  CS +Q+  MQ +R  FL  L     SPS G FI+SCYAHCQ
Sbjct  280  PSAADPKGSWKSCKMGIKNCSPAQIQTMQDYRTTFLNVLNGGLTSPSHGAFIDSCYAHCQ  339

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVF  293
               QETWL  DSPV+  T+IAKAVGDWYY+RSP +KIDCPYPC+ +C N+ F
Sbjct  340  IGTQETWLAADSPVVGKTTIAKAVGDWYYNRSPSKKIDCPYPCNPTCKNKEF  391


 Score = 40.4 bits (93),  Expect(2) = 5e-39, Method: Compositional matrix adjust.
 Identities = 16/22 (73%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -1

Query  695  IQTXLFLVNSAYDSWQVKNILA  630
            ++T +FLVN+AYDSWQ+KNILA
Sbjct  258  LRTPIFLVNAAYDSWQIKNILA  279



>emb|CDP15161.1| unnamed protein product [Coffea canephora]
Length=365

 Score =   149 bits (376),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 82/118 (69%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            + S  P  ADPHGTWH CKL+  KCS SQ+  +Q FR+  L ++ + A S   G FINSC
Sbjct  248  QASLAPPAADPHGTWHDCKLNHAKCSASQIRFLQAFRIRMLNSVRSFAMSGQNGLFINSC  307

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +AHCQ+E Q+TW  DDSP +    IA AVGDWY+DR+  + IDC YPCDK+CHN VF+
Sbjct  308  FAHCQSERQDTWFADDSPAIGNKGIALAVGDWYFDRTGIKAIDCAYPCDKTCHNLVFK  365



>gb|KJB81156.1| hypothetical protein B456_013G131600 [Gossypium raimondii]
Length=395

 Score =   149 bits (377),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 84/118 (71%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            ++S  P  ADPHG WH C+L+  KCS SQ+  +QGFR+E L A+   + S   G FINSC
Sbjct  278  QSSIAPPSADPHGYWHECRLNHAKCSASQMRFLQGFRIEMLNAIKGFSQSRENGLFINSC  337

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +AHCQTE Q+TW   +SP +   +IA AVGDWY+DR+  + IDCPYPCDKSCHN VF+
Sbjct  338  FAHCQTERQDTWFAANSPEIRNKAIAIAVGDWYFDRAGVKIIDCPYPCDKSCHNLVFK  395



>emb|CDX80575.1| BnaC07g28690D [Brassica napus]
Length=417

 Score =   149 bits (377),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 85/118 (72%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            ++S  P  ADPHG WH C+L+  +C+ +QL  +QGFR + L+A+   + S   G FINSC
Sbjct  300  QSSIAPTSADPHGYWHECRLNHGRCNAAQLRFLQGFRNQMLRAVTGFSKSRKNGLFINSC  359

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +AHCQTE Q+TW  DDSPV+   ++A AVGDWY+DR+  + IDCPYPCD+SCHN VF 
Sbjct  360  FAHCQTERQDTWFADDSPVIHKKAVAIAVGDWYFDRAEVKLIDCPYPCDRSCHNLVFR  417



>ref|XP_009151150.1| PREDICTED: protein notum homolog [Brassica rapa]
 emb|CDY68463.1| BnaA06g39520D [Brassica napus]
Length=417

 Score =   149 bits (377),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 85/118 (72%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            ++S  P  ADPHG WH C+L+  +C+ +QL  +QGFR + L+A+   + S   G FINSC
Sbjct  300  QSSIAPTSADPHGYWHECRLNHGRCNAAQLRFLQGFRNQMLRAVTGFSKSRKNGLFINSC  359

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +AHCQTE Q+TW  DDSPV+   ++A AVGDWY+DR+  + IDCPYPCD+SCHN VF 
Sbjct  360  FAHCQTERQDTWFADDSPVIHKKAVAIAVGDWYFDRAEVKLIDCPYPCDRSCHNLVFR  417



>ref|XP_002280816.3| PREDICTED: protein notum homolog [Vitis vinifera]
Length=408

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 81/118 (69%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            + S +P  ADPHG W  CKL+ + C+ +Q+  +Q FRME L  +   A     G FINSC
Sbjct  291  QESLVPSSADPHGEWKGCKLNHVNCNSTQIQFLQDFRMEMLDDVKGFARDDQNGLFINSC  350

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +AHCQTE+Q+TW  DDSP L    IA++VGDWY+DR P + IDCPYPCD +CHN VF+
Sbjct  351  FAHCQTELQDTWFADDSPFLGKRKIAESVGDWYFDRRPVKAIDCPYPCDNTCHNLVFK  408



>gb|KJB81153.1| hypothetical protein B456_013G131600 [Gossypium raimondii]
Length=413

 Score =   149 bits (377),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 84/118 (71%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            ++S  P  ADPHG WH C+L+  KCS SQ+  +QGFR+E L A+   + S   G FINSC
Sbjct  296  QSSIAPPSADPHGYWHECRLNHAKCSASQMRFLQGFRIEMLNAIKGFSQSRENGLFINSC  355

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +AHCQTE Q+TW   +SP +   +IA AVGDWY+DR+  + IDCPYPCDKSCHN VF+
Sbjct  356  FAHCQTERQDTWFAANSPEIRNKAIAIAVGDWYFDRAGVKIIDCPYPCDKSCHNLVFK  413



>ref|XP_002318919.2| hypothetical protein POPTR_0013s00280g [Populus trichocarpa]
 gb|EEE94842.2| hypothetical protein POPTR_0013s00280g [Populus trichocarpa]
Length=419

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 82/118 (69%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            ++S  P  ADPHG W +C+ D  KCS SQL  +QGFR + L A+   +NS   G FINSC
Sbjct  302  QSSLAPPSADPHGYWSNCRKDHSKCSASQLQFLQGFRNQMLNAIKGFSNSRQNGLFINSC  361

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +AHCQ+E Q+TW  DDSPVL    IA AVGDWY+DR+  + IDCPYPCD SCHN VF 
Sbjct  362  FAHCQSERQDTWFADDSPVLGSRPIALAVGDWYFDRAGEKAIDCPYPCDNSCHNLVFR  419



>ref|XP_010327278.1| PREDICTED: uncharacterized protein LOC101257906 isoform X3 [Solanum 
lycopersicum]
 ref|XP_010327279.1| PREDICTED: uncharacterized protein LOC101257906 isoform X3 [Solanum 
lycopersicum]
Length=246

 Score =   145 bits (366),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 79/116 (68%), Gaps = 0/116 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            ++S  P VADPHG WH CK D  KCS SQ+  +Q FR + L A+     S   G FINSC
Sbjct  129  QSSLAPPVADPHGLWHDCKRDYKKCSASQIQFLQDFRNDMLNAIKGFGASTQSGLFINSC  188

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRV  296
            +AHCQ+E Q+TW  DDSP++   +IA AVGDWY+DR   + IDC YPCDK+CHN V
Sbjct  189  FAHCQSERQDTWFADDSPLIDNKTIALAVGDWYFDREGMKAIDCAYPCDKTCHNMV  244



>gb|KDP28068.1| hypothetical protein JCGZ_19476 [Jatropha curcas]
Length=400

 Score =   147 bits (371),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 76/107 (71%), Gaps = 0/107 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            PGVADPHG W  CKLDI  CS  QL  MQ FR++FL AL     S SRG +I+SCY HCQ
Sbjct  281  PGVADPHGAWKGCKLDISNCSLLQLKTMQDFRLQFLNALYRSTTSSSRGLYIDSCYIHCQ  340

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSC  308
            +E QETW   DSPVL  + IAKAVGDW+YDR   QKIDC YPC+ +C
Sbjct  341  SETQETWFMADSPVLGRSKIAKAVGDWFYDRISVQKIDCAYPCNPTC  387


 Score = 39.7 bits (91),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 16/22 (73%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -1

Query  695  IQTXLFLVNSAYDSWQVKNILA  630
            I+T LF++N+AYDSWQ+KNILA
Sbjct  259  IRTPLFILNAAYDSWQIKNILA  280



>ref|XP_010942974.1| PREDICTED: protein notum homolog [Elaeis guineensis]
Length=391

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 81/110 (74%), Gaps = 2/110 (2%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            P  +DP   W  CKLDI KCS SQL +MQGFR EFL+AL   ANSPS G FI+SCY+HCQ
Sbjct  281  PSPSDPRKFWGECKLDIKKCSSSQLQVMQGFRSEFLRAL--PANSPSIGMFIDSCYSHCQ  338

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNR  299
            +  QETWL  DSP +    IAKAVGDWY+ R+  +KIDCPYPC+ +CHNR
Sbjct  339  SGAQETWLSSDSPAINKMPIAKAVGDWYFGRTAMKKIDCPYPCNPTCHNR  388



>ref|XP_007031285.1| Pectinacetylesterase family protein [Theobroma cacao]
 gb|EOY11787.1| Pectinacetylesterase family protein [Theobroma cacao]
Length=439

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 82/118 (69%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            ++S  P  ADPHG WH C+L+  KCS SQ+  +QGFR + L A+   + S   G FINSC
Sbjct  322  QSSIAPPSADPHGYWHDCRLNHAKCSASQIRFLQGFRTQMLNAIKGFSMSRQNGLFINSC  381

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +AHCQTE Q+TW  DDSP +    IA AVGDWY+DR+  + IDCPYPCDK+CHN VF 
Sbjct  382  FAHCQTERQDTWFADDSPEIRNKPIAIAVGDWYFDRAGVRSIDCPYPCDKTCHNLVFR  439



>gb|ACA61623.1| hypothetical protein AP8_E07.1 [Arabidopsis lyrata subsp. petraea]
Length=257

 Score =   145 bits (365),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 84/118 (71%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            ++S  P  ADP G WH C+L+  +C+ +Q+  +QGFR + L+A+   +N    G FINSC
Sbjct  140  QSSIAPPSADPSGYWHECRLNHGRCTPAQIRFLQGFRNQMLRAVRGFSNLKKNGLFINSC  199

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +AHCQTE Q+TW  DDSPV+   ++A AVGDWY+DR+  + IDCPYPCD+SCHN VF 
Sbjct  200  FAHCQTERQDTWFADDSPVIHKKAVAIAVGDWYFDRAEVKLIDCPYPCDRSCHNLVFR  257



>ref|XP_008246334.1| PREDICTED: protein notum homolog isoform X2 [Prunus mume]
Length=415

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 83/118 (70%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            ++S  P  ADP G WH C+L+  KC+ SQ+  +QGFR + L A+   + S   G FINSC
Sbjct  295  QSSLAPASADPAGFWHECRLNHAKCTPSQINFLQGFRNQMLNAVKRFSMSKKNGLFINSC  354

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +AHCQTE Q+TW  DDSP++   +IA AVGDWY+DR+  + +DCPYPCD SCHN VF+
Sbjct  355  FAHCQTERQDTWFADDSPIIGKKAIAIAVGDWYFDRTSVKAVDCPYPCDNSCHNLVFQ  412



>ref|XP_008797988.1| PREDICTED: protein notum homolog isoform X2 [Phoenix dactylifera]
Length=337

 Score =   146 bits (369),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 80/110 (73%), Gaps = 2/110 (2%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            P  +DP   W  CKLDI KCS SQL  +QGFR EFL+AL    NSPS G FI+SCY+HCQ
Sbjct  227  PSPSDPRKIWSECKLDIKKCSSSQLQALQGFRSEFLRAL--PRNSPSVGMFIDSCYSHCQ  284

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNR  299
            +  QETWL  +SP +   SIAKAVGDW+Y RS  QKIDCPYPC+ +CHNR
Sbjct  285  SGAQETWLSSNSPAIDRMSIAKAVGDWFYGRSAVQKIDCPYPCNPTCHNR  334



>ref|XP_011023896.1| PREDICTED: protein notum homolog [Populus euphratica]
Length=419

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 82/118 (69%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            ++S  P  ADPHG W +C+ D  KCS SQL  +QGFR + L A+   +NS   G FINSC
Sbjct  302  QSSLAPPSADPHGYWSNCRKDHSKCSASQLQFLQGFRNQMLNAIKGFSNSRQNGLFINSC  361

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +AHCQ+E Q+TW  DDSPVL    IA AVGDWY++R+  + IDCPYPCD SCHN VF 
Sbjct  362  FAHCQSERQDTWFADDSPVLGSKPIALAVGDWYFERAGEKAIDCPYPCDNSCHNLVFR  419



>gb|AFK35535.1| unknown [Lotus japonicus]
Length=422

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 82/117 (70%), Gaps = 0/117 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            ++S  P  ADPHG WH C+L+  KCS SQ+  +QGFR   L  +   + S   G FINSC
Sbjct  305  QSSLAPPTADPHGYWHDCRLNHAKCSRSQVQFLQGFRNRMLNVIKDFSRSNRNGLFINSC  364

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVF  293
            +AHCQ+E Q+TW  D+SPV+   +IA AVGDWY+DR+  + IDCPYPCDK+CHN +F
Sbjct  365  FAHCQSERQDTWFSDNSPVIGNKAIAVAVGDWYFDRAGVKAIDCPYPCDKTCHNLIF  421



>gb|KHG26188.1| Protein notum [Gossypium arboreum]
Length=413

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 83/118 (70%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            ++S  P  ADPHG WH C+L+  KCS SQ+  +QGFR+E L  +   + S   G FINSC
Sbjct  296  QSSIAPPSADPHGYWHECRLNHAKCSASQMRFLQGFRIEMLNVIKGFSQSRENGLFINSC  355

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +AHCQTE Q+TW   +SP +   +IA AVGDWY+DR+  + IDCPYPCDKSCHN VF+
Sbjct  356  FAHCQTERQDTWFAANSPEIRNKAIAIAVGDWYFDRAGVKVIDCPYPCDKSCHNLVFK  413



>gb|AAC13595.1| similar to Vigna radiata pectinacetylesterase precursor (GB:X99348) 
[Arabidopsis thaliana]
Length=422

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 85/118 (72%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            ++S  P  ADP G WH C+L+  +C+ +Q+  +QGFR + L+A+   +NS   G FINSC
Sbjct  305  QSSIAPPSADPSGYWHECRLNHGRCTPAQIRFLQGFRNQMLRAVSGFSNSKKNGLFINSC  364

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +AHCQTE Q+TW  DDSPV+   ++A AVGDWY+DR+  + IDCPYPCD+SCHN VF 
Sbjct  365  FAHCQTERQDTWFADDSPVIHKKAVAIAVGDWYFDRAEVKLIDCPYPCDRSCHNLVFR  422



>ref|NP_850878.2| pectinacetylesterase family protein [Arabidopsis thaliana]
 sp|Q66GM8.1|PAE10_ARATH RecName: Full=Pectin acetylesterase 10; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAU05497.1| At5g26670 [Arabidopsis thaliana]
 gb|AED93578.1| pectinacetylesterase family protein [Arabidopsis thaliana]
Length=416

 Score =   148 bits (373),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 85/118 (72%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            ++S  P  ADP G WH C+L+  +C+ +Q+  +QGFR + L+A+   +NS   G FINSC
Sbjct  299  QSSIAPPSADPSGYWHECRLNHGRCTPAQIRFLQGFRNQMLRAVSGFSNSKKNGLFINSC  358

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +AHCQTE Q+TW  DDSPV+   ++A AVGDWY+DR+  + IDCPYPCD+SCHN VF 
Sbjct  359  FAHCQTERQDTWFADDSPVIHKKAVAIAVGDWYFDRAEVKLIDCPYPCDRSCHNLVFR  416



>ref|XP_008347803.1| PREDICTED: uncharacterized protein LOC103410929 [Malus domestica]
Length=401

 Score =   147 bits (372),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 83/113 (73%), Gaps = 0/113 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            PGVADP G W  CKL+I  CS SQL  +Q +R++FLK +   + S S G FI+SC+AHCQ
Sbjct  283  PGVADPKGAWKKCKLNIKNCSPSQLQTLQEYRLQFLKTIAXSSTSSSHGAFIDSCFAHCQ  342

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
               QETWL  DSP+L+ T+IA AVGDWYYDR+ F+K DCPYPC+ +C NR F+
Sbjct  343  IGTQETWLAADSPMLSKTTIANAVGDWYYDRTAFKKFDCPYPCNPTCKNREFD  395



>dbj|BAH19826.1| AT5G26670 [Arabidopsis thaliana]
Length=416

 Score =   148 bits (373),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 85/118 (72%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            ++S  P  ADP G WH C+L+  +C+ +Q+  +QGFR + L+A+   +NS   G FINSC
Sbjct  299  QSSIAPPSADPSGYWHECRLNHGRCTPAQIRFLQGFRNQMLRAVSGFSNSKKNGLFINSC  358

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +AHCQTE Q+TW  DDSPV+   ++A AVGDWY+DR+  + IDCPYPCD+SCHN VF 
Sbjct  359  FAHCQTERQDTWFADDSPVIHKKAVAIAVGDWYFDRAEVKLIDCPYPCDRSCHNLVFR  416



>ref|XP_002519912.1| pectin acetylesterase, putative [Ricinus communis]
 gb|EEF42516.1| pectin acetylesterase, putative [Ricinus communis]
Length=452

 Score =   144 bits (362),  Expect(2) = 6e-38, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 79/108 (73%), Gaps = 1/108 (1%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKAL-GAVANSPSRGFFINSCYAHC  452
            P   D  G+W SCKLD+ KCS +QL  +Q FR +F+ AL G V N P+ G+FINSCYAHC
Sbjct  338  PSAVDKKGSWKSCKLDLKKCSAAQLQTVQDFRTQFIGALSGGVTNKPANGYFINSCYAHC  397

Query  451  QTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSC  308
            Q+    TWL D SPV++ T I KAVGDW+YDR+ FQKIDCPYPC+ +C
Sbjct  398  QSGSLATWLADKSPVVSNTKIGKAVGDWFYDRATFQKIDCPYPCNPTC  445


 Score = 41.2 bits (95),  Expect(2) = 6e-38, Method: Compositional matrix adjust.
 Identities = 16/22 (73%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -1

Query  695  IQTXLFLVNSAYDSWQVKNILA  630
            ++T LFL+NSAYDSWQ+KN+LA
Sbjct  316  MRTPLFLINSAYDSWQIKNVLA  337



>emb|CBI39680.3| unnamed protein product [Vitis vinifera]
Length=365

 Score =   146 bits (368),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 81/118 (69%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            + S  P  ADPHG W+ CK +  +CS SQ+  +QGFR + L A+   + S   G FINSC
Sbjct  248  QASLAPPSADPHGYWNECKKNHAQCSPSQIQFLQGFRNQMLNAIKGFSMSKQNGLFINSC  307

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +AHCQTE Q+TW  D+SP++    IA AVGDWY+DRS  + IDCPYPCDK+CHN VF 
Sbjct  308  FAHCQTERQDTWFADNSPIIKNKGIALAVGDWYFDRSGIKAIDCPYPCDKTCHNLVFR  365



>ref|XP_008797987.1| PREDICTED: protein notum homolog isoform X1 [Phoenix dactylifera]
Length=391

 Score =   146 bits (369),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 82/115 (71%), Gaps = 2/115 (2%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            +  + P  +DP   W  CKLDI KCS SQL  +QGFR EFL+AL    NSPS G FI+SC
Sbjct  276  KNIFAPSPSDPRKIWSECKLDIKKCSSSQLQALQGFRSEFLRAL--PRNSPSVGMFIDSC  333

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNR  299
            Y+HCQ+  QETWL  +SP +   SIAKAVGDW+Y RS  QKIDCPYPC+ +CHNR
Sbjct  334  YSHCQSGAQETWLSSNSPAIDRMSIAKAVGDWFYGRSAVQKIDCPYPCNPTCHNR  388



>ref|XP_008365263.1| PREDICTED: protein notum homolog [Malus domestica]
Length=300

 Score =   144 bits (364),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 81/118 (69%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            +TS  P  ADP G W  C+L+  KC+ SQ+  +QGFR + L A+   + S   G FINSC
Sbjct  181  QTSLAPPAADPAGYWRDCRLNHEKCTPSQINFLQGFRNQMLNAVKQFSMSEQNGLFINSC  240

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +AHCQ+E Q+TW  DDSPV+   +IA AVGDWY+DR+  + IDCPYPCD SCHN  FE
Sbjct  241  FAHCQSERQDTWFADDSPVIGKKAIAIAVGDWYFDRTSVKIIDCPYPCDNSCHNLNFE  298



>ref|XP_009129612.1| PREDICTED: protein notum homolog [Brassica rapa]
Length=414

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 83/118 (70%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            ++S  P  ADP G WH C+L+  KC+ SQ+  +QGFR + L+ +   + S   G FINSC
Sbjct  297  QSSIAPTSADPRGFWHDCRLNHAKCTPSQIRFLQGFRDQMLRVVKGFSMSRHNGLFINSC  356

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +AHCQTE Q+TW  DDSPV+   ++A AVGDWY+DR+  + IDCPYPCDKSCHN VF 
Sbjct  357  FAHCQTERQDTWFADDSPVIRKKAVAIAVGDWYFDRAEVKLIDCPYPCDKSCHNLVFR  414



>gb|AAF26093.1|AC012393_19 putative pectinacetylesterase [Arabidopsis thaliana]
Length=371

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 83/118 (70%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            ++S  P  ADP G WH C+L+  KC+ +QL  +QGFR + L+ +   + S   G FINSC
Sbjct  254  QSSIAPTSADPSGFWHDCRLNHGKCTPAQLRFLQGFREQMLRVVKGFSMSRQNGLFINSC  313

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +AHCQTE Q+TW  DDSPV+   ++A AVGDWY+DR+  + +DCPYPCDKSCHN VF 
Sbjct  314  FAHCQTERQDTWFADDSPVIRKKAVAIAVGDWYFDRAEVKLVDCPYPCDKSCHNLVFR  371



>ref|XP_003613922.1| Notum-like protein [Medicago truncatula]
 gb|AES96880.1| pectinacetylesterase family protein [Medicago truncatula]
Length=394

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 79/102 (77%), Gaps = 0/102 (0%)
 Frame = -2

Query  601  WHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLR  422
            W +CKLDI KC+ +QL  +QGFR EFL+AL  + NS S G FI+SCY HCQTE+QE WL 
Sbjct  287  WKNCKLDITKCTPAQLNQVQGFRKEFLRALAPIGNSSSVGTFIDSCYLHCQTELQEFWLF  346

Query  421  DDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRV  296
            + SP+LA T+IAK+V DW+YDR PF +IDCPYPC+ +CH  V
Sbjct  347  NGSPLLANTTIAKSVADWFYDRRPFHQIDCPYPCNPTCHTHV  388



>ref|XP_009111712.1| PREDICTED: protein notum homolog [Brassica rapa]
Length=416

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 84/118 (71%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            ++S  P  ADP G WH C+L+  +C+ +Q+  +QGFR + L+A+    N+   G FINSC
Sbjct  299  QSSLAPPSADPSGYWHECRLNHGRCTPAQILFLQGFRDQMLRAVSGFLNARKNGLFINSC  358

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +AHCQTE Q+TW  DDSPV+   ++A AVGDWY+DR+  + IDCPYPCD+SCHN VF 
Sbjct  359  FAHCQTERQDTWFADDSPVINKKAVATAVGDWYFDRAEVKLIDCPYPCDRSCHNLVFR  416



>gb|KJB82697.1| hypothetical protein B456_013G211000 [Gossypium raimondii]
Length=401

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 82/118 (69%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            ++S  P  ADPHG WH C+L+  KCS SQL  +QGFR + L A+   + S   G FINSC
Sbjct  284  QSSIAPPSADPHGYWHDCRLNHAKCSASQLRYLQGFRTQMLNAIKGFSMSRENGLFINSC  343

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +AHCQ+E Q+TW  D+SP +    IA AVGDWY+DR+  + +DCPYPCDK+CHN VF 
Sbjct  344  FAHCQSERQDTWFADNSPEIRNKPIAIAVGDWYFDRTAVKVVDCPYPCDKTCHNLVFR  401



>emb|CDY19761.1| BnaA09g04140D [Brassica napus]
Length=416

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 84/118 (71%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            ++S  P  ADP G WH C+L+  +C+ +Q+  +QGFR + L+A+    N+   G FINSC
Sbjct  299  QSSLAPPSADPSGYWHECRLNHGRCTPAQILFLQGFRDQMLRAVSGFLNARKNGLFINSC  358

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +AHCQTE Q+TW  DDSPV+   ++A AVGDWY+DR+  + IDCPYPCD+SCHN VF 
Sbjct  359  FAHCQTERQDTWFADDSPVINKKAVATAVGDWYFDRAEVKLIDCPYPCDRSCHNLVFR  416



>emb|CDY27732.1| BnaA05g31410D [Brassica napus]
Length=414

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 83/118 (70%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            ++S  P  ADP G WH C+L+  KC+ SQ+  +QGFR + L+ +   + S   G FINSC
Sbjct  297  QSSIAPTSADPSGFWHDCRLNHAKCTPSQIRFLQGFRDQMLRVVKGFSMSRHNGLFINSC  356

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +AHCQTE Q+TW  DDSPV+   ++A AVGDWY+DR+  + IDCPYPCDKSCHN VF 
Sbjct  357  FAHCQTERQDTWFADDSPVIRKKAVAIAVGDWYFDRAEVKLIDCPYPCDKSCHNLVFR  414



>ref|XP_002279030.1| PREDICTED: protein notum homolog [Vitis vinifera]
Length=423

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 81/118 (69%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            + S  P  ADPHG W+ CK +  +CS SQ+  +QGFR + L A+   + S   G FINSC
Sbjct  306  QASLAPPSADPHGYWNECKKNHAQCSPSQIQFLQGFRNQMLNAIKGFSMSKQNGLFINSC  365

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +AHCQTE Q+TW  D+SP++    IA AVGDWY+DRS  + IDCPYPCDK+CHN VF 
Sbjct  366  FAHCQTERQDTWFADNSPIIKNKGIALAVGDWYFDRSGIKAIDCPYPCDKTCHNLVFR  423



>ref|XP_007040900.1| Pectinacetylesterase family protein [Theobroma cacao]
 gb|EOY25401.1| Pectinacetylesterase family protein [Theobroma cacao]
Length=399

 Score =   144 bits (362),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/109 (60%), Positives = 76/109 (70%), Gaps = 0/109 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            P  AD    W SCKLD+ KC+  QL I+Q FR +FL AL    NS SRG FI+SCYAHCQ
Sbjct  281  PTAADSGKAWKSCKLDLKKCTPGQLKIIQDFRAQFLSALTGAGNSSSRGMFIDSCYAHCQ  340

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHN  302
               Q TW  ++SP +  T IAKAVGDWYY+RSP QKIDCPYPC+ +C N
Sbjct  341  AGKQITWSSNNSPAVGNTKIAKAVGDWYYERSPVQKIDCPYPCNPTCQN  389


 Score = 39.7 bits (91),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -1

Query  695  IQTXLFLVNSAYDSWQVKNILA  630
            +QT +F +N+AYDSWQ+KNILA
Sbjct  259  MQTPIFFINAAYDSWQIKNILA  280



>emb|CAN62190.1| hypothetical protein VITISV_020113 [Vitis vinifera]
Length=423

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 81/118 (69%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            + S  P  ADPHG W+ CK +  +CS SQ+  +QGFR + L A+   + S   G FINSC
Sbjct  306  QASLAPPSADPHGYWNECKKNHAQCSPSQIQFLQGFRNQMLNAIKGFSMSKQNGLFINSC  365

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +AHCQTE Q+TW  D+SP++    IA AVGDWY+DRS  + IDCPYPCDK+CHN VF 
Sbjct  366  FAHCQTERQDTWFADNSPIIKNKGIALAVGDWYFDRSGIKAIDCPYPCDKTCHNLVFR  423



>emb|CDY49986.1| BnaC03g34430D [Brassica napus]
Length=925

 Score =   150 bits (378),  Expect(2) = 2e-37, Method: Composition-based stats.
 Identities = 59/114 (52%), Positives = 80/114 (70%), Gaps = 0/114 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            ++S  P  ADP G WH C+L+  KC+  Q+  +Q FR + L+ +   + S   G FINSC
Sbjct  299  QSSIAPKSADPSGFWHDCRLNHEKCTSGQMRFLQSFRDQMLRVVKGFSMSRQNGLFINSC  358

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHN  302
            +AHCQTE Q+TW  DDSPV++  ++A AVGDWY+DR+  + +DCPYPCDKSCHN
Sbjct  359  FAHCQTERQDTWFADDSPVISKKAVAIAVGDWYFDRAEVKLVDCPYPCDKSCHN  412


 Score = 33.5 bits (75),  Expect(2) = 2e-37, Method: Composition-based stats.
 Identities = 11/26 (42%), Positives = 22/26 (85%), Gaps = 0/26 (0%)
 Frame = -1

Query  695  IQTXLFLVNSAYDSWQVKNILAXRGS  618
            ++T LF+VN+AYD+WQ+++ +A + +
Sbjct  282  MKTPLFIVNAAYDTWQIQSSIAPKSA  307



>gb|KJB82696.1| hypothetical protein B456_013G211000 [Gossypium raimondii]
Length=389

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 82/118 (69%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            ++S  P  ADPHG WH C+L+  KCS SQL  +QGFR + L A+   + S   G FINSC
Sbjct  272  QSSIAPPSADPHGYWHDCRLNHAKCSASQLRYLQGFRTQMLNAIKGFSMSRENGLFINSC  331

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +AHCQ+E Q+TW  D+SP +    IA AVGDWY+DR+  + +DCPYPCDK+CHN VF 
Sbjct  332  FAHCQSERQDTWFADNSPEIRNKPIAIAVGDWYFDRTAVKVVDCPYPCDKTCHNLVFR  389



>ref|XP_009610135.1| PREDICTED: protein notum homolog [Nicotiana tomentosiformis]
Length=427

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 83/118 (70%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            ++S  P VADP G WH CKL+  +CS SQ+  +QGFR + L A+   A S   G FINSC
Sbjct  310  QSSLAPPVADPKGLWHDCKLNNEQCSASQIQFLQGFRNDMLNAVKGFAASTQNGLFINSC  369

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +AHCQ+E Q+TW  DDSP++    +A AVGDWY+DR+  + IDC YPCDK+CHN VF+
Sbjct  370  FAHCQSERQDTWFADDSPLIDNKPVALAVGDWYFDRAGVKSIDCAYPCDKTCHNLVFK  427



>ref|XP_010524828.1| PREDICTED: protein notum homolog [Tarenaya hassleriana]
Length=415

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 83/118 (70%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            ++S  P  ADP G W  C+L+  +C+ +Q+  +QGFR + L+ +G    S   G FINSC
Sbjct  298  QSSIAPPTADPIGYWRDCRLNHGRCTPAQIQFLQGFRNQMLRTVGGFLESKQNGLFINSC  357

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +AHCQTE Q+TW  DDSPV+  T++A AVGDWY+DR+  + IDCPYPCDKSCHN VF 
Sbjct  358  FAHCQTERQDTWFADDSPVIQKTAVAIAVGDWYFDRAEVKLIDCPYPCDKSCHNLVFR  415



>ref|XP_010094916.1| hypothetical protein L484_022666 [Morus notabilis]
 gb|EXB57559.1| hypothetical protein L484_022666 [Morus notabilis]
Length=410

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 81/118 (69%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            ++S  P  ADPHG WH C+L+  KC+ SQL  +QGFR + L  +   A S   G FINSC
Sbjct  293  QSSLAPPSADPHGYWHDCRLNHAKCNPSQLLFLQGFRNQMLNVIRQFATSHQNGLFINSC  352

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +AHCQTE Q+TW  D+SPVL    IA AVGDWY+DR+  + IDCPYPCD +CH+ VF 
Sbjct  353  FAHCQTERQDTWFADNSPVLHNKPIALAVGDWYFDRAAVKAIDCPYPCDNTCHHLVFR  410



>ref|NP_566263.1| pectinacetylesterase family protein [Arabidopsis thaliana]
 sp|Q9SFF6.1|PAE12_ARATH RecName: Full=Pectin acetylesterase 12; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF23225.1|AC013454_12 putative pectinacetylesterase [Arabidopsis thaliana]
 gb|AAL16135.1|AF428303_1 AT3g05910/F2O10_3 [Arabidopsis thaliana]
 gb|AAK92782.1| putative pectinacetylesterase [Arabidopsis thaliana]
 gb|AAM20385.1| putative pectinacetylesterase [Arabidopsis thaliana]
 gb|AEE74314.1| pectinacetylesterase family protein [Arabidopsis thaliana]
Length=415

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 83/118 (70%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            ++S  P  ADP G WH C+L+  KC+ +QL  +QGFR + L+ +   + S   G FINSC
Sbjct  298  QSSIAPTSADPSGFWHDCRLNHGKCTPAQLRFLQGFREQMLRVVKGFSMSRQNGLFINSC  357

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +AHCQTE Q+TW  DDSPV+   ++A AVGDWY+DR+  + +DCPYPCDKSCHN VF 
Sbjct  358  FAHCQTERQDTWFADDSPVIRKKAVAIAVGDWYFDRAEVKLVDCPYPCDKSCHNLVFR  415



>ref|XP_003536006.1| PREDICTED: uncharacterized protein LOC100810716 [Glycine max]
Length=421

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 83/118 (70%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            ++S  P  ADPHG WH C+L+  KC+ SQ+  +QGFR + L A+   + S   G FINSC
Sbjct  304  QSSLAPSSADPHGFWHDCRLNHAKCTSSQIQYLQGFRNQMLNAIKGFSRSRQNGLFINSC  363

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +AHCQ+E Q+TW  D+SPV+   +IA +VGDWY+DR+  + IDCPYPCD +CH+ VF 
Sbjct  364  FAHCQSERQDTWFADNSPVIGNKAIALSVGDWYFDRAVVKAIDCPYPCDNTCHHLVFR  421



>gb|KJB82695.1| hypothetical protein B456_013G211000 [Gossypium raimondii]
Length=412

 Score =   145 bits (367),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 82/118 (69%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            ++S  P  ADPHG WH C+L+  KCS SQL  +QGFR + L A+   + S   G FINSC
Sbjct  295  QSSIAPPSADPHGYWHDCRLNHAKCSASQLRYLQGFRTQMLNAIKGFSMSRENGLFINSC  354

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +AHCQ+E Q+TW  D+SP +    IA AVGDWY+DR+  + +DCPYPCDK+CHN VF 
Sbjct  355  FAHCQSERQDTWFADNSPEIRNKPIAIAVGDWYFDRTAVKVVDCPYPCDKTCHNLVFR  412



>ref|XP_010433795.1| PREDICTED: protein notum homolog [Camelina sativa]
Length=364

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 83/118 (70%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            ++S  P  ADP G WH C+L+  KC+ +QL  +QGFR + L+ +   + S   G FINSC
Sbjct  247  QSSIAPTSADPSGFWHDCRLNHGKCTPAQLRFLQGFRDQMLRVVKGFSMSRQNGLFINSC  306

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +AHCQTE Q+TW  DDSPV+   ++A AVGDWY+DR+  + +DCPYPCDKSCHN VF 
Sbjct  307  FAHCQTERQDTWFADDSPVIRKKAVAIAVGDWYFDRAEVKLVDCPYPCDKSCHNLVFR  364



>gb|ABG34280.1| pectin acetylesterase [Eucalyptus globulus subsp. globulus]
Length=350

 Score =   144 bits (363),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 81/118 (69%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            + S  P  ADPHG W  C L+  +CS SQ+  +QGFR + L A+   ++S   G F+NSC
Sbjct  232  QASLAPSSADPHGHWRQCTLNHARCSASQIQFLQGFRNQMLNAIRGFSSSRQNGLFLNSC  291

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +AHCQ+E Q+TW  D+SP +   +IA AVGDWY+DR+  + IDCPYPCDK+CHN VF 
Sbjct  292  FAHCQSERQDTWFADNSPTIGNKAIALAVGDWYFDRAAVKAIDCPYPCDKTCHNLVFH  349



>ref|XP_002872227.1| hypothetical protein ARALYDRAFT_489494 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48486.1| hypothetical protein ARALYDRAFT_489494 [Arabidopsis lyrata subsp. 
lyrata]
Length=416

 Score =   145 bits (366),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 84/118 (71%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            ++S  P  ADP G WH C+L+  +C+ +Q+  +QGFR + L+A+   +N    G FINSC
Sbjct  299  QSSIAPPSADPSGYWHECRLNHGRCTPAQIRFLQGFRNQMLRAVRGFSNLKKNGLFINSC  358

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +AHCQTE Q+TW  DDSPV+   ++A AVGDWY+DR+  + IDCPYPCD+SCHN VF 
Sbjct  359  FAHCQTERQDTWFADDSPVIHKMAVAIAVGDWYFDRAEVKLIDCPYPCDRSCHNLVFR  416



>emb|CDY05211.1| BnaC05g45920D [Brassica napus]
Length=413

 Score =   145 bits (366),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 83/118 (70%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            ++S  P  ADP G WH C+L+  KC+ SQ+  +QGFR + L+ +   + S   G FINSC
Sbjct  296  QSSIAPTSADPSGFWHDCRLNHAKCTPSQIRFLQGFRDQMLRVVRGFSMSRHNGLFINSC  355

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +AHCQTE Q+TW  DDSPV+   ++A AVGDWY+DR+  + +DCPYPCDKSCHN VF 
Sbjct  356  FAHCQTERQDTWFADDSPVIRKKAVAIAVGDWYFDRAEVKLVDCPYPCDKSCHNLVFR  413



>gb|ABK26312.1| unknown [Picea sitchensis]
 gb|ACN40309.1| unknown [Picea sitchensis]
Length=421

 Score =   145 bits (366),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 82/112 (73%), Gaps = 0/112 (0%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            PG  DPHG WH CK + + C+ SQL I+QG+RME L AL     S + G FINSC+ HCQ
Sbjct  309  PGSEDPHGHWHYCKQNPVNCTSSQLEILQGYRMEMLNALETFKPSETGGMFINSCFCHCQ  368

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVF  293
            +E Q+TW + +SP++   +IA+AVGDWY++R   +++DCPYPCD++CHN VF
Sbjct  369  SENQDTWFQSNSPMMNNKTIAQAVGDWYFERCTVKEVDCPYPCDQTCHNLVF  420



>ref|XP_004248530.1| PREDICTED: protein notum homolog isoform X2 [Solanum lycopersicum]
Length=413

 Score =   145 bits (366),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 79/116 (68%), Gaps = 0/116 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            ++S  P VADPHG WH CK D  KCS SQ+  +Q FR + L A+     S   G FINSC
Sbjct  296  QSSLAPPVADPHGLWHDCKRDYKKCSASQIQFLQDFRNDMLNAIKGFGASTQSGLFINSC  355

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRV  296
            +AHCQ+E Q+TW  DDSP++   +IA AVGDWY+DR   + IDC YPCDK+CHN V
Sbjct  356  FAHCQSERQDTWFADDSPLIDNKTIALAVGDWYFDREGMKAIDCAYPCDKTCHNMV  411



>gb|KFK26428.1| hypothetical protein AALP_AA8G247000 [Arabis alpina]
Length=416

 Score =   145 bits (366),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 84/118 (71%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            ++S  P  ADP G WH C+L+  +C+ +Q+  +QGFR + L+ +   +NS   G FINSC
Sbjct  299  QSSIAPPRADPSGYWHECRLNHGRCTPAQIRFLQGFRDQMLRVVSEFSNSRKNGLFINSC  358

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +AHCQTE Q+TW  DDSPV+   ++A AVGDWY+DR+  + IDCPYPCD+SCHN VF 
Sbjct  359  FAHCQTERQDTWFADDSPVIHKKAVAIAVGDWYFDRAEVKLIDCPYPCDRSCHNLVFR  416



>ref|XP_006338905.1| PREDICTED: protein notum homolog isoform X2 [Solanum tuberosum]
Length=330

 Score =   143 bits (361),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 78/116 (67%), Gaps = 0/116 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            ++S  P VADPHG WH CKL+  KCS SQ+  +Q FR + L A+     S   G FINSC
Sbjct  213  QSSLAPPVADPHGLWHDCKLNYEKCSASQIQFLQDFRNDMLNAIKGFGVSTQNGLFINSC  272

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRV  296
            +AHCQ+E Q+TW  DDSP++    +A AVGDWY+DR     IDC YPCDK+CHN V
Sbjct  273  FAHCQSERQDTWFADDSPLIDNKPVALAVGDWYFDREGVNAIDCAYPCDKTCHNMV  328



>ref|XP_010464149.1| PREDICTED: protein notum homolog [Camelina sativa]
Length=415

 Score =   145 bits (365),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 83/118 (70%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            ++S  P  ADP G WH C+L+  KC+ +QL  +QGFR + L+ +   + S   G FINSC
Sbjct  298  QSSIAPTSADPSGFWHDCRLNHGKCTPAQLRFLQGFRDQMLRVVKGFSMSRQNGLFINSC  357

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +AHCQTE Q+TW  DDSPV+   ++A AVGDWY+DR+  + +DCPYPCDKSCHN VF 
Sbjct  358  FAHCQTERQDTWFADDSPVIRKKAVAIAVGDWYFDRAEVKLVDCPYPCDKSCHNLVFR  415



>ref|XP_010327277.1| PREDICTED: protein notum homolog isoform X1 [Solanum lycopersicum]
Length=416

 Score =   145 bits (365),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 79/116 (68%), Gaps = 0/116 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            ++S  P VADPHG WH CK D  KCS SQ+  +Q FR + L A+     S   G FINSC
Sbjct  299  QSSLAPPVADPHGLWHDCKRDYKKCSASQIQFLQDFRNDMLNAIKGFGASTQSGLFINSC  358

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRV  296
            +AHCQ+E Q+TW  DDSP++   +IA AVGDWY+DR   + IDC YPCDK+CHN V
Sbjct  359  FAHCQSERQDTWFADDSPLIDNKTIALAVGDWYFDREGMKAIDCAYPCDKTCHNMV  414



>ref|XP_010240825.1| PREDICTED: protein notum homolog [Nelumbo nucifera]
Length=410

 Score =   145 bits (365),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 82/118 (69%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            + S  P  ADPHG W  CKL+  +C+ SQ+  +QGFR + L A+   + S   G FINSC
Sbjct  293  QASLAPPSADPHGYWRGCKLNHAQCTASQIQFLQGFRNQMLNAIKGFSMSRKNGLFINSC  352

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +AHCQTE Q+TW  DDSP++    IA++VGDWY+DR+  + IDC YPCDK+CHN VF+
Sbjct  353  FAHCQTERQDTWFADDSPLIGNKGIAQSVGDWYFDRAGVRAIDCEYPCDKTCHNLVFK  410



>ref|XP_011039059.1| PREDICTED: uncharacterized protein LOC105135726 isoform X2 [Populus 
euphratica]
Length=298

 Score =   142 bits (358),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 80/118 (68%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            ++S  P  ADP G W +C+ D  KCS SQ+  +QGFR + L A+   + S   G FINSC
Sbjct  181  QSSLAPPSADPAGYWSNCRKDHSKCSASQIQFLQGFRNQMLNAIKGFSRSRQNGLFINSC  240

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +AHCQ+E Q+TW  D+SPVL    IA AVGDWY+DRS  + IDCPYPCD SCHN VF 
Sbjct  241  FAHCQSERQDTWFADNSPVLGNKPIALAVGDWYFDRSGEKAIDCPYPCDSSCHNLVFR  298



>ref|XP_002884540.1| hypothetical protein ARALYDRAFT_477888 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60799.1| hypothetical protein ARALYDRAFT_477888 [Arabidopsis lyrata subsp. 
lyrata]
Length=415

 Score =   144 bits (364),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 83/118 (70%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            ++S  P  ADP G WH C+L+  KC+ +QL  +QGFR + L+ +   + S   G FINSC
Sbjct  298  QSSIAPTSADPSGFWHDCRLNHGKCTPAQLRFLQGFRDQMLRVVRGFSMSRQNGLFINSC  357

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +AHCQTE Q+TW  DDSPV+   ++A AVGDWY+DR+  + +DCPYPCDKSCHN VF 
Sbjct  358  FAHCQTERQDTWFADDSPVIRKKAVAIAVGDWYFDRAEVKLVDCPYPCDKSCHNLVFR  415



>ref|XP_009779872.1| PREDICTED: protein notum homolog [Nicotiana sylvestris]
Length=423

 Score =   145 bits (365),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 82/118 (69%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            ++S  P VADP G WH CKL+  +CS SQ+  +QGFR + L  +   A S   G FINSC
Sbjct  306  QSSLAPPVADPKGLWHDCKLNNEQCSASQIQFLQGFRNDMLNVVKGFAASTQNGLFINSC  365

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +AHCQ+E Q+TW  DDSP++    +A AVGDWY+DR+  + IDC YPCDK+CHN VF+
Sbjct  366  FAHCQSERQDTWFADDSPLIDNKPVALAVGDWYFDRAGVKSIDCAYPCDKTCHNLVFK  423



>ref|XP_008363955.1| PREDICTED: protein notum homolog [Malus domestica]
Length=414

 Score =   144 bits (364),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 81/118 (69%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            ++S  P  ADP G W  C+L+  KC+ SQ+  +QGFR + L A+   + S   G FINSC
Sbjct  295  QSSLAPPAADPAGYWRBCRLNHAKCTSSQINFLQGFRNQMLNAVKRFSMSKQNGLFINSC  354

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +AHCQ+E Q+TW  DDSPV+   +IA AVGDWY+DR+  + +DCPYPCD SCHN  FE
Sbjct  355  FAHCQSERQDTWFADDSPVIGNKAIAIAVGDWYFDRTSVKAVDCPYPCDNSCHNLNFE  412



>gb|KCW58690.1| hypothetical protein EUGRSUZ_H01338 [Eucalyptus grandis]
Length=386

 Score =   144 bits (362),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 81/118 (69%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            + S  P  ADPHG W  C L+  +CS SQ+  +QGFR + L A+   ++S   G F+NSC
Sbjct  268  QASLAPSSADPHGHWRQCTLNHARCSASQIQFLQGFRNQMLNAIRGFSSSRQNGLFLNSC  327

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +AHCQ+E Q+TW  D+SP +   +IA AVGDWY+DR+  + IDCPYPCDK+CHN VF 
Sbjct  328  FAHCQSERQDTWFADNSPTIGNKAIALAVGDWYFDRAAVKAIDCPYPCDKTCHNLVFH  385



>gb|ABR16604.1| unknown [Picea sitchensis]
Length=434

 Score =   144 bits (364),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 85/117 (73%), Gaps = 1/117 (1%)
 Frame = -2

Query  640  TSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCY  461
            +S +P  ADP G WH C+L+   CS SQL ++QGFRM+ L  L  +A S   G FINSC+
Sbjct  317  SSLVPTAADPQGHWHFCRLNPANCSASQLQVLQGFRMDMLNELRVLAGSRVGGMFINSCF  376

Query  460  AHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            AHCQ+E Q+TW   DSP L  T IA++VGDWY+DRSP ++IDC YPCD++CHN +F+
Sbjct  377  AHCQSERQDTWFAPDSPRLKKT-IAESVGDWYFDRSPSKEIDCAYPCDQTCHNLIFK  432



>ref|XP_009366012.1| PREDICTED: protein notum homolog [Pyrus x bretschneideri]
Length=414

 Score =   144 bits (363),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 81/118 (69%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            ++S  P  ADP G W  C+L+  KC+ SQ+  +QGFR + L A+   + S   G FINSC
Sbjct  295  QSSLAPPAADPAGYWRDCRLNHAKCTSSQINFLQGFRNQMLNAVKRFSMSKQNGLFINSC  354

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +AHCQ+E Q+TW  DDSPV+   +IA AVGDWY+DR+  + IDCPYPCD SCHN  FE
Sbjct  355  FAHCQSERQDTWFADDSPVIGKKAIAIAVGDWYFDRTSVKAIDCPYPCDNSCHNLNFE  412



>ref|XP_009600844.1| PREDICTED: protein notum homolog [Nicotiana tomentosiformis]
Length=421

 Score =   142 bits (358),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 79/118 (67%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            + S  P  ADPHG WH C L+  +CS SQ+  +QGFR+  L  +   A S   G FINSC
Sbjct  304  QESLAPRGADPHGVWHDCTLNNERCSPSQIQFLQGFRIHMLNTIKRFAASRQNGLFINSC  363

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +AHCQ+E Q+TW  D+SP++    IA AVGDWY+DRS  + IDC YPCD++CHN VF 
Sbjct  364  FAHCQSERQDTWFSDNSPMINNKPIALAVGDWYFDRSGMKAIDCAYPCDRTCHNLVFR  421


 Score = 38.5 bits (88),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 16/26 (62%), Positives = 22/26 (85%), Gaps = 0/26 (0%)
 Frame = -1

Query  695  IQTXLFLVNSAYDSWQVKNILAXRGS  618
            I+T LFL+N+AYDSWQ++  LA RG+
Sbjct  287  IKTPLFLLNAAYDSWQLQESLAPRGA  312



>ref|XP_010911666.1| PREDICTED: protein notum homolog [Elaeis guineensis]
Length=388

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 79/110 (72%), Gaps = 2/110 (2%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQ  449
            P  +DP   W  CKLDI KCS SQL ++Q FR EFL AL A  NSPS G FI+SCY+HCQ
Sbjct  278  PSPSDPSKVWGECKLDIKKCSSSQLQVLQDFRSEFLHALPA--NSPSTGLFIDSCYSHCQ  335

Query  448  TEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNR  299
            +  QETWL  +SP +   SIAKAVGDW+Y RS  QKIDCPYPC+ +C NR
Sbjct  336  SGAQETWLSSNSPAIDKMSIAKAVGDWFYGRSAIQKIDCPYPCNPTCVNR  385



>ref|XP_010070108.1| PREDICTED: protein notum homolog [Eucalyptus grandis]
 gb|KCW58691.1| hypothetical protein EUGRSUZ_H01338 [Eucalyptus grandis]
Length=424

 Score =   144 bits (363),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 81/118 (69%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            + S  P  ADPHG W  C L+  +CS SQ+  +QGFR + L A+   ++S   G F+NSC
Sbjct  306  QASLAPSSADPHGHWRQCTLNHARCSASQIQFLQGFRNQMLNAIRGFSSSRQNGLFLNSC  365

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +AHCQ+E Q+TW  D+SP +   +IA AVGDWY+DR+  + IDCPYPCDK+CHN VF 
Sbjct  366  FAHCQSERQDTWFADNSPTIGNKAIALAVGDWYFDRAAVKAIDCPYPCDKTCHNLVFH  423



>ref|XP_010489689.1| PREDICTED: protein notum homolog [Camelina sativa]
Length=413

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 82/118 (69%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            ++S  P  ADP G WH C+L+  KC+ +QL  +QGFR + L+ +   + S   G FINSC
Sbjct  296  QSSIAPTSADPSGFWHDCRLNHGKCTPAQLRFLQGFRDQMLRVVKGFSMSRQNGLFINSC  355

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +AHCQTE Q+TW  DDSPV+    +A AVGDWY+DR+  + +DCPYPCDKSCHN VF 
Sbjct  356  FAHCQTERQDTWFADDSPVIRKKVVAIAVGDWYFDRAEVKLVDCPYPCDKSCHNLVFR  413



>ref|XP_006408013.1| hypothetical protein EUTSA_v10020818mg [Eutrema salsugineum]
 gb|ESQ49466.1| hypothetical protein EUTSA_v10020818mg [Eutrema salsugineum]
Length=415

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 82/118 (69%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            ++S  P  ADP G WH C+L+  KC+ +Q+  +QGFR + L  +   + S   G FINSC
Sbjct  298  QSSIAPTSADPSGFWHDCRLNHEKCTPAQMRFLQGFRDQMLSVVRGFSMSRQNGLFINSC  357

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +AHCQTE Q+TW  DDSPV+   ++A AVGDWY+DR+  + +DCPYPCDKSCHN VF 
Sbjct  358  FAHCQTERQDTWFADDSPVIKKKAVAIAVGDWYFDRAEVKLVDCPYPCDKSCHNLVFR  415



>ref|XP_009805042.1| PREDICTED: protein notum homolog [Nicotiana sylvestris]
Length=417

 Score =   141 bits (356),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 79/118 (67%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            + S  P  ADPHG WH C L+  +CS SQ+  +QGFR+  L  +   A S   G FINSC
Sbjct  300  QESLAPRGADPHGIWHDCTLNNERCSPSQIHFLQGFRIHMLNTIKRFAASRQNGLFINSC  359

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +AHCQ+E Q+TW  D+SP++    IA AVGDWY+DRS  + IDC YPCD++CHN +F 
Sbjct  360  FAHCQSERQDTWFSDNSPMINNKPIALAVGDWYFDRSGMKAIDCAYPCDRTCHNLIFR  417


 Score = 38.9 bits (89),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 16/26 (62%), Positives = 22/26 (85%), Gaps = 0/26 (0%)
 Frame = -1

Query  695  IQTXLFLVNSAYDSWQVKNILAXRGS  618
            I+T LFL+N+AYDSWQ++  LA RG+
Sbjct  283  IKTPLFLLNAAYDSWQLQESLAPRGA  308



>ref|XP_006394896.1| hypothetical protein EUTSA_v10004301mg [Eutrema salsugineum]
 gb|ESQ32182.1| hypothetical protein EUTSA_v10004301mg [Eutrema salsugineum]
Length=416

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 84/118 (71%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            ++S  P  ADP G WH C+L+  +C+ +Q+  +QGFR + L+A+   +N    G FINSC
Sbjct  299  QSSIAPPSADPSGYWHECRLNHGRCTPAQIRFLQGFRNQMLRAVRGFSNLRKNGLFINSC  358

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +AHCQTE Q+TW  D+SPV+   ++A AVGDWY+DR+  + IDCPYPCD+SCHN VF 
Sbjct  359  FAHCQTERQDTWFADNSPVIHKKAVAIAVGDWYFDRAEVKLIDCPYPCDRSCHNLVFR  416



>ref|XP_010042504.1| PREDICTED: protein notum homolog isoform X2 [Eucalyptus grandis]
Length=298

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 79/118 (67%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            + S  P  ADP G WH C L+  KC+ SQ+  +Q FR + L  +   + S   G FINSC
Sbjct  181  QVSLAPPSADPQGYWHECTLNYTKCNSSQIQFLQDFRSQMLNVIKYFSKSNRNGLFINSC  240

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +AHCQ+E Q+TW  DDSP + G  IA AVG+WY+DR+  + IDCPYPCDK+CHN +F+
Sbjct  241  FAHCQSERQDTWFSDDSPRIGGQPIAIAVGNWYFDRAVVKAIDCPYPCDKTCHNLIFK  298



>ref|XP_006338904.1| PREDICTED: protein notum homolog isoform X1 [Solanum tuberosum]
Length=413

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 78/116 (67%), Gaps = 0/116 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            ++S  P VADPHG WH CKL+  KCS SQ+  +Q FR + L A+     S   G FINSC
Sbjct  296  QSSLAPPVADPHGLWHDCKLNYEKCSASQIQFLQDFRNDMLNAIKGFGVSTQNGLFINSC  355

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRV  296
            +AHCQ+E Q+TW  DDSP++    +A AVGDWY+DR     IDC YPCDK+CHN V
Sbjct  356  FAHCQSERQDTWFADDSPLIDNKPVALAVGDWYFDREGVNAIDCAYPCDKTCHNMV  411



>emb|CDX74124.1| BnaA03g29230D [Brassica napus]
Length=417

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 82/118 (69%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            ++S  P  ADP G WH C+L+  KC+  Q+  +Q FR + L+ +   + S   G FINSC
Sbjct  300  QSSIAPKSADPSGFWHDCRLNHEKCTSGQMRFLQSFRDQMLRVVKGFSMSRQNGLFINSC  359

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +AHCQTE Q+TW  DDSPV++  ++A AVGDWY+DR+  + +DCPYPCDKSCHN VF 
Sbjct  360  FAHCQTERQDTWFADDSPVISKKAVAIAVGDWYFDRAEVKLVDCPYPCDKSCHNMVFR  417



>ref|XP_009134857.1| PREDICTED: protein notum homolog [Brassica rapa]
Length=417

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 82/118 (69%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            ++S  P  ADP G WH C+L+  KC+  Q+  +Q FR + L+ +   + S   G FINSC
Sbjct  300  QSSIAPKSADPSGFWHDCRLNHEKCTSGQMRFLQSFRDQMLRVVKGFSMSRQNGLFINSC  359

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +AHCQTE Q+TW  DDSPV++  ++A AVGDWY+DR+  + +DCPYPCDKSCHN VF 
Sbjct  360  FAHCQTERQDTWFADDSPVISKKAVAIAVGDWYFDRAEVKLVDCPYPCDKSCHNMVFR  417



>ref|XP_008807933.1| PREDICTED: protein notum homolog [Phoenix dactylifera]
Length=400

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 80/116 (69%), Gaps = 0/116 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            R S     ADP G W +CK + LKC+D Q+  +QGFR + L A    +NS   G FINSC
Sbjct  283  RQSLATKNADPKGHWQACKYNYLKCNDDQIKFLQGFRNQMLDATKGFSNSKQNGLFINSC  342

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRV  296
            +AHCQ+E Q+TW  D+SP +    IAK+VGDWY+DR+  ++IDCPYPCDK+CHN V
Sbjct  343  FAHCQSEKQDTWYGDNSPTIQDKGIAKSVGDWYFDRAQVREIDCPYPCDKTCHNLV  398



>ref|XP_009397056.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
 ref|XP_009397057.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
Length=393

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 83/118 (70%), Gaps = 1/118 (1%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            + +  P  ADP  +W++CKL+I  CS  QL  MQ FR EFL+AL A  N PS G FI SC
Sbjct  277  KNTLAPSSADPRKSWNACKLNIKSCSSDQLEKMQEFRSEFLRALPASGN-PSTGMFIISC  335

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            YAHCQ+  Q+TWL  DSP++    IAKAVGDW+Y RS  +KIDCPYPC+ SC NRV+E
Sbjct  336  YAHCQSGSQDTWLGADSPMIDKMPIAKAVGDWFYGRSVVRKIDCPYPCNSSCRNRVYE  393



>gb|KHG09455.1| Protein notum [Gossypium arboreum]
Length=397

 Score =   139 bits (349),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 78/109 (72%), Gaps = 2/109 (2%)
 Frame = -2

Query  628  PGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKAL--GAVANSPSRGFFINSCYAH  455
            P  AD    W SCKLD+ KC+++QL I+Q FR +FL AL    V NSPS+G FI+SCYAH
Sbjct  282  PSAADKSKEWKSCKLDLKKCTETQLKIIQDFRTQFLSALNRAGVINSPSKGMFIDSCYAH  341

Query  454  CQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSC  308
            CQ   Q  W  D SPV++   IAKAVGDWYY+RSP +K+DCPYPC+ +C
Sbjct  342  CQVGKQIQWSSDSSPVVSNMKIAKAVGDWYYERSPIKKLDCPYPCNPTC  390


 Score = 41.2 bits (95),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -1

Query  695  IQTXLFLVNSAYDSWQVKNILA  630
            +QT +F VNSAYDSWQ+KNILA
Sbjct  260  MQTPIFFVNSAYDSWQIKNILA  281



>gb|EPS60657.1| hypothetical protein M569_14145, partial [Genlisea aurea]
Length=224

 Score =   139 bits (349),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 80/117 (68%), Gaps = 0/117 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            + S  P  ADPHGTW  CK++  +CS SQ+  +Q FR E + A+   + S   G F+NSC
Sbjct  108  QESLAPPTADPHGTWRDCKMNNQRCSPSQIQFLQNFRNEMVNAVRGFSGSRQAGLFVNSC  167

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVF  293
            +AHCQ+E Q+TW  D+SP +   ++A AVGDW++DR   ++IDC YPCD+SCHN VF
Sbjct  168  FAHCQSERQDTWFADNSPTINNKAVAIAVGDWFFDRGTVKEIDCAYPCDRSCHNLVF  224



>gb|KCW85006.1| hypothetical protein EUGRSUZ_B01828 [Eucalyptus grandis]
Length=302

 Score =   140 bits (354),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 79/118 (67%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            + S  P  ADP G WH C L+  KC+ SQ+  +Q FR + L  +   + S   G FINSC
Sbjct  185  QVSLAPPSADPQGYWHECTLNYTKCNSSQIQFLQDFRSQMLNVIKYFSKSNRNGLFINSC  244

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +AHCQ+E Q+TW  DDSP + G  IA AVG+WY+DR+  + IDCPYPCDK+CHN +F+
Sbjct  245  FAHCQSERQDTWFSDDSPRIGGQPIAIAVGNWYFDRAVVKAIDCPYPCDKTCHNLIFK  302



>ref|XP_006286504.1| hypothetical protein CARUB_v10001019mg [Capsella rubella]
 gb|EOA19402.1| hypothetical protein CARUB_v10001019mg [Capsella rubella]
Length=427

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 83/118 (70%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            ++S  P  ADP G WH C+L+  +C+ +Q+  +QGFR + L+A+   +     G FINSC
Sbjct  310  QSSIAPPSADPSGYWHECRLNHGRCTPAQIRFLQGFRNQMLRAVNGFSKMKKNGLFINSC  369

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            ++HCQTE Q+TW  DDSPV+   ++A AVGDWY+DR+  + IDCPYPCD+SCHN VF 
Sbjct  370  FSHCQTERQDTWFADDSPVIHKKAVAIAVGDWYFDRAEVKLIDCPYPCDRSCHNLVFR  427



>ref|XP_002280865.3| PREDICTED: protein notum homolog [Vitis vinifera]
Length=410

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 80/116 (69%), Gaps = 0/116 (0%)
 Frame = -2

Query  637  SWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYA  458
            S +P   DPHG W++CK +   C+ +Q+ ++Q FRME L  + + A     G FINSC+ 
Sbjct  295  SLVPSSVDPHGEWNACKSNQSNCNSTQIQLLQDFRMEMLDDVKSFARDDQNGLFINSCFV  354

Query  457  HCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            HCQTE Q+TW  DDSP++    IA++VGDWY+DR P + IDCPYPCD +CHN VF+
Sbjct  355  HCQTERQDTWFADDSPLIGKKKIAESVGDWYFDRRPVKAIDCPYPCDTTCHNLVFK  410



>ref|XP_006359968.1| PREDICTED: protein notum homolog, partial [Solanum tuberosum]
Length=369

 Score =   134 bits (336),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 79/112 (71%), Gaps = 0/112 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            R   +P   DP G W+SC  +I  C+  QL ++QGFR+ FLKAL  +  S +RG++INSC
Sbjct  257  RNILVPRGTDPKGAWNSCGANIKTCTPDQLKVLQGFRLNFLKALEGLGPSSTRGYYINSC  316

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSC  308
            +AHCQT+ Q +W   +SP L   +IA+AVGDW  +R+ F++IDCPYPCDK+C
Sbjct  317  FAHCQTQKQASWFGPNSPRLFNKTIAEAVGDWVLERNQFRQIDCPYPCDKTC  368


 Score = 45.8 bits (107),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 19/26 (73%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = -1

Query  695  IQTXLFLVNSAYDSWQVKNILAXRGS  618
            IQT LF++NSAYDSWQV+NIL  RG+
Sbjct  240  IQTPLFIINSAYDSWQVRNILVPRGT  265



>ref|XP_003591264.1| Pectin acetylesterase [Medicago truncatula]
 gb|AES61515.1| pectinacetylesterase family protein [Medicago truncatula]
Length=402

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 80/118 (68%), Gaps = 0/118 (0%)
 Frame = -2

Query  643  RTSWLPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSC  464
            ++S  P  ADPHG W  C+L+  KCS SQ+  +QGFR   +  +   + S   G FINSC
Sbjct  285  QSSLAPSSADPHGNWRECRLNHNKCSGSQIQFLQGFRNHMVNVVRGFSRSSQNGLFINSC  344

Query  463  YAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  290
            +AHCQ+E Q+TW  D+SPV+   +IA AVGDWY+DR+  + IDCPYPCD +CH+ VF 
Sbjct  345  FAHCQSERQDTWFADNSPVIGNKAIALAVGDWYFDRAAVKDIDCPYPCDNTCHHLVFR  402



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1171852487340