BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF001H11

Length=719
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009618592.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    351   5e-119   Nicotiana tomentosiformis
ref|XP_004252860.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    351   1e-118   
ref|XP_009785468.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    349   2e-118   Nicotiana sylvestris
ref|XP_006365808.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    347   1e-117   
gb|EYU44192.1|  hypothetical protein MIMGU_mgv1a013253mg                347   2e-117   Erythranthe guttata [common monkey flower]
ref|XP_011098741.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    345   6e-117   Sesamum indicum [beniseed]
ref|XP_008455431.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    341   3e-115   Cucumis melo [Oriental melon]
ref|XP_003548187.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    340   5e-115   Glycine max [soybeans]
gb|KJB80515.1|  hypothetical protein B456_013G101000                    340   8e-115   Gossypium raimondii
gb|KHN42547.1|  50S ribosomal protein L6, chloroplastic                 340   1e-114   Glycine soja [wild soybean]
ref|XP_007045631.1|  Ribosomal protein L6 family                        339   2e-114   Theobroma cacao [chocolate]
ref|XP_004144493.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    338   4e-114   Cucumis sativus [cucumbers]
ref|XP_003534001.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    338   5e-114   Glycine max [soybeans]
gb|KHG21050.1|  50S ribosomal L6, chloroplastic -like protein           335   7e-113   Gossypium arboreum [tree cotton]
ref|XP_008223584.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    330   5e-111   Prunus mume [ume]
gb|ACU23468.1|  unknown                                                 330   6e-111   Glycine max [soybeans]
gb|AFK43716.1|  unknown                                                 330   8e-111   Medicago truncatula
ref|XP_004514093.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    330   1e-110   Cicer arietinum [garbanzo]
ref|XP_008379631.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    330   1e-110   Malus domestica [apple tree]
ref|XP_007223925.1|  hypothetical protein PRUPE_ppa011034mg             329   2e-110   Prunus persica
ref|XP_010522339.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    328   4e-110   Tarenaya hassleriana [spider flower]
ref|XP_010100629.1|  50S ribosomal protein L6                           328   6e-110   Morus notabilis
gb|ACU19091.1|  unknown                                                 327   1e-109   Glycine max [soybeans]
ref|XP_002279657.2|  PREDICTED: 50S ribosomal protein L6, chlorop...    325   4e-109   Vitis vinifera
ref|XP_010557010.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    325   5e-109   Tarenaya hassleriana [spider flower]
ref|XP_006304184.1|  hypothetical protein CARUB_v10010237mg             325   9e-109   Capsella rubella
ref|XP_008342000.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    325   1e-108   
ref|XP_006418054.1|  hypothetical protein EUTSA_v10008693mg             324   1e-108   Eutrema salsugineum [saltwater cress]
ref|XP_007152280.1|  hypothetical protein PHAVU_004G116200g             324   1e-108   Phaseolus vulgaris [French bean]
ref|XP_002892273.1|  EMB2394                                            324   1e-108   
ref|XP_010484767.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    324   2e-108   Camelina sativa [gold-of-pleasure]
ref|XP_010243082.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    323   2e-108   Nelumbo nucifera [Indian lotus]
ref|XP_010276744.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    323   3e-108   Nelumbo nucifera [Indian lotus]
ref|NP_172011.1|  50S ribosomal protein L6                              323   3e-108   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010457601.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    323   3e-108   Camelina sativa [gold-of-pleasure]
emb|CDY70611.1|  BnaAnng34360D                                          323   5e-108   Brassica napus [oilseed rape]
ref|XP_011005106.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    323   6e-108   Populus euphratica
ref|XP_002320459.1|  ribosomal protein L6                               322   1e-107   Populus trichocarpa [western balsam poplar]
ref|XP_009119188.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    322   1e-107   Brassica rapa
emb|CDY46838.1|  BnaA10g03220D                                          322   1e-107   Brassica napus [oilseed rape]
ref|XP_010475192.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    322   1e-107   Camelina sativa [gold-of-pleasure]
ref|XP_010689735.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    321   2e-107   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009353272.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    320   7e-107   Pyrus x bretschneideri [bai li]
ref|XP_009401055.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    319   1e-106   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004287942.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    319   2e-106   Fragaria vesca subsp. vesca
emb|CDY49511.1|  BnaC05g03230D                                          318   2e-106   Brassica napus [oilseed rape]
ref|XP_010051031.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    318   4e-106   Eucalyptus grandis [rose gum]
dbj|BAH20405.1|  AT1G05190                                              316   7e-106   Arabidopsis thaliana [mouse-ear cress]
gb|ACG25590.1|  50S ribosomal protein L6                                317   1e-105   Zea mays [maize]
ref|XP_006447548.1|  hypothetical protein CICLE_v10016578mg             317   1e-105   Citrus clementina [clementine]
ref|XP_010907839.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    317   2e-105   Elaeis guineensis
ref|XP_009118616.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    316   3e-105   Brassica rapa
ref|XP_006650092.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    315   4e-105   Oryza brachyantha
ref|XP_003557902.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    315   4e-105   Brachypodium distachyon [annual false brome]
ref|NP_001051292.1|  Os03g0751400                                       315   6e-105   
gb|KDP25836.1|  hypothetical protein JCGZ_22866                         315   9e-105   Jatropha curcas
ref|NP_001050139.1|  Os03g0356300                                       314   1e-104   
emb|CDY06163.1|  BnaA09g50400D                                          314   1e-104   
gb|EAZ26952.1|  hypothetical protein OsJ_10878                          314   2e-104   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002465260.1|  hypothetical protein SORBIDRAFT_01g035090          312   6e-104   Sorghum bicolor [broomcorn]
dbj|BAJ92513.1|  predicted protein                                      311   1e-103   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ84917.1|  predicted protein                                      312   1e-103   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ91776.1|  predicted protein                                      311   2e-103   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004984341.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    310   3e-103   Setaria italica
gb|KDO41664.1|  hypothetical protein CISIN_1g027306mg                   310   3e-103   Citrus sinensis [apfelsine]
gb|EPS61113.1|  hypothetical protein M569_13685                         308   2e-102   Genlisea aurea
gb|EMT33559.1|  50S ribosomal protein L6, chloroplastic                 310   4e-102   
ref|NP_001148555.1|  50S ribosomal protein L6                           306   2e-101   Zea mays [maize]
ref|NP_001152325.1|  50S ribosomal protein L6                           306   2e-101   Zea mays [maize]
gb|EMS56589.1|  50S ribosomal protein L6, chloroplastic                 308   2e-101   Triticum urartu
emb|CDP19076.1|  unnamed protein product                                306   3e-101   Coffea canephora [robusta coffee]
ref|XP_008680805.1|  PREDICTED: 50S ribosomal protein L6 isoform X1     295   7e-97    Zea mays [maize]
ref|XP_006858065.1|  hypothetical protein AMTR_s00062p00057610          294   8e-97    Amborella trichopoda
gb|ABK21300.1|  unknown                                                 289   9e-95    Picea sitchensis
ref|XP_008802994.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    285   4e-94    
gb|KEH16126.1|  50S ribosomal protein L6                                268   2e-87    Medicago truncatula
ref|XP_002977678.1|  hypothetical protein SELMODRAFT_107348             268   2e-86    
ref|XP_002979598.1|  hypothetical protein SELMODRAFT_110948             267   3e-86    
ref|XP_001771522.1|  predicted protein                                  257   4e-82    
ref|XP_001784938.1|  predicted protein                                  256   9e-82    
ref|XP_006376781.1|  hypothetical protein POPTR_0012s06340g             251   5e-80    
ref|XP_006376783.1|  hypothetical protein POPTR_0012s06360g             234   4e-74    
emb|CDY41816.1|  BnaC02g12270D                                          231   3e-72    Brassica napus [oilseed rape]
ref|XP_005849229.1|  hypothetical protein CHLNCDRAFT_34831              223   4e-69    Chlorella variabilis
ref|XP_011399322.1|  50S ribosomal protein L6, chloroplastic            213   5e-65    Auxenochlorella protothecoides
gb|KIZ02220.1|  50S ribosomal protein L6                                203   2e-61    Monoraphidium neglectum
ref|XP_005643355.1|  ribosomal protein L6                               200   4e-60    Coccomyxa subellipsoidea C-169
gb|ACN31842.1|  unknown                                                 194   4e-59    Zea mays [maize]
ref|XP_001421323.1|  Plastid ribosomal protein L6 large ribosomal...    197   5e-59    Ostreococcus lucimarinus CCE9901
ref|WP_015170862.1|  50S ribosomal protein L6                           195   9e-59    Geitlerinema sp. PCC 7407
gb|AAP68351.1|  putative ribosomal protein CtrL6e, 5'-partial           192   3e-58    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002505297.1|  predicted protein                                  195   5e-58    Micromonas commoda
ref|XP_009763796.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    191   5e-58    Nicotiana sylvestris
ref|WP_036002394.1|  50S ribosomal protein L6                           193   6e-58    [Leptolyngbya] sp. JSC-1
ref|WP_015203286.1|  50S ribosomal protein L6                           192   1e-57    Crinalium epipsammum
ref|WP_037217674.1|  50S ribosomal protein L6                           191   5e-57    
ref|WP_039717296.1|  50S ribosomal protein L6                           191   6e-57    
emb|CEG01824.1|  Ribosomal protein L6, conserved site                   192   8e-57    Ostreococcus tauri
ref|WP_015152288.1|  50S ribosomal protein L6                           190   2e-56    Cyanobacteria [blue-green bacteria]
ref|WP_017721159.1|  50S ribosomal protein L6                           190   2e-56    Oscillatoria sp. PCC 10802
ref|WP_009543883.1|  MULTISPECIES: 50S ribosomal protein L6             189   2e-56    Cyanothece
ref|XP_002966651.1|  hypothetical protein SELMODRAFT_6327               188   4e-56    
ref|WP_008275484.1|  50S ribosomal protein L6                           189   4e-56    Cyanothece sp. CCY0110
ref|WP_009782735.1|  50S ribosomal protein L6                           189   4e-56    Lyngbya sp. PCC 8106
ref|WP_022605574.1|  50S ribosomal protein L6                           188   5e-56    Rubidibacter lacunae
ref|WP_036532292.1|  50S ribosomal protein L6                           188   5e-56    Neosynechococcus sphagnicola
ref|WP_015118729.1|  50S ribosomal protein L6                           188   6e-56    Rivularia sp. PCC 7116
ref|WP_023067381.1|  50S ribosomal protein L6                           188   7e-56    Lyngbya aestuarii
ref|WP_006621330.1|  MULTISPECIES: 50S ribosomal protein L6             188   7e-56    Arthrospira
emb|CCQ60081.1|  LSU ribosomal protein L6p (L9e)                        188   8e-56    Crocosphaera watsonii WH 0401
ref|WP_015141077.1|  50S ribosomal protein L6                           188   9e-56    Nostoc sp. PCC 7524
ref|WP_027844107.1|  50S ribosomal protein L6                           187   1e-55    Mastigocoleus testarum
ref|WP_023071150.1|  50S ribosomal protein L6                           187   1e-55    Leptolyngbya sp. Heron Island J
ref|WP_008191191.1|  50S ribosomal protein L6                           187   1e-55    Moorea producens
ref|WP_007306418.1|  50S ribosomal protein L6                           187   2e-55    Crocosphaera watsonii
ref|WP_015955691.1|  50S ribosomal protein L6                           187   2e-55    Cyanothece sp. PCC 7424
ref|WP_019500654.1|  50S ribosomal protein L6                           187   2e-55    Pseudanabaena sp. PCC 6802
ref|WP_007472094.1|  50S ribosomal protein L6                           187   2e-55    Segniliparus rugosus
ref|WP_002787868.1|  50S ribosomal protein L6                           187   3e-55    Microcystis aeruginosa
ref|WP_015200868.1|  50S ribosomal protein L6                           186   3e-55    Calothrix parietina
ref|WP_017321361.1|  50S ribosomal protein L6                           186   3e-55    cyanobacterium PCC 7702
ref|WP_015231117.1|  50S ribosomal protein L6                           186   4e-55    Dactylococcopsis salina
ref|WP_023358196.1|  50S ribosomal protein L6                           186   4e-55    Actinoplanes friuliensis
ref|WP_015227140.1|  50S ribosomal protein L6                           186   4e-55    Halothece sp. PCC 7418
ref|XP_001696829.1|  plastid ribosomal protein L6                       187   4e-55    Chlamydomonas reinhardtii
ref|WP_017325553.1|  50S ribosomal protein L6                           186   5e-55    Synechococcus sp. PCC 7336
ref|WP_041036063.1|  50S ribosomal protein L6                           186   6e-55    Tolypothrix campylonemoides
ref|WP_026086027.1|  50S ribosomal protein L6                           186   7e-55    Fischerella muscicola
ref|WP_026099472.1|  50S ribosomal protein L6                           185   8e-55    Prochlorothrix hollandica
ref|WP_010469303.1|  MULTISPECIES: 50S ribosomal protein L6             185   8e-55    Acaryochloris
gb|KIE08718.1|  50S ribosomal protein L6                                185   1e-54    Tolypothrix bouteillei VB521301
ref|WP_007073021.1|  50S ribosomal protein L6                           185   1e-54    Micromonospora sp. ATCC 39149
ref|XP_003060321.1|  predicted protein                                  186   1e-54    Micromonas pusilla CCMP1545
ref|WP_009455538.1|  MULTISPECIES: 50S ribosomal protein L6             185   1e-54    Fischerella
ref|WP_002771057.1|  50S ribosomal protein L6                           185   1e-54    Microcystis aeruginosa
ref|WP_002753903.1|  50S ribosomal protein L6                           185   1e-54    Microcystis aeruginosa
ref|WP_002794624.1|  50S ribosomal protein L6                           185   1e-54    Microcystis aeruginosa
gb|ACN31089.1|  unknown                                                 182   2e-54    Zea mays [maize]
ref|WP_013735942.1|  50S ribosomal protein L6                           184   2e-54    Verrucosispora
ref|WP_015195219.1|  50S ribosomal protein L6                           184   2e-54    Stanieria cyanosphaera
ref|WP_015187428.1|  50S ribosomal protein L6                           184   2e-54    Gloeocapsa sp. PCC 7428
ref|WP_011317570.1|  50S ribosomal protein L6                           184   2e-54    Trichormus variabilis
ref|WP_010998339.1|  50S ribosomal protein L6                           184   2e-54    Nostocaceae
ref|WP_017310480.1|  MULTISPECIES: 50S ribosomal protein L6             184   2e-54    Hapalosiphonaceae
ref|WP_012593618.1|  MULTISPECIES: 50S ribosomal protein L6             184   2e-54    Cyanothece
ref|WP_002780093.1|  50S ribosomal protein L6                           184   2e-54    Microcystis
ref|WP_002746609.1|  50S ribosomal protein L6                           184   3e-54    Microcystis aeruginosa
ref|WP_006196730.1|  50S ribosomal protein L6                           184   3e-54    Nodularia spumigena
ref|WP_029639091.1|  50S ribosomal protein L6                           184   3e-54    alpha proteobacterium Mf 1.05b.01
ref|YP_009029516.1|  ribosomal protein L6                               184   3e-54    Lithodesmium undulatum
ref|WP_028191074.1|  50S ribosomal protein L6                           184   3e-54    Salinispora arenicola
ref|WP_011612508.1|  50S ribosomal protein L6                           184   3e-54    Trichodesmium erythraeum
ref|WP_026722080.1|  50S ribosomal protein L6                           184   3e-54    Fischerella sp. PCC 9431
ref|WP_015186046.1|  50S ribosomal protein L6                           184   4e-54    Microcoleus sp. PCC 7113
ref|WP_006515901.1|  50S ribosomal protein L6                           183   4e-54    Leptolyngbya sp. PCC 7375
ref|WP_035156543.1|  50S ribosomal protein L6                           184   4e-54    Calothrix sp. 336/3
ref|WP_017748883.1|  50S ribosomal protein L6                           184   4e-54    Scytonema hofmannii
ref|WP_030473453.1|  50S ribosomal protein L6                           183   4e-54    Lechevalieria
ref|WP_035991895.1|  50S ribosomal protein L6                           183   4e-54    Leptolyngbya sp. KIOST-1
ref|WP_002733352.1|  50S ribosomal protein L6                           184   5e-54    Microcystis aeruginosa
ref|WP_018908047.1|  50S ribosomal protein L6                           183   5e-54    Salinispora arenicola
ref|WP_007356156.1|  MULTISPECIES: 50S ribosomal protein L6             183   5e-54    Kamptonema
ref|WP_016859434.1|  50S ribosomal protein L6                           183   5e-54    Fischerella muscicola
ref|WP_015113417.1|  50S ribosomal protein L6                           183   5e-54    Nostoc sp. PCC 7107
ref|WP_017314774.1|  50S ribosomal protein L6                           183   5e-54    Mastigocladopsis repens
ref|WP_025781338.1|  50S ribosomal protein L6                           183   6e-54    Candidatus Synechococcus spongiarum
ref|WP_008312941.1|  50S ribosomal protein L6                           183   8e-54    Leptolyngbya sp. PCC 6406
ref|WP_011430033.1|  50S ribosomal protein L6                           182   8e-54    Synechococcus
ref|WP_026732530.1|  50S ribosomal protein L6                           182   9e-54    Fischerella sp. PCC 9605
ref|WP_017297633.1|  50S ribosomal protein L6                           182   1e-53    Nodosilinea nodulosa
ref|WP_006618086.1|  50S ribosomal protein L6                           182   1e-53    Arthrospira platensis
emb|CCQ65151.1|  LSU ribosomal protein L6p (L9e)                        182   1e-53    Crocosphaera watsonii WH 0402
ref|WP_026797653.1|  MULTISPECIES: 50S ribosomal protein L6             182   1e-53    Planktothrix
ref|WP_016953005.1|  50S ribosomal protein L6                           182   1e-53    Anabaena sp. PCC 7108
ref|WP_027254766.1|  50S ribosomal protein L6                           182   1e-53    Planktothrix agardhii
ref|WP_026786891.1|  MULTISPECIES: 50S ribosomal protein L6             182   1e-53    Planktothrix
ref|WP_025729639.1|  50S ribosomal protein L6                           182   1e-53    Atopobacter phocae
ref|WP_016877819.1|  50S ribosomal protein L6                           182   2e-53    Chlorogloeopsis fritschii
ref|WP_017651207.1|  50S ribosomal protein L6                           182   2e-53    Fortiea contorta
ref|WP_002757583.1|  50S ribosomal protein L6                           182   2e-53    Microcystis aeruginosa
ref|WP_027654160.1|  50S ribosomal protein L6                           182   2e-53    Salinispora pacifica
ref|WP_043368788.1|  50S ribosomal protein L6                           182   2e-53    Cyanobium sp. PCC 7001
ref|WP_012184316.1|  50S ribosomal protein L6                           182   2e-53    Salinispora arenicola
ref|WP_012410711.1|  50S ribosomal protein L6                           182   2e-53    Nostoc punctiforme
ref|WP_015105249.1|  50S ribosomal protein L6                           182   2e-53    Saccharothrix espanaensis
ref|WP_013139775.1|  50S ribosomal protein L6                           182   2e-53    Segniliparus rotundus
ref|WP_039727917.1|  MULTISPECIES: 50S ribosomal protein L6             182   2e-53    Lyngbya confervoides
ref|WP_015619007.1|  50S ribosomal protein L6                           182   2e-53    Actinoplanes sp. N902-109
ref|WP_040931604.1|  50S ribosomal protein L6                           181   2e-53    
ref|WP_009767984.1|  50S ribosomal protein L6                           181   3e-53    Oscillatoriales cyanobacterium JSC-12
ref|WP_002796422.1|  50S ribosomal protein L6                           181   3e-53    Microcystis aeruginosa
ref|WP_011628222.1|  50S ribosomal protein L6                           181   3e-53    Alkalilimnicola ehrlichii
ref|WP_027649217.1|  50S ribosomal protein L6                           181   3e-53    Salinispora pacifica
ref|WP_004273659.1|  50S ribosomal protein L6                           181   4e-53    Nitrospirillum amazonense
ref|WP_034304256.1|  50S ribosomal protein L6                           181   4e-53    Amycolatopsis lurida
ref|WP_006456930.1|  50S ribosomal protein L6                           181   4e-53    Synechococcus sp. PCC 7335
ref|WP_015129709.1|  50S ribosomal protein L6                           181   5e-53    Calothrix sp. PCC 7507
gb|KIJ83485.1|  50S ribosomal protein L6                                181   5e-53    Scytonema tolypothrichoides VB-61278
ref|WP_039688659.1|  50S ribosomal protein L6                           181   5e-53    Coriobacteriaceae bacterium 68-1-3
ref|WP_043965528.1|  50S ribosomal protein L6                           181   5e-53    Micromonospora carbonacea
ref|WP_009634242.1|  50S ribosomal protein L6                           181   5e-53    Synechocystis sp. PCC 7509
gb|AFC39969.1|  ribosomal protein L6                                    181   5e-53    Porphyra umbilicalis
ref|WP_026929011.1|  50S ribosomal protein L6                           181   6e-53    Glycomyces tenuis
ref|WP_024286973.1|  50S ribosomal protein L6                           180   6e-53    Cellulomonas sp. KRMCY2
ref|WP_027104281.1|  50S ribosomal protein L6                           180   7e-53    Lachnospiraceae bacterium V9D3004
ref|WP_020691491.1|  50S ribosomal protein L6                           180   7e-53    Aeromicrobium massiliense
ref|WP_018784558.1|  50S ribosomal protein L6                           180   8e-53    Micromonospora
ref|WP_022874123.1|  50S ribosomal protein L6                           180   8e-53    Arthrobacter sp. PAO19
ref|WP_007031044.1|  50S ribosomal protein L6                           180   9e-53    Amycolatopsis decaplanina
ref|WP_028085247.1|  50S ribosomal protein L6                           180   9e-53    Dolichospermum circinale
ref|WP_042104150.1|  50S ribosomal protein L6                           180   9e-53    Parachlamydiaceae bacterium HS-T3
ref|WP_028848728.1|  50S ribosomal protein L6                           180   1e-52    Thermocrispum agreste
ref|WP_019174650.1|  50S ribosomal protein L6                           179   1e-52    Brevibacterium
ref|YP_009092968.1|  ribosomal protein L6                               179   1e-52    Chaetoceros simplex
ref|WP_018720668.1|  50S ribosomal protein L6                           179   1e-52    Salinispora pacifica
ref|WP_008900997.1|  MULTISPECIES: 50S ribosomal protein L6             179   1e-52    Peptoniphilus
ref|WP_015805277.1|  50S ribosomal protein L6                           179   2e-52    Actinosynnema
ref|WP_037270096.1|  50S ribosomal protein L6                           179   2e-52    Kibdelosporangium aridum
ref|WP_018729116.1|  50S ribosomal protein L6                           179   2e-52    Salinispora pacifica
ref|WP_018682818.1|  50S ribosomal protein L6                           179   2e-52    Actinokineospora enzanensis
ref|WP_004820353.1|  50S ribosomal protein L6                           179   2e-52    Peptoniphilus indolicus
ref|WP_014349107.1|  50S ribosomal protein L6                           179   2e-52    Nocardia cyriacigeorgica
ref|WP_038992188.1|  50S ribosomal protein L6                           179   2e-52    Micrococcaceae
ref|WP_014440736.1|  50S ribosomal protein L6                           179   2e-52    Actinoplanes missouriensis
ref|WP_035279546.1|  50S ribosomal protein L6                           179   2e-52    Actinokineospora
ref|WP_037332683.1|  50S ribosomal protein L6                           179   2e-52    Amycolatopsis sp. MJM2582
ref|WP_010311645.1|  50S ribosomal protein L6                           179   2e-52    Synechococcus sp. CB0101
ref|YP_003734607.1|  ribosomal protein L6                               179   2e-52    Kryptoperidinium foliaceum
ref|YP_007947829.1|  ribosomal protein L6                               179   2e-52    Pyropia haitanensis
ref|WP_018801042.1|  50S ribosomal protein L6                           179   2e-52    Salinispora arenicola
ref|WP_025616601.1|  50S ribosomal protein L6                           179   2e-52    Salinispora pacifica
ref|WP_013324975.1|  50S ribosomal protein L6                           179   2e-52    Cyanothece sp. PCC 7822
ref|WP_026922777.1|  50S ribosomal protein L6                           179   2e-52    Glycomyces arizonensis
ref|WP_017286247.1|  50S ribosomal protein L6                           179   3e-52    Leptolyngbya boryana
ref|WP_007465267.1|  50S ribosomal protein L6                           179   3e-52    Micromonospora lupini
ref|WP_009344499.1|  50S ribosomal protein L6                           179   3e-52    Aphanizomenonaceae
ref|YP_009093384.1|  ribosomal protein L6                               179   3e-52    Cerataulina daemon
ref|WP_018726241.1|  50S ribosomal protein L6                           179   3e-52    Salinispora pacifica
ref|WP_044561661.1|  50S ribosomal protein L6                           179   3e-52    Azospirillum sp. B4
ref|WP_006276968.1|  50S ribosomal protein L6                           179   3e-52    Aphanizomenonaceae
ref|WP_030478310.1|  50S ribosomal protein L6                           179   3e-52    Lentzea albidocapillata
ref|WP_020633320.1|  50S ribosomal protein L6                           179   3e-52    Amycolatopsis alba
ref|WP_036533248.1|  50S ribosomal protein L6                           179   3e-52    Nocardia cyriacigeorgica
ref|WP_018217052.1|  50S ribosomal protein L6                           179   3e-52    Salinispora pacifica
ref|XP_002950331.1|  plastid/chloroplast ribosomal protein L6           179   4e-52    Volvox carteri f. nagariensis
ref|WP_018222588.1|  50S ribosomal protein L6                           178   4e-52    Salinispora pacifica
ref|WP_006100646.1|  50S ribosomal protein L6                           178   4e-52    Coleofasciculus chthonoplastes
ref|WP_007001493.1|  50S ribosomal protein L6                           178   4e-52    Actinobaculum massiliense
ref|WP_008197245.1|  50S ribosomal protein L6                           178   4e-52    Microcystis
ref|WP_013288623.1|  MULTISPECIES: 50S ribosomal protein L6             178   4e-52    Micromonosporaceae
ref|WP_012015113.1|  MULTISPECIES: 50S ribosomal protein L6             178   4e-52    Salinispora tropica
ref|WP_019132906.1|  50S ribosomal protein L6                           178   4e-52    Peptoniphilus obesi
ref|WP_029127897.1|  50S ribosomal protein L6                           178   4e-52    Salinispora pacifica
ref|NP_043602.1|  ribosomal protein L6                                  178   5e-52    Trieres chinensis
ref|WP_027402093.1|  50S ribosomal protein L6                           178   5e-52    Nostocales
ref|WP_028187530.1|  50S ribosomal protein L6                           178   5e-52    Salinispora pacifica
ref|WP_018252463.1|  50S ribosomal protein L6                           178   5e-52    Salinispora pacifica
ref|WP_033094748.1|  50S ribosomal protein L6                           178   5e-52    Colwellia psychrerythraea
ref|WP_044304315.1|  50S ribosomal protein L6                           178   6e-52    Richelia intracellularis
ref|WP_011932338.1|  50S ribosomal protein L6                           178   6e-52    Synechococcus sp. WH 7803
ref|WP_012196215.1|  50S ribosomal protein L6                           178   6e-52    Prochlorococcus marinus
ref|WP_028322671.1|  50S ribosomal protein L6                           178   6e-52    Desulfatiglans anilini
ref|YP_003289191.1|  50S ribosomal protein L6                           178   6e-52    Ectocarpus siliculosus
ref|WP_007100630.1|  50S ribosomal protein L6                           178   7e-52    Synechococcus sp. RS9917
ref|WP_011434166.1|  50S ribosomal protein L6                           178   7e-52    Synechococcus sp. JA-2-3B'a(2-13)
ref|WP_030436516.1|  50S ribosomal protein L6                           177   7e-52    Actinoplanes subtropicus
ref|WP_015178716.1|  50S ribosomal protein L6                           178   7e-52    Oscillatoria nigro-viridis
ref|WP_033428587.1|  50S ribosomal protein L6                           177   7e-52    Saccharothrix syringae
ref|WP_032520648.1|  50S ribosomal protein L6                           177   7e-52    
ref|WP_015148984.1|  50S ribosomal protein L6                           177   7e-52    Oscillatoria acuminata
ref|WP_011314653.1|  50S ribosomal protein L6                           177   8e-52    Nitrobacter winogradskyi
ref|WP_015215925.1|  50S ribosomal protein L6                           177   8e-52    Anabaena cylindrica
ref|WP_030329899.1|  50S ribosomal protein L6                           177   8e-52    Micromonospora parva
ref|WP_020513600.1|  50S ribosomal protein L6                           177   8e-52    Actinoplanes globisporus
ref|WP_026424131.1|  50S ribosomal protein L6                           177   9e-52    Actinokineospora inagensis
ref|WP_024125573.1|  50S ribosomal protein L6                           177   9e-52    Thermosynechococcus sp. NK55a
ref|WP_037314677.1|  50S ribosomal protein L6                           177   9e-52    Actinobacteria
ref|WP_020178178.1|  50S ribosomal protein L6                           177   1e-51    Methylopila sp. M107
ref|WP_003421144.1|  50S ribosomal protein L6                           177   1e-51    Clostridioides difficile
ref|WP_009152392.1|  50S ribosomal protein L6                           177   1e-51    
ref|WP_010185508.1|  50S ribosomal protein L6                           177   1e-51    
ref|WP_006634987.1|  50S ribosomal protein L6                           177   1e-51    
ref|WP_009233265.1|  MULTISPECIES: 50S ribosomal protein L6             177   1e-51    
ref|WP_012111673.1|  50S ribosomal protein L6                           177   1e-51    
ref|WP_022145100.1|  50S ribosomal protein L6                           177   1e-51    
ref|WP_016331093.1|  50S ribosomal protein L6                           177   1e-51    
ref|WP_011936544.1|  50S ribosomal protein L6                           177   1e-51    
ref|WP_013191483.1|  50S ribosomal protein L6                           177   1e-51    
ref|WP_013016481.1|  50S ribosomal protein L6                           177   1e-51    
ref|WP_017506047.1|  50S ribosomal protein L6                           177   1e-51    
ref|WP_015144997.1|  50S ribosomal protein L6                           177   1e-51    
ref|WP_003789306.1|  MULTISPECIES: 50S ribosomal protein L6             177   1e-51    
ref|WP_012799441.1|  50S ribosomal protein L6                           177   1e-51    
ref|WP_042182741.1|  50S ribosomal protein L6                           177   1e-51    
ref|WP_005166793.1|  MULTISPECIES: 50S ribosomal protein L6             177   1e-51    
ref|WP_015079199.1|  50S ribosomal protein L6                           177   1e-51    
ref|WP_033436726.1|  50S ribosomal protein L6                           177   2e-51    
ref|WP_031586324.1|  50S ribosomal protein L6                           177   2e-51    
ref|YP_005090141.1|  rpl6 gene product                                  177   2e-51    
ref|WP_021414769.1|  50S ribosomal protein L6                           177   2e-51    
ref|WP_003435668.1|  50S ribosomal protein L6                           177   2e-51    
ref|WP_028576620.1|  50S ribosomal protein L6                           177   2e-51    
ref|WP_028026217.1|  50S ribosomal protein L6                           177   2e-51    
ref|WP_018292103.1|  50S ribosomal protein L6                           177   2e-51    
ref|WP_015208458.1|  50S ribosomal protein L6                           177   2e-51    
ref|WP_030489593.1|  50S ribosomal protein L6                           177   2e-51    
ref|WP_030155107.1|  50S ribosomal protein L6                           177   2e-51    
ref|WP_040788652.1|  50S ribosomal protein L6                           176   2e-51    
ref|WP_043694887.1|  50S ribosomal protein L6                           176   2e-51    
ref|WP_020643212.1|  50S ribosomal protein L6                           176   2e-51    
ref|WP_035830882.1|  50S ribosomal protein L6                           176   2e-51    
ref|WP_015218384.1|  50S ribosomal protein L6                           176   2e-51    
ref|WP_019181715.1|  50S ribosomal protein L6                           176   2e-51    
ref|WP_010871965.1|  50S ribosomal protein L6                           176   3e-51    
ref|WP_028479346.1|  50S ribosomal protein L6                           176   3e-51    
ref|WP_013268935.1|  50S ribosomal protein L6                           176   3e-51    
ref|WP_028852098.1|  50S ribosomal protein L6                           176   3e-51    
ref|WP_009797123.1|  50S ribosomal protein L6                           176   3e-51    
ref|WP_003427724.1|  50S ribosomal protein L6                           176   3e-51    
ref|WP_003781878.1|  MULTISPECIES: 50S ribosomal protein L6             176   3e-51    
ref|WP_011510068.1|  50S ribosomal protein L6                           176   3e-51    
ref|WP_044565307.1|  50S ribosomal protein L6                           176   3e-51    
ref|WP_011133172.1|  50S ribosomal protein L6                           176   3e-51    
ref|WP_003544720.1|  MULTISPECIES: 50S ribosomal protein L6             176   3e-51    
ref|WP_012973220.1|  50S ribosomal protein L6                           176   3e-51    
ref|WP_018171458.1|  50S ribosomal protein L6                           176   3e-51    
ref|WP_037816261.1|  MULTISPECIES: 50S ribosomal protein L6             176   4e-51    
ref|WP_006512304.1|  50S ribosomal protein L6                           176   4e-51    
ref|WP_039754636.1|  50S ribosomal protein L6                           176   4e-51    
ref|WP_026406673.1|  50S ribosomal protein L6                           176   4e-51    
emb|CEK31218.1|  50S ribosomal protein L6 [ [                           176   4e-51    
ref|WP_003170020.1|  50S ribosomal protein L6                           176   4e-51    
ref|WP_021127556.1|  50S ribosomal protein L6 [                         176   4e-51    
ref|WP_016213343.1|  50S ribosomal protein L6                           176   4e-51    
ref|WP_044106037.1|  50S ribosomal protein L6                           176   4e-51    
ref|WP_014847225.1|  50S ribosomal protein L6                           176   4e-51    
ref|WP_012419975.1|  50S ribosomal protein L6                           176   4e-51    
ref|YP_006639104.1|  50S ribosomal protein L6                           176   5e-51    
ref|NP_053910.1|  ribosomal protein L6                                  176   5e-51    
ref|WP_040485101.1|  50S ribosomal protein L6                           176   5e-51    
ref|WP_017659044.1|  50S ribosomal protein L6                           176   5e-51    
ref|WP_014246900.1|  50S ribosomal protein L6                           175   5e-51    
ref|WP_010244377.1|  50S ribosomal protein L6                           175   5e-51    
ref|WP_025777917.1|  50S ribosomal protein L6                           175   5e-51    
ref|WP_024353168.1|  50S ribosomal protein L6                           175   6e-51    
ref|WP_011952181.1|  MULTISPECIES: 50S ribosomal protein L6             175   6e-51    
ref|YP_277414.1|  ribosomal protein L6                                  175   6e-51    
ref|WP_025783849.1|  50S ribosomal protein L6                           175   6e-51    
ref|WP_009221342.1|  MULTISPECIES: 50S ribosomal protein L6             175   6e-51    
ref|WP_010403714.1|  MULTISPECIES: 50S ribosomal protein L6             175   6e-51    
gb|AHY04335.1|  50S ribosomal protein L6                                175   7e-51    
ref|WP_026928237.1|  50S ribosomal protein L6                           175   7e-51    
ref|WP_012065426.1|  50S ribosomal protein L6                           175   7e-51    
ref|WP_039248561.1|  50S ribosomal protein L6                           175   7e-51    
ref|WP_039795552.1|  50S ribosomal protein L6                           175   7e-51    
ref|WP_033291192.1|  50S ribosomal protein L6                           175   7e-51    
ref|WP_043605503.1|  50S ribosomal protein L6                           175   7e-51    
ref|WP_040345018.1|  50S ribosomal protein L6                           175   7e-51    
ref|WP_026369821.1|  50S ribosomal protein L6                           175   7e-51    
ref|WP_031712151.1|  50S ribosomal protein L6                           175   8e-51    
ref|WP_013349670.1|  50S ribosomal protein L6                           175   8e-51    
ref|WP_029635498.1|  50S ribosomal protein L6 [                         175   8e-51    
ref|WP_013362395.1|  50S ribosomal protein L6 [                         175   8e-51    
ref|WP_029254913.1|  50S ribosomal protein L6                           175   8e-51    
ref|YP_004072636.1|  50S ribosomal protein L6                           175   8e-51    
ref|WP_006042218.1|  50S ribosomal protein L6                           175   9e-51    
ref|WP_009072324.1|  MULTISPECIES: 50S ribosomal protein L6             175   9e-51    
ref|WP_011055950.1|  50S ribosomal protein L6                           175   9e-51    
ref|WP_040157837.1|  50S ribosomal protein L6                           175   9e-51    
ref|WP_039043307.1|  50S ribosomal protein L6                           175   9e-51    
ref|WP_015109414.1|  50S ribosomal protein L6                           175   1e-50    
ref|WP_036309870.1|  50S ribosomal protein L6                           175   1e-50    
ref|WP_032376650.1|  50S ribosomal protein L6                           175   1e-50    
ref|WP_019026711.1|  50S ribosomal protein L6                           174   1e-50    
ref|WP_034243832.1|  50S ribosomal protein L6                           175   1e-50    
ref|WP_021431511.1|  MULTISPECIES: 50S ribosomal protein L6             175   1e-50    
ref|WP_003940970.1|  MULTISPECIES: 50S ribosomal protein L6             174   1e-50    
ref|WP_028795243.1|  50S ribosomal protein L6                           174   1e-50    
ref|YP_009029385.1|  ribosomal protein L6                               174   1e-50    
ref|WP_033357653.1|  50S ribosomal protein L6                           174   1e-50    
ref|WP_039206324.1|  50S ribosomal protein L6                           174   1e-50    
ref|WP_034513976.1|  50S ribosomal protein L6                           174   1e-50    
ref|WP_031711030.1|  50S ribosomal protein L6                           174   1e-50    
ref|WP_039403001.1|  50S ribosomal protein L6                           174   1e-50    
ref|WP_013222612.1|  50S ribosomal protein L6                           174   1e-50    
ref|WP_040745995.1|  50S ribosomal protein L6                           174   1e-50    
ref|WP_015164363.1|  50S ribosomal protein L6                           174   1e-50    
ref|WP_030006185.1|  50S ribosomal protein L6                           174   1e-50    
ref|WP_040864897.1|  50S ribosomal protein L6                           174   1e-50    
ref|WP_031581709.1|  50S ribosomal protein L6                           174   1e-50    
ref|WP_034547848.1|  50S ribosomal protein L6                           174   1e-50    
ref|WP_006237995.1|  50S ribosomal protein L6                           174   1e-50    
ref|WP_028496520.1|  MULTISPECIES: 50S ribosomal protein L6             174   1e-50    
ref|WP_028481924.1|  50S ribosomal protein L6                           174   1e-50    
ref|WP_008547719.1|  MULTISPECIES: 50S ribosomal protein L6             174   1e-50    
ref|WP_003403673.1|  MULTISPECIES: 50S ribosomal protein L6             174   1e-50    
ref|WP_039965685.1|  50S ribosomal protein L6 [                         174   1e-50    
ref|WP_011824506.1|  50S ribosomal protein L6                           174   1e-50    
gb|EDP62442.1|  Ribosomal protein L6P/L9E                               174   1e-50    
ref|WP_022913997.1|  50S ribosomal protein L6                           174   1e-50    
ref|WP_027837636.1|  50S ribosomal protein L6                           174   1e-50    
ref|WP_016285747.1|  50S ribosomal protein L6                           174   2e-50    
ref|WP_008729370.1|  50S ribosomal protein L6                           174   2e-50    
ref|WP_039345443.1|  50S ribosomal protein L6                           174   2e-50    
ref|WP_011295459.1|  50S ribosomal protein L6                           174   2e-50    
ref|WP_005987248.1|  50S ribosomal protein L6                           174   2e-50    
ref|WP_018347778.1|  50S ribosomal protein L6                           174   2e-50    
ref|WP_031447972.1|  50S ribosomal protein L6                           174   2e-50    
ref|WP_012084965.1|  50S ribosomal protein L6                           174   2e-50    
ref|WP_017194739.1|  50S ribosomal protein L6                           174   2e-50    
ref|WP_020417565.1|  MULTISPECIES: 50S ribosomal protein L6             174   2e-50    
ref|WP_019116572.1|  50S ribosomal protein L6                           174   2e-50    
ref|WP_042694088.1|  50S ribosomal protein L6                           174   2e-50    
gb|AIA21327.1|  50S ribosomal protein L6                                174   2e-50    
ref|WP_029433451.1|  50S ribosomal protein L6                           174   2e-50    
ref|WP_027940987.1|  50S ribosomal protein L6                           174   2e-50    
ref|WP_017986620.1|  50S ribosomal protein L6                           174   2e-50    
ref|WP_016698502.1|  50S ribosomal protein L6                           174   2e-50    
gb|AHF62773.1|  50S ribosomal protein L6                                174   2e-50    
ref|WP_031715051.1|  50S ribosomal protein L6                           174   2e-50    
ref|WP_036922402.1|  50S ribosomal protein L6                           174   2e-50    
ref|WP_006310548.1|  50S ribosomal protein L6                           174   2e-50    
emb|CDZ75245.1|  50S ribosomal protein L6                               174   2e-50    
ref|WP_012306676.1|  50S ribosomal protein L6                           174   2e-50    
ref|WP_010840030.1|  50S ribosomal protein L6                           174   2e-50    
ref|WP_006854814.1|  50S ribosomal protein L6                           174   2e-50    
ref|WP_029340048.1|  50S ribosomal protein L6                           174   2e-50    
ref|YP_009027582.1|  50S ribosomal protein L6                           174   2e-50    
ref|WP_030427406.1|  50S ribosomal protein L6                           174   2e-50    
ref|WP_043687380.1|  50S ribosomal protein L6                           174   2e-50    
ref|WP_024034507.1|  50S ribosomal protein L6                           174   3e-50    
ref|WP_026347514.1|  MULTISPECIES: 50S ribosomal protein L6             174   3e-50    
ref|WP_022764365.1|  MULTISPECIES: 50S ribosomal protein L6             174   3e-50    
ref|WP_027342523.1|  50S ribosomal protein L6                           174   3e-50    
ref|WP_016303557.1|  50S ribosomal protein L6                           174   3e-50    
ref|WP_005607455.1|  50S ribosomal protein L6                           174   3e-50    
ref|WP_008375943.1|  50S ribosomal protein L6                           174   3e-50    
ref|WP_019807076.1|  50S ribosomal protein L6                           174   3e-50    
ref|WP_015539823.1|  50S ribosomal protein L6                           174   3e-50    
ref|WP_019107908.1|  50S ribosomal protein L6                           173   3e-50    
ref|WP_008410873.1|  50S ribosomal protein L6                           174   3e-50    
ref|WP_026877482.1|  50S ribosomal protein L6                           173   3e-50    
ref|WP_011618388.1|  50S ribosomal protein L6                           173   3e-50    
ref|WP_026419518.1|  50S ribosomal protein L6                           173   3e-50    
ref|WP_011363381.1|  50S ribosomal protein L6                           173   3e-50    
ref|WP_041775860.1|  50S ribosomal protein L6                           173   3e-50    
ref|YP_536980.1|  ribosomal protein L6                                  173   4e-50    
ref|WP_044096020.1|  50S ribosomal protein L6                           173   4e-50    
ref|WP_020662788.1|  50S ribosomal protein L6                           173   4e-50    
ref|WP_043531076.1|  50S ribosomal protein L6                           173   4e-50    
ref|WP_038170822.1|  50S ribosomal protein L6                           173   4e-50    
ref|WP_011826918.1|  50S ribosomal protein L6                           173   4e-50    
ref|WP_040716840.1|  50S ribosomal protein L6                           173   4e-50    
ref|WP_007540789.1|  50S ribosomal protein L6                           173   4e-50    
ref|WP_027399935.1|  50S ribosomal protein L6                           173   4e-50    
ref|WP_028349045.1|  50S ribosomal protein L6                           173   4e-50    
ref|WP_002844197.1|  MULTISPECIES: 50S ribosomal protein L6             173   4e-50    
ref|WP_022740325.1|  50S ribosomal protein L6                           173   4e-50    
ref|WP_026844847.1|  50S ribosomal protein L6                           173   4e-50    
ref|WP_011131113.1|  50S ribosomal protein L6                           173   4e-50    
ref|WP_019707835.1|  50S ribosomal protein L6                           173   4e-50    
ref|WP_023954056.1|  50S ribosomal protein L6                           173   4e-50    
ref|WP_011345176.1|  50S ribosomal protein L6                           173   5e-50    
ref|WP_043781945.1|  50S ribosomal protein L6                           173   5e-50    
ref|WP_016309208.1|  50S ribosomal protein L6                           173   5e-50    
ref|WP_026534034.1|  50S ribosomal protein L6                           173   5e-50    
ref|WP_007023275.1|  MULTISPECIES: 50S ribosomal protein L6             173   5e-50    
ref|WP_007099875.1|  50S ribosomal protein L6                           173   5e-50    
ref|WP_031333108.1|  50S ribosomal protein L6                           173   5e-50    
ref|WP_029139311.1|  50S ribosomal protein L6                           173   5e-50    
ref|WP_028947560.1|  50S ribosomal protein L6                           173   5e-50    
ref|WP_004558872.1|  50S ribosomal protein L6                           173   5e-50    
ref|WP_043466731.1|  50S ribosomal protein L6                           173   5e-50    
ref|WP_020176144.1|  50S ribosomal protein L6                           173   5e-50    
ref|WP_003912916.1|  50S ribosomal protein L6                           173   5e-50    
ref|WP_004838115.1|  MULTISPECIES: 50S ribosomal protein L6             173   5e-50    
ref|WP_014687769.1|  50S ribosomal protein L6                           173   5e-50    
ref|WP_043558656.1|  50S ribosomal protein L6                           173   5e-50    
ref|WP_029009714.1|  50S ribosomal protein L6                           173   5e-50    
ref|WP_028702603.1|  50S ribosomal protein L6                           173   5e-50    
ref|WP_037108941.1|  50S ribosomal protein L6                           173   6e-50    
ref|WP_019229587.1|  50S ribosomal protein L6                           173   6e-50    
ref|WP_013840386.1|  50S ribosomal protein L6                           173   6e-50    
ref|WP_002712286.1|  50S ribosomal protein L6                           172   6e-50    
ref|WP_027583267.1|  50S ribosomal protein L6                           172   6e-50    
ref|WP_022155397.1|  50S ribosomal protein L6                           172   6e-50    
ref|WP_029939590.1|  50S ribosomal protein L6                           172   6e-50    
ref|WP_015136283.1|  50S ribosomal protein L6                           172   6e-50    
gb|AIA21533.1|  50S ribosomal protein L6                                172   6e-50    
ref|WP_009748903.1|  50S ribosomal protein L6                           172   6e-50    
ref|WP_028339311.1|  50S ribosomal protein L6                           172   7e-50    
ref|WP_011712540.1|  50S ribosomal protein L6                           172   7e-50    
ref|WP_023647009.1|  50S ribosomal protein L6                           172   7e-50    
ref|WP_030710347.1|  50S ribosomal protein L6                           172   7e-50    
ref|WP_027441046.1|  50S ribosomal protein L6                           172   7e-50    
ref|WP_022917267.1|  50S ribosomal protein L6                           172   7e-50    
ref|WP_022897972.1|  50S ribosomal protein L6                           172   7e-50    
ref|WP_007707874.1|  50S ribosomal protein L6                           172   7e-50    
ref|WP_038654337.1|  50S ribosomal protein L6                           172   7e-50    
ref|WP_006554596.1|  MULTISPECIES: 50S ribosomal protein L6             172   7e-50    



>ref|XP_009618592.1| PREDICTED: 50S ribosomal protein L6, chloroplastic [Nicotiana 
tomentosiformis]
Length=227

 Score =   351 bits (900),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 167/200 (84%), Positives = 180/200 (90%), Gaps = 0/200 (0%)
 Frame = -1

Query  713  FIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPLGE  534
            F+G  +G     + + R  FVRK VECKESRIGKQPI VPSNVT+ MEGQD KVKGPLGE
Sbjct  19   FVGSLNGFHVSSVAVRRVGFVRKVVECKESRIGKQPITVPSNVTLTMEGQDLKVKGPLGE  78

Query  533  LGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQLVG  354
            + ITYPREVKLE+EE GVLRVRKAMETRRAN+MHGLFRTLTDNM+VGVSKGF+KKLQLVG
Sbjct  79   MAITYPREVKLEREEEGVLRVRKAMETRRANQMHGLFRTLTDNMVVGVSKGFEKKLQLVG  138

Query  353  VGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIRKW  174
            VGYRA VEGKDIVLNLGFSHPV+M IPDGLQVKVEENTRITVSGYDKS IGQFAASIRKW
Sbjct  139  VGYRATVEGKDIVLNLGFSHPVKMEIPDGLQVKVEENTRITVSGYDKSEIGQFAASIRKW  198

Query  173  RPPEPYKGKGVKYADEVIRR  114
            RPPEPYKGKGVKYADE++RR
Sbjct  199  RPPEPYKGKGVKYADEIVRR  218



>ref|XP_004252860.1| PREDICTED: 50S ribosomal protein L6, chloroplastic [Solanum lycopersicum]
Length=257

 Score =   351 bits (900),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 165/202 (82%), Positives = 180/202 (89%), Gaps = 0/202 (0%)
 Frame = -1

Query  719  SNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPL  540
            S F+G  +G     + + R  FV KTVECKESRIGKQPI VPSNVT+ MEGQD KVKGPL
Sbjct  47   SPFVGSLNGFHVSSVAVRRVGFVSKTVECKESRIGKQPISVPSNVTLTMEGQDLKVKGPL  106

Query  539  GELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQL  360
            GE+ ITYPREVKLEKE+ G+LRVRKAMETRRAN+MHGLFRTLTDNM+VGVSKGF+KKLQL
Sbjct  107  GEMAITYPREVKLEKEDGGILRVRKAMETRRANQMHGLFRTLTDNMVVGVSKGFEKKLQL  166

Query  359  VGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIR  180
            VGVGYRA +EGKDIVLNLGFSHPVRM +P GLQVKVEENTRITVSGYDKS IGQFAASIR
Sbjct  167  VGVGYRATIEGKDIVLNLGFSHPVRMEVPAGLQVKVEENTRITVSGYDKSEIGQFAASIR  226

Query  179  KWRPPEPYKGKGVKYADEVIRR  114
            KWRPPEPYKGKGVKYADE++RR
Sbjct  227  KWRPPEPYKGKGVKYADEIVRR  248



>ref|XP_009785468.1| PREDICTED: 50S ribosomal protein L6, chloroplastic [Nicotiana 
sylvestris]
Length=228

 Score =   349 bits (896),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 166/202 (82%), Positives = 181/202 (90%), Gaps = 0/202 (0%)
 Frame = -1

Query  719  SNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPL  540
            S F+G  +G     + + R  FVRK VECKESRIGKQPI VPSNVT+ MEGQD KVKGPL
Sbjct  18   SPFVGSLNGFHVSSVAVRRVGFVRKVVECKESRIGKQPITVPSNVTLTMEGQDLKVKGPL  77

Query  539  GELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQL  360
            GE+ ITYPREVKLE+EE G+LRVRKA+ETRRAN+MHGLFRTLTDNM+VGVSKGF+KKLQL
Sbjct  78   GEMAITYPREVKLEREEEGILRVRKAVETRRANQMHGLFRTLTDNMVVGVSKGFEKKLQL  137

Query  359  VGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIR  180
            VGVGYRA VEGKDIVLNLGFSHPV+M IPDGLQVKVEENTRITVSGYDKS IGQFAASIR
Sbjct  138  VGVGYRATVEGKDIVLNLGFSHPVKMEIPDGLQVKVEENTRITVSGYDKSEIGQFAASIR  197

Query  179  KWRPPEPYKGKGVKYADEVIRR  114
            KWRPPEPYKGKGVKYADE++RR
Sbjct  198  KWRPPEPYKGKGVKYADEIVRR  219



>ref|XP_006365808.1| PREDICTED: 50S ribosomal protein L6, chloroplastic-like [Solanum 
tuberosum]
Length=227

 Score =   347 bits (891),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 164/202 (81%), Positives = 182/202 (90%), Gaps = 0/202 (0%)
 Frame = -1

Query  719  SNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPL  540
            S F+G+ +G R   + + R  FVRK +ECKESRIGKQPI VPSNVT+ MEGQD KVKGPL
Sbjct  17   SPFVGNLNGFRVSSVAVRRVGFVRKMIECKESRIGKQPISVPSNVTLTMEGQDLKVKGPL  76

Query  539  GELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQL  360
            GE+ ITYPREVKLEK++ G+LRVRKA+ETRRAN+MHGLFRTLTDNM+VGVSKGF+KKLQL
Sbjct  77   GEMAITYPREVKLEKDDGGILRVRKAVETRRANQMHGLFRTLTDNMVVGVSKGFEKKLQL  136

Query  359  VGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIR  180
            VGVGYRA +EGKDIVLNLGFSHPVRM IP GLQVKVEENTRITVSGYDKS IGQFAASIR
Sbjct  137  VGVGYRATIEGKDIVLNLGFSHPVRMEIPAGLQVKVEENTRITVSGYDKSEIGQFAASIR  196

Query  179  KWRPPEPYKGKGVKYADEVIRR  114
            KWRPPEPYKGKGVKYADE++RR
Sbjct  197  KWRPPEPYKGKGVKYADEIVRR  218



>gb|EYU44192.1| hypothetical protein MIMGU_mgv1a013253mg [Erythranthe guttata]
Length=226

 Score =   347 bits (889),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 163/202 (81%), Positives = 184/202 (91%), Gaps = 0/202 (0%)
 Frame = -1

Query  719  SNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPL  540
            S F+G+ +GIR   ++  R   VRKTVECKESRIGKQPIPVPSNVT+ M+GQD KVKGPL
Sbjct  16   SAFLGETNGIRVSGISAPRLAVVRKTVECKESRIGKQPIPVPSNVTLVMDGQDLKVKGPL  75

Query  539  GELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQL  360
            GEL ITYPRE+ L+K++SG+LRVRKA+ETRRAN+MHGLFRTLTDNM+VGVSKGF+KKLQL
Sbjct  76   GELAITYPREILLDKDDSGILRVRKAVETRRANQMHGLFRTLTDNMVVGVSKGFEKKLQL  135

Query  359  VGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIR  180
            VG GYRA VEGKDIVLNLGFSHPVRM IPDGLQVKV+ENT+I V+GYDKSAIGQFAASIR
Sbjct  136  VGTGYRATVEGKDIVLNLGFSHPVRMTIPDGLQVKVDENTKIAVTGYDKSAIGQFAASIR  195

Query  179  KWRPPEPYKGKGVKYADEVIRR  114
            KWRPPEPYKGKGVKYADE++RR
Sbjct  196  KWRPPEPYKGKGVKYADEIVRR  217



>ref|XP_011098741.1| PREDICTED: 50S ribosomal protein L6, chloroplastic [Sesamum indicum]
 ref|XP_011098742.1| PREDICTED: 50S ribosomal protein L6, chloroplastic [Sesamum indicum]
Length=226

 Score =   345 bits (886),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 164/200 (82%), Positives = 182/200 (91%), Gaps = 0/200 (0%)
 Frame = -1

Query  713  FIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPLGE  534
            F+G+A+G+RF  ++  R   VRK VECKESRIGKQPI VPSNVT+ M+GQD KVKGPLGE
Sbjct  18   FLGEANGLRFSPVSAPRVAVVRKIVECKESRIGKQPITVPSNVTLTMDGQDLKVKGPLGE  77

Query  533  LGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQLVG  354
            L +TYPRE+KLEKEESG LRV+K++ETRRAN+MHGLFRTLTDNM+VGVSKGF+K+LQLVG
Sbjct  78   LALTYPREIKLEKEESGALRVKKSVETRRANQMHGLFRTLTDNMVVGVSKGFEKRLQLVG  137

Query  353  VGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIRKW  174
             GYRA VEGKDIVLNLGFSHPVRMAIP GLQVKVEENTRI VSGYDKS IGQFAASIRKW
Sbjct  138  TGYRAAVEGKDIVLNLGFSHPVRMAIPSGLQVKVEENTRIIVSGYDKSEIGQFAASIRKW  197

Query  173  RPPEPYKGKGVKYADEVIRR  114
            RPPEPYKGKGVKYADEV+RR
Sbjct  198  RPPEPYKGKGVKYADEVVRR  217



>ref|XP_008455431.1| PREDICTED: 50S ribosomal protein L6, chloroplastic [Cucumis melo]
Length=233

 Score =   341 bits (875),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 157/202 (78%), Positives = 183/202 (91%), Gaps = 0/202 (0%)
 Frame = -1

Query  719  SNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPL  540
            S F+G+ +G     + +     +RKT+ECKESRIGKQPI VPSNVTI ++GQD KVKGPL
Sbjct  23   STFLGEKNGFCVSAMPVCHIGLLRKTIECKESRIGKQPIQVPSNVTITLQGQDLKVKGPL  82

Query  539  GELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQL  360
            GEL I YPREVK+E+E+SG++RV+KA+ETRRAN+MHGLFRTLTDNM+VGVSKGF+KKLQL
Sbjct  83   GELSILYPREVKIEREDSGIIRVKKALETRRANQMHGLFRTLTDNMVVGVSKGFEKKLQL  142

Query  359  VGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIR  180
            +GVGYRAMVEGKD+VLNLGFSHPVRMAIPDG+Q+KVEENTRITVSGYDK AIGQFAASIR
Sbjct  143  IGVGYRAMVEGKDLVLNLGFSHPVRMAIPDGIQIKVEENTRITVSGYDKCAIGQFAASIR  202

Query  179  KWRPPEPYKGKGVKYADEVIRR  114
            +WRPPEPYKGKGVKYADE++RR
Sbjct  203  QWRPPEPYKGKGVKYADEIVRR  224



>ref|XP_003548187.1| PREDICTED: 50S ribosomal protein L6, chloroplastic-like isoform 
1 [Glycine max]
Length=226

 Score =   340 bits (873),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 159/202 (79%), Positives = 183/202 (91%), Gaps = 0/202 (0%)
 Frame = -1

Query  719  SNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPL  540
            S F+G+ + +R   +  A   F RKTVECKESRIGKQPIPVPSNVT+K+EGQD +VKGPL
Sbjct  16   SVFVGETNKLRVSSVPGAHVGFNRKTVECKESRIGKQPIPVPSNVTVKLEGQDIQVKGPL  75

Query  539  GELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQL  360
            GEL +TYPREV +E+EESG LRV+KA+ETRRAN+MHGLFRTLTDN+++GVSKGFDKKLQL
Sbjct  76   GELALTYPREVLVEREESGTLRVKKAVETRRANQMHGLFRTLTDNLVIGVSKGFDKKLQL  135

Query  359  VGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIR  180
            VGVGYRAMVEG ++VLNLGFSHPV+M IPDGL+VKVEENTRITVSGYDKS +GQFAASIR
Sbjct  136  VGVGYRAMVEGNEVVLNLGFSHPVKMTIPDGLKVKVEENTRITVSGYDKSEVGQFAASIR  195

Query  179  KWRPPEPYKGKGVKYADEVIRR  114
            KWRPPEPYKGKGVKYADE++RR
Sbjct  196  KWRPPEPYKGKGVKYADEIVRR  217



>gb|KJB80515.1| hypothetical protein B456_013G101000 [Gossypium raimondii]
Length=225

 Score =   340 bits (872),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 157/202 (78%), Positives = 182/202 (90%), Gaps = 0/202 (0%)
 Frame = -1

Query  719  SNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPL  540
            S F+G+ +GI    + I R + VRK +ECKESRIGKQPI VPSNVTI MEGQD KVKGPL
Sbjct  15   SAFLGEKTGICVSSIPITRVSLVRKAIECKESRIGKQPITVPSNVTITMEGQDIKVKGPL  74

Query  539  GELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQL  360
            GE+ +TYPREVK+ +EESG LRVRK++ETRRAN+MHGLFRTLTDNM+VGVSKGF+K+LQL
Sbjct  75   GEMALTYPREVKVNREESGALRVRKSVETRRANQMHGLFRTLTDNMVVGVSKGFEKRLQL  134

Query  359  VGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIR  180
            +GVGYRA +EGKD+VL+LGFSHPVRMAIPDG+QVKVEENTRI +SGYDKS +GQFAA+IR
Sbjct  135  IGVGYRATLEGKDLVLSLGFSHPVRMAIPDGIQVKVEENTRIVISGYDKSDVGQFAATIR  194

Query  179  KWRPPEPYKGKGVKYADEVIRR  114
            KWRPPEPYKGKGVKYADEV+RR
Sbjct  195  KWRPPEPYKGKGVKYADEVVRR  216



>gb|KHN42547.1| 50S ribosomal protein L6, chloroplastic [Glycine soja]
Length=226

 Score =   340 bits (871),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 159/202 (79%), Positives = 182/202 (90%), Gaps = 0/202 (0%)
 Frame = -1

Query  719  SNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPL  540
            S F+G+ + +R   +  A   F RKTVECKESRIGKQPIPVPSNVT+K+EGQD +VKGPL
Sbjct  16   SVFVGETNKLRVSSVPGAHVGFNRKTVECKESRIGKQPIPVPSNVTVKLEGQDIQVKGPL  75

Query  539  GELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQL  360
            GEL +TYPREV +E+EESG LRV+KA+ETRRAN+MHGLFRTLTDN++ GVSKGFDKKLQL
Sbjct  76   GELALTYPREVLVEREESGTLRVKKAVETRRANQMHGLFRTLTDNLVTGVSKGFDKKLQL  135

Query  359  VGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIR  180
            VGVGYRAMVEG ++VLNLGFSHPV+M IPDGL+VKVEENTRITVSGYDKS +GQFAASIR
Sbjct  136  VGVGYRAMVEGNEVVLNLGFSHPVKMTIPDGLKVKVEENTRITVSGYDKSEVGQFAASIR  195

Query  179  KWRPPEPYKGKGVKYADEVIRR  114
            KWRPPEPYKGKGVKYADE++RR
Sbjct  196  KWRPPEPYKGKGVKYADEIVRR  217



>ref|XP_007045631.1| Ribosomal protein L6 family [Theobroma cacao]
 gb|EOY01463.1| Ribosomal protein L6 family [Theobroma cacao]
Length=225

 Score =   339 bits (869),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 159/202 (79%), Positives = 183/202 (91%), Gaps = 0/202 (0%)
 Frame = -1

Query  719  SNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPL  540
            S F+G+ + I    + + R + VRK VECKESRIGKQPI VPSNVTI +EGQD KVKGPL
Sbjct  15   SAFLGERNAICISSIPVTRVSLVRKAVECKESRIGKQPIQVPSNVTITLEGQDVKVKGPL  74

Query  539  GELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQL  360
            GEL +TYPREVK+++EE G+LRVRKA+ETRRAN+MHGLFRTLTDNM+VGVSKGF+K+LQL
Sbjct  75   GELALTYPREVKVDREEPGILRVRKAVETRRANQMHGLFRTLTDNMVVGVSKGFEKRLQL  134

Query  359  VGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIR  180
            +GVGYRAM EGKD+VL+LGFSHPVRMAIP+G++VKVEENTRI VSGYDKSAIGQFAAS+R
Sbjct  135  IGVGYRAMFEGKDLVLSLGFSHPVRMAIPEGIKVKVEENTRIVVSGYDKSAIGQFAASVR  194

Query  179  KWRPPEPYKGKGVKYADEVIRR  114
            KWRPPEPYKGKGVKYADEVIRR
Sbjct  195  KWRPPEPYKGKGVKYADEVIRR  216



>ref|XP_004144493.1| PREDICTED: 50S ribosomal protein L6, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004164857.1| PREDICTED: 50S ribosomal protein L6, chloroplastic-like [Cucumis 
sativus]
 gb|KGN43529.1| hypothetical protein Csa_7G044200 [Cucumis sativus]
Length=233

 Score =   338 bits (868),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 156/202 (77%), Positives = 182/202 (90%), Gaps = 0/202 (0%)
 Frame = -1

Query  719  SNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPL  540
            S F+G+ +G     +       +RKT+ECKESRIGKQPI VPS+VTI ++GQD KVKGPL
Sbjct  23   STFLGEKNGFCVSAMPACHIGLLRKTIECKESRIGKQPIQVPSSVTITLQGQDLKVKGPL  82

Query  539  GELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQL  360
            GEL I YPREVK+E+E+SG++RV+KA+ETRRAN+MHGLFRTLTDNM+VGVSKGF+KKLQL
Sbjct  83   GELSILYPREVKIEREDSGIIRVKKALETRRANQMHGLFRTLTDNMVVGVSKGFEKKLQL  142

Query  359  VGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIR  180
            +GVGYRAMVEGKD+VLNLGFSHPVRMAIPDG+Q+KVEENTRITVSGYDK AIGQFAASIR
Sbjct  143  IGVGYRAMVEGKDLVLNLGFSHPVRMAIPDGIQIKVEENTRITVSGYDKCAIGQFAASIR  202

Query  179  KWRPPEPYKGKGVKYADEVIRR  114
            +WRPPEPYKGKGVKYADE++RR
Sbjct  203  QWRPPEPYKGKGVKYADEIVRR  224



>ref|XP_003534001.1| PREDICTED: 50S ribosomal protein L6, chloroplastic-like [Glycine 
max]
 gb|KHN23211.1| 50S ribosomal protein L6, chloroplastic [Glycine soja]
Length=226

 Score =   338 bits (866),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 158/202 (78%), Positives = 183/202 (91%), Gaps = 0/202 (0%)
 Frame = -1

Query  719  SNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPL  540
            S F+G+ +  R   +  A   F+RKTVECKESRIGKQPIPVPSNVT+K+EGQD +VKGPL
Sbjct  16   SVFVGETNKFRVSTVPGAHVGFIRKTVECKESRIGKQPIPVPSNVTVKLEGQDIQVKGPL  75

Query  539  GELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQL  360
            GEL ++YPREV +E+EESG LRV+KA+ETRRAN+MHGLFRTLTDN+++GVSKGF+KKLQL
Sbjct  76   GELALSYPREVLVEREESGTLRVKKAVETRRANQMHGLFRTLTDNLVIGVSKGFEKKLQL  135

Query  359  VGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIR  180
            VGVGYRAMVEG ++VLNLGFSHPV+M IPDGL+VKVEENTRITVSGYDKS +GQFAASIR
Sbjct  136  VGVGYRAMVEGNEVVLNLGFSHPVKMIIPDGLKVKVEENTRITVSGYDKSEVGQFAASIR  195

Query  179  KWRPPEPYKGKGVKYADEVIRR  114
            KWRPPEPYKGKGVKYADEV+RR
Sbjct  196  KWRPPEPYKGKGVKYADEVVRR  217



>gb|KHG21050.1| 50S ribosomal L6, chloroplastic -like protein [Gossypium arboreum]
Length=225

 Score =   335 bits (859),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 155/202 (77%), Positives = 181/202 (90%), Gaps = 0/202 (0%)
 Frame = -1

Query  719  SNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPL  540
            S F+G+ +G     + I R + VRK +ECKESRIGKQPI VPSNVTI MEGQD KVKGPL
Sbjct  15   SAFLGEKNGSCVSSIPITRVSLVRKAIECKESRIGKQPITVPSNVTITMEGQDIKVKGPL  74

Query  539  GELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQL  360
            GE+ +TYPREVK+++EESG LR+RK++ETRRAN+MHGLFRTLTDNM+VGVSKGF+K+LQL
Sbjct  75   GEMALTYPREVKVDREESGALRIRKSVETRRANQMHGLFRTLTDNMVVGVSKGFEKRLQL  134

Query  359  VGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIR  180
            +GVGYRA +EGKD+VL+LGFSHPVRMAIPD +QVKVEENTRI VSGYDKS +GQFAA+IR
Sbjct  135  IGVGYRATLEGKDLVLSLGFSHPVRMAIPDDIQVKVEENTRIVVSGYDKSDVGQFAATIR  194

Query  179  KWRPPEPYKGKGVKYADEVIRR  114
            KWRPPEPYKGKGVKYADEV+RR
Sbjct  195  KWRPPEPYKGKGVKYADEVVRR  216



>ref|XP_008223584.1| PREDICTED: 50S ribosomal protein L6, chloroplastic [Prunus mume]
Length=226

 Score =   330 bits (847),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 153/202 (76%), Positives = 181/202 (90%), Gaps = 0/202 (0%)
 Frame = -1

Query  719  SNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPL  540
            S F+G+ +G     +++    F++KT+ECKESRIGKQPI VPSNV+IK+EGQ  +VKGPL
Sbjct  16   SAFLGERNGFSVCSVSVTHVGFLKKTIECKESRIGKQPIEVPSNVSIKLEGQALEVKGPL  75

Query  539  GELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQL  360
            G+L +TYPREV L+KE+SG LRVRKA+ETRRAN+MHGLFRTLTDNM+VGVSKGF+K+LQL
Sbjct  76   GQLSMTYPREVLLQKEDSGFLRVRKALETRRANQMHGLFRTLTDNMVVGVSKGFEKRLQL  135

Query  359  VGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIR  180
            VGVGYRA +EG+ +VL+LGFSHPVRM IPDG+QVKVEENTR+ VSGYDKSAIGQFAASIR
Sbjct  136  VGVGYRATLEGRILVLSLGFSHPVRMDIPDGIQVKVEENTRVVVSGYDKSAIGQFAASIR  195

Query  179  KWRPPEPYKGKGVKYADEVIRR  114
            KWRPPEPYKGKGVKYADE+IRR
Sbjct  196  KWRPPEPYKGKGVKYADEIIRR  217



>gb|ACU23468.1| unknown [Glycine max]
Length=226

 Score =   330 bits (846),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 155/202 (77%), Positives = 180/202 (89%), Gaps = 0/202 (0%)
 Frame = -1

Query  719  SNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPL  540
            S F+G+ + +R   +  A   F RKTVECKESRIGKQPIPVPSNVT+K+EGQD +VKGPL
Sbjct  16   SVFVGETNKLRVSSVPGAHVGFNRKTVECKESRIGKQPIPVPSNVTVKLEGQDIQVKGPL  75

Query  539  GELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQL  360
            GEL +TYPREV +E+EESG LRV+KA+ETRRAN+MHGLFRTLTDN+++GVSKGFDKKLQL
Sbjct  76   GELALTYPREVLVEREESGTLRVKKAVETRRANQMHGLFRTLTDNLVIGVSKGFDKKLQL  135

Query  359  VGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIR  180
            VGVGYRAMVEG ++VLNLGFSHPV+M IPDGL+VKVEE+TRITVSGYDK  +GQFAASI 
Sbjct  136  VGVGYRAMVEGNEVVLNLGFSHPVKMTIPDGLKVKVEEDTRITVSGYDKFEVGQFAASIM  195

Query  179  KWRPPEPYKGKGVKYADEVIRR  114
            KWRPPEPY GKGVKYADE++RR
Sbjct  196  KWRPPEPYIGKGVKYADEIVRR  217



>gb|AFK43716.1| unknown [Medicago truncatula]
Length=226

 Score =   330 bits (846),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 155/202 (77%), Positives = 177/202 (88%), Gaps = 0/202 (0%)
 Frame = -1

Query  719  SNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPL  540
            S+F+G+ S IR          F RKT ECKESRIGKQPIPVPSNVTIKMEGQ F  KGPL
Sbjct  16   SSFVGERSRIRISSAPATHVGFFRKTTECKESRIGKQPIPVPSNVTIKMEGQYFHAKGPL  75

Query  539  GELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQL  360
            GEL +TYPREVK+E++E GVL+V KA+ETRRAN+MHGLFRTLTDN++VGVSKGF+KKLQL
Sbjct  76   GELSLTYPREVKVERQEEGVLKVSKAVETRRANQMHGLFRTLTDNIVVGVSKGFEKKLQL  135

Query  359  VGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIR  180
            +GVGYRA VEG ++VLNLGFSHPV+M IP+GL+VKV+ENTRITVSGYDKS IGQFAASIR
Sbjct  136  IGVGYRATVEGNEVVLNLGFSHPVKMTIPEGLKVKVDENTRITVSGYDKSEIGQFAASIR  195

Query  179  KWRPPEPYKGKGVKYADEVIRR  114
            KWRPPEPYKGKG+KY DEV+RR
Sbjct  196  KWRPPEPYKGKGIKYEDEVVRR  217



>ref|XP_004514093.1| PREDICTED: 50S ribosomal protein L6, chloroplastic-like [Cicer 
arietinum]
Length=226

 Score =   330 bits (845),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 153/202 (76%), Positives = 179/202 (89%), Gaps = 0/202 (0%)
 Frame = -1

Query  719  SNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPL  540
            S ++G+ S +R       R    RKT ECKESRIGKQPIPVPSNVTIK+EGQD +VKGPL
Sbjct  16   SVYLGERSKLRVSSAPATRVGVFRKTTECKESRIGKQPIPVPSNVTIKLEGQDIQVKGPL  75

Query  539  GELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQL  360
            GEL +TYPREVK+E+++ G+L+V KA+ETRRAN+MHGLFRTLTDN++VGVSKGF+KKLQL
Sbjct  76   GELSLTYPREVKVERQDEGILKVSKAVETRRANQMHGLFRTLTDNLVVGVSKGFEKKLQL  135

Query  359  VGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIR  180
            +GVGYRAMVEG D+VLNLGFSHPV+M IPDGL+VKVEENT+ITVSGY+KS IGQFAASIR
Sbjct  136  IGVGYRAMVEGNDVVLNLGFSHPVKMTIPDGLKVKVEENTKITVSGYNKSDIGQFAASIR  195

Query  179  KWRPPEPYKGKGVKYADEVIRR  114
            KWRPPEPYKGKG+KY DEV+RR
Sbjct  196  KWRPPEPYKGKGIKYEDEVVRR  217



>ref|XP_008379631.1| PREDICTED: 50S ribosomal protein L6, chloroplastic-like [Malus 
domestica]
 ref|XP_008365451.1| PREDICTED: 50S ribosomal protein L6, chloroplastic-like [Malus 
domestica]
Length=226

 Score =   330 bits (845),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 155/202 (77%), Positives = 178/202 (88%), Gaps = 0/202 (0%)
 Frame = -1

Query  719  SNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPL  540
            S F+G  +G     + ++   F++KT+ECKESRIGKQPI VPSNVTI +EGQ   VKGPL
Sbjct  16   SAFLGKRNGFSVCSVPVSHVKFLKKTIECKESRIGKQPIEVPSNVTITLEGQALAVKGPL  75

Query  539  GELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQL  360
            G+L +TYPREV ++KE+SG LRVRKA+ETRRAN+MHGLFRTLTDNM+VGVSKGFDK+LQL
Sbjct  76   GQLSLTYPREVLVQKEDSGALRVRKAVETRRANQMHGLFRTLTDNMVVGVSKGFDKRLQL  135

Query  359  VGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIR  180
            VGVGYRA +EGK +VL+LGFSHPVRM IPDG+QVKVEENTRI VSGYDKSAIGQFAASIR
Sbjct  136  VGVGYRATLEGKILVLSLGFSHPVRMDIPDGIQVKVEENTRIVVSGYDKSAIGQFAASIR  195

Query  179  KWRPPEPYKGKGVKYADEVIRR  114
            KWRPPEPYKGKGVKYADE+IRR
Sbjct  196  KWRPPEPYKGKGVKYADEIIRR  217



>ref|XP_007223925.1| hypothetical protein PRUPE_ppa011034mg [Prunus persica]
 gb|EMJ25124.1| hypothetical protein PRUPE_ppa011034mg [Prunus persica]
Length=226

 Score =   329 bits (843),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 152/202 (75%), Positives = 181/202 (90%), Gaps = 0/202 (0%)
 Frame = -1

Query  719  SNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPL  540
            S F+G+ +G     +++    F++KT+ECKESRIGKQPI VPSNV+IK+EGQ  +VKGPL
Sbjct  16   SAFLGERNGFSVCSVSVTHVGFLKKTIECKESRIGKQPIEVPSNVSIKLEGQALEVKGPL  75

Query  539  GELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQL  360
            G+L +TYPREV ++KE+SG LRVRKA+ETRRAN+MHGLFRTLTDNM+VGVSKGF+K+LQL
Sbjct  76   GQLSMTYPREVLVQKEDSGFLRVRKALETRRANQMHGLFRTLTDNMVVGVSKGFEKRLQL  135

Query  359  VGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIR  180
            VGVGYRA +EG+ +VL+LGFSHPVRM IPDG+QVKVEENTR+ VSGYDKSAIGQFAASIR
Sbjct  136  VGVGYRATLEGRILVLSLGFSHPVRMDIPDGIQVKVEENTRVVVSGYDKSAIGQFAASIR  195

Query  179  KWRPPEPYKGKGVKYADEVIRR  114
            KWRPPEPYKGKGVKYADE+IRR
Sbjct  196  KWRPPEPYKGKGVKYADEIIRR  217



>ref|XP_010522339.1| PREDICTED: 50S ribosomal protein L6, chloroplastic [Tarenaya 
hassleriana]
Length=226

 Score =   328 bits (841),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 156/202 (77%), Positives = 177/202 (88%), Gaps = 0/202 (0%)
 Frame = -1

Query  719  SNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPL  540
            S F+GD  G R  +  +    F  KTVECKESRIGKQPI VPSNVTI + GQD KVKGPL
Sbjct  16   SVFLGDGRGFRASRAHVVNVGFSSKTVECKESRIGKQPIAVPSNVTITLAGQDLKVKGPL  75

Query  539  GELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQL  360
            GEL +TYPREV+++KE+SG LRVRK +ETRRAN+MHGLFRTLTDNMIVGVSKGF+K+LQL
Sbjct  76   GELSLTYPREVEVKKEDSGSLRVRKTVETRRANQMHGLFRTLTDNMIVGVSKGFEKRLQL  135

Query  359  VGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIR  180
            +GVGYRAMVEGK++VLNLGFSHPVRM IP+ L+VKVEENTRI VSGYDKS IGQFAA++R
Sbjct  136  IGVGYRAMVEGKELVLNLGFSHPVRMEIPNDLKVKVEENTRIIVSGYDKSNIGQFAATVR  195

Query  179  KWRPPEPYKGKGVKYADEVIRR  114
            KWRPPEPYKGKGVKYADEV+RR
Sbjct  196  KWRPPEPYKGKGVKYADEVVRR  217



>ref|XP_010100629.1| 50S ribosomal protein L6 [Morus notabilis]
 gb|EXB83377.1| 50S ribosomal protein L6 [Morus notabilis]
Length=225

 Score =   328 bits (840),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 157/202 (78%), Positives = 181/202 (90%), Gaps = 0/202 (0%)
 Frame = -1

Query  719  SNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPL  540
            S F+G+ +G     + ++R  FV+K +ECKESRIGKQ I VPSNVTI +EGQ  KVKGPL
Sbjct  15   SVFLGERNGFSVSSVPVSRVGFVKKNIECKESRIGKQAIEVPSNVTITLEGQGLKVKGPL  74

Query  539  GELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQL  360
            GEL + YPREVK+E+EESG+LRVRKA+ETRRAN+MHGLFRTLTDNM+VGVSKGF+K+LQL
Sbjct  75   GELSLNYPREVKVEREESGILRVRKAVETRRANQMHGLFRTLTDNMVVGVSKGFEKRLQL  134

Query  359  VGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIR  180
            VGVGYRAM+EGKD+VL+LGFSHPVRM IP+G+QVKVE+NTRI VSGYDKS IGQFAASIR
Sbjct  135  VGVGYRAMLEGKDLVLSLGFSHPVRMTIPNGIQVKVEDNTRIVVSGYDKSEIGQFAASIR  194

Query  179  KWRPPEPYKGKGVKYADEVIRR  114
            KWRPPEPYKGKGVKYADEVIRR
Sbjct  195  KWRPPEPYKGKGVKYADEVIRR  216



>gb|ACU19091.1| unknown [Glycine max]
Length=226

 Score =   327 bits (838),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 154/202 (76%), Positives = 180/202 (89%), Gaps = 0/202 (0%)
 Frame = -1

Query  719  SNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPL  540
            S F+G+ +  R   +  A   F+RKTVECKESRIGKQPIPVPSNVT+K+EGQD +VKGPL
Sbjct  16   SVFVGETNKFRVSTVPGAHVGFIRKTVECKESRIGKQPIPVPSNVTVKLEGQDIQVKGPL  75

Query  539  GELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQL  360
            GEL ++YPREV +++EESG LRV+KA+ETRRAN+MHGLFRT TDN+++GV KGF+KKLQL
Sbjct  76   GELALSYPREVLVKREESGTLRVKKAVETRRANQMHGLFRTPTDNLVIGVFKGFEKKLQL  135

Query  359  VGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIR  180
            VGVGYRAMVEG ++VLNLGFSHPV+M IPDGL+VKVEENTRITVSGYDK  +GQFAASIR
Sbjct  136  VGVGYRAMVEGNEVVLNLGFSHPVKMIIPDGLKVKVEENTRITVSGYDKFEVGQFAASIR  195

Query  179  KWRPPEPYKGKGVKYADEVIRR  114
            KWRPPEPYKGKGVKYADEV+RR
Sbjct  196  KWRPPEPYKGKGVKYADEVVRR  217



>ref|XP_002279657.2| PREDICTED: 50S ribosomal protein L6, chloroplastic [Vitis vinifera]
 emb|CBI28941.3| unnamed protein product [Vitis vinifera]
Length=226

 Score =   325 bits (834),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 154/202 (76%), Positives = 178/202 (88%), Gaps = 0/202 (0%)
 Frame = -1

Query  719  SNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPL  540
            S F+G+ +GI    + + R  F+RKT+ECKESRIGK+PI VPSNVTI +EGQD KVKGPL
Sbjct  16   SAFLGERNGIYVSSVPVTRVGFLRKTIECKESRIGKKPIEVPSNVTITLEGQDLKVKGPL  75

Query  539  GELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQL  360
            GEL  TYPREVK++K+ESG+L V+KA ETRRAN+MHGLFRTLTDNM+VGVSKGF+K+LQL
Sbjct  76   GELSRTYPREVKVQKDESGILTVKKAFETRRANQMHGLFRTLTDNMVVGVSKGFEKRLQL  135

Query  359  VGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIR  180
            VGVGYRA VEGKD+VLNLGFSHPVRM IP  L+VKVE+NTRI VSGYDK  IGQFAAS+R
Sbjct  136  VGVGYRATVEGKDLVLNLGFSHPVRMPIPGDLKVKVEDNTRIIVSGYDKCNIGQFAASVR  195

Query  179  KWRPPEPYKGKGVKYADEVIRR  114
            KWRPPEPYKGKGVKYADE++RR
Sbjct  196  KWRPPEPYKGKGVKYADEIVRR  217



>ref|XP_010557010.1| PREDICTED: 50S ribosomal protein L6, chloroplastic-like [Tarenaya 
hassleriana]
Length=225

 Score =   325 bits (834),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 158/200 (79%), Positives = 177/200 (89%), Gaps = 1/200 (1%)
 Frame = -1

Query  713  FIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPLGE  534
            F+GD+ GI   + T     F  KTVECKESRIGKQPI VPSNVTI + GQD KVKGPLGE
Sbjct  18   FLGDSRGIPASR-TPVHVGFSSKTVECKESRIGKQPIAVPSNVTITLAGQDLKVKGPLGE  76

Query  533  LGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQLVG  354
            L +TYPREV+++KE+SG LRVRK +ETRRAN+MHGLFRTLTDNM+VGVSKGF+K+LQLVG
Sbjct  77   LSLTYPREVEVKKEDSGFLRVRKTIETRRANQMHGLFRTLTDNMVVGVSKGFEKRLQLVG  136

Query  353  VGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIRKW  174
            VGYRAMVEGK++VLNLGFSHPVRM IP+ LQVKVEENTRI VSGYDKS IGQFAAS+RKW
Sbjct  137  VGYRAMVEGKELVLNLGFSHPVRMEIPNDLQVKVEENTRIIVSGYDKSNIGQFAASVRKW  196

Query  173  RPPEPYKGKGVKYADEVIRR  114
            RPPEPYKGKGVKYADEV+RR
Sbjct  197  RPPEPYKGKGVKYADEVVRR  216



>ref|XP_006304184.1| hypothetical protein CARUB_v10010237mg [Capsella rubella]
 gb|EOA37082.1| hypothetical protein CARUB_v10010237mg [Capsella rubella]
Length=223

 Score =   325 bits (832),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 153/202 (76%), Positives = 176/202 (87%), Gaps = 0/202 (0%)
 Frame = -1

Query  719  SNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPL  540
            S F+GD +  +      A+  F  KT+ECKESRIGKQPI VPSNVTI +EGQD KVKGPL
Sbjct  13   SAFLGDRNVFKVSSTPFAQVGFSSKTIECKESRIGKQPIAVPSNVTIALEGQDLKVKGPL  72

Query  539  GELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQL  360
            GEL +TYPREV+L KE+SG LRV+K +ETRRAN+MHGLFRTLTDNM+VGVSKGF+KKL L
Sbjct  73   GELALTYPREVELTKEDSGFLRVKKTVETRRANQMHGLFRTLTDNMVVGVSKGFEKKLIL  132

Query  359  VGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIR  180
            VGVGYRA VEGK++VLNLGFSHPV+M IPD L+VKVEENTRITVSGYDKS IGQFAA++R
Sbjct  133  VGVGYRATVEGKELVLNLGFSHPVKMQIPDSLKVKVEENTRITVSGYDKSEIGQFAATVR  192

Query  179  KWRPPEPYKGKGVKYADEVIRR  114
            KWRPPEPYKGKGVKY+DE++RR
Sbjct  193  KWRPPEPYKGKGVKYSDEIVRR  214



>ref|XP_008342000.1| PREDICTED: 50S ribosomal protein L6, chloroplastic-like [Malus 
domestica]
Length=225

 Score =   325 bits (832),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 155/202 (77%), Positives = 178/202 (88%), Gaps = 2/202 (1%)
 Frame = -1

Query  719  SNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPL  540
            S F+G+  G  F   ++    F++KT+ECKESRIGKQPI VPSNVTI +EGQ   VKGPL
Sbjct  17   SAFLGERKG--FXXCSVPXVGFLKKTIECKESRIGKQPIEVPSNVTITLEGQALAVKGPL  74

Query  539  GELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQL  360
            G+L +TYPREV ++KE+SG LRVRKA+ETRRAN+MHGLFRTLTDNM+VGVSKGF+K+LQL
Sbjct  75   GQLSLTYPREVLVQKEDSGTLRVRKAVETRRANQMHGLFRTLTDNMVVGVSKGFEKRLQL  134

Query  359  VGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIR  180
            VGVGYRA +EGK +VL+LGFSHPVRM IPDG+QVKVEENTRI VSGYDKSAIGQFAASIR
Sbjct  135  VGVGYRATLEGKILVLSLGFSHPVRMDIPDGIQVKVEENTRIVVSGYDKSAIGQFAASIR  194

Query  179  KWRPPEPYKGKGVKYADEVIRR  114
            KWRPPEPYKGKGVKYADE+IRR
Sbjct  195  KWRPPEPYKGKGVKYADEIIRR  216



>ref|XP_006418054.1| hypothetical protein EUTSA_v10008693mg [Eutrema salsugineum]
 gb|ESQ36407.1| hypothetical protein EUTSA_v10008693mg [Eutrema salsugineum]
Length=226

 Score =   324 bits (831),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 153/202 (76%), Positives = 176/202 (87%), Gaps = 0/202 (0%)
 Frame = -1

Query  719  SNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPL  540
            S F+GD +  +      A+  F  KT+ECKESRIGKQPI VPSNVTI +EGQD KVKGPL
Sbjct  16   SAFLGDRNVFKVSTTPFAQVGFSSKTIECKESRIGKQPIAVPSNVTIALEGQDLKVKGPL  75

Query  539  GELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQL  360
            GEL +TYPREV+L KE+SG LRV+K +ETRRAN+MHGLFRTLTDNM+VGVSKGF+KKL L
Sbjct  76   GELALTYPREVELTKEDSGFLRVKKTVETRRANQMHGLFRTLTDNMVVGVSKGFEKKLIL  135

Query  359  VGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIR  180
            VGVGYRA VEGK++VLNLGFSHPV+M IPD L+VKVEENTRITVSGYDKS IGQFAA++R
Sbjct  136  VGVGYRATVEGKELVLNLGFSHPVKMQIPDSLKVKVEENTRITVSGYDKSEIGQFAATVR  195

Query  179  KWRPPEPYKGKGVKYADEVIRR  114
            KWRPPEPYKGKGVKY+DE++RR
Sbjct  196  KWRPPEPYKGKGVKYSDEIVRR  217



>ref|XP_007152280.1| hypothetical protein PHAVU_004G116200g [Phaseolus vulgaris]
 gb|ESW24274.1| hypothetical protein PHAVU_004G116200g [Phaseolus vulgaris]
Length=226

 Score =   324 bits (831),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 152/200 (76%), Positives = 179/200 (90%), Gaps = 0/200 (0%)
 Frame = -1

Query  713  FIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPLGE  534
            F+G+ + +R   +  A+  FVRKTVECKESRIGKQ I VP+NVT+K+EGQ  +VKGPLGE
Sbjct  18   FVGETNKLRVSSVPGAQAGFVRKTVECKESRIGKQRITVPTNVTVKLEGQGIQVKGPLGE  77

Query  533  LGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQLVG  354
            L +TYPREV +EKEE+G LRVRKA+ETRRAN+MHGLFRTLT+N++VGVS+GF+KKLQLVG
Sbjct  78   LALTYPREVLVEKEEAGTLRVRKAVETRRANQMHGLFRTLTNNLVVGVSEGFEKKLQLVG  137

Query  353  VGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIRKW  174
            VGYRAMVEG  +VLNLGFSHPV+M IP GL+VKVEENTRITVSG+DKS +GQFAASIRKW
Sbjct  138  VGYRAMVEGNAVVLNLGFSHPVKMEIPGGLKVKVEENTRITVSGFDKSEVGQFAASIRKW  197

Query  173  RPPEPYKGKGVKYADEVIRR  114
            RPPEPYKGKGVKYADE++RR
Sbjct  198  RPPEPYKGKGVKYADEIVRR  217



>ref|XP_002892273.1| EMB2394 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68532.1| EMB2394 [Arabidopsis lyrata subsp. lyrata]
Length=223

 Score =   324 bits (831),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 152/201 (76%), Positives = 176/201 (88%), Gaps = 0/201 (0%)
 Frame = -1

Query  719  SNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPL  540
            S F+GD +  +      A+  +  KT+ECKESRIGKQPI VPSNVTI +EGQD KVKGPL
Sbjct  13   SAFLGDRNVFKVSSTPFAQVGYSSKTIECKESRIGKQPIAVPSNVTIALEGQDLKVKGPL  72

Query  539  GELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQL  360
            GEL +TYPREV+L KEESG+LRV+K +ETRRAN+MHGLFRTLTDNM+VGVSKGF+KKL L
Sbjct  73   GELALTYPREVELTKEESGLLRVKKTVETRRANQMHGLFRTLTDNMVVGVSKGFEKKLIL  132

Query  359  VGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIR  180
            VGVGYRA VEGK++VLNLGFSHPV+M IPD L+VKVEENTRITVSGYDKS IGQFAA++R
Sbjct  133  VGVGYRATVEGKELVLNLGFSHPVKMQIPDSLKVKVEENTRITVSGYDKSEIGQFAATVR  192

Query  179  KWRPPEPYKGKGVKYADEVIR  117
            KWRPPEPYKGKGVKY+DE++R
Sbjct  193  KWRPPEPYKGKGVKYSDEIVR  213



>ref|XP_010484767.1| PREDICTED: 50S ribosomal protein L6, chloroplastic-like [Camelina 
sativa]
Length=223

 Score =   324 bits (830),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 152/202 (75%), Positives = 177/202 (88%), Gaps = 0/202 (0%)
 Frame = -1

Query  719  SNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPL  540
            S F+GD +  +      A+  +  KT+ECKESRIGKQPI VPSNVTI +EGQD KVKGPL
Sbjct  13   SAFLGDRNVFKVSNTPFAQVGYSSKTIECKESRIGKQPIAVPSNVTIALEGQDLKVKGPL  72

Query  539  GELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQL  360
            GEL +TYPREV+L KE+SG+LRV+K +ETRRAN+MHGLFRTLTDNM+VGVSKGF+KKL L
Sbjct  73   GELALTYPREVELTKEDSGLLRVKKTVETRRANQMHGLFRTLTDNMVVGVSKGFEKKLIL  132

Query  359  VGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIR  180
            VGVGYRA VEGK++VLNLGFSHPV+M IPD L+VKVEENTRITVSGYDKS IGQFAA++R
Sbjct  133  VGVGYRATVEGKELVLNLGFSHPVKMKIPDSLKVKVEENTRITVSGYDKSEIGQFAATVR  192

Query  179  KWRPPEPYKGKGVKYADEVIRR  114
            KWRPPEPYKGKGVKY+DE++RR
Sbjct  193  KWRPPEPYKGKGVKYSDEIVRR  214



>ref|XP_010243082.1| PREDICTED: 50S ribosomal protein L6, chloroplastic-like [Nelumbo 
nucifera]
Length=226

 Score =   323 bits (829),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 151/202 (75%), Positives = 178/202 (88%), Gaps = 0/202 (0%)
 Frame = -1

Query  719  SNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPL  540
            S F+G+ S  +  ++ + +   +RK VECKESRIGK+ I VPSNVTI +EGQD KVKGPL
Sbjct  16   STFLGEMSATQVVRVPVTKVGLLRKVVECKESRIGKKAIEVPSNVTITLEGQDLKVKGPL  75

Query  539  GELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQL  360
            GEL  TYPREVK+ +EESG L+V KA++TRRAN+MHGLFRTLTDNM+VGVSKGF+K+LQL
Sbjct  76   GELSRTYPREVKIVREESGTLKVNKALDTRRANQMHGLFRTLTDNMVVGVSKGFEKRLQL  135

Query  359  VGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIR  180
            VGVGYRA VEG D+VLNLGFSHPVRMAIPDGL+VKVE+NTRI+VSGYDK +IG+FAASIR
Sbjct  136  VGVGYRATVEGNDLVLNLGFSHPVRMAIPDGLKVKVEDNTRISVSGYDKCSIGEFAASIR  195

Query  179  KWRPPEPYKGKGVKYADEVIRR  114
            KWRPPEPYKGKGVKYADE++RR
Sbjct  196  KWRPPEPYKGKGVKYADEIVRR  217



>ref|XP_010276744.1| PREDICTED: 50S ribosomal protein L6, chloroplastic-like [Nelumbo 
nucifera]
Length=225

 Score =   323 bits (829),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 154/202 (76%), Positives = 177/202 (88%), Gaps = 0/202 (0%)
 Frame = -1

Query  719  SNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPL  540
            S F+G+ S  +  ++ +    F+RKTVECKESRIGK+PI VP NV I +EGQD KVKGPL
Sbjct  15   SKFLGEVSATQVGRVPVTHVGFLRKTVECKESRIGKKPIEVPPNVAITLEGQDLKVKGPL  74

Query  539  GELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQL  360
            GEL  TYPREVKL +EESG LRV KA+ETRRAN+MHGLFRTLTDNM+VGVSKGF+K+LQL
Sbjct  75   GELSRTYPREVKLVREESGNLRVIKAVETRRANQMHGLFRTLTDNMVVGVSKGFEKRLQL  134

Query  359  VGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIR  180
            VGVGYRA +EGKD+VLNLGFSHPVRM IPDGL+VKVE+NTRI VSGYDK +IG+FAASIR
Sbjct  135  VGVGYRATLEGKDLVLNLGFSHPVRMTIPDGLKVKVEDNTRIAVSGYDKCSIGEFAASIR  194

Query  179  KWRPPEPYKGKGVKYADEVIRR  114
            KWRPPEPYKGKGVKYADE++RR
Sbjct  195  KWRPPEPYKGKGVKYADEIVRR  216



>ref|NP_172011.1| 50S ribosomal protein L6 [Arabidopsis thaliana]
 sp|O23049.1|RK6_ARATH RecName: Full=50S ribosomal protein L6, chloroplastic; AltName: 
Full=Protein EMBRYO DEFECTIVE 2394; Flags: Precursor [Arabidopsis 
thaliana]
 pdb|3BBO|I Chain I, Homology Model For The Spinach Chloroplast 50s Subunit 
Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome
 gb|AAK25975.1|AF360265_1 putative chloroplast 50S ribosomal protein L6 [Arabidopsis thaliana]
 gb|AAB71459.1| Similar to Mycobacterium RlpF (gb|Z84395). ESTs gb|T75785,gb|R30580,gb|T04698 
come from this gene [Arabidopsis thaliana]
 gb|AAK64135.1| putative chloroplast 50S ribosomal protein L6 [Arabidopsis thaliana]
 gb|AAM62933.1| putative chloroplast 50S ribosomal protein L6 [Arabidopsis thaliana]
 gb|AEE27802.1| 50S ribosomal protein L6 [Arabidopsis thaliana]
Length=223

 Score =   323 bits (828),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 152/202 (75%), Positives = 176/202 (87%), Gaps = 0/202 (0%)
 Frame = -1

Query  719  SNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPL  540
            S F+GD +  +      A+  +  KT+ECKESRIGKQPI VPSNVTI +EGQD KVKGPL
Sbjct  13   SAFLGDRNVFKVSSTPFAQVGYSSKTIECKESRIGKQPIAVPSNVTIALEGQDLKVKGPL  72

Query  539  GELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQL  360
            GEL +TYPREV+L KEESG LRV+K +ETRRAN+MHGLFRTLTDNM+VGVSKGF+KKL L
Sbjct  73   GELALTYPREVELTKEESGFLRVKKTVETRRANQMHGLFRTLTDNMVVGVSKGFEKKLIL  132

Query  359  VGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIR  180
            VGVGYRA V+GK++VLNLGFSHPV+M IPD L+VKVEENTRITVSGYDKS IGQFAA++R
Sbjct  133  VGVGYRATVDGKELVLNLGFSHPVKMQIPDSLKVKVEENTRITVSGYDKSEIGQFAATVR  192

Query  179  KWRPPEPYKGKGVKYADEVIRR  114
            KWRPPEPYKGKGVKY+DE++RR
Sbjct  193  KWRPPEPYKGKGVKYSDEIVRR  214



>ref|XP_010457601.1| PREDICTED: 50S ribosomal protein L6, chloroplastic [Camelina 
sativa]
Length=223

 Score =   323 bits (828),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 152/202 (75%), Positives = 177/202 (88%), Gaps = 0/202 (0%)
 Frame = -1

Query  719  SNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPL  540
            S F+GD +  +      A+  +  KT+ECKESRIGKQPI VPSNVTI +EGQD KVKGPL
Sbjct  13   SAFLGDRNVFKVSITPFAQVGYSSKTIECKESRIGKQPIAVPSNVTIALEGQDLKVKGPL  72

Query  539  GELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQL  360
            GEL +TYPREV+L KE+SG+LRV+K +ETRRAN+MHGLFRTLTDNM+VGVSKGF+KKL L
Sbjct  73   GELALTYPREVELTKEDSGLLRVKKTVETRRANQMHGLFRTLTDNMVVGVSKGFEKKLIL  132

Query  359  VGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIR  180
            VGVGYRA VEGK++VLNLGFSHPV+M IPD L+VKVEENTRITVSGYDKS IGQFAA++R
Sbjct  133  VGVGYRATVEGKELVLNLGFSHPVKMKIPDSLKVKVEENTRITVSGYDKSEIGQFAATVR  192

Query  179  KWRPPEPYKGKGVKYADEVIRR  114
            KWRPPEPYKGKGVKY+DE++RR
Sbjct  193  KWRPPEPYKGKGVKYSDEIVRR  214



>emb|CDY70611.1| BnaAnng34360D [Brassica napus]
Length=223

 Score =   323 bits (827),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 152/202 (75%), Positives = 178/202 (88%), Gaps = 0/202 (0%)
 Frame = -1

Query  719  SNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPL  540
            S+F+G+ +  +     IA+  F  KT+ECKESRIGKQPI VPSNVTI +EGQD KVKGPL
Sbjct  13   SSFLGERNVFKVSTAPIAQVGFSSKTIECKESRIGKQPIAVPSNVTIALEGQDLKVKGPL  72

Query  539  GELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQL  360
            GEL +TYPREV+L KE+SG LRV+K +ETRRAN+MHGLFRTLTDNM+VGVSKGF+KKL L
Sbjct  73   GELALTYPREVELLKEDSGFLRVKKTVETRRANQMHGLFRTLTDNMVVGVSKGFEKKLIL  132

Query  359  VGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIR  180
            VGVGYRA VEGK++VLNLGFSHPV+M IP+ L+VKVEENTRITVSGYDKS IGQFAA++R
Sbjct  133  VGVGYRATVEGKELVLNLGFSHPVKMQIPESLKVKVEENTRITVSGYDKSEIGQFAATVR  192

Query  179  KWRPPEPYKGKGVKYADEVIRR  114
            KWRPPEPYKGKGVKY+DE++RR
Sbjct  193  KWRPPEPYKGKGVKYSDEIVRR  214



>ref|XP_011005106.1| PREDICTED: 50S ribosomal protein L6, chloroplastic [Populus euphratica]
Length=226

 Score =   323 bits (827),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 152/201 (76%), Positives = 179/201 (89%), Gaps = 0/201 (0%)
 Frame = -1

Query  719  SNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPL  540
            S F+G+ +GI    + + R  F+RK +ECKESRIGKQPI VPSNVTI +EGQD KVKGPL
Sbjct  16   SVFLGERNGICVPSVPVTRFGFLRKAIECKESRIGKQPIQVPSNVTITLEGQDLKVKGPL  75

Query  539  GELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQL  360
            GEL  TYPREVKLE++E G++RV+KA+ETRRAN+MHGLFRTLTDNM+VGVSKGF+K+LQL
Sbjct  76   GELSRTYPREVKLERDEDGIIRVKKALETRRANQMHGLFRTLTDNMLVGVSKGFEKRLQL  135

Query  359  VGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIR  180
            VGVGYRA VEGKD+VL+LGFSHPVRMAIP  LQVKVEENTRI VSG+DK +IG+FAASIR
Sbjct  136  VGVGYRANVEGKDLVLSLGFSHPVRMAIPATLQVKVEENTRIVVSGFDKCSIGEFAASIR  195

Query  179  KWRPPEPYKGKGVKYADEVIR  117
            +WRPPEPYKGKGV+YA+E+IR
Sbjct  196  RWRPPEPYKGKGVRYANEIIR  216



>ref|XP_002320459.1| ribosomal protein L6 [Populus trichocarpa]
 gb|EEE98774.1| ribosomal protein L6 [Populus trichocarpa]
Length=227

 Score =   322 bits (825),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 152/201 (76%), Positives = 179/201 (89%), Gaps = 0/201 (0%)
 Frame = -1

Query  719  SNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPL  540
            S F+G+ + I    + + R  F+RK +ECKESRIGKQPI VPSNVTIK+EGQD KVKGPL
Sbjct  17   SVFLGERNRICVPSVPVTRIGFLRKAIECKESRIGKQPIQVPSNVTIKLEGQDLKVKGPL  76

Query  539  GELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQL  360
            GEL  TYPREVKLE++E G++RV+KA+ETRRAN+MHGLFRTLTDNM+VGVSKGF+K+LQL
Sbjct  77   GELSRTYPREVKLERDEDGIIRVKKALETRRANQMHGLFRTLTDNMVVGVSKGFEKRLQL  136

Query  359  VGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIR  180
            VGVGYRA VEGKD+VL+LGFSHPVRMAIP  LQVKVEENTRI VSG+DK +IG+FAASIR
Sbjct  137  VGVGYRANVEGKDLVLSLGFSHPVRMAIPATLQVKVEENTRIVVSGFDKCSIGEFAASIR  196

Query  179  KWRPPEPYKGKGVKYADEVIR  117
            +WRPPEPYKGKGV+YA+E+IR
Sbjct  197  RWRPPEPYKGKGVRYANEIIR  217



>ref|XP_009119188.1| PREDICTED: 50S ribosomal protein L6, chloroplastic [Brassica 
rapa]
Length=223

 Score =   322 bits (825),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 150/202 (74%), Positives = 178/202 (88%), Gaps = 0/202 (0%)
 Frame = -1

Query  719  SNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPL  540
            S F+GD +  +      A+  + RKT++CKESRIGKQPI VP+NVTI +EGQD KVKGPL
Sbjct  13   SAFLGDRNVFKVLATPSAQVGYSRKTIQCKESRIGKQPIAVPTNVTIALEGQDLKVKGPL  72

Query  539  GELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQL  360
            GEL +TYPREV+L KE++GVLRV+K +ETRRAN+MHGLFRTLTDNM+VGVSKGF+KKL L
Sbjct  73   GELALTYPREVELIKEDAGVLRVKKTVETRRANQMHGLFRTLTDNMVVGVSKGFEKKLIL  132

Query  359  VGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIR  180
            VGVGYRA VEGK++VLNLGFSHPV+M IP+ L+VKVEENTRITVSGYDKS IGQFAA++R
Sbjct  133  VGVGYRATVEGKELVLNLGFSHPVKMQIPESLKVKVEENTRITVSGYDKSEIGQFAATVR  192

Query  179  KWRPPEPYKGKGVKYADEVIRR  114
            KWRPPEPYKGKGVKY+DE++RR
Sbjct  193  KWRPPEPYKGKGVKYSDEIVRR  214



>emb|CDY46838.1| BnaA10g03220D [Brassica napus]
Length=223

 Score =   322 bits (824),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 151/202 (75%), Positives = 178/202 (88%), Gaps = 0/202 (0%)
 Frame = -1

Query  719  SNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPL  540
            S F+GD +  +      A+  + RKT+ECKESRIGKQPI VP+NVTI +EGQD KVKGPL
Sbjct  13   SAFLGDRNVFKVSNTPYAQVGYSRKTIECKESRIGKQPIAVPTNVTIALEGQDLKVKGPL  72

Query  539  GELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQL  360
            GEL +TYPREV+L KE++GVLRV+K +ETRRAN+MHGLFRTLTDNM+VGVSKGF+KKL L
Sbjct  73   GELALTYPREVELIKEDAGVLRVKKTVETRRANQMHGLFRTLTDNMVVGVSKGFEKKLIL  132

Query  359  VGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIR  180
            VGVGYRA VEGK++VLNLGFSHPV+M IP+ L+VKVEENTRITVSGYDKS IGQFAA++R
Sbjct  133  VGVGYRATVEGKELVLNLGFSHPVKMQIPESLKVKVEENTRITVSGYDKSEIGQFAATVR  192

Query  179  KWRPPEPYKGKGVKYADEVIRR  114
            KWRPPEPYKGKGVKY+DE++RR
Sbjct  193  KWRPPEPYKGKGVKYSDEIVRR  214



>ref|XP_010475192.1| PREDICTED: 50S ribosomal protein L6, chloroplastic-like [Camelina 
sativa]
Length=224

 Score =   322 bits (824),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 153/203 (75%), Positives = 178/203 (88%), Gaps = 1/203 (0%)
 Frame = -1

Query  719  SNFIGDASGIRFFKLT-IARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGP  543
            S F+GD +  +    T  A+  +  KT+ECKESRIGKQPI VPSNVTI +EGQD KVKGP
Sbjct  13   SAFLGDRNVFKVSSSTPFAQVGYSSKTIECKESRIGKQPIAVPSNVTIALEGQDLKVKGP  72

Query  542  LGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQ  363
            LGEL +TYPREV+L KE+SG+LRV+K +ETRRAN+MHGLFRTLTDNM+VGVSKGF+KKL 
Sbjct  73   LGELALTYPREVELTKEDSGLLRVKKTVETRRANQMHGLFRTLTDNMVVGVSKGFEKKLI  132

Query  362  LVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASI  183
            LVGVGYRA VEGK++VLNLGFSHPV+M IPD L+VKVEENTRITVSGYDKS IGQFAA++
Sbjct  133  LVGVGYRATVEGKELVLNLGFSHPVKMKIPDSLKVKVEENTRITVSGYDKSEIGQFAATV  192

Query  182  RKWRPPEPYKGKGVKYADEVIRR  114
            RKWRPPEPYKGKGVKY+DE++RR
Sbjct  193  RKWRPPEPYKGKGVKYSDEIVRR  215



>ref|XP_010689735.1| PREDICTED: 50S ribosomal protein L6, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=220

 Score =   321 bits (823),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 152/186 (82%), Positives = 168/186 (90%), Gaps = 0/186 (0%)
 Frame = -1

Query  671  IARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKE  492
            + R  F RK VECKESRIGKQPI VP+NV I MEGQD KVKGPLGEL ITYPREV +EK+
Sbjct  26   VTRAGFWRKNVECKESRIGKQPIAVPANVAIAMEGQDLKVKGPLGELAITYPREVIVEKQ  85

Query  491  ESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVL  312
            ESG LRVRKA+ETRRAN+MHGLFRTLTDNM+VGVSKGF+KKLQLVGVGYRA VEGKD+VL
Sbjct  86   ESGFLRVRKAVETRRANQMHGLFRTLTDNMVVGVSKGFEKKLQLVGVGYRATVEGKDLVL  145

Query  311  NLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYA  132
            +LGFSHPVRMA+PD LQVKVEENT++TVSG DKS +GQFAASIR WRPPEPYKGKGV+Y 
Sbjct  146  SLGFSHPVRMAVPDDLQVKVEENTKVTVSGRDKSVVGQFAASIRSWRPPEPYKGKGVRYV  205

Query  131  DEVIRR  114
            DEV+RR
Sbjct  206  DEVVRR  211



>ref|XP_009353272.1| PREDICTED: 50S ribosomal protein L6, chloroplastic [Pyrus x bretschneideri]
Length=226

 Score =   320 bits (820),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 149/202 (74%), Positives = 176/202 (87%), Gaps = 0/202 (0%)
 Frame = -1

Query  719  SNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPL  540
            S F+G+ +G     + ++   F++KT+ECKESRIGKQP  VPSN+TI +EGQ   VKGPL
Sbjct  16   STFLGERNGFSVCSVPVSHVGFLKKTIECKESRIGKQPSEVPSNLTISVEGQALAVKGPL  75

Query  539  GELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQL  360
            G+L +TY REV ++KE+SG LRVRKA+ETRRAN+MHGLFRTLTDNM+VGVSKGFDK+LQL
Sbjct  76   GQLSLTYQREVLVQKEDSGALRVRKAVETRRANQMHGLFRTLTDNMVVGVSKGFDKRLQL  135

Query  359  VGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIR  180
            VG+GYRA +EGK +VL+LGFSHPVRM  P+G+QVKVEENTRI VSGYDKSAIGQFAASIR
Sbjct  136  VGIGYRATLEGKILVLSLGFSHPVRMDTPNGIQVKVEENTRIVVSGYDKSAIGQFAASIR  195

Query  179  KWRPPEPYKGKGVKYADEVIRR  114
            KWRPPEPYKGKGVKYADE+IRR
Sbjct  196  KWRPPEPYKGKGVKYADEIIRR  217



>ref|XP_009401055.1| PREDICTED: 50S ribosomal protein L6, chloroplastic [Musa acuminata 
subsp. malaccensis]
Length=226

 Score =   319 bits (818),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 150/202 (74%), Positives = 177/202 (88%), Gaps = 0/202 (0%)
 Frame = -1

Query  719  SNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPL  540
            S F+GD S I       +R +F+RK VECKESRIGK+PI VP NVTI ++GQD KVKGPL
Sbjct  16   SAFLGDRSRICISDAPFSRVHFLRKPVECKESRIGKRPIEVPPNVTIALDGQDLKVKGPL  75

Query  539  GELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQL  360
            GEL  TYPREVK++++ESG L+V KA+ETRRAN+MHGLFRTLTDNM+VGVSKGF+K+LQL
Sbjct  76   GELSRTYPREVKVQRDESGFLKVSKAVETRRANQMHGLFRTLTDNMVVGVSKGFEKRLQL  135

Query  359  VGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIR  180
            VGVGYRA +EG+D+VLNLGFSHPVRMAIPDGLQV VE+NTRI V GYDK AIG+FAA++R
Sbjct  136  VGVGYRATLEGRDLVLNLGFSHPVRMAIPDGLQVMVEDNTRIAVIGYDKCAIGEFAAAVR  195

Query  179  KWRPPEPYKGKGVKYADEVIRR  114
            KWRPPEPYKGKG+KYADE++RR
Sbjct  196  KWRPPEPYKGKGIKYADEIVRR  217



>ref|XP_004287942.1| PREDICTED: 50S ribosomal protein L6, chloroplastic [Fragaria 
vesca subsp. vesca]
Length=226

 Score =   319 bits (817),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 149/202 (74%), Positives = 175/202 (87%), Gaps = 0/202 (0%)
 Frame = -1

Query  719  SNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPL  540
            S F+G+  G   +        F++K VECKESRIGKQPI VP+NVT+K+EGQ  +VKGPL
Sbjct  16   SAFLGERKGFTVYSAPATNVGFLKKAVECKESRIGKQPIEVPANVTLKLEGQSLEVKGPL  75

Query  539  GELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQL  360
            G+L +  PREV +EK+ESGVL+VRKAMETRRAN+MHGLFRTLTDNM+VGVSKGF+K+LQL
Sbjct  76   GQLSMILPREVVVEKQESGVLKVRKAMETRRANQMHGLFRTLTDNMVVGVSKGFEKRLQL  135

Query  359  VGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIR  180
            +GVGYRA +EG+ +VL+LGFSHPVRM IPDG+QVKVEENTRI VSGYDKS IGQFAASIR
Sbjct  136  IGVGYRATLEGRILVLSLGFSHPVRMDIPDGIQVKVEENTRIIVSGYDKSEIGQFAASIR  195

Query  179  KWRPPEPYKGKGVKYADEVIRR  114
            KWRPPEPYKGKGVKYADE++RR
Sbjct  196  KWRPPEPYKGKGVKYADEIVRR  217



>emb|CDY49511.1| BnaC05g03230D [Brassica napus]
Length=223

 Score =   318 bits (816),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 149/202 (74%), Positives = 177/202 (88%), Gaps = 0/202 (0%)
 Frame = -1

Query  719  SNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPL  540
            S F+GD +  +      A+  + RKT++CKESRIGKQPI VP+NVTI +EGQD KVKGPL
Sbjct  13   SAFLGDRNVFKVSATPSAQVGYSRKTIQCKESRIGKQPIAVPTNVTIALEGQDLKVKGPL  72

Query  539  GELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQL  360
            GEL +TYPREV+L KE++G LRV+K +ETRRAN+MHGLFRTLTDNM+VGVSKGF+KKL L
Sbjct  73   GELALTYPREVELIKEDAGFLRVKKTVETRRANQMHGLFRTLTDNMVVGVSKGFEKKLIL  132

Query  359  VGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIR  180
            VGVGYRA VEGK++VLNLGFSHPV+M IP+ L+VKVEENTRITVSGYDKS IGQFAA++R
Sbjct  133  VGVGYRATVEGKELVLNLGFSHPVKMQIPESLKVKVEENTRITVSGYDKSEIGQFAATVR  192

Query  179  KWRPPEPYKGKGVKYADEVIRR  114
            KWRPPEPYKGKGVKY+DE++RR
Sbjct  193  KWRPPEPYKGKGVKYSDEIVRR  214



>ref|XP_010051031.1| PREDICTED: 50S ribosomal protein L6, chloroplastic [Eucalyptus 
grandis]
 gb|KCW89410.1| hypothetical protein EUGRSUZ_A01711 [Eucalyptus grandis]
Length=226

 Score =   318 bits (814),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 147/201 (73%), Positives = 174/201 (87%), Gaps = 0/201 (0%)
 Frame = -1

Query  719  SNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPL  540
            S  +G+ SGI    + +    F+R  +ECKESRIGKQPI VP NVTI +EGQ  +VKGPL
Sbjct  16   SAILGERSGICISSVPVTHVGFMRSNIECKESRIGKQPIEVPKNVTITLEGQSLRVKGPL  75

Query  539  GELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQL  360
            GEL   YPREVK+EK+ESG L+V KA+ETRRAN+MHGLFRTLTDNM+VGVSKGF+K+LQL
Sbjct  76   GELSQIYPREVKVEKQESGYLKVNKALETRRANQMHGLFRTLTDNMVVGVSKGFEKRLQL  135

Query  359  VGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIR  180
            VGVGYRA +EG+D+VL+LGFSHPVRMAIP+G+QVKVE+NTRI +SGYDKSAIGQFAAS+R
Sbjct  136  VGVGYRATLEGRDLVLSLGFSHPVRMAIPEGIQVKVEDNTRIIISGYDKSAIGQFAASVR  195

Query  179  KWRPPEPYKGKGVKYADEVIR  117
            KWRPPEPYKGKGV+Y DEV+R
Sbjct  196  KWRPPEPYKGKGVRYVDEVVR  216



>dbj|BAH20405.1| AT1G05190 [Arabidopsis thaliana]
Length=200

 Score =   316 bits (810),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 148/186 (80%), Positives = 169/186 (91%), Gaps = 0/186 (0%)
 Frame = -1

Query  671  IARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKE  492
             A+  +  KT+ECKESRIGKQPI VPSNVTI +EGQD KVKGPLGEL +TYPREV+L KE
Sbjct  6    FAQVGYSSKTIECKESRIGKQPIAVPSNVTIALEGQDLKVKGPLGELALTYPREVELTKE  65

Query  491  ESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVL  312
            ESG LRV+K +ETRRAN+MHGLFRTLTDNM+VGVSKGF+KKL LVGVGYRA V+GK++VL
Sbjct  66   ESGFLRVKKTVETRRANQMHGLFRTLTDNMVVGVSKGFEKKLILVGVGYRATVDGKELVL  125

Query  311  NLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYA  132
            NLGFSHPV+M IPD L+VKVEENTRITVSGYDKS IGQFAA++RKWRPPEPYKGKGVKY+
Sbjct  126  NLGFSHPVKMQIPDSLKVKVEENTRITVSGYDKSEIGQFAATVRKWRPPEPYKGKGVKYS  185

Query  131  DEVIRR  114
            DE++RR
Sbjct  186  DEIVRR  191



>gb|ACG25590.1| 50S ribosomal protein L6 [Zea mays]
Length=224

 Score =   317 bits (812),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 152/206 (74%), Positives = 179/206 (87%), Gaps = 7/206 (3%)
 Frame = -1

Query  719  SNFIGDASGIRFFKLT----IARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKV  552
            S+F+GD +    FK++      +  F  KT+ECKESRIGKQPI VPSNVTI +EGQD KV
Sbjct  13   SSFLGDRNA---FKVSTTPPFTQVGFSSKTIECKESRIGKQPISVPSNVTIALEGQDLKV  69

Query  551  KGPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDK  372
            KGPLGEL +TYPREV+L KE+SG LRV+K +ETRRAN+MHGLFRTLTDNM+VGVSKGF+K
Sbjct  70   KGPLGELALTYPREVELLKEDSGFLRVKKTVETRRANQMHGLFRTLTDNMVVGVSKGFEK  129

Query  371  KLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFA  192
            KL +VGVGYRA VEGK++VLNLGFSHPV+M IP+ L+VKVEENTRITVSGYDKS IGQFA
Sbjct  130  KLIVVGVGYRATVEGKELVLNLGFSHPVKMQIPESLKVKVEENTRITVSGYDKSEIGQFA  189

Query  191  ASIRKWRPPEPYKGKGVKYADEVIRR  114
            A++RKWRPPEPYKGKGVKY+DE++RR
Sbjct  190  ATVRKWRPPEPYKGKGVKYSDEIVRR  215



>ref|XP_006447548.1| hypothetical protein CICLE_v10016578mg [Citrus clementina]
 ref|XP_006469689.1| PREDICTED: 50S ribosomal protein L6, chloroplastic-like [Citrus 
sinensis]
 gb|ESR60788.1| hypothetical protein CICLE_v10016578mg [Citrus clementina]
 gb|KDO41663.1| hypothetical protein CISIN_1g027306mg [Citrus sinensis]
Length=225

 Score =   317 bits (811),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 153/202 (76%), Positives = 175/202 (87%), Gaps = 1/202 (0%)
 Frame = -1

Query  719  SNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPL  540
            S F G+ +G     + + R  F RKT+ECKESRIGKQPI VPSNVTI + GQD KVKGPL
Sbjct  16   SIFFGERNGFSMSNVPVNRVGFSRKTIECKESRIGKQPIEVPSNVTITLGGQDLKVKGPL  75

Query  539  GELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQL  360
            GEL + YPREVK+++E+S  LRVRK +ETRRAN+MHGLFRTLTDNM+VGVSKGF+KKLQ+
Sbjct  76   GELSLVYPREVKVDREDS-FLRVRKTVETRRANQMHGLFRTLTDNMVVGVSKGFEKKLQM  134

Query  359  VGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIR  180
            VGVGYRA +EG+ +VL+LGFSHPVRM IPDG++V VEENTRITVSGYDKSAIGQFAASIR
Sbjct  135  VGVGYRAALEGQVLVLSLGFSHPVRMTIPDGIKVNVEENTRITVSGYDKSAIGQFAASIR  194

Query  179  KWRPPEPYKGKGVKYADEVIRR  114
            KWRPPEPYKGKGVKY DEVIRR
Sbjct  195  KWRPPEPYKGKGVKYVDEVIRR  216



>ref|XP_010907839.1| PREDICTED: 50S ribosomal protein L6, chloroplastic [Elaeis guineensis]
Length=247

 Score =   317 bits (812),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 151/202 (75%), Positives = 175/202 (87%), Gaps = 0/202 (0%)
 Frame = -1

Query  719  SNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPL  540
            S F+G+   I      I+R  F+RK V+CKESRIGK+PI VP NVTI ++GQD KVKGPL
Sbjct  37   SLFLGERKEICITNSPISRIGFLRKPVQCKESRIGKRPIEVPPNVTIALDGQDLKVKGPL  96

Query  539  GELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQL  360
            GEL  TYPREVK+E  ESG LRV KA +TRRAN+MHGLFRTLTDNM+VGVSKGF+K+LQL
Sbjct  97   GELSTTYPREVKIEILESGTLRVFKASDTRRANQMHGLFRTLTDNMVVGVSKGFEKRLQL  156

Query  359  VGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIR  180
            VGVGYRAM+EG+D+VLNLGFSHP+RM IP+GLQVKVE+NTRI VSGYDK AIG+FAA+IR
Sbjct  157  VGVGYRAMLEGRDLVLNLGFSHPIRMTIPEGLQVKVEDNTRIAVSGYDKCAIGEFAAAIR  216

Query  179  KWRPPEPYKGKGVKYADEVIRR  114
            KWRPPEPYKGKGV+YADEV+RR
Sbjct  217  KWRPPEPYKGKGVRYADEVVRR  238



>ref|XP_009118616.1| PREDICTED: 50S ribosomal protein L6, chloroplastic-like [Brassica 
rapa]
Length=224

 Score =   316 bits (809),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 152/206 (74%), Positives = 178/206 (86%), Gaps = 7/206 (3%)
 Frame = -1

Query  719  SNFIGDASGIRFFKLT----IARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKV  552
            S+F+GD +    FK++      +  F  KT+ECKESRIGKQPI VPSNVTI + GQD KV
Sbjct  13   SSFLGDRNA---FKVSTTPPFTQVGFSSKTIECKESRIGKQPISVPSNVTIALAGQDLKV  69

Query  551  KGPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDK  372
            KGPLGEL +TYPREV+L KE+SG LRV+K +ETRRAN+MHGLFRTLTDNM+VGVSKGF+K
Sbjct  70   KGPLGELALTYPREVELLKEDSGFLRVKKTVETRRANQMHGLFRTLTDNMVVGVSKGFEK  129

Query  371  KLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFA  192
            KL LVGVGYRA VEGK++VLNLGFSHPV+M IP+ L+VKVEENTRITVSGYDKS IGQFA
Sbjct  130  KLILVGVGYRATVEGKELVLNLGFSHPVKMQIPESLKVKVEENTRITVSGYDKSEIGQFA  189

Query  191  ASIRKWRPPEPYKGKGVKYADEVIRR  114
            A++RKWRPPEPYKGKGVKY+DE++RR
Sbjct  190  ATVRKWRPPEPYKGKGVKYSDEIVRR  215



>ref|XP_006650092.1| PREDICTED: 50S ribosomal protein L6, chloroplastic-like [Oryza 
brachyantha]
Length=226

 Score =   315 bits (808),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 151/202 (75%), Positives = 172/202 (85%), Gaps = 0/202 (0%)
 Frame = -1

Query  719  SNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPL  540
            + F+    GIR   +   R  FVRKTVECKESRIGK+PI VPSNVT+ +E Q  K KGPL
Sbjct  16   TGFVAKTQGIRLRVIPAGRVGFVRKTVECKESRIGKKPIEVPSNVTLTLEEQFVKAKGPL  75

Query  539  GELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQL  360
            GEL + YP EVK+ KEESG LRV K +ET+RAN+MHGLFRTLTDN+IVGVSKGFDKKLQL
Sbjct  76   GELSLNYPAEVKVVKEESGKLRVSKTVETKRANQMHGLFRTLTDNIIVGVSKGFDKKLQL  135

Query  359  VGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIR  180
            VGVGYRA VEGKD+V+NLGFSHPVRMA+P+GL+VKVEENTRI VSGYDKS IGQFAASI+
Sbjct  136  VGVGYRAAVEGKDLVMNLGFSHPVRMAVPEGLKVKVEENTRIIVSGYDKSEIGQFAASIK  195

Query  179  KWRPPEPYKGKGVKYADEVIRR  114
            KWRPPEPYKGKG++YADE +RR
Sbjct  196  KWRPPEPYKGKGIRYADEFVRR  217



>ref|XP_003557902.1| PREDICTED: 50S ribosomal protein L6, chloroplastic [Brachypodium 
distachyon]
Length=226

 Score =   315 bits (808),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 150/202 (74%), Positives = 174/202 (86%), Gaps = 0/202 (0%)
 Frame = -1

Query  719  SNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPL  540
            + F+G + GIR   +   R  FVRKTVECKESRIGK+PI VPSNVT+ +E Q  K KGPL
Sbjct  16   TGFLGKSQGIRLRVIPAGRVGFVRKTVECKESRIGKKPIEVPSNVTLTLEQQFVKAKGPL  75

Query  539  GELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQL  360
            GEL + YP EVK+ KEESG LRV K +ET+RAN+MHGLFRTLTDN+IVGVSKGFDK+LQL
Sbjct  76   GELSLNYPNEVKVVKEESGKLRVFKTVETKRANQMHGLFRTLTDNIIVGVSKGFDKRLQL  135

Query  359  VGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIR  180
            VGVGYRA VEGKD+V+NLGFSHPVRMA+P+GLQVKVEENTRI VSGYDKS IGQFAA+I+
Sbjct  136  VGVGYRATVEGKDLVMNLGFSHPVRMAVPEGLQVKVEENTRIIVSGYDKSEIGQFAATIK  195

Query  179  KWRPPEPYKGKGVKYADEVIRR  114
            KWRPPEPYKGKG++Y DE++RR
Sbjct  196  KWRPPEPYKGKGIRYQDEIVRR  217



>ref|NP_001051292.1| Os03g0751400 [Oryza sativa Japonica Group]
 gb|AAO32311.1| putative chloroplast 50S ribosomal protein L6 [Oryza sativa Japonica 
Group]
 gb|AAR87250.1| putative ribosomal protein L6 [Oryza sativa Japonica Group]
 gb|ABF98910.1| 50S ribosomal protein L6, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF13206.1| Os03g0751400 [Oryza sativa Japonica Group]
 gb|EAY91881.1| hypothetical protein OsI_13529 [Oryza sativa Indica Group]
 gb|EAZ28603.1| hypothetical protein OsJ_12590 [Oryza sativa Japonica Group]
 dbj|BAG91224.1| unnamed protein product [Oryza sativa Japonica Group]
Length=226

 Score =   315 bits (807),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 151/202 (75%), Positives = 173/202 (86%), Gaps = 0/202 (0%)
 Frame = -1

Query  719  SNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPL  540
            + F+G   GI    +   R  FVRKT+ECKESRIGK+PI VPSNVT+ +E Q  K KGPL
Sbjct  16   TGFLGKRQGICLHVIPAGRVGFVRKTIECKESRIGKKPIEVPSNVTLTLEEQFIKAKGPL  75

Query  539  GELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQL  360
            GEL + YP EVK+ KEESG LRV K +ET+RAN+MHGLFRTLTDN+IVGVSKGFDKKLQL
Sbjct  76   GELSLNYPGEVKVVKEESGKLRVSKTVETKRANQMHGLFRTLTDNIIVGVSKGFDKKLQL  135

Query  359  VGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIR  180
            VGVGYRA VEGKD+V+NLGFSHPVRMA+P+GL+VKVEENTRI VSGYDKS IGQFAASI+
Sbjct  136  VGVGYRAAVEGKDLVMNLGFSHPVRMAVPEGLKVKVEENTRIIVSGYDKSEIGQFAASIK  195

Query  179  KWRPPEPYKGKGVKYADEVIRR  114
            KWRPPEPYKGKG++YADEV+RR
Sbjct  196  KWRPPEPYKGKGIRYADEVVRR  217



>gb|KDP25836.1| hypothetical protein JCGZ_22866 [Jatropha curcas]
Length=226

 Score =   315 bits (806),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 149/201 (74%), Positives = 176/201 (88%), Gaps = 0/201 (0%)
 Frame = -1

Query  719  SNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPL  540
            S F+G+ +G+        R  F+RK + CKESRIGKQPI VP+NVTI ++GQD KVKGPL
Sbjct  16   SVFLGERNGVGVPIAPTTRVGFLRKMIVCKESRIGKQPIQVPTNVTITLDGQDLKVKGPL  75

Query  539  GELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQL  360
            GEL  TYPREVKLE++E+GV+RV+KA+ETRRAN+MHGLFRTLTDNM+VGVSKGF+K+LQL
Sbjct  76   GELSRTYPREVKLERDENGVIRVKKALETRRANQMHGLFRTLTDNMVVGVSKGFEKRLQL  135

Query  359  VGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIR  180
            VGVGYRA VEGKD+VL+LGFSHPVRM IPD L+VKVEENTRI +SGY+K  IGQFAASIR
Sbjct  136  VGVGYRATVEGKDLVLSLGFSHPVRMTIPDDLKVKVEENTRIIISGYEKCNIGQFAASIR  195

Query  179  KWRPPEPYKGKGVKYADEVIR  117
            KWRPPEPYKGKGV+YA+EV+R
Sbjct  196  KWRPPEPYKGKGVRYANEVVR  216



>ref|NP_001050139.1| Os03g0356300 [Oryza sativa Japonica Group]
 gb|ABF96017.1| 50S ribosomal protein L6, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF12053.1| Os03g0356300 [Oryza sativa Japonica Group]
 gb|EAY90037.1| hypothetical protein OsI_11607 [Oryza sativa Indica Group]
 dbj|BAG87949.1| unnamed protein product [Oryza sativa Japonica Group]
Length=226

 Score =   314 bits (805),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 151/202 (75%), Positives = 172/202 (85%), Gaps = 0/202 (0%)
 Frame = -1

Query  719  SNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPL  540
            + F G   GIR   +   R  FVR TVECKESRIGK+PI VPSNVT+ +E Q  K KGPL
Sbjct  16   TGFAGKTQGIRLRVIPAGRVGFVRTTVECKESRIGKKPIEVPSNVTLTLEEQFIKAKGPL  75

Query  539  GELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQL  360
            GEL + YP EVK+ KEESG LRV K +ET+RAN+MHGLFRTLTDN+IVGVSKGFDKKLQL
Sbjct  76   GELSLNYPGEVKVVKEESGKLRVSKTVETKRANQMHGLFRTLTDNIIVGVSKGFDKKLQL  135

Query  359  VGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIR  180
            VGVGYRA VEGKD+V+NLGFSHPVRMA+P+GL+VKVEENTRI VSGYDKS IGQFAASI+
Sbjct  136  VGVGYRAAVEGKDLVMNLGFSHPVRMAVPEGLKVKVEENTRIIVSGYDKSEIGQFAASIK  195

Query  179  KWRPPEPYKGKGVKYADEVIRR  114
            KWRPPEPYKGKG++YADE++RR
Sbjct  196  KWRPPEPYKGKGIRYADEIVRR  217



>emb|CDY06163.1| BnaA09g50400D [Brassica napus]
Length=224

 Score =   314 bits (805),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 151/206 (73%), Positives = 178/206 (86%), Gaps = 7/206 (3%)
 Frame = -1

Query  719  SNFIGDASGIRFFKLT----IARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKV  552
            S+F+GD +    FK++      +  F  KT+ECKESRIGKQPI VPSNVTI + GQD KV
Sbjct  13   SSFLGDRNA---FKVSTTPPFTQVGFSSKTIECKESRIGKQPISVPSNVTIALAGQDLKV  69

Query  551  KGPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDK  372
            KGPLGEL +TYPREV+L KE+SG LRV+K +ETRRAN+MHGLFRTLTDNM+VGVSKGF+K
Sbjct  70   KGPLGELALTYPREVELLKEDSGFLRVKKTVETRRANQMHGLFRTLTDNMVVGVSKGFEK  129

Query  371  KLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFA  192
            KL LVGVGYRA VEGK++VLNLGFSHPV+M IP+ L+VKVEENTRITVSGYDK+ IGQFA
Sbjct  130  KLILVGVGYRATVEGKELVLNLGFSHPVKMQIPESLKVKVEENTRITVSGYDKNEIGQFA  189

Query  191  ASIRKWRPPEPYKGKGVKYADEVIRR  114
            A++RKWRPPEPYKGKGVKY+DE++RR
Sbjct  190  ATVRKWRPPEPYKGKGVKYSDEIVRR  215



>gb|EAZ26952.1| hypothetical protein OsJ_10878 [Oryza sativa Japonica Group]
Length=226

 Score =   314 bits (804),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 151/202 (75%), Positives = 172/202 (85%), Gaps = 0/202 (0%)
 Frame = -1

Query  719  SNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPL  540
            + F G   GIR   +   R  FVR TVECKESRIGK+PI VPSNVT+ +E Q  K KGPL
Sbjct  16   TGFAGKTQGIRLRVIPAGRVGFVRTTVECKESRIGKKPIEVPSNVTLTLEEQFIKAKGPL  75

Query  539  GELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQL  360
            GEL + YP EVK+ KEESG LRV K +ET+RAN+MHGLFRTLTDN+IVGVSKGFDKKLQL
Sbjct  76   GELSLNYPGEVKVVKEESGKLRVSKTVETKRANQMHGLFRTLTDNIIVGVSKGFDKKLQL  135

Query  359  VGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIR  180
            VGVGYRA VEGKD+V+NLGFSHPVRMA+P+GL+VKVEENTRI VSGYDKS IGQFAASI+
Sbjct  136  VGVGYRAAVEGKDLVMNLGFSHPVRMAVPEGLKVKVEENTRIIVSGYDKSEIGQFAASIK  195

Query  179  KWRPPEPYKGKGVKYADEVIRR  114
            KWRPPEPYKGKG++YADE++RR
Sbjct  196  KWRPPEPYKGKGIRYADEIVRR  217



>ref|XP_002465260.1| hypothetical protein SORBIDRAFT_01g035090 [Sorghum bicolor]
 gb|EER92258.1| hypothetical protein SORBIDRAFT_01g035090 [Sorghum bicolor]
Length=226

 Score =   312 bits (800),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 151/202 (75%), Positives = 172/202 (85%), Gaps = 0/202 (0%)
 Frame = -1

Query  719  SNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPL  540
            + F+G   GIR   L   R  FVR  VECKESRIGKQPI VPSNVT+ +E Q  K KGPL
Sbjct  16   TGFLGKTHGIRPRVLPAGRVGFVRTVVECKESRIGKQPIEVPSNVTLTLEEQFVKAKGPL  75

Query  539  GELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQL  360
            GEL +++P +VK+ KEESG+LRV K  ET+RAN+MHGLFRTLTDN+IVGVSKGFDKKLQL
Sbjct  76   GELSLSFPGDVKIVKEESGMLRVYKTAETKRANQMHGLFRTLTDNIIVGVSKGFDKKLQL  135

Query  359  VGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIR  180
            VGVGYRA VEG D+V+NLGFSHPVRMAIP+GL VKVEENTRITVSGYDKSAIGQFAA+I+
Sbjct  136  VGVGYRAAVEGNDLVMNLGFSHPVRMAIPEGLAVKVEENTRITVSGYDKSAIGQFAATIK  195

Query  179  KWRPPEPYKGKGVKYADEVIRR  114
            KWRPPEPYKGKG++Y DEV+RR
Sbjct  196  KWRPPEPYKGKGIRYMDEVVRR  217



>dbj|BAJ92513.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=216

 Score =   311 bits (798),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 148/202 (73%), Positives = 173/202 (86%), Gaps = 0/202 (0%)
 Frame = -1

Query  719  SNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPL  540
            + F+G + GI    +   R  FVRKTVECKESRIGK+PI VPSNVT+ +E Q  K KGPL
Sbjct  6    TGFLGKSRGIHLRVIPAGRVGFVRKTVECKESRIGKKPIEVPSNVTLTLEEQFVKAKGPL  65

Query  539  GELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQL  360
            GEL + YP EVK+ KEE+G LRV K +ET+RAN+MHGLFRTLTDN+IVGVSKGFDK+LQL
Sbjct  66   GELSLNYPTEVKVVKEETGKLRVFKTVETKRANQMHGLFRTLTDNIIVGVSKGFDKRLQL  125

Query  359  VGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIR  180
            VGVGYRA VEGKD+V+NLGFSHPVRMA+P+GLQVKVEENTRI VSGYDKS IGQFAA+I+
Sbjct  126  VGVGYRATVEGKDLVMNLGFSHPVRMAVPEGLQVKVEENTRIIVSGYDKSEIGQFAATIK  185

Query  179  KWRPPEPYKGKGVKYADEVIRR  114
            KWRPPEPYKGKG++Y DE++RR
Sbjct  186  KWRPPEPYKGKGIRYQDEIVRR  207



>dbj|BAJ84917.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=239

 Score =   312 bits (799),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 148/202 (73%), Positives = 173/202 (86%), Gaps = 0/202 (0%)
 Frame = -1

Query  719  SNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPL  540
            + F+G + GI    +   R  FVRKTVECKESRIGK+PI VPSNVT+ +E Q  K KGPL
Sbjct  29   TGFLGKSRGIHLRVIPAGRVGFVRKTVECKESRIGKKPIEVPSNVTLTLEEQFVKAKGPL  88

Query  539  GELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQL  360
            GEL + YP EVK+ KEE+G LRV K +ET+RAN+MHGLFRTLTDN+IVGVSKGFDK+LQL
Sbjct  89   GELSLNYPTEVKVVKEETGKLRVFKTVETKRANQMHGLFRTLTDNIIVGVSKGFDKRLQL  148

Query  359  VGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIR  180
            VGVGYRA VEGKD+V+NLGFSHPVRMA+P+GLQVKVEENTRI VSGYDKS IGQFAA+I+
Sbjct  149  VGVGYRATVEGKDLVMNLGFSHPVRMAVPEGLQVKVEENTRIIVSGYDKSEIGQFAATIK  208

Query  179  KWRPPEPYKGKGVKYADEVIRR  114
            KWRPPEPYKGKG++Y DE++RR
Sbjct  209  KWRPPEPYKGKGIRYQDEIVRR  230



>dbj|BAJ91776.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88259.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93276.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=226

 Score =   311 bits (798),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 148/202 (73%), Positives = 173/202 (86%), Gaps = 0/202 (0%)
 Frame = -1

Query  719  SNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPL  540
            + F+G + GI    +   R  FVRKTVECKESRIGK+PI VPSNVT+ +E Q  K KGPL
Sbjct  16   TGFLGKSRGIHLRVIPAGRVGFVRKTVECKESRIGKKPIEVPSNVTLTLEEQFVKAKGPL  75

Query  539  GELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQL  360
            GEL + YP EVK+ KEE+G LRV K +ET+RAN+MHGLFRTLTDN+IVGVSKGFDK+LQL
Sbjct  76   GELSLNYPTEVKVVKEETGKLRVFKTVETKRANQMHGLFRTLTDNIIVGVSKGFDKRLQL  135

Query  359  VGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIR  180
            VGVGYRA VEGKD+V+NLGFSHPVRMA+P+GLQVKVEENTRI VSGYDKS IGQFAA+I+
Sbjct  136  VGVGYRATVEGKDLVMNLGFSHPVRMAVPEGLQVKVEENTRIIVSGYDKSEIGQFAATIK  195

Query  179  KWRPPEPYKGKGVKYADEVIRR  114
            KWRPPEPYKGKG++Y DE++RR
Sbjct  196  KWRPPEPYKGKGIRYQDEIVRR  217



>ref|XP_004984341.1| PREDICTED: 50S ribosomal protein L6, chloroplastic-like [Setaria 
italica]
Length=226

 Score =   310 bits (795),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 149/202 (74%), Positives = 172/202 (85%), Gaps = 0/202 (0%)
 Frame = -1

Query  719  SNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPL  540
            + F+G   GIR   +   R  FVR  VECKESRIGK+PI VPSNVT+ +E Q  K KGPL
Sbjct  16   TGFLGKTQGIRPRVIPAGRVGFVRTVVECKESRIGKKPIDVPSNVTLTLEEQFVKAKGPL  75

Query  539  GELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQL  360
            GEL ++YP EVK+ KEESG LR+ K  ET+RAN+MHGLFRTLTDN+I+GVSKGFDKKLQL
Sbjct  76   GELSLSYPGEVKVVKEESGKLRLYKTAETKRANQMHGLFRTLTDNIIIGVSKGFDKKLQL  135

Query  359  VGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIR  180
            VGVGYRA VEG D+V+NLGFSHPVRMA+P+GLQVKVEENTRI VSGYDKSAIGQFAA+I+
Sbjct  136  VGVGYRAAVEGNDLVMNLGFSHPVRMAVPEGLQVKVEENTRIIVSGYDKSAIGQFAATIK  195

Query  179  KWRPPEPYKGKGVKYADEVIRR  114
            KWRPPEPYKGKG++YADEV+RR
Sbjct  196  KWRPPEPYKGKGIRYADEVVRR  217



>gb|KDO41664.1| hypothetical protein CISIN_1g027306mg [Citrus sinensis]
Length=199

 Score =   310 bits (793),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 149/186 (80%), Positives = 168/186 (90%), Gaps = 1/186 (1%)
 Frame = -1

Query  671  IARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKE  492
            + R  F RKT+ECKESRIGKQPI VPSNVTI + GQD KVKGPLGEL + YPREVK+++E
Sbjct  6    VNRVGFSRKTIECKESRIGKQPIEVPSNVTITLGGQDLKVKGPLGELSLVYPREVKVDRE  65

Query  491  ESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVL  312
            +S  LRVRK +ETRRAN+MHGLFRTLTDNM+VGVSKGF+KKLQ+VGVGYRA +EG+ +VL
Sbjct  66   DS-FLRVRKTVETRRANQMHGLFRTLTDNMVVGVSKGFEKKLQMVGVGYRAALEGQVLVL  124

Query  311  NLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYA  132
            +LGFSHPVRM IPDG++V VEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKY 
Sbjct  125  SLGFSHPVRMTIPDGIKVNVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYV  184

Query  131  DEVIRR  114
            DEVIRR
Sbjct  185  DEVIRR  190



>gb|EPS61113.1| hypothetical protein M569_13685, partial [Genlisea aurea]
Length=208

 Score =   308 bits (789),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 142/180 (79%), Positives = 168/180 (93%), Gaps = 0/180 (0%)
 Frame = -1

Query  653  VRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLR  474
            VRK  ECKESRIGKQPI VPS V++ +EGQD KVKGPLGEL ITYPRE+++ +EESGVL+
Sbjct  20   VRKITECKESRIGKQPITVPSTVSLTLEGQDLKVKGPLGELAITYPREIQVLEEESGVLK  79

Query  473  VRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSH  294
            VRKA+++RRAN+MHGLFRTLTDNM+VGVS+GF+K+LQLVG GYRA VEG ++VL+LGFSH
Sbjct  80   VRKALDSRRANQMHGLFRTLTDNMVVGVSRGFEKRLQLVGTGYRAAVEGGEVVLSLGFSH  139

Query  293  PVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            PVRM+IP G++VKVEENTRITVSG+DKSA+GQFAASIRKWRPPEPYKGKGVKYADEV++R
Sbjct  140  PVRMSIPSGIRVKVEENTRITVSGFDKSAVGQFAASIRKWRPPEPYKGKGVKYADEVVKR  199



>gb|EMT33559.1| 50S ribosomal protein L6, chloroplastic [Aegilops tauschii]
Length=279

 Score =   310 bits (793),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 147/202 (73%), Positives = 173/202 (86%), Gaps = 0/202 (0%)
 Frame = -1

Query  719  SNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPL  540
            + F+G + GI    +   R  F+RKTVECKESRIGK+PI VPSNVT+ +E Q  K KGPL
Sbjct  69   TGFLGKSQGILLRVIPAGRVGFIRKTVECKESRIGKKPIEVPSNVTLTLEEQFVKAKGPL  128

Query  539  GELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQL  360
            GEL + YP EVK+ KEE+G LRV K +ET+RAN+MHGLFRTLTDN+IVGVSKGFDK+LQL
Sbjct  129  GELSLNYPTEVKVVKEETGKLRVFKTVETKRANQMHGLFRTLTDNIIVGVSKGFDKRLQL  188

Query  359  VGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIR  180
            VGVGYRA VEGKD+V+NLGFSHPVRMA+P+GLQVKVEENTRI VSGYDKS IGQFAA+I+
Sbjct  189  VGVGYRATVEGKDLVMNLGFSHPVRMAVPEGLQVKVEENTRIIVSGYDKSEIGQFAATIK  248

Query  179  KWRPPEPYKGKGVKYADEVIRR  114
            KWRPPEPYKGKG++Y DE++RR
Sbjct  249  KWRPPEPYKGKGIRYQDEIVRR  270



>ref|NP_001148555.1| 50S ribosomal protein L6 [Zea mays]
 gb|ACG32024.1| 50S ribosomal protein L6 [Zea mays]
 gb|ACN30855.1| unknown [Zea mays]
 gb|AFW88352.1| 50S ribosomal protein L6 [Zea mays]
Length=226

 Score =   306 bits (784),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 148/202 (73%), Positives = 169/202 (84%), Gaps = 0/202 (0%)
 Frame = -1

Query  719  SNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPL  540
            + F+G   GIR       R  FVR  VECKESRIGKQPI VPSNVT+ +E Q  K KGPL
Sbjct  16   TGFLGKTRGIRPCVFPAGRVGFVRTVVECKESRIGKQPIEVPSNVTLTLEEQFVKAKGPL  75

Query  539  GELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQL  360
            GEL +++P ++K+ KEESG LRV K  ET+RAN+MHGLFRTLTDN+IVGVSKGFDKKLQL
Sbjct  76   GELSLSFPGDLKIVKEESGNLRVYKTAETKRANQMHGLFRTLTDNIIVGVSKGFDKKLQL  135

Query  359  VGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIR  180
            VGVGYRA VEG D+V+NLGFSHPVRMAIP+GL VKVEENTRI VSGYDKSAIGQFAA+I+
Sbjct  136  VGVGYRAAVEGNDLVMNLGFSHPVRMAIPEGLAVKVEENTRIIVSGYDKSAIGQFAATIK  195

Query  179  KWRPPEPYKGKGVKYADEVIRR  114
            KWRPPEPYKGKG++Y DEV+RR
Sbjct  196  KWRPPEPYKGKGIRYMDEVVRR  217



>ref|NP_001152325.1| 50S ribosomal protein L6 [Zea mays]
 gb|ACG47033.1| 50S ribosomal protein L6 [Zea mays]
 tpg|DAA45424.1| TPA: 50S ribosomal protein L6 [Zea mays]
Length=226

 Score =   306 bits (784),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 148/202 (73%), Positives = 169/202 (84%), Gaps = 0/202 (0%)
 Frame = -1

Query  719  SNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPL  540
            + F+G   G R    +  R  FVR  VECKESRIGKQPI VP NVT+ +E Q  K KGPL
Sbjct  16   TGFLGKTHGTRPRLFSAGRVGFVRTLVECKESRIGKQPIEVPPNVTLTLEEQFVKAKGPL  75

Query  539  GELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQL  360
            GEL +++P +VK+ KEESG LRV K  ET+RAN+MHGLFRTLTDN+IVGVSKGFDKKLQL
Sbjct  76   GELSLSFPGDVKIVKEESGNLRVYKTAETKRANQMHGLFRTLTDNIIVGVSKGFDKKLQL  135

Query  359  VGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIR  180
            VGVGYRA VEG D+V+NLGFSHPVRMAIP+GL VKVEENTRITVSGYDKSAIGQFAA+I+
Sbjct  136  VGVGYRAAVEGNDLVMNLGFSHPVRMAIPEGLAVKVEENTRITVSGYDKSAIGQFAATIK  195

Query  179  KWRPPEPYKGKGVKYADEVIRR  114
            KWRPPEPYKGKG++Y DEV+RR
Sbjct  196  KWRPPEPYKGKGIRYMDEVVRR  217



>gb|EMS56589.1| 50S ribosomal protein L6, chloroplastic [Triticum urartu]
Length=280

 Score =   308 bits (789),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 147/200 (74%), Positives = 172/200 (86%), Gaps = 0/200 (0%)
 Frame = -1

Query  713  FIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPLGE  534
            F+G + GI    +   R  F+RKTVECKESRIGK+PI VPSNVT+ +E Q  K KGPLGE
Sbjct  72   FLGKSQGILLRVIPAGRVGFIRKTVECKESRIGKKPIEVPSNVTLTLEEQFVKAKGPLGE  131

Query  533  LGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQLVG  354
            L + YP EVK+ KEE+G LRV K +ET+RAN+MHGLFRTLTDN+IVGVSKGFDK+LQLVG
Sbjct  132  LTLNYPAEVKVVKEETGKLRVFKTVETKRANQMHGLFRTLTDNIIVGVSKGFDKRLQLVG  191

Query  353  VGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIRKW  174
            VGYRA VEGKD+V+NLGFSHPVRMA+P+GLQVKVEENTRI VSGYDKS IGQFAA+I+KW
Sbjct  192  VGYRATVEGKDLVMNLGFSHPVRMAVPEGLQVKVEENTRIIVSGYDKSEIGQFAATIKKW  251

Query  173  RPPEPYKGKGVKYADEVIRR  114
            RPPEPYKGKG++Y DE++RR
Sbjct  252  RPPEPYKGKGIRYQDEIVRR  271



>emb|CDP19076.1| unnamed protein product [Coffea canephora]
Length=226

 Score =   306 bits (783),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 144/179 (80%), Positives = 166/179 (93%), Gaps = 1/179 (1%)
 Frame = -1

Query  650  RKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRV  471
            R  VECKESRIGKQ I VPSNVT+ ++GQD KVKGPLGEL +TYP+E+ L++++SG LRV
Sbjct  40   RTIVECKESRIGKQLIEVPSNVTLTIDGQDLKVKGPLGELALTYPKEILLQRDDSG-LRV  98

Query  470  RKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHP  291
            RK++ETRRAN+MHGLFRTLTDNM+VGVSKGF+K+LQLVGVGYRA +EGKDIVL+LGFSHP
Sbjct  99   RKSIETRRANQMHGLFRTLTDNMVVGVSKGFEKRLQLVGVGYRATIEGKDIVLSLGFSHP  158

Query  290  VRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            VRM IPDGLQVKVE+NTR+ V G+DKSAIGQFAASIRKWRPPEPYKGKGVKYADE+IRR
Sbjct  159  VRMTIPDGLQVKVEDNTRVIVGGFDKSAIGQFAASIRKWRPPEPYKGKGVKYADEIIRR  217



>ref|XP_008680805.1| PREDICTED: 50S ribosomal protein L6 isoform X1 [Zea mays]
Length=245

 Score =   295 bits (755),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 148/221 (67%), Positives = 169/221 (76%), Gaps = 19/221 (9%)
 Frame = -1

Query  719  SNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPL  540
            + F+G   G R    +  R  FVR  VECKESRIGKQPI VP NVT+ +E Q  K KGPL
Sbjct  16   TGFLGKTHGTRPRLFSAGRVGFVRTLVECKESRIGKQPIEVPPNVTLTLEEQFVKAKGPL  75

Query  539  GELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFR-------------------T  417
            GEL +++P +VK+ KEESG LRV K  ET+RAN+MHGLFR                   T
Sbjct  76   GELSLSFPGDVKIVKEESGNLRVYKTAETKRANQMHGLFRSSKQKHLRQGHMQAGTTRRT  135

Query  416  LTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTR  237
            LTDN+IVGVSKGFDKKLQLVGVGYRA VEG D+V+NLGFSHPVRMAIP+GL VKVEENTR
Sbjct  136  LTDNIIVGVSKGFDKKLQLVGVGYRAAVEGNDLVMNLGFSHPVRMAIPEGLAVKVEENTR  195

Query  236  ITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            ITVSGYDKSAIGQFAA+I+KWRPPEPYKGKG++Y DEV+RR
Sbjct  196  ITVSGYDKSAIGQFAATIKKWRPPEPYKGKGIRYMDEVVRR  236



>ref|XP_006858065.1| hypothetical protein AMTR_s00062p00057610 [Amborella trichopoda]
 gb|ERN19532.1| hypothetical protein AMTR_s00062p00057610 [Amborella trichopoda]
Length=225

 Score =   294 bits (753),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 140/202 (69%), Positives = 167/202 (83%), Gaps = 0/202 (0%)
 Frame = -1

Query  719  SNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPL  540
            S F G+ +G       +    F RK VECKESR+GK PI VPS+VTI ++GQD KVKGPL
Sbjct  15   SKFWGEKNGRVHTSSPVIGIGFFRKNVECKESRVGKHPIEVPSSVTITLDGQDLKVKGPL  74

Query  539  GELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQL  360
            GEL  TYPREVK+E+ +   L+V KA++TRRAN+MHGLFRTLTDNM+VGVSKGF+K+LQL
Sbjct  75   GELSRTYPREVKVERLDPTTLKVSKALDTRRANQMHGLFRTLTDNMVVGVSKGFEKRLQL  134

Query  359  VGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIR  180
            +GVGYRA +EG D+VLNLGFSHPVRM IP  ++VKVE+NTRI VSG+DK A+G F+ASIR
Sbjct  135  IGVGYRATLEGNDLVLNLGFSHPVRMPIPKEIKVKVEDNTRIAVSGFDKCAVGDFSASIR  194

Query  179  KWRPPEPYKGKGVKYADEVIRR  114
            KWRPPEPYKGKGVKYADEV+RR
Sbjct  195  KWRPPEPYKGKGVKYADEVVRR  216



>gb|ABK21300.1| unknown [Picea sitchensis]
 gb|ABK26219.1| unknown [Picea sitchensis]
Length=231

 Score =   289 bits (740),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 136/206 (66%), Positives = 169/206 (82%), Gaps = 4/206 (2%)
 Frame = -1

Query  719  SNFIGDASGIRFFK----LTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKV  552
            S  +G+ +G++  +    + I +   VR T+ECKESRIGK+P+ VP+NV I +EGQ  +V
Sbjct  17   STLLGEDNGLKAARDRPAIAIVKLPSVRPTIECKESRIGKKPVVVPANVNITLEGQHIRV  76

Query  551  KGPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDK  372
             G LGEL  TYP E+K+E++ SG +++ KA+ETRRAN+MHGLFRTLTDNM+VGVSKGF+K
Sbjct  77   NGLLGELSQTYPNEIKVERDPSGFIKISKAVETRRANQMHGLFRTLTDNMVVGVSKGFEK  136

Query  371  KLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFA  192
            KLQLVGVGYRA VEG D+V+NLGFSHPVR+A+P G++V VE NT ITVSG DKS +GQFA
Sbjct  137  KLQLVGVGYRAAVEGSDLVMNLGFSHPVRLAVPAGIKVTVEANTSITVSGRDKSVVGQFA  196

Query  191  ASIRKWRPPEPYKGKGVKYADEVIRR  114
            A IRKWRPPEPYKGKG+KYADEVIRR
Sbjct  197  ADIRKWRPPEPYKGKGIKYADEVIRR  222



>ref|XP_008802994.1| PREDICTED: 50S ribosomal protein L6, chloroplastic [Phoenix dactylifera]
Length=175

 Score =   285 bits (730),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 135/165 (82%), Positives = 153/165 (93%), Gaps = 0/165 (0%)
 Frame = -1

Query  608  PIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHG  429
            PI VP NVTI ++GQD KVKG LGEL  TYPREVK+E+ ESG LRV KA++TRRAN+MHG
Sbjct  2    PIEVPPNVTIALDGQDLKVKGRLGELSRTYPREVKIERLESGTLRVFKALDTRRANQMHG  61

Query  428  LFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVE  249
            LFRTLTDNM+VGVSKGF+K+LQLVGVGYRAM+EG+D+VLNLGFSHPVRMAIP+GLQVKVE
Sbjct  62   LFRTLTDNMVVGVSKGFEKRLQLVGVGYRAMLEGRDLVLNLGFSHPVRMAIPEGLQVKVE  121

Query  248  ENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +NTRI VSGYDK AIG+FAASIRKWRPPEPYKGKGV+YADEV+RR
Sbjct  122  DNTRIAVSGYDKCAIGEFAASIRKWRPPEPYKGKGVRYADEVVRR  166



>gb|KEH16126.1| 50S ribosomal protein L6 [Medicago truncatula]
Length=163

 Score =   268 bits (685),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = -1

Query  575  MEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIV  396
            MEGQ F  KGPLGEL +TYPREVK+E++E GVL+V KA+ETRRAN+MHGLFRTLTDN++V
Sbjct  1    MEGQYFHAKGPLGELSLTYPREVKVERQEEGVLKVSKAVETRRANQMHGLFRTLTDNIVV  60

Query  395  GVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYD  216
            GVSKGF+KKLQL+GVGYRA VEG ++VLNLGFSHPV+M IP+GL+VKV+ENTRITVSGYD
Sbjct  61   GVSKGFEKKLQLIGVGYRATVEGNEVVLNLGFSHPVKMTIPEGLKVKVDENTRITVSGYD  120

Query  215  KSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            KS IGQFAASIRKWRPPEPYKGKG+KY DEV+RR
Sbjct  121  KSEIGQFAASIRKWRPPEPYKGKGIKYEDEVVRR  154



>ref|XP_002977678.1| hypothetical protein SELMODRAFT_107348, partial [Selaginella 
moellendorffii]
 gb|EFJ21016.1| hypothetical protein SELMODRAFT_107348, partial [Selaginella 
moellendorffii]
Length=212

 Score =   268 bits (684),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 130/202 (64%), Positives = 160/202 (79%), Gaps = 0/202 (0%)
 Frame = -1

Query  719  SNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPL  540
            SNF G+  G      + + +  +   V CKESRIGK+P+ VP +V + ++G +  VKGPL
Sbjct  2    SNFSGETLGTSICSSSSSASGNLPLRVICKESRIGKRPVEVPKSVNVVLQGPNLSVKGPL  61

Query  539  GELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQL  360
            GEL   YPREV L ++ESG + V +A+ETRRA +MHGLFRTLTDNM+VGVS+GF+KKLQ+
Sbjct  62   GELTRYYPREVSLTRDESGRIVVTRALETRRARQMHGLFRTLTDNMVVGVSQGFEKKLQM  121

Query  359  VGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIR  180
            VGVGYRA VE  +I+LN+GFSHPV++ IPDG+ VKVEENTRITVSG DK A+GQFAA IR
Sbjct  122  VGVGYRATVEPTEIILNVGFSHPVKIKIPDGISVKVEENTRITVSGRDKCAVGQFAAIIR  181

Query  179  KWRPPEPYKGKGVKYADEVIRR  114
             WRPPEPYKGKG+KYADEVIRR
Sbjct  182  SWRPPEPYKGKGIKYADEVIRR  203



>ref|XP_002979598.1| hypothetical protein SELMODRAFT_110948 [Selaginella moellendorffii]
 gb|EFJ19487.1| hypothetical protein SELMODRAFT_110948 [Selaginella moellendorffii]
Length=220

 Score =   267 bits (683),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 130/202 (64%), Positives = 160/202 (79%), Gaps = 0/202 (0%)
 Frame = -1

Query  719  SNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPL  540
            SNF G+  G      + + +  +   V CKESRIGK+P+ VP +V + ++G +  VKGPL
Sbjct  10   SNFSGETLGASICSSSSSASGNLPLRVICKESRIGKRPVEVPKSVNVVLQGPNLSVKGPL  69

Query  539  GELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQL  360
            GEL   YPREV L ++ESG + V +A+ETRRA +MHGLFRTLTDNM+VGVS+GF+KKLQ+
Sbjct  70   GELTRYYPREVSLTRDESGRIVVTRALETRRARQMHGLFRTLTDNMVVGVSQGFEKKLQM  129

Query  359  VGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIR  180
            VGVGYRA VE  +I+LN+GFSHPV++ IPDG+ VKVEENTRITVSG DK A+GQFAA IR
Sbjct  130  VGVGYRATVEPTEIILNVGFSHPVKIKIPDGISVKVEENTRITVSGRDKCAVGQFAAIIR  189

Query  179  KWRPPEPYKGKGVKYADEVIRR  114
             WRPPEPYKGKG+KYADEVIRR
Sbjct  190  SWRPPEPYKGKGIKYADEVIRR  211



>ref|XP_001771522.1| predicted protein [Physcomitrella patens]
 gb|EDQ63722.1| predicted protein [Physcomitrella patens]
Length=230

 Score =   257 bits (656),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 120/176 (68%), Positives = 145/176 (82%), Gaps = 1/176 (1%)
 Frame = -1

Query  641  VECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKA  462
            ++ KESRIGK PIPVP  VTI +EGQ   VKGPLGEL  TYPREVKL      VL V +A
Sbjct  47   IKAKESRIGKAPIPVPKGVTINLEGQSLTVKGPLGELARTYPREVKLT-NAGDVLTVERA  105

Query  461  METRRANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRM  282
            +E+RRA +MHGLFRTLTDNM++GVSKGF+K+LQL+GVGYRA VE  ++ LNLGFSH VRM
Sbjct  106  VESRRARQMHGLFRTLTDNMVIGVSKGFEKRLQLIGVGYRAAVEKDELALNLGFSHQVRM  165

Query  281  AIPDGLQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
             IP+ + VKVEENTR+ +SG DK ++G F+A++RKWRPPEPYKGKG+KY+DEVIRR
Sbjct  166  KIPEDITVKVEENTRVLISGKDKCSVGDFSAAVRKWRPPEPYKGKGIKYSDEVIRR  221



>ref|XP_001784938.1| predicted protein [Physcomitrella patens]
 gb|EDQ50246.1| predicted protein [Physcomitrella patens]
Length=229

 Score =   256 bits (654),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 122/177 (69%), Positives = 147/177 (83%), Gaps = 3/177 (2%)
 Frame = -1

Query  641  VECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESG-VLRVRK  465
            +E KESRIGK PIPVP  VT+ ++GQ+  VKG LGEL  TYPREVKL    SG VL V +
Sbjct  46   IEAKESRIGKAPIPVPKGVTVNLDGQNLSVKGALGELVRTYPREVKLT--NSGEVLLVER  103

Query  464  AMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVR  285
            A+E+RRA +MHGLFRTLTDNM++GVSKGF+K+LQL+GVGYRA VE  ++ LNLGFSH VR
Sbjct  104  AVESRRARQMHGLFRTLTDNMVIGVSKGFEKRLQLIGVGYRAAVEKDELALNLGFSHQVR  163

Query  284  MAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            M IP+ + VKVEENTR+ VSG DK A+G F+A++RKWRPPEPYKGKG+KY+DEVIRR
Sbjct  164  MKIPEAITVKVEENTRVIVSGKDKCAVGDFSAAVRKWRPPEPYKGKGIKYSDEVIRR  220



>ref|XP_006376781.1| hypothetical protein POPTR_0012s06340g, partial [Populus trichocarpa]
 ref|XP_006376782.1| hypothetical protein POPTR_0012s06350g, partial [Populus trichocarpa]
 gb|ERP54578.1| hypothetical protein POPTR_0012s06340g, partial [Populus trichocarpa]
 gb|ERP54579.1| hypothetical protein POPTR_0012s06350g, partial [Populus trichocarpa]
Length=205

 Score =   251 bits (640),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 124/201 (62%), Positives = 156/201 (78%), Gaps = 9/201 (4%)
 Frame = -1

Query  719  SNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPL  540
            S F+ + SGI    + + R  F R+ +ECKES IGKQP+ VP NVTI +EGQ+ KVKG L
Sbjct  4    SVFLDERSGICAPSVPVTRVGFSREIIECKESWIGKQPVQVPFNVTITLEGQNLKVKGLL  63

Query  539  GELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQL  360
            G L   YP+EVK+E++E+G+L+V+KA++TR AN+MHGLFRTLT+NM+VGVS  F+K    
Sbjct  64   GGLSRNYPQEVKIERDENGILQVKKAVDTRIANQMHGLFRTLTNNMVVGVSNDFEK----  119

Query  359  VGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIR  180
                 R   +GKD+VL+LGFSHPVRM  P  LQVKVEENTRI VSG DK +IG+FAASIR
Sbjct  120  -----RPSTKGKDLVLSLGFSHPVRMTTPGDLQVKVEENTRIAVSGNDKCSIGEFAASIR  174

Query  179  KWRPPEPYKGKGVKYADEVIR  117
            +WRPPEPY+GKGV+YA+EVIR
Sbjct  175  RWRPPEPYEGKGVRYANEVIR  195



>ref|XP_006376783.1| hypothetical protein POPTR_0012s06360g, partial [Populus trichocarpa]
 gb|ERP54580.1| hypothetical protein POPTR_0012s06360g, partial [Populus trichocarpa]
Length=171

 Score =   234 bits (598),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 115/175 (66%), Positives = 140/175 (80%), Gaps = 16/175 (9%)
 Frame = -1

Query  641  VECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKA  462
            +ECKES IGKQP+ VP NVTI +EGQ+ KVKG LG L   YP+EVK+E++E+G+L+V+KA
Sbjct  3    IECKESWIGKQPVQVPFNVTITLEGQNLKVKGLLGGLSRNYPQEVKIERDENGILQVKKA  62

Query  461  METRRANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRM  282
            ++TR AN+MHGLFR L                QLVGVGYRA +EGKD+VL+LGFSHPVRM
Sbjct  63   VDTRIANQMHGLFRDL----------------QLVGVGYRANIEGKDLVLSLGFSHPVRM  106

Query  281  AIPDGLQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIR  117
            + P  LQVKVEENTRI VSG DK +IG+FAASIR+WRPPEPY+GKGV+YA+EVIR
Sbjct  107  STPGDLQVKVEENTRIAVSGNDKCSIGEFAASIRRWRPPEPYEGKGVRYANEVIR  161



>emb|CDY41816.1| BnaC02g12270D [Brassica napus]
Length=208

 Score =   231 bits (589),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 129/152 (85%), Gaps = 0/152 (0%)
 Frame = -1

Query  569  GQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGV  390
             QD KVKGPLGEL +TYP EV+L +E+SG LRVRK +ETRRA EMHGLFRTLTDNM+VGV
Sbjct  48   SQDLKVKGPLGELALTYPPEVELTEEDSGFLRVRKTVETRRAKEMHGLFRTLTDNMVVGV  107

Query  389  SKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKS  210
            SKGF+K L+L GVGYRAMV+GK++VLNLGFSHPV++ IPD L+VKV++   I VSGYDK 
Sbjct  108  SKGFEKTLELKGVGYRAMVQGKELVLNLGFSHPVKIEIPDSLKVKVDKKIIIFVSGYDKC  167

Query  209  AIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
             IGQFAA++RKWRP EPYK  GV Y+DE++ R
Sbjct  168  EIGQFAATVRKWRPAEPYKRIGVCYSDEIVHR  199



>ref|XP_005849229.1| hypothetical protein CHLNCDRAFT_34831 [Chlorella variabilis]
 gb|EFN57127.1| hypothetical protein CHLNCDRAFT_34831 [Chlorella variabilis]
Length=209

 Score =   223 bits (568),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 110/189 (58%), Positives = 137/189 (72%), Gaps = 1/189 (1%)
 Frame = -1

Query  680  KLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKL  501
            + T AR    +  V  K+SRIGK P+PVP  V++ ++GQ  KVKGP GEL  T+   VK 
Sbjct  15   QATTARQQRQQLNVVAKDSRIGKVPVPVPDKVSVTLDGQTVKVKGPRGELQRTFHPAVKF  74

Query  500  EKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKD  321
            E+EE  + RV +A ETR AN+ HGL R+L  NM+VGV  GF  KLQ++GVGYRA V G +
Sbjct  75   EQEEKAI-RVVRANETRTANQQHGLARSLLSNMVVGVDTGFTTKLQMIGVGYRAAVAGNN  133

Query  320  IVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGV  141
            + LNLG+SHPV MAIP GL VKVE+NT I VSG+DK  +GQF+A+IR  R PEPYKGKGV
Sbjct  134  LTLNLGYSHPVEMAIPSGLAVKVEKNTNIEVSGFDKELVGQFSANIRSKREPEPYKGKGV  193

Query  140  KYADEVIRR  114
            +YADEV+ R
Sbjct  194  RYADEVVLR  202



>ref|XP_011399322.1| 50S ribosomal protein L6, chloroplastic [Auxenochlorella protothecoides]
 gb|KFM22401.1| 50S ribosomal protein L6, chloroplastic [Auxenochlorella protothecoides]
Length=210

 Score =   213 bits (541),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 101/191 (53%), Positives = 135/191 (71%), Gaps = 1/191 (1%)
 Frame = -1

Query  683  FKLTIARNNF-VRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREV  507
            FK  + R    + + ++CKESRIG + IPVP  V +K++G +F VKGP GEL  T    V
Sbjct  13   FKTNVGRPRVSISRLIQCKESRIGVKAIPVPKGVDVKLDGHNFVVKGPKGELARTLSTLV  72

Query  506  KLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEG  327
             + +EE+G +R+ + +ETR A   HGL R L +NM+VGVS GF + L LVGVGYRA V G
Sbjct  73   TVSREENGDIRLVRNVETREAGAQHGLARALLNNMVVGVSTGFTRTLMLVGVGYRAAVSG  132

Query  326  KDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGK  147
              + LNLG+S PV +AIP G++V V +NT + + GYDK  +GQFAA+IR  RPPEPYKGK
Sbjct  133  TKLTLNLGYSKPVELAIPGGVEVSVVKNTTVNIHGYDKEVVGQFAATIRAKRPPEPYKGK  192

Query  146  GVKYADEVIRR  114
            GV+Y+DE++RR
Sbjct  193  GVRYSDEIVRR  203



>gb|KIZ02220.1| 50S ribosomal protein L6 [Monoraphidium neglectum]
Length=200

 Score =   203 bits (517),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 131/175 (75%), Gaps = 1/175 (1%)
 Frame = -1

Query  641  VECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKA  462
            V CKESRIG +PIPVP  VT+ ++G   KVKGP GEL +T    V +E+ E G L +++A
Sbjct  18   VVCKESRIGSKPIPVPKGVTVDLKGSHLKVKGPKGELELTLTPYVTIEQTE-GKLLLKRA  76

Query  461  METRRANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRM  282
             ET++A  MHGL RTL  N++VGVS+GF+KKL+LVG GYRA + G+++ LNLG+S P  +
Sbjct  77   EETKKAAAMHGLSRTLASNIVVGVSEGFEKKLELVGTGYRAAISGQELTLNLGYSKPRIL  136

Query  281  AIPDGLQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIR  117
             +PDG++V VE+ T I +SG DK A+G F A +R+ RPPEPYKGKGV+Y+ EVI+
Sbjct  137  TVPDGIKVTVEKTTAIFISGADKVAVGDFCALVRRQRPPEPYKGKGVRYSGEVIK  191



>ref|XP_005643355.1| ribosomal protein L6 [Coccomyxa subellipsoidea C-169]
 gb|EIE18811.1| ribosomal protein L6 [Coccomyxa subellipsoidea C-169]
Length=222

 Score =   200 bits (509),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 104/210 (50%), Positives = 135/210 (64%), Gaps = 9/210 (4%)
 Frame = -1

Query  719  SNFIGDASGIRFFKLTIARNNFVRKTVEC--------KESRIGKQPIPVPSNVTIKMEGQ  564
            S F G     +F + T A    V+   +         KESRIGK PIP+P  V + +   
Sbjct  7    SQFAGSRLLRQFSQRTAASRVLVQTRCQAPPRGTEFGKESRIGKAPIPIPKGVQLTLTRD  66

Query  563  DFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSK  384
              KVKGP GEL +  P  V++E++E+  LRV K  E+R+ANE+HGL R L +NM+VG S 
Sbjct  67   LLKVKGPKGELELAIPEIVEIEQQENA-LRVYKMEESRKANEVHGLIRALANNMVVGTST  125

Query  383  GFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAI  204
            G+ K L LVGVGYRA V G  +VLNLG+SHP+ M  P G+ V VE+ T + +SGYDK  +
Sbjct  126  GWIKTLSLVGVGYRASVSGTKLVLNLGYSHPIEMDFPKGVTVAVEKQTTVVISGYDKEQV  185

Query  203  GQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            GQFAA +R  RPPEPYK KGV+Y DEV+R+
Sbjct  186  GQFAAKVRAKRPPEPYKQKGVRYFDEVVRK  215



>gb|ACN31842.1| unknown [Zea mays]
 tpg|DAA45422.1| TPA: hypothetical protein ZEAMMB73_235465 [Zea mays]
Length=119

 Score =   194 bits (493),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 90/103 (87%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = -1

Query  422  RTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEEN  243
            RTLTDN+IVGVSKGFDKKLQLVGVGYRA VEG D+V+NLGFSHPVRMAIP+GL VKVEEN
Sbjct  8    RTLTDNIIVGVSKGFDKKLQLVGVGYRAAVEGNDLVMNLGFSHPVRMAIPEGLAVKVEEN  67

Query  242  TRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            TRITVSGYDKSAIGQFAA+I+KWRPPEPYKGKG++Y DEV+RR
Sbjct  68   TRITVSGYDKSAIGQFAATIKKWRPPEPYKGKGIRYMDEVVRR  110



>ref|XP_001421323.1| Plastid ribosomal protein L6 large ribosomal subunit [Ostreococcus 
lucimarinus CCE9901]
 gb|ABO99616.1| Plastid ribosomal protein L6 large ribosomal subunit [Ostreococcus 
lucimarinus CCE9901]
Length=213

 Score =   197 bits (501),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 94/178 (53%), Positives = 129/178 (72%), Gaps = 1/178 (1%)
 Frame = -1

Query  653  VRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLR  474
            VR T+E KESRIGKQP+ VP  VT  ++     VKGP G L +++P +  +  EE   ++
Sbjct  28   VRATIEAKESRIGKQPVAVPKGVTYTLKDNHLAVKGPKGSLEMSFP-DTMVFTEEGDSIK  86

Query  473  VRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSH  294
            + +A +T  A + HGL+RTL +NM+VGVS GF+KKL+L+GVGY+A ++GKD+ L LG+SH
Sbjct  87   ISRANDTPDARKGHGLYRTLANNMMVGVSTGFEKKLKLLGVGYKASMQGKDLNLALGYSH  146

Query  293  PVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVI  120
            PV M +P+G+QV    NT + VSGYDK  +G FAA IR  RPPEPYKGKG++Y +EV+
Sbjct  147  PVIMKLPEGVQVTCPSNTEVVVSGYDKVEVGNFAAIIRSKRPPEPYKGKGIRYENEVV  204



>ref|WP_015170862.1| 50S ribosomal protein L6 [Geitlerinema sp. PCC 7407]
 gb|AFY65294.1| LSU ribosomal protein L6P [Geitlerinema sp. PCC 7407]
Length=179

 Score =   195 bits (496),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 93/171 (54%), Positives = 127/171 (74%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+PI +P+ VT+ + GQ   VKGP GEL  T+P  V  E++   +L V++  E+R 
Sbjct  2    SRIGKRPISIPAKVTVSISGQSITVKGPKGELSRTFPAGVVFEQDGETIL-VKRRDESRV  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A E HGL RTL  NM+ GVS+GF K+L++ GVGYRA V+G++++LN+G+SH V +  P+G
Sbjct  61   ARERHGLCRTLLSNMVEGVSQGFQKRLEIQGVGYRAQVQGRNLILNVGYSHQVNIEPPEG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +Q+ VE NT + VSG+DK A+G  AASIR  RPPEPYKGKG++YA EV+RR
Sbjct  121  VQLAVENNTNVIVSGFDKEAVGNIAASIRAVRPPEPYKGKGIRYAGEVVRR  171



>gb|AAP68351.1| putative ribosomal protein CtrL6e, 5'-partial [Oryza sativa Japonica 
Group]
Length=111

 Score =   192 bits (487),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 89/102 (87%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = -1

Query  419  TLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENT  240
            TLTDN+IVGVSKGFDKKLQLVGVGYRA VEGKD+V+NLGFSHPVRMA+P+GL+VKVEENT
Sbjct  1    TLTDNIIVGVSKGFDKKLQLVGVGYRAAVEGKDLVMNLGFSHPVRMAVPEGLKVKVEENT  60

Query  239  RITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            RI VSGYDKS IGQFAASI+KWRPPEPYKGKG++YADEV+RR
Sbjct  61   RIIVSGYDKSEIGQFAASIKKWRPPEPYKGKGIRYADEVVRR  102



>ref|XP_002505297.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO66555.1| predicted protein [Micromonas sp. RCC299]
Length=220

 Score =   195 bits (495),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 99/176 (56%), Positives = 129/176 (73%), Gaps = 2/176 (1%)
 Frame = -1

Query  644  TVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRK  465
             V  K+SRIGKQP+PVP  VT  ++     VKGP GEL + +P  + L + ++ +   R 
Sbjct  38   AVVAKQSRIGKQPVPVPKGVTYTLKDNHLSVKGPKGELQMQFPETMVLTEGDNEIAFAR-  96

Query  464  AMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEG-KDIVLNLGFSHPV  288
            A ++RRA E HGL+RTL +NM+VGVS GF+KKL+LVGVGY+A +EG K I L+LG++H V
Sbjct  97   ADDSRRAREGHGLYRTLANNMMVGVSTGFEKKLKLVGVGYKAAMEGSKAINLSLGYAHQV  156

Query  287  RMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVI  120
             + IP+GLQVK + NT ITVSGYDK  +G FAA +R  R PEPYKGKGV+YADEV+
Sbjct  157  IVEIPEGLQVKCDSNTEITVSGYDKVEVGNFAAILRSKRKPEPYKGKGVRYADEVV  212



>ref|XP_009763796.1| PREDICTED: 50S ribosomal protein L6, chloroplastic [Nicotiana 
sylvestris]
Length=106

 Score =   191 bits (485),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 91/97 (94%), Positives = 95/97 (98%), Gaps = 0/97 (0%)
 Frame = -1

Query  404  MIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVS  225
            M+VGVSKGF+KKLQLVGVGYRA +EGKDIVLNLGFSHPVRM IPDGLQVKVEENTRITVS
Sbjct  1    MVVGVSKGFEKKLQLVGVGYRATIEGKDIVLNLGFSHPVRMEIPDGLQVKVEENTRITVS  60

Query  224  GYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            GYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEV+RR
Sbjct  61   GYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVVRR  97



>ref|WP_036002394.1| 50S ribosomal protein L6 [Leptolyngbya sp. JSC-1]
Length=179

 Score =   193 bits (491),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 94/171 (55%), Positives = 125/171 (73%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+PIPVP NVT+ +  Q   VKGP GEL  T P EV++ +E   +L V +  ++R 
Sbjct  2    SRIGKRPIPVPKNVTVTIANQHVAVKGPKGELARTLPDEVEVVQEGETIL-VNRRNDSRV  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A + HGL RTL  NM+ GVS+GF K+L++ GVGYRA V+G+++VL+LG+SHPV++  PDG
Sbjct  61   ARQRHGLSRTLVANMVEGVSQGFQKRLEIQGVGYRAQVQGRNLVLSLGYSHPVQIEPPDG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +Q  VE NT + VSG +K  +G  AA IR  RPPEPYKGKGV+YA E++RR
Sbjct  121  IQFAVENNTNVVVSGINKEIVGNVAAQIRAARPPEPYKGKGVRYAGEIVRR  171



>ref|WP_015203286.1| 50S ribosomal protein L6 [Crinalium epipsammum]
 gb|AFZ13172.1| LSU ribosomal protein L6P [Crinalium epipsammum PCC 9333]
Length=179

 Score =   192 bits (489),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/171 (55%), Positives = 124/171 (73%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+PI +P  VT+ +EGQ   VKGP GEL    P EV +E +E   L V++  E+R 
Sbjct  2    SRIGKRPINIPGKVTVAIEGQHVGVKGPKGELSRVLPAEVTVE-QEGDTLVVKRRNESRP  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A ++HGL RTL  NM+ GVS+GF K+L++ GVGYRA V+G++++LN+G+S PV +  PDG
Sbjct  61   ARQLHGLSRTLVANMVDGVSEGFQKRLEIQGVGYRAQVQGRNLILNVGYSKPVEITPPDG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +QV VE NT + VSG DK  +G  AA IR  RPPEPYKGKG++YA EV+RR
Sbjct  121  IQVAVENNTNVVVSGIDKEVVGNTAAKIRDIRPPEPYKGKGIRYAGEVVRR  171



>ref|WP_037217674.1| 50S ribosomal protein L6 [Richelia intracellularis]
 emb|CDN11380.1| LSU ribosomal protein L6p (L9e) [Richelia intracellularis]
Length=182

 Score =   191 bits (485),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 125/171 (73%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+PI VP+ V + ++G +  VKGP GEL    P  V + +E   +L  R+  +TR+
Sbjct  2    SRIGKRPITVPAKVQVTIDGTNIAVKGPKGELARQLPANVNISQEGESLLVSRRD-DTRQ  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            + +MHGL RTL  NM+ GVS+GF ++L++ GVGYRA V+GK++VLN+G+SH V++A P+G
Sbjct  61   SRQMHGLCRTLVANMVEGVSQGFQRRLEIQGVGYRAQVQGKNLVLNIGYSHQVQIAPPEG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +Q  VE NT + VSGYDK  +G  AA IR  RPPEPYKGKG++YA EV+RR
Sbjct  121  VQFAVENNTNVIVSGYDKEVVGNTAAKIRDVRPPEPYKGKGIRYAGEVVRR  171



>ref|WP_039717296.1| 50S ribosomal protein L6 [Scytonema millei]
 gb|KIF19826.1| 50S ribosomal protein L6 [Scytonema millei VB511283]
Length=179

 Score =   191 bits (484),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 125/171 (73%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+PI +PS VT+ + G    VKGP GEL    P  V +E+E   +L V++  E+R 
Sbjct  2    SRIGKRPITIPSKVTVTINGSHVAVKGPKGELARVLPSAVTVEQEGDTIL-VKRHDESRL  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            + ++HGL RTL  NM+ GVS+GF K+L++ GVGYRA V+G+++VL+LG+SHPV++  P+G
Sbjct  61   SRQLHGLSRTLVANMVDGVSQGFQKRLEIQGVGYRAQVQGRNLVLSLGYSHPVQIEPPEG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +Q+ VE NT + VSG+DK  +G  AA IR  RPPEPYKGKGV+YA E +RR
Sbjct  121  IQLAVENNTNVIVSGFDKELVGNVAAQIRDKRPPEPYKGKGVRYAGEAVRR  171



>emb|CEG01824.1| Ribosomal protein L6, conserved site [Ostreococcus tauri]
Length=214

 Score =   192 bits (487),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 91/178 (51%), Positives = 127/178 (71%), Gaps = 1/178 (1%)
 Frame = -1

Query  653  VRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLR  474
            V + VE KESRIGK+P+ VP  VT  ++     VKGP GEL + +P  +  E E+   ++
Sbjct  29   VTRVVEAKESRIGKKPVAVPKGVTYTLKDNHLAVKGPKGELKMQFPPTMVFE-EQGDAIK  87

Query  473  VRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSH  294
            + ++ ++  A + HGL+RTL DNM VGVS GF+KKL+L+GVGY+A ++GKD+ L+LG+SH
Sbjct  88   ITRSDDSPEARKGHGLYRTLADNMFVGVSTGFEKKLKLLGVGYKAAMQGKDLNLSLGYSH  147

Query  293  PVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVI  120
            PV M +P+G+ V    NT + VSGYDK  +G FAA IR  RPPEPYKGKG++Y +EV+
Sbjct  148  PVIMKLPEGITVTCPSNTEVVVSGYDKVEVGNFAAIIRAKRPPEPYKGKGIRYENEVV  205



>ref|WP_015152288.1| 50S ribosomal protein L6 [Chroococcidiopsis thermalis]
 gb|AFY85737.1| LSU ribosomal protein L6P [Chroococcidiopsis thermalis PCC 7203]
Length=179

 Score =   190 bits (482),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 125/171 (73%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+PI +PS VT+ + G    VKGP GEL    P  V +E+E   +L V++  ++R 
Sbjct  2    SRIGKRPITIPSKVTVTINGSHVAVKGPKGELARVLPSAVTVEQEGDTIL-VKRQDDSRL  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            + ++HGL RTL  NM+ GVS+GF K+L++ GVGYRA V+G+++VL+LG+SHPV++  P+G
Sbjct  61   SRQLHGLSRTLVANMVDGVSQGFQKRLEIQGVGYRAQVQGRNLVLSLGYSHPVQIEPPEG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +Q+ VE NT + VSG+DK  +G  AA IR  RPPEPYKGKGV+YA E +RR
Sbjct  121  IQLAVENNTNVIVSGFDKELVGNVAAQIRDKRPPEPYKGKGVRYAGEAVRR  171



>ref|WP_017721159.1| 50S ribosomal protein L6 [Oscillatoria sp. PCC 10802]
Length=182

 Score =   190 bits (482),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/171 (54%), Positives = 125/171 (73%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+PIP+P  VT++++GQ   VKGP GEL    P+EV++  E+SG + VR+  E+R 
Sbjct  2    SRIGKRPIPIPGKVTVEIDGQRVAVKGPKGELSRVLPQEVEV-VEDSGTIAVRRRDESRA  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A + HGL RTL  NMI GVS GF K+L++ GVGYRA V+G+ ++LN+G+S PV +  P+G
Sbjct  61   ARQRHGLCRTLVANMIDGVSAGFQKRLEIQGVGYRAQVQGRTLILNVGYSKPVEIQPPEG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +QV VE NT + VSG DK  +G  AA IR  RPPE YKGKG++YA E++RR
Sbjct  121  IQVAVENNTNVIVSGIDKEVVGNTAAKIRAVRPPEVYKGKGIRYAGELVRR  171



>ref|WP_009543883.1| MULTISPECIES: 50S ribosomal protein L6 [Cyanothece]
 sp|B1WQS5.1|RL6_CYAA5 RecName: Full=50S ribosomal protein L6 [Cyanothece sp. ATCC 51142]
 gb|ACB53377.1| 50S ribosomal protein L6 [Cyanothece sp. ATCC 51142]
Length=179

 Score =   189 bits (480),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/171 (54%), Positives = 120/171 (70%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+PIP+P+ VTI ++GQ   VKGP G L +  P EV + +E   V  V++  ++R 
Sbjct  2    SRIGKKPIPLPNKVTIDIKGQHIAVKGPKGSLELDLPSEVTVNQEGETV-EVQRVDDSRT  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A E HGLFRTL  NMI GVS+GF+K+L + GVGYRA  +G  + LN+G+S PV M +P G
Sbjct  61   ARERHGLFRTLVANMIQGVSQGFEKRLNIQGVGYRAQAQGSKLTLNVGYSKPVEMTMPQG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            + V VE NT++ VSG DK  +G  AA IR  RPPEPYKGKG++Y DE +RR
Sbjct  121  INVAVENNTQVVVSGIDKEIVGNIAAKIRGVRPPEPYKGKGIRYQDEYVRR  171



>ref|XP_002966651.1| hypothetical protein SELMODRAFT_6327, partial [Selaginella moellendorffii]
 ref|XP_002978092.1| hypothetical protein SELMODRAFT_6323, partial [Selaginella moellendorffii]
 gb|EFJ20749.1| hypothetical protein SELMODRAFT_6323, partial [Selaginella moellendorffii]
 gb|EFJ32678.1| hypothetical protein SELMODRAFT_6327, partial [Selaginella moellendorffii]
Length=171

 Score =   188 bits (478),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 90/168 (54%), Positives = 125/168 (74%), Gaps = 1/168 (1%)
 Frame = -1

Query  617  GKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRANE  438
            G++P+PVP  VT+K++GQ  +V GPLG L  T+  EV++  E   ++ +++ MET+++  
Sbjct  1    GRKPVPVPKGVTVKIDGQLVEVTGPLGSLSWTFRDEVRITLENDTLI-LKRVMETKKSRA  59

Query  437  MHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQV  258
            MHGL R L  NM+VGVS+GF+KKL +VGVGYRA+V+G  ++LN+GF  P  +AIPDG+  
Sbjct  60   MHGLSRQLLSNMVVGVSQGFEKKLIMVGVGYRAVVQGNKLLLNIGFKMPEVVAIPDGITA  119

Query  257  KVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
             VEENT+ITVSG D   +G FAA +R  R PEPYKGKG++YADE +RR
Sbjct  120  VVEENTKITVSGRDNVLLGNFAALVRSKRKPEPYKGKGIRYADEKVRR  167



>ref|WP_008275484.1| 50S ribosomal protein L6 [Cyanothece sp. CCY0110]
 gb|EAZ91358.1| 50S ribosomal protein L6 [Cyanothece sp. CCY0110]
Length=179

 Score =   189 bits (479),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 121/171 (71%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+PIP+P+ VTI ++GQ   VKGP G L +  P +V + ++   +L V++  ++R 
Sbjct  2    SRIGKKPIPLPNKVTIDIKGQHIAVKGPKGSLELDLPSQVTVNQDGETIL-VQRVDDSRV  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A E HGLFRTL  NMI GVSKGF+K+L + GVGYRA  +G  + LN+G+S PV M +P G
Sbjct  61   ARERHGLFRTLVSNMIEGVSKGFEKRLSIQGVGYRAQAQGTKLTLNVGYSKPVEMTMPKG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            + V VE NT++ VSG DK  +G  AA IR  RPPEPYKGKG++Y DE +RR
Sbjct  121  INVAVENNTQVVVSGIDKEIVGNIAAKIRGVRPPEPYKGKGIRYQDEYVRR  171



>ref|WP_009782735.1| 50S ribosomal protein L6 [Lyngbya sp. PCC 8106]
 gb|EAW38760.1| 50S ribosomal protein L6 [Lyngbya sp. PCC 8106]
Length=181

 Score =   189 bits (479),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 93/171 (54%), Positives = 123/171 (72%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+PIP+P  VT  +EGQ   VKGP GEL    P +V LE++   +L V++  E+R 
Sbjct  2    SRIGKRPIPIPPKVTFTIEGQHIIVKGPKGELSRVLPEKVILEQDGDTLL-VKRRDESRV  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A ++HGL RTL  NM+ GVSKGF+K+L++ GVGYRA V+GK+++LN+G+S PV M  P G
Sbjct  61   ARQLHGLSRTLVANMVDGVSKGFEKRLEIQGVGYRAQVQGKNLILNVGYSKPVEMNPPQG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            + V VE NT + +SG DK  +G  AA IR  RPPEPYKGKG++YA E +RR
Sbjct  121  ITVAVENNTNVIISGIDKEVVGNIAAQIRAVRPPEPYKGKGIRYAGEQVRR  171



>ref|WP_022605574.1| 50S ribosomal protein L6 [Rubidibacter lacunae]
 gb|ERN42229.1| ribosomal protein L6 [Rubidibacter lacunae KORDI 51-2]
Length=179

 Score =   188 bits (478),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 88/171 (51%), Positives = 124/171 (73%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+PIP+P+ V++ ++GQ  KVKGP GEL    P  + + + + G L V +  E+R 
Sbjct  2    SRIGKRPIPIPAKVSVALDGQQVKVKGPKGELARILPAPIAIAQTD-GQLHVTRVDESRT  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A ++HGL RTL  NM+ GVS+GF +KL+L GVGYRA V+G+++VLN+G+SHPV +  P+G
Sbjct  61   ARQLHGLCRTLVANMVEGVSQGFTRKLELQGVGYRAAVQGRNLVLNVGYSHPVEIVPPEG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            + V VE+N  IT++G DK  +G  AA +R  RPPEPYKGKG++Y  E +RR
Sbjct  121  ISVAVEKNVSITLTGIDKEILGNLAARVRAVRPPEPYKGKGIRYEGERVRR  171



>ref|WP_036532292.1| 50S ribosomal protein L6 [Neosynechococcus sphagnicola]
 gb|KGF73056.1| 50S ribosomal protein L6 [Neosynechococcus sphagnicola sy1]
Length=179

 Score =   188 bits (478),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 92/171 (54%), Positives = 123/171 (72%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+PI +P  VT+ +EGQ   VKGP GEL    P EV +E+E +  L V++  E+R 
Sbjct  2    SRIGKRPISIPPKVTVTLEGQQVLVKGPKGELSRLLPAEVSVEQEGT-TLVVKRRDESRA  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A   HGL RTL  NM+ GVS+GF ++L++ GVGYRA ++G ++VLN+G+SHPV++  PDG
Sbjct  61   ARARHGLSRTLVANMVDGVSQGFQRRLEIQGVGYRAQLQGVNLVLNMGYSHPVQIVPPDG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +Q  VE NT + VSG DK  +G  +A IR  RPPEPYKGKG++YA EV+RR
Sbjct  121  IQFAVENNTNVIVSGIDKEIVGNTSAKIRAVRPPEPYKGKGIRYAGEVVRR  171



>ref|WP_015118729.1| 50S ribosomal protein L6 [Rivularia sp. PCC 7116]
 gb|AFY55156.1| LSU ribosomal protein L6P [Rivularia sp. PCC 7116]
Length=183

 Score =   188 bits (478),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 94/172 (55%), Positives = 121/172 (70%), Gaps = 2/172 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGKQPI VP+ V IK+EG    VKGP GEL    P +V +  +E   L V +  ++R 
Sbjct  2    SRIGKQPIAVPAKVQIKIEGASISVKGPKGELSRELPTQVSVS-QEGDTLTVSRQDDSRV  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
              +MHGL R+L  NM+ GVS+GF +KLQL GVGYRA V+GKD+VLN+G+SHPV +  PDG
Sbjct  61   CRQMHGLSRSLVSNMVEGVSQGFQRKLQLQGVGYRAQVKGKDLVLNVGYSHPVEITPPDG  120

Query  266  LQVKVEE-NTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +Q  +E+    I VSGYDK  +G  +A IR  RPPEPYKGKG++Y +EV+RR
Sbjct  121  VQFAIEDKGLTIVVSGYDKEIVGNTSARIRAVRPPEPYKGKGIRYENEVVRR  172



>ref|WP_023067381.1| 50S ribosomal protein L6 [Lyngbya aestuarii]
 gb|ERT06416.1| ribosomal protein L6 [Lyngbya aestuarii BL J]
Length=181

 Score =   188 bits (477),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 92/171 (54%), Positives = 122/171 (71%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+PIP+P  VT+ +EGQ   VKGP GEL    P +V  E++   +L V++  E+R 
Sbjct  2    SRIGKRPIPIPPKVTLTIEGQQITVKGPKGELSRVLPAQVLFEQDGETLL-VKRRDESRV  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A + HGL RTL  NM+ GVSKGF+K+L++ GVGYRA V+GK+++LN+G+S PV M  P G
Sbjct  61   ARQRHGLSRTLVANMVDGVSKGFEKRLEIQGVGYRAQVQGKNLILNVGYSKPVEMNPPQG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            + V VE NT + +SG DK  +G  AA IR  RPPEPYKGKG++YA E +RR
Sbjct  121  ITVAVENNTNVIISGIDKEVVGNIAAQIRAVRPPEPYKGKGIRYAGEQVRR  171



>ref|WP_006621330.1| MULTISPECIES: 50S ribosomal protein L6 [Arthrospira]
 gb|EDZ92808.1| ribosomal protein L6 [Arthrospira maxima CS-328]
 emb|CCE20751.1| 50S ribosomal subunit protein L6 [Arthrospira sp. PCC 8005]
 gb|EKD10653.1| ribosomal protein L6 [Arthrospira platensis C1]
 emb|CDM93372.1| 50S ribosomal subunit protein L6 [Arthrospira sp. PCC 8005]
Length=179

 Score =   188 bits (477),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 123/171 (72%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+PIP+P+ VT+ ++GQ   VKGP GEL    P EV L  EE  ++ V++  E+R 
Sbjct  2    SRIGKRPIPIPAKVTLTLDGQKVTVKGPKGELSRVLPNEVILSLEEDTLI-VKRRDESRV  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A + HGL RTL  NM+ GVS+GF+++L++ GVGYRA V+GK+++LN+G+S PV M  P+G
Sbjct  61   ARQRHGLCRTLVANMVDGVSQGFERRLEIQGVGYRAQVQGKNLILNVGYSKPVEMVPPEG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
              V VE NT + VSG +K  +G  AA IR  RPPEPYKGKG++YA E +RR
Sbjct  121  CSVAVENNTNVIVSGINKELVGNMAAKIRAVRPPEPYKGKGIRYAGEQVRR  171



>emb|CCQ60081.1| LSU ribosomal protein L6p (L9e) [Crocosphaera watsonii WH 0401]
Length=179

 Score =   188 bits (477),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 123/171 (72%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+PIP+P+ VTI ++GQ   VKGP G L +  P +V +++E   V+ V    ++R 
Sbjct  2    SRIGKKPIPLPNKVTIDIKGQHIAVKGPKGSLELDLPSKVSVKQEGENVV-VTTDDDSRT  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A+E HGL RTL  NM+ GVSKGF+K+L + GVGYRA  +G  + LN+G+S+PV M +P G
Sbjct  61   AHERHGLSRTLVANMVEGVSKGFEKRLSIQGVGYRAQAQGTKLTLNVGYSNPVEMTMPKG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            + VKVE NT +TVSG +K  +G  AA+IR  RPPEPYKGKG++Y DE +RR
Sbjct  121  VNVKVENNTMVTVSGINKEVVGNTAATIRAVRPPEPYKGKGIRYVDEFVRR  171



>ref|WP_015141077.1| 50S ribosomal protein L6 [Nostoc sp. PCC 7524]
 gb|AFY50667.1| ribosomal protein L6, bacterial type [Nostoc sp. PCC 7524]
Length=182

 Score =   188 bits (477),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 123/171 (72%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+PI VP+ V + ++G    VKGP GEL    P  V + ++   +L  RK  ++R 
Sbjct  2    SRIGKRPITVPAKVQVTVDGSKVIVKGPKGELSRDLPTHVTVAQDGQTLLVTRKD-DSRT  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            + +MHGL RTL  NM+ GVS+GF K+L++ GVGYRA V+G+++VLN+G+SH V++A PDG
Sbjct  61   SRQMHGLSRTLVANMVEGVSQGFQKRLEIQGVGYRAQVQGRNLVLNMGYSHQVQIAPPDG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +Q  VE NT + VSGYDK  +G  AA IR  RPPEPYKGKG++YA EV+RR
Sbjct  121  IQFAVENNTNVIVSGYDKEVVGNTAAKIRAVRPPEPYKGKGIRYAGEVVRR  171



>ref|WP_027844107.1| 50S ribosomal protein L6 [Mastigocoleus testarum]
Length=182

 Score =   187 bits (476),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 124/171 (73%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGKQPI VP+ V I ++G    VKGP GEL       V +E ++   L V++  ++R 
Sbjct  2    SRIGKQPITVPAKVQITLDGTKIAVKGPKGELSRELSSNVSVE-QDGDTLWVKRQDDSRL  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            + +MHGL RTL  NM+ GVSKGF+++L++ GVGYRA V+G+++VLN+G+SH V++  P G
Sbjct  61   SRQMHGLSRTLVANMVQGVSKGFERRLEIQGVGYRAQVQGRNLVLNIGYSHQVQIEPPQG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +Q  VE NT++ VSGYDK  +G  AA IR  RPPEPYKGKG++YA+EV+RR
Sbjct  121  VQFAVEANTKVVVSGYDKEVVGNTAAKIRAVRPPEPYKGKGIRYANEVVRR  171



>ref|WP_023071150.1| 50S ribosomal protein L6 [Leptolyngbya sp. Heron Island J]
 gb|ESA38002.1| 50s ribosomal protein l6 [Leptolyngbya sp. Heron Island J]
Length=178

 Score =   187 bits (476),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 93/171 (54%), Positives = 121/171 (71%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+P+PVPS VT+ ++ Q   VKGP GEL    P EV + +E   V+  R+  ++R 
Sbjct  2    SRIGKKPVPVPSGVTVSIDAQSVVVKGPKGELSRVLPGEVNIAQEGEQVVVTRQD-DSRT  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A   HGL RTL  NM+ GVSKGF+K+L++ GVGYRA V+GK + +NLG+SHPV    P G
Sbjct  61   ARARHGLSRTLIANMVEGVSKGFEKRLEIKGVGYRAAVKGKTLTMNLGYSHPVEFEPPAG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            ++ KVE NT +TVSG DK  +G  AA IR  RPPEPYKGKGV+Y+ E++RR
Sbjct  121  IEFKVESNTNVTVSGIDKELVGTVAAKIRDARPPEPYKGKGVRYSGEMVRR  171



>ref|WP_008191191.1| 50S ribosomal protein L6 [Moorea producens]
 gb|EGJ28572.1| LSU ribosomal protein L6P [Moorea producens 3L]
Length=179

 Score =   187 bits (475),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 94/171 (55%), Positives = 123/171 (72%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+PIP+PS VT+ ++GQ  KVKG  GEL    P  +K E+    V +V +  ETR 
Sbjct  2    SRIGKRPIPIPSKVTVTIDGQQVKVKGSKGELDWVLPDTIKAEQVGETV-QVSRREETRT  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A E HGL RTL  NMI GVSKGF+K+L + GVGYRA V+G++++LN+G+S PV +  P+G
Sbjct  61   ARESHGLSRTLVANMIEGVSKGFEKRLDIQGVGYRAQVQGRNLILNVGYSKPVEIVPPEG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +QVKVE NT + VSG +K  +G  AA IR  RPPE YKGKG++YA E++RR
Sbjct  121  IQVKVENNTNVIVSGINKEVVGNTAAKIRAVRPPEVYKGKGIRYAGEIVRR  171



>ref|WP_007306418.1| 50S ribosomal protein L6 [Crocosphaera watsonii]
 gb|EAM49865.1| Ribosomal protein L6 [Crocosphaera watsonii WH 8501]
 gb|EHJ11711.1| LSU ribosomal protein L6p (L9e) [Crocosphaera watsonii WH 0003]
 emb|CCQ53513.1| LSU ribosomal protein L6p (L9e) [Crocosphaera watsonii WH 8502]
 emb|CCQ57161.1| LSU ribosomal protein L6p (L9e) [Crocosphaera watsonii WH 0005]
Length=179

 Score =   187 bits (475),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 122/171 (71%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+PIP+P+ VTI ++GQ   VKGP G L +  P +V +++E   V+ V    ++R 
Sbjct  2    SRIGKKPIPLPNKVTIDIKGQHIAVKGPKGSLELDLPSKVSVKQEGENVV-VTTDDDSRT  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A E HGL RTL  NM+ GVSKGF+K+L + GVGYRA  +G  + LN+G+S+PV M +P G
Sbjct  61   ARERHGLSRTLVANMVEGVSKGFEKRLSIQGVGYRAQAQGTKLTLNVGYSNPVEMTMPKG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            + VKVE NT +TVSG +K  +G  AA+IR  RPPEPYKGKG++Y DE +RR
Sbjct  121  VNVKVENNTMVTVSGINKEVVGNTAATIRAVRPPEPYKGKGIRYVDEFVRR  171



>ref|WP_015955691.1| 50S ribosomal protein L6 [Cyanothece sp. PCC 7424]
 sp|B7KI01.1|RL6_CYAP7 RecName: Full=50S ribosomal protein L6 [Cyanothece sp. PCC 7424]
 gb|ACK72098.1| ribosomal protein L6 [Cyanothece sp. PCC 7424]
Length=179

 Score =   187 bits (475),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/171 (54%), Positives = 123/171 (72%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+PI +P+ VT+ ++G    VKGP GEL  T P  V +E++E GVLRV +  ++R 
Sbjct  2    SRIGKRPITIPNKVTVNIDGSHVAVKGPKGELQRTLPTLVIVEQDE-GVLRVVRQDDSRT  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A + HGL RTL  NM+ GVSKGF+K+L++ GVGYRA  +G  + LN+G+S PV M +P G
Sbjct  61   ARQRHGLCRTLVSNMVEGVSKGFEKRLEIQGVGYRAAAQGSKLTLNVGYSKPVEMDMPSG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            + V VE+NT IT++G DK  +G  AA IR  RPPEPYKGKG++Y  EV+RR
Sbjct  121  IGVAVEKNTEITITGIDKEIVGNVAAKIRAVRPPEPYKGKGIRYKGEVVRR  171



>ref|WP_019500654.1| 50S ribosomal protein L6 [Pseudanabaena sp. PCC 6802]
Length=179

 Score =   187 bits (474),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 126/171 (74%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+PIPVP+ VT+ + GQ   VKGP GEL  T P +V++ + +S VL+V +  ++R 
Sbjct  2    SRIGKRPIPVPNKVTVTIAGQHVTVKGPKGELQRTLPNQVEVVQSDS-VLQVNRRDDSRP  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A +MHGL RTL  NM+ GVS+GF ++L++ GVGYRA V+G  ++LN+G+S+PV +  P G
Sbjct  61   ARQMHGLCRTLVANMVEGVSEGFQRRLEIQGVGYRAQVQGTTLILNVGYSNPVPVEAPAG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +Q+ VE NT + V+G DK ++G  AA IR  RPPE YKGKG++YA EV+RR
Sbjct  121  IQLAVENNTNVIVTGIDKESVGNIAAQIRAVRPPEVYKGKGIRYAGEVVRR  171



>ref|WP_007472094.1| 50S ribosomal protein L6 [Segniliparus rugosus]
 gb|EFV11908.1| 50S ribosomal protein L6 [Segniliparus rugosus ATCC BAA-974]
Length=180

 Score =   187 bits (474),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 124/171 (73%), Gaps = 0/171 (0%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIG+ PI VPS V + ++GQD KVKGP GELG+T    +K+E+ E G L V +  + RR
Sbjct  2    SRIGRAPIQVPSGVDVTIDGQDVKVKGPKGELGLTLVEPIKVERGEDGALTVVRPDDERR  61

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
               +HGL RTL +N++VGV++G+ K+L++VGVGYR   +GKD+   LGFSH V +A P+G
Sbjct  62   NRALHGLSRTLVNNLVVGVTQGYTKQLEIVGVGYRVQQKGKDLEFALGFSHSVPVAAPEG  121

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +   VE  T+ +VSG DK  +G+ AA+IRK + PEPYKGKG++YA EV+RR
Sbjct  122  ITFAVETPTKFSVSGIDKQKVGEVAANIRKLKKPEPYKGKGIRYAGEVVRR  172



>ref|WP_002787868.1| 50S ribosomal protein L6 [Microcystis aeruginosa]
 emb|CCI17958.1| 50S ribosomal subunit protein L6 [Microcystis aeruginosa PCC 
9807]
Length=186

 Score =   187 bits (474),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 121/171 (71%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+PIP+P+ VT+ ++G    VKGP G L  T P  V + K+   +L  R+  ++R 
Sbjct  2    SRIGKRPIPIPNKVTVDIDGATVTVKGPKGTLQRTLPTAVTINKDGETILVTRQD-DSRT  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A E HGL RTL  NM+ GV+ GF K+L + GVGYRA+V+G  +VLN+G+S PV M +PDG
Sbjct  61   ARERHGLCRTLVANMVEGVATGFQKRLDIQGVGYRALVQGSKLVLNVGYSKPVEMEMPDG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            + V VE NT++ VSG DK A+G  AA IR+ RPPEPYKGKG++Y  EV+RR
Sbjct  121  VSVAVENNTQVIVSGIDKEAVGNTAAKIREVRPPEPYKGKGIRYLGEVVRR  171



>ref|WP_015200868.1| 50S ribosomal protein L6 [Calothrix parietina]
 gb|AFZ04259.1| LSU ribosomal protein L6P [Calothrix sp. PCC 6303]
Length=182

 Score =   186 bits (473),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 122/171 (71%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+PI VP+ V + + G + +VKGP GEL    P  + L +E   +L V    ++R 
Sbjct  2    SRIGKRPITVPAKVQVTINGSNVQVKGPKGELSRDLPANIVLTQEGE-ILTVSPIDDSRS  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            + ++HGLFRTL  NM+ GVS GF ++L++ GVGYRA V+G+++VLN+G+SH V++  PDG
Sbjct  61   SRQLHGLFRTLISNMVEGVSTGFQRRLEIQGVGYRAAVQGRNLVLNMGYSHQVQIPPPDG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +Q  VE NT + VSGYDK  +G  AA IR  RPPEPYKGKG++YA EV+RR
Sbjct  121  VQFAVENNTNVIVSGYDKEIVGNTAAQIRAVRPPEPYKGKGIRYAGEVVRR  171



>ref|WP_017321361.1| 50S ribosomal protein L6 [cyanobacterium PCC 7702]
Length=182

 Score =   186 bits (473),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 123/171 (72%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+PI +P  V + ++G    VKGP GEL    P  V +  ++  +L V +  ++R 
Sbjct  2    SRIGKRPITIPPKVQVTVDGTKVSVKGPKGELSRQLPSNVTIS-QQGEILTVNRCDDSRT  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            + +MHGL RTL  NMI GVSKGF+++L++ GVGYRA ++G++++LN+G+SH V++A PDG
Sbjct  61   SRQMHGLCRTLVANMIEGVSKGFERRLEIQGVGYRAQLQGRNLILNVGYSHQVQIAPPDG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +Q  VE NT + VSGYDK  +G  AA IR  RPPEPYKGKG++YA E++RR
Sbjct  121  IQFAVENNTNVIVSGYDKEVVGNTAARIRAVRPPEPYKGKGIRYAGELVRR  171



>ref|WP_015231117.1| 50S ribosomal protein L6 [Dactylococcopsis salina]
 gb|AFZ52143.1| ribosomal protein L6, bacterial type [Dactylococcopsis salina 
PCC 8305]
Length=179

 Score =   186 bits (472),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 125/171 (73%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK PIP+P  V I ++G+  KVKGP GEL  T P  V +E+EE  +L V +  ++R+
Sbjct  2    SRIGKLPIPIPKKVEITLDGKLVKVKGPKGELEQTMPDFVTIEQEEDRIL-VHRVNDSRK  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A E HGL RTL  NM+ GVS+GF+++LQ+ GVGYRA V+G++++LN+G+SHPV +  PDG
Sbjct  61   ARERHGLARTLVANMVHGVSQGFERRLQIQGVGYRAQVQGRNLILNVGYSHPVEIVPPDG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +QV VE+NT I ++G +K  +G   A IR  RPPEPYKGKG+++  E +R+
Sbjct  121  IQVAVEKNTEIIINGINKELVGNLTAKIRAVRPPEPYKGKGIRFLGEQVRQ  171



>ref|WP_023358196.1| 50S ribosomal protein L6 [Actinoplanes friuliensis]
 gb|AGZ39205.1| 50S ribosomal protein L6 [Actinoplanes friuliensis DSM 7358]
Length=180

 Score =   186 bits (472),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 93/171 (54%), Positives = 118/171 (69%), Gaps = 0/171 (0%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIG++ IPVP+ V + + GQ  KVKGP GEL  T    + +EK E+G L V +  + RR
Sbjct  2    SRIGRKSIPVPAGVDVTITGQTVKVKGPKGELSHTVAEPITVEKAENGELAVNRPNDERR  61

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A E+HGL RTL  NMIVGV++G+ K L++ G GYR   +GKD+   LGFSHPV +  P G
Sbjct  62   AKELHGLSRTLVANMIVGVTEGYKKTLEINGTGYRVTAKGKDLEFALGFSHPVNVVPPAG  121

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +   VE  T+ TV+G DK  +G+ AA+IRK RPPEPYKGKGVKY  EVIRR
Sbjct  122  ITFSVERPTQFTVTGIDKQLVGEVAANIRKIRPPEPYKGKGVKYQGEVIRR  172



>ref|WP_015227140.1| 50S ribosomal protein L6 [Halothece sp. PCC 7418]
 gb|AFZ45268.1| LSU ribosomal protein L6P [Halothece sp. PCC 7418]
Length=179

 Score =   186 bits (472),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 127/171 (74%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK PIP+P  V I ++G+  KVKGP GEL  T P  V +E+E++ +L V++  ++R+
Sbjct  2    SRIGKLPIPIPQKVEITVDGKQVKVKGPKGELEQTMPDFVTIEQEDNQIL-VKRVNDSRK  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A E HGL RTL  NM+ GVS+GF+++LQ+ GVGYRA V+G++++LN+G+SHPV +A P+G
Sbjct  61   ARERHGLARTLVANMVHGVSQGFERRLQIQGVGYRAQVQGRNLILNVGYSHPVEIAPPEG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +Q+ VE+NT I +SG +K  +G   A IR  RPPEPYK KG+++  E +R+
Sbjct  121  IQINVEKNTEIIISGINKEIVGNLTAKIRAVRPPEPYKQKGIRFMGEQVRQ  171



>ref|XP_001696829.1| plastid ribosomal protein L6 [Chlamydomonas reinhardtii]
 gb|EDP00937.1| plastid ribosomal protein L6 [Chlamydomonas reinhardtii]
Length=207

 Score =   187 bits (474),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 95/189 (50%), Positives = 133/189 (70%), Gaps = 3/189 (2%)
 Frame = -1

Query  686  FFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREV  507
            F    ++R++  R  V  K+SRIG+ PI VP  VT+ +EGQ  +VKGP G L  T    V
Sbjct  9    FRAAAVSRSS--RLCVVAKDSRIGRAPITVPKGVTVTLEGQLVRVKGPNGTLEQTLSPLV  66

Query  506  KLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEG  327
            K+E+ + G L++ K  + R A   HGL R+L +N++VGVS GF+K++++VG GYRA V G
Sbjct  67   KIEQAD-GKLKLFKLADDRVAMSQHGLNRSLVNNLVVGVSTGFEKRMEMVGTGYRAAVAG  125

Query  326  KDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGK  147
            KD+ LN+G+S P  +AIP+GL+V VE+NT + +SG DK  +G F A+IR+ RPPEPYKGK
Sbjct  126  KDLTLNVGYSKPRVLAIPEGLKVVVEKNTTLVISGADKVKVGDFCATIRRQRPPEPYKGK  185

Query  146  GVKYADEVI  120
            G++YA EVI
Sbjct  186  GIRYAGEVI  194



>ref|WP_017325553.1| 50S ribosomal protein L6 [Synechococcus sp. PCC 7336]
Length=178

 Score =   186 bits (471),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 92/171 (54%), Positives = 122/171 (71%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGKQPIP+P  VT+K+EGQD  VKGP GEL  T P +V +  +  G ++V     TR 
Sbjct  2    SRIGKQPIPIPDKVTVKIEGQDVAVKGPKGELQRTIPAKVTVVLD-GGEVKVAPVDSTRV  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
              +MHGL RTL  NM+ GVS+GF+K+L++ GVGYRA  +G  +VLN+G+S+PV +  P+G
Sbjct  61   GRQMHGLCRTLVANMVEGVSQGFEKRLEIQGVGYRAQAKGTTLVLNVGYSNPVEIPAPEG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +Q+ VE NT + V+G DK  +G  AA+IR  RPPEPYKGKG++YA E I R
Sbjct  121  IQLAVEGNTNVIVTGIDKELVGNTAATIRAVRPPEPYKGKGIRYAGEYILR  171



>ref|WP_041036063.1| 50S ribosomal protein L6 [Tolypothrix campylonemoides]
 gb|KIJ75816.1| 50S ribosomal protein L6 [Tolypothrix campylonemoides VB511288]
Length=181

 Score =   186 bits (471),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 121/171 (71%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+PI VP+ V + ++G    VKGP GEL    P  V +  +E   L+V +  ++R 
Sbjct  2    SRIGKRPITVPAKVQVTIDGTKVLVKGPKGELCRDLPTHVTIS-QEGETLQVNRRDDSRT  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            + +MHGL RTL  NM+ GVS GF ++L++ GVGYRA V+G+++VLN+G+SH V++A PDG
Sbjct  61   SRQMHGLCRTLVANMVEGVSTGFQRRLEIQGVGYRAQVQGRNLVLNMGYSHQVQIAPPDG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +Q  VE NT + VSGYDK  +G  AA IR  RPPEPYKGKG++YA E +RR
Sbjct  121  IQFAVENNTNVIVSGYDKEVVGNTAAKIRAVRPPEPYKGKGIRYAGEAVRR  171



>ref|WP_026086027.1| 50S ribosomal protein L6 [Fischerella muscicola]
Length=182

 Score =   186 bits (471),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 88/171 (51%), Positives = 122/171 (71%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+PI VP+ V +  +     VKGP GEL    P  V L  ++  +L V +  E+R 
Sbjct  2    SRIGKRPITVPAKVQVTFDNAKVSVKGPKGELSRELPANVILS-QDGEILTVNRRDESRT  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            + ++HGLFRTL  NM+ GVSKGF+++L++ GVGYRA ++G+++VLN+G+SH V++A P+G
Sbjct  61   SRQLHGLFRTLVANMVEGVSKGFERRLEIQGVGYRAQIQGRNLVLNMGYSHQVQIAPPEG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +Q  VE NT + VSGYDK  +G  AA IR  RPPEPYKGKG++YA E +RR
Sbjct  121  VQFAVENNTNVIVSGYDKEVVGNTAAKIRAVRPPEPYKGKGIRYAGEAVRR  171



>ref|WP_026099472.1| 50S ribosomal protein L6 [Prochlorothrix hollandica]
Length=179

 Score =   185 bits (470),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 93/171 (54%), Positives = 120/171 (70%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+PIP+P  V + +EG+   VKGP GEL    P  + + + ++  + V +  E+R 
Sbjct  2    SRIGKRPIPIPDKVAVTIEGRHVAVKGPKGELSRLLPWGIVIAQSDN-TITVSRFDESRI  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A E HGL RTL  NM+ GVS+G+ K+L + GVGYRA V+G+ +VL+LG+SHPV M  P G
Sbjct  61   ARERHGLCRTLVANMVEGVSQGYSKRLAITGVGYRAQVQGQKLVLSLGYSHPVEMDPPSG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +Q  VE NT ITVSG DK  +G  AA+IR  RPPEPYKGKGV+YADE IRR
Sbjct  121  IQFAVEGNTNITVSGIDKELVGNVAATIRDARPPEPYKGKGVRYADEKIRR  171



>ref|WP_010469303.1| MULTISPECIES: 50S ribosomal protein L6 [Acaryochloris]
 sp|B0C1E7.1|RL6_ACAM1 RecName: Full=50S ribosomal protein L6 [Acaryochloris marina 
MBIC11017]
 gb|ABW29682.1| 50S ribosomal protein L6 [Acaryochloris marina MBIC11017]
Length=179

 Score =   185 bits (470),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 92/171 (54%), Positives = 123/171 (72%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK PIP+P  V + ++GQ   VKGP GEL      EV +E+ ++ V   R+  E+R 
Sbjct  2    SRIGKVPIPIPDKVNVTIKGQAVTVKGPKGELSREITPEVAIEQADNLVTVTRRN-ESRI  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A + HGL RTL  NM+ GVSKGF+KKLQ+ GVGYRA V+G++++LN+G+S+PV +  P+G
Sbjct  61   ARQRHGLSRTLIANMVEGVSKGFEKKLQIQGVGYRAQVQGRNLILNVGYSNPVTIEPPEG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +QV VE NT + VSG +K  +G  AA IR  RPPEPYKGKG++YADE +RR
Sbjct  121  VQVAVESNTNVIVSGINKEVVGNTAARIRAVRPPEPYKGKGIRYADEYVRR  171



>gb|KIE08718.1| 50S ribosomal protein L6 [Tolypothrix bouteillei VB521301]
Length=181

 Score =   185 bits (469),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 122/171 (71%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+PI +P+ V + + G    VKGP GEL    P +V L  +E  VL+V +  ++R 
Sbjct  2    SRIGKRPIKIPAKVEVTVNGTKVVVKGPKGELSRELPTQVSLS-QEGEVLQVNRRDDSRV  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            + +MHGL RTL  NM+ GVS+GF ++L++ GVGYRA V+G+ +VLN+G+SH V++A P+G
Sbjct  61   SRQMHGLSRTLVSNMVEGVSQGFQRRLEIQGVGYRAAVQGRTLVLNMGYSHQVQIAPPEG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +Q  VE NT + VSGYDK  +G  AA IR  RPPEPYKGKG++YA E +RR
Sbjct  121  IQFAVENNTNVIVSGYDKEVVGNIAAKIRDVRPPEPYKGKGIRYAGEAVRR  171



>ref|WP_007073021.1| 50S ribosomal protein L6 [Micromonospora sp. ATCC 39149]
 gb|EEP71745.1| 50S ribosomal protein L6 [Micromonospora sp. ATCC 39149]
Length=180

 Score =   185 bits (469),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 92/171 (54%), Positives = 118/171 (69%), Gaps = 0/171 (0%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIG++ IPVP+ V I ++GQ  KVKGP GEL +T    +  E+ E G L+V +  + R+
Sbjct  2    SRIGRKSIPVPAGVDITIDGQTVKVKGPKGELTLTLAEPITAERAEDGQLQVNRPNDERK  61

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A E+HGL RTL  NMIVGV++G  K L++ G GYR   +GKD+   LGFSHPV +  PDG
Sbjct  62   AKELHGLSRTLVANMIVGVTEGHRKSLEIAGTGYRVTAKGKDLEFALGFSHPVLVPAPDG  121

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +   VE+ T   V+G DK  +G+ AA+IRK RPPEPYKGKGVKY  EVIRR
Sbjct  122  ITFTVEKPTVFHVAGIDKQLVGEVAANIRKIRPPEPYKGKGVKYQGEVIRR  172



>ref|XP_003060321.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH55090.1| predicted protein [Micromonas pusilla CCMP1545]
Length=218

 Score =   186 bits (472),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/170 (54%), Positives = 121/170 (71%), Gaps = 1/170 (1%)
 Frame = -1

Query  629  ESRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETR  450
            ESR+GKQP+ VP  VT  ++     VKGP G L   +P +  +  E+   +++ KA E+R
Sbjct  42   ESRVGKQPVKVPKGVTYTLKDNHLAVKGPKGSLEFQFP-DTMVFTEDGDEIKLSKADESR  100

Query  449  RANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPD  270
             A E HGL+RTLT+NM+VGVS GF+KKL+LVGVGY+A ++GKD+ L LG++HPV ++ P 
Sbjct  101  TAREGHGLYRTLTNNMMVGVSTGFEKKLKLVGVGYKASMQGKDLNLALGYAHPVILSPPP  160

Query  269  GLQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVI  120
            G+ +    NT ITVSGYDK  +G FAA IR  R PEPYKGKGV+YADE +
Sbjct  161  GIDIACTSNTEITVSGYDKVEVGNFAAIIRSKRKPEPYKGKGVRYADEYV  210



>ref|WP_009455538.1| MULTISPECIES: 50S ribosomal protein L6 [Fischerella]
 gb|EHC18126.1| ribosomal protein L6 [Fischerella sp. JSC-11]
Length=182

 Score =   185 bits (469),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 121/171 (71%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+PI VP+ V +  +     VKGP GEL    P  V L  ++   L V +  E+R 
Sbjct  2    SRIGKRPITVPAKVQVNFDNAKVTVKGPKGELSRELPANVILS-QDGETLTVSRRDESRT  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            + ++HGLFRTL  NM+ GVSKGF+++L++ GVGYRA V+G+++VLN+G+SH V++A P+G
Sbjct  61   SRQLHGLFRTLVANMVEGVSKGFERRLEIQGVGYRAQVQGRNLVLNMGYSHQVQIAPPEG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +Q  VE NT + VSGYDK  +G  AA IR  RPPEPYKGKG++YA E +RR
Sbjct  121  IQFAVENNTNVIVSGYDKELVGNTAAKIRAVRPPEPYKGKGIRYAGEAVRR  171



>ref|WP_002771057.1| 50S ribosomal protein L6 [Microcystis aeruginosa]
 emb|CCI04359.1| 50S ribosomal subunit protein L6 [Microcystis aeruginosa PCC 
9443]
Length=189

 Score =   185 bits (469),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 119/171 (70%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+PIP+P+ VT+ ++G    VKGP G L  T P  V + K+   +L  R+  ++R 
Sbjct  2    SRIGKRPIPIPNKVTVDIDGATVTVKGPKGTLQRTLPTAVTINKDGETILVTRQD-DSRT  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A E HGL RTL  NM+ GV+ GF K+L + GVGYRA  +G  +VLN+G+S PV M +PDG
Sbjct  61   ARERHGLCRTLVANMVEGVATGFQKRLDIQGVGYRAQAQGSKLVLNVGYSKPVEMEMPDG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            + V VE NT++ VSG DK A+G  AA IR+ RPPEPYKGKG++Y  EV+RR
Sbjct  121  VSVAVENNTQVIVSGIDKEAVGNIAAKIREVRPPEPYKGKGIRYLGEVVRR  171



>ref|WP_002753903.1| 50S ribosomal protein L6 [Microcystis aeruginosa]
 emb|CCH92486.1| 50S ribosomal subunit protein L6 [Microcystis aeruginosa PCC 
9432]
 emb|CCI07993.1| 50S ribosomal subunit protein L6 [Microcystis aeruginosa PCC 
7941]
 gb|EPF19527.1| hypothetical protein MAESPC_03895 [Microcystis aeruginosa SPC777]
Length=189

 Score =   185 bits (469),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 120/171 (70%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+PIP+P+ VT+ ++G    VKGP G L  T P  V ++K+   +L  R+  ++R 
Sbjct  2    SRIGKRPIPIPNKVTVDIDGATVTVKGPKGTLQRTLPTAVTIDKDGETLLVTRQD-DSRT  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A E HGL RTL  NM+ GV+ GF K+L + GVGYRA  +G  +VLN+G+S PV M +PDG
Sbjct  61   ARERHGLCRTLVANMVEGVATGFQKRLDIQGVGYRAQAQGSKLVLNVGYSKPVEMEMPDG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            + V VE NT++ VSG DK A+G  AA IR+ RPPEPYKGKG++Y  EV+RR
Sbjct  121  VSVAVENNTQVIVSGIDKEAVGNIAAKIREVRPPEPYKGKGIRYLGEVVRR  171



>ref|WP_002794624.1| 50S ribosomal protein L6 [Microcystis aeruginosa]
 emb|CCI26440.1| 50S ribosomal subunit protein L6 [Microcystis aeruginosa PCC 
9808]
 emb|CCI35627.1| 50S ribosomal subunit protein L6 [Microcystis aeruginosa PCC 
9701]
 dbj|GAL92996.1| LSU ribosomal protein L6p (L9e) [Microcystis aeruginosa NIES-44]
Length=189

 Score =   185 bits (469),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 120/171 (70%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+PIP+P+ VT+ ++G    VKGP G L  T P  V ++K+   +L  R+  ++R 
Sbjct  2    SRIGKRPIPIPNKVTVDIDGATVTVKGPKGTLQRTLPTAVAIDKDGETLLVTRQD-DSRT  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A E HGL RTL  NM+ GV+ GF K+L + GVGYRA  +G  +VLN+G+S PV M +PDG
Sbjct  61   ARERHGLCRTLVANMVEGVATGFQKRLDIQGVGYRAQAQGSKLVLNVGYSKPVEMEMPDG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            + V VE NT++ VSG DK A+G  AA IR+ RPPEPYKGKG++Y  EV+RR
Sbjct  121  VSVAVENNTQVIVSGIDKEAVGNIAAKIREVRPPEPYKGKGIRYLGEVVRR  171



>gb|ACN31089.1| unknown [Zea mays]
Length=112

 Score =   182 bits (462),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = -1

Query  416  LTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTR  237
            L+ N+IVGVSKGFDKKLQLVGVGYRA VEG D+V+NLGFSHPVRMAIP+GL VKVEENTR
Sbjct  3    LSVNVIVGVSKGFDKKLQLVGVGYRAAVEGNDLVMNLGFSHPVRMAIPEGLAVKVEENTR  62

Query  236  ITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            I VSGYDKSAIGQFAA+I+KWRPPEPYKGKG++Y DEV+RR
Sbjct  63   IIVSGYDKSAIGQFAATIKKWRPPEPYKGKGIRYMDEVVRR  103



>ref|WP_013735942.1| 50S ribosomal protein L6 [Verrucosispora maris]
 gb|AEB47301.1| 50S ribosomal protein L6 [Verrucosispora maris AB-18-032]
Length=180

 Score =   184 bits (468),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 118/171 (69%), Gaps = 0/171 (0%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIG++ IPVPS V + ++G+  KVKGP GEL  T    + +E+ E G L V +  + R+
Sbjct  2    SRIGRKSIPVPSGVDVTIDGRTVKVKGPKGELSHTLAEPISIERAEDGQLSVNRPNDERK  61

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A E+HGL RTL  NMIVGV++G+ K L++ G GYR   +GKD+   LGFSHPV +  PDG
Sbjct  62   AKELHGLSRTLVANMIVGVTEGYRKSLEISGTGYRVTAKGKDLEFALGFSHPVTVPAPDG  121

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +   VE+ T   V+G DK  +G+ AA+IRK RPPEPYKGKGVKY  EVIRR
Sbjct  122  ITFTVEKPTLFHVAGIDKQQVGEVAANIRKIRPPEPYKGKGVKYQGEVIRR  172



>ref|WP_015195219.1| 50S ribosomal protein L6 [Stanieria cyanosphaera]
 gb|AFZ37565.1| LSU ribosomal protein L6P [Stanieria cyanosphaera PCC 7437]
Length=179

 Score =   184 bits (468),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 93/171 (54%), Positives = 120/171 (70%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+PIP+P+ VT+ ++ +   VKGP G L    P  V + K+E   L V    E+R+
Sbjct  2    SRIGKRPIPIPNKVTVNIQERYVTVKGPKGTLERELPSLVSV-KQEGETLLVVPEDESRK  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A E HGL RTL  NM+ GV+ GF+K+LQ+ GVGYRA  +GK + LN+G+S PV M +PDG
Sbjct  61   ARERHGLSRTLVANMVSGVADGFEKRLQIQGVGYRAQAQGKKLTLNVGYSKPVEMTMPDG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +QV VE+NT ITVSG DK  +G  AA IR  RPPEPYKGKG++Y  EV+RR
Sbjct  121  IQVAVEKNTEITVSGIDKEVVGNVAAKIRAVRPPEPYKGKGIRYLGEVVRR  171



>ref|WP_015187428.1| 50S ribosomal protein L6 [Gloeocapsa sp. PCC 7428]
 gb|AFZ29552.1| LSU ribosomal protein L6P [Gloeocapsa sp. PCC 7428]
Length=179

 Score =   184 bits (468),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 85/171 (50%), Positives = 124/171 (73%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+PI +P+ V + ++G    VKGP GEL    P  V +E+E   +L V++  ++R 
Sbjct  2    SRIGKRPIAIPAKVQVTLDGSQVTVKGPKGELSRELPSAVTIEQEGDTLL-VKRKDDSRT  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A +MHGL RTL  NM+ GVS+GF ++L++ GVGYRA V+G+++ LN+G+SHPV++  P+G
Sbjct  61   ARQMHGLARTLVANMVDGVSQGFQRRLEIQGVGYRAAVQGRNLTLNVGYSHPVQIEPPEG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +Q+ VE NT + V+G+DK  +G  AA IR  RPPEPYKGKG++Y+ E +RR
Sbjct  121  IQIAVENNTNVIVTGFDKELVGNTAAKIRDVRPPEPYKGKGIRYSGEFVRR  171



>ref|WP_011317570.1| 50S ribosomal protein L6 [Anabaena variabilis]
 sp|Q3MFA7.1|RL6_ANAVT RecName: Full=50S ribosomal protein L6 [Anabaena variabilis ATCC 
29413]
 gb|ABA20329.1| LSU ribosomal protein L6P [Anabaena variabilis ATCC 29413]
Length=182

 Score =   184 bits (468),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 122/171 (71%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+PI VP+ V + ++G    VKGP GEL    P  V +  +E   L+V +  ETR 
Sbjct  2    SRIGKRPITVPAKVQVTIDGTKVVVKGPKGELSRELPVNVSV-SQEGETLQVTRRDETRT  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            + ++HGL RTL  NM+ GVS+GF ++L++ GVGYRA V+G++++LN+G+SH V++  PDG
Sbjct  61   SRQLHGLSRTLVANMVEGVSQGFQRRLEIQGVGYRAQVQGRNLILNMGYSHQVQIEPPDG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +Q  VE NT + VSGYDK  +G  AA IR  RPPEPYKGKG++YA EV+RR
Sbjct  121  IQFAVENNTNVIVSGYDKEIVGNTAAKIRAVRPPEPYKGKGIRYAGEVVRR  171



>ref|WP_010998339.1| 50S ribosomal protein L6 [Nostoc sp. PCC 7120]
 sp|Q8YPJ3.1|RL6_NOSS1 RecName: Full=50S ribosomal protein L6 [Nostoc sp. PCC 7120]
 dbj|BAB75900.1| 50S ribosomal protein L6 [Nostoc sp. PCC 7120]
Length=182

 Score =   184 bits (467),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 122/171 (71%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+PI VP+ V + ++G    VKGP GEL    P  V +  +E   L+V +  ETR 
Sbjct  2    SRIGKRPITVPAKVQVTIDGTKVVVKGPKGELSRELPANVSV-SQEGETLQVTRRDETRT  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            + ++HGL RTL  NM+ GVS+GF ++L++ GVGYRA V+G+++VLN+G+SH V++  PDG
Sbjct  61   SRQLHGLSRTLVANMVEGVSQGFQRRLEIQGVGYRAQVQGRNLVLNMGYSHQVQIEPPDG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +Q  VE NT + VSGYDK  +G  AA +R  RPPEPYKGKG++YA EV+RR
Sbjct  121  IQFVVENNTNVIVSGYDKEIVGNTAAKVRAVRPPEPYKGKGIRYAGEVVRR  171



>ref|WP_017310480.1| MULTISPECIES: 50S ribosomal protein L6 [Stigonematales]
 gb|KIY13455.1| 50S ribosomal protein L6 [Mastigocladus laminosus UU774]
Length=182

 Score =   184 bits (467),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 122/171 (71%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+PI VP+ V +  +     VKGP GEL    P  V L  +E  +L V +  E+R 
Sbjct  2    SRIGKRPITVPAKVQVTFDNTKVVVKGPKGELSRELPANVILS-QEGEILTVNRRDESRV  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            + ++HGLFRTL  NM+ GVSKGF+++L++ GVGYRA V+G+++V+N+G+SH V++  P+G
Sbjct  61   SRQLHGLFRTLVSNMVEGVSKGFERRLEIQGVGYRAQVQGRNLVMNMGYSHQVQIVPPEG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +Q  VE NT + VSGYDK  +G  AA IR  RPPEPYKGKG++YA EV+RR
Sbjct  121  VQFAVENNTNVIVSGYDKEIVGNTAAKIRAVRPPEPYKGKGIRYAGEVVRR  171



>ref|WP_012593618.1| MULTISPECIES: 50S ribosomal protein L6 [Cyanothece]
 sp|B7K234.1|RL6_CYAP8 RecName: Full=50S ribosomal protein L6 [Cyanothece sp. PCC 8801]
 gb|ACK64341.1| ribosomal protein L6 signature 1 [Cyanothece sp. PCC 8801]
 gb|ACU99203.1| ribosomal protein L6 [Cyanothece sp. PCC 8802]
Length=179

 Score =   184 bits (467),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 121/171 (71%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+PIP+P+ VTI ++GQ   VKGP G L  T P +V + +E   +L V++  ++R 
Sbjct  2    SRIGKRPIPIPNKVTIDIQGQHVAVKGPKGSLERTLPDKVNVVQENDTLL-VQREDDSRT  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A E HGL RTL  NM+ GVSKGF+K+L + GVGYRA V+G  + LN+G+S PV M +P G
Sbjct  61   ARERHGLTRTLVANMVEGVSKGFEKRLSIQGVGYRAQVQGTKLTLNVGYSKPVEMTMPAG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +QV VE NT + VSG DK  +G  +A IR  RPPE YKGKG++Y+DE +RR
Sbjct  121  IQVAVENNTLVIVSGIDKEIVGNVSAEIRAVRPPEVYKGKGIRYSDEFVRR  171



>ref|WP_002780093.1| 50S ribosomal protein L6 [Microcystis aeruginosa]
 emb|CCI11964.1| 50S ribosomal subunit protein L6 [Microcystis aeruginosa PCC 
9806]
Length=189

 Score =   184 bits (468),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 120/171 (70%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+PIP+P+ VT+ ++G    VKGP G L  T P  V ++K+   +L  R+  ++R 
Sbjct  2    SRIGKRPIPIPNKVTVDIDGATVTVKGPKGTLQRTLPTAVAIDKDGETLLVTRQD-DSRT  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A E HGL RTL  NM+ GV+ GF K+L + GVGYRA  +G  +VLN+G+S PV M +PDG
Sbjct  61   ARERHGLCRTLVANMVEGVATGFQKRLDIQGVGYRAQAQGSKLVLNVGYSKPVEMEMPDG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            + V VE NT++ VSG DK A+G  AA IR+ RPPEPYKGKG++Y  EV+RR
Sbjct  121  VSVAVENNTQVIVSGIDKEAVGNTAAKIREVRPPEPYKGKGIRYLGEVVRR  171



>ref|WP_002746609.1| 50S ribosomal protein L6 [Microcystis aeruginosa]
 emb|CAO89799.1| rplF [Microcystis aeruginosa PCC 7806]
 gb|ELS46360.1| ribosomal protein L6 [Microcystis aeruginosa DIANCHI905]
Length=186

 Score =   184 bits (467),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 119/171 (70%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+PIP+P+ VT+ ++G    VKGP G L  T P  V + K+   +L  R+  ++R 
Sbjct  2    SRIGKRPIPIPNKVTVDIDGATVTVKGPKGTLQRTLPTAVTINKDGETILVTRQD-DSRT  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A E HGL RTL  NM+ GV+ GF K+L + GVGYRA  +G  +VLN+G+S PV M +PDG
Sbjct  61   ARERHGLCRTLVANMVEGVATGFQKRLDIQGVGYRAQAQGSKLVLNVGYSKPVEMEMPDG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            + V VE NT++ VSG DK A+G  AA IR+ RPPEPYKGKG++Y  EV+RR
Sbjct  121  VSVAVENNTQVIVSGIDKEAVGNTAAKIREVRPPEPYKGKGIRYLGEVVRR  171



>ref|WP_006196730.1| 50S ribosomal protein L6 [Nodularia spumigena]
 gb|EAW45073.1| 50S ribosomal protein L6 [Nodularia spumigena CCY9414]
 gb|AHJ30666.1| LSU ribosomal protein L6p (L9e) [Nodularia spumigena CCY9414]
Length=182

 Score =   184 bits (467),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 122/171 (71%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGKQPI +P+ V + ++G    VKGP G+L  T    V +  +E G+L V +  ETR 
Sbjct  2    SRIGKQPITIPAKVEVTIDGPKVVVKGPKGQLSRTLSANV-IVSQEGGILNVTRRDETRV  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            + +MHGL RTL  NM+ GVS+GF ++L++ GVGYRA ++G+++VLN+G+SH V +  PDG
Sbjct  61   SRQMHGLSRTLVANMVEGVSQGFKRRLEIQGVGYRAQLQGRNLVLNIGYSHQVNIVPPDG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            ++  VE NT I VSGYDK  +G  AA IR  RPPEPYKGKG++YA EV+RR
Sbjct  121  VEFLVETNTNIVVSGYDKEIVGNTAAKIRAVRPPEPYKGKGIRYAGEVVRR  171



>ref|WP_029639091.1| 50S ribosomal protein L6 [alpha proteobacterium Mf 1.05b.01]
Length=177

 Score =   184 bits (466),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 94/171 (55%), Positives = 120/171 (70%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGKQPI VP  VT+ ++GQ+  VKGP GE+ +T   EV L + + G L V    ET+R
Sbjct  2    SRIGKQPIAVPGGVTVNIDGQNLAVKGPKGEMSMTLVDEVTLAQGDDG-LTVTPRDETQR  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A  M G+ RTL  N++ GV++GF K+L++ GVGYRA ++GKD+ L LGFSH V   IP+G
Sbjct  61   ARAMWGMQRTLVQNIVTGVTEGFTKRLEINGVGYRAQMQGKDLQLALGFSHEVVHKIPEG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +QVK  + T I +SG DK  +GQ AA IR +RPPEPYKGKGVKY DE I R
Sbjct  121  IQVKTPKPTEIEISGMDKQTVGQVAAEIRAYRPPEPYKGKGVKYEDEYIFR  171



>ref|YP_009029516.1| ribosomal protein L6 (chloroplast) [Lithodesmium undulatum]
 gb|AGH29047.1| ribosomal protein L6 (chloroplast) (chloroplast) [Lithodesmium 
undulatum]
Length=179

 Score =   184 bits (466),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 116/171 (68%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK PI VP+NV + +   D  VKG  G L  T P  ++++++E  ++   K  ETR 
Sbjct  2    SRIGKLPIKVPANVDVNLNELDIIVKGKFGTLQNTIPEVLQVKQDEDKLIVTVKN-ETRT  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
               +HGL+RTL +NM++GVS+ F   L L GVGYRA V+   IVLNLG+SHPV+M IPDG
Sbjct  61   NRALHGLYRTLINNMVIGVSEQFQLTLNLQGVGYRAAVQSNSIVLNLGYSHPVKMTIPDG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            + V+V +NT I +   DK  +G FAA IR WRPPEPYKGKG+ Y DEV+ R
Sbjct  121  ISVEVVQNTTINLQACDKEQLGLFAAKIRTWRPPEPYKGKGILYKDEVVNR  171



>ref|WP_028191074.1| 50S ribosomal protein L6 [Salinispora arenicola]
Length=180

 Score =   184 bits (466),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 118/171 (69%), Gaps = 0/171 (0%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIG++ IPVP+ V + ++GQ  KVKGP GEL  T    + +E+ E G L V +  + R+
Sbjct  2    SRIGRKSIPVPAGVDVTIDGQTVKVKGPKGELSHTLAEPITVERAEDGQLNVARPNDERK  61

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A E+HGL RTL  NMIVGV++G+ K L++ G GYR   +GKD+   LGFSHPV +  PDG
Sbjct  62   AKELHGLSRTLVANMIVGVTEGYRKSLEIAGTGYRVTAKGKDLEFALGFSHPVTVVAPDG  121

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +   VE+ T   V+G +K  +G+ AA+IRK RPPEPYKGKGVKY  EVIRR
Sbjct  122  ITFSVEKPTLFHVAGINKQLVGEVAANIRKIRPPEPYKGKGVKYQGEVIRR  172



>ref|WP_011612508.1| 50S ribosomal protein L6 [Trichodesmium erythraeum]
 sp|Q110C1.1|RL6_TRIEI RecName: Full=50S ribosomal protein L6 [Trichodesmium erythraeum 
IMS101]
 gb|ABG52153.1| LSU ribosomal protein L6P [Trichodesmium erythraeum IMS101]
Length=179

 Score =   184 bits (466),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/170 (53%), Positives = 123/170 (72%), Gaps = 1/170 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK PIP+P  VTI +EGQ   VKGPLGEL    P E+ ++++E+ ++ V+   ++RR
Sbjct  2    SRIGKLPIPIPKKVTITIEGQKVTVKGPLGELSRVLPPEIAVKEQENTII-VKPQEQSRR  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A + +GL RTL  NM+ GVSKG++K+L + GVGYRA V+GK +VLN+G+S PV M  P+G
Sbjct  61   ARQRYGLCRTLVANMVEGVSKGYEKRLVIQGVGYRAQVQGKTLVLNVGYSKPVEMPAPEG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIR  117
            + + VE NT + V+G +K  +G  AA IR  RPPE YKGKGV+YA EVI+
Sbjct  121  INIAVENNTNVIVNGINKELVGNTAAKIRAVRPPEVYKGKGVRYAGEVIK  170



>ref|WP_026722080.1| 50S ribosomal protein L6 [Fischerella sp. PCC 9431]
Length=182

 Score =   184 bits (466),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 122/171 (71%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+PI VP+ V +  +     VKGP GEL    P  V L  +E  +L V +  E+R 
Sbjct  2    SRIGKRPITVPAKVQVTFDNAKVVVKGPKGELSRELPANVIL-SQEGEILTVNRRDESRV  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            + ++HGLFRTL  NM+ GVSKGF+++L++ GVGYRA V+G+++V+N+G+SH V++  P+G
Sbjct  61   SRQLHGLFRTLVANMVEGVSKGFERRLEIQGVGYRAQVQGRNLVMNMGYSHQVQIVPPEG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +Q  VE NT + VSGYDK  +G  AA IR  RPPEPYKGKG++YA EV+RR
Sbjct  121  VQFAVENNTNVIVSGYDKEVVGNTAARIRAVRPPEPYKGKGIRYAGEVVRR  171



>ref|WP_015186046.1| 50S ribosomal protein L6 [Microcoleus sp. PCC 7113]
 gb|AFZ21918.1| LSU ribosomal protein L6P [Microcoleus sp. PCC 7113]
Length=179

 Score =   184 bits (466),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 122/171 (71%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+PI VP  VT+ ++GQ   VKGP GEL    P +V +E ++   LRV +  E+R 
Sbjct  2    SRIGKRPITVPGKVTVNIDGQHVAVKGPKGELSRILPEQVAIE-QDGETLRVVRRDESRA  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A + HGL RTL  NM+ GVS+GF+K+L + GVGYRA V+G++++LN+G+S PV +  PDG
Sbjct  61   ARQRHGLSRTLVANMVEGVSQGFEKRLSIQGVGYRAQVQGRNLILNVGYSKPVEIVPPDG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +QV VE N  + VSG +K  +G  AA IR  RPPE YKGKG++YA+EV+RR
Sbjct  121  IQVAVENNVNVIVSGINKEIVGNTAARIRAVRPPEVYKGKGIRYANEVVRR  171



>ref|WP_006515901.1| 50S ribosomal protein L6 [Leptolyngbya sp. PCC 7375]
 gb|EKV01506.1| LSU ribosomal protein L6P [Leptolyngbya sp. PCC 7375]
Length=178

 Score =   183 bits (465),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 94/171 (55%), Positives = 117/171 (68%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+P+PVPS VT+ +  Q   VKGP GEL    P EV + +E   V+  R+  E+R 
Sbjct  2    SRIGKKPVPVPSGVTVSINAQSVVVKGPKGELSRILPGEVNITQEGEQVIVTRQD-ESRA  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A   HGL RTL  NM+ GVSKGF+K+L++ GVGYRA V+GK + +NLG+SHPV    P G
Sbjct  61   ARACHGLSRTLIANMVEGVSKGFEKRLEIKGVGYRAAVKGKTLNMNLGYSHPVEFEPPKG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +  KVE NT I VSG DK  +G  AA IR  RPPEPYKGKGV+Y  E++RR
Sbjct  121  IDFKVENNTNIIVSGIDKELVGTVAAKIRDARPPEPYKGKGVRYLGEMVRR  171



>ref|WP_035156543.1| 50S ribosomal protein L6 [Calothrix sp. 336/3]
 gb|KFB85343.1| 50S ribosomal protein L6 [Calothrix sp. 336/3]
Length=182

 Score =   184 bits (466),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 88/171 (51%), Positives = 123/171 (72%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+PI VP+ V IK++G    VKGP GEL    P +V +  +E   L V +  ++R 
Sbjct  2    SRIGKRPIAVPAKVEIKIDGTKIVVKGPKGELSRELPTQVSVS-QEGQTLTVERKDDSRV  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            + +MHGL RTL  NM+ GVS+GF ++L++ GVGYRA V+G+++V+N+G+SH V++  P+G
Sbjct  61   SRQMHGLSRTLVANMVEGVSQGFQRRLEIQGVGYRAQVQGRNLVMNMGYSHQVQIVPPEG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +Q  VE NT + V+GYDK  +G  AA IR  RPPEPYKGKG++YA EV+RR
Sbjct  121  IQFAVENNTNVIVTGYDKEIVGNTAAKIRAVRPPEPYKGKGIRYAGEVVRR  171



>ref|WP_017748883.1| 50S ribosomal protein L6 [Scytonema hofmanni]
Length=181

 Score =   184 bits (466),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 123/171 (72%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+PI VP+ V + ++G    VKGP GEL    P +V +  +E  +L+V +  ++R 
Sbjct  2    SRIGKRPINVPAKVQVTIDGAKVVVKGPKGELSRELPTQVTVS-QEGEILQVNRRDDSRV  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            + +MHGL RTL  NM+ GVS+GF ++L++ GVGYRA V+G+++VLN+G+SH V++  P+G
Sbjct  61   SRQMHGLSRTLVSNMVEGVSQGFQRRLEIQGVGYRAAVQGRNLVLNMGYSHQVQIVPPEG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +Q  VE NT + VSGYDK  +G  AA IR  RPPEPYKGKG++YA E +RR
Sbjct  121  IQFAVENNTNVIVSGYDKEVVGNIAAKIRDVRPPEPYKGKGIRYAGEAVRR  171



>ref|WP_030473453.1| 50S ribosomal protein L6 [Lechevalieria aerocolonigenes]
Length=179

 Score =   183 bits (465),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 88/171 (51%), Positives = 120/171 (70%), Gaps = 0/171 (0%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGKQPI VPS V + + GQD  VKGP G L +T    + LEK E G L V++  + RR
Sbjct  2    SRIGKQPIIVPSGVDVNIAGQDVSVKGPKGTLTLTIAEPISLEKAEDGTLEVKRPNDERR  61

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
               +HGL RTL  NM+VGV++G++KK+++ GVGYR  ++G ++   LG+SHPV++  P+G
Sbjct  62   NRALHGLSRTLVHNMVVGVTQGYEKKMEIHGVGYRVALKGSELEFALGYSHPVKVEAPEG  121

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +   VE  TR +VSG DK  +G+ AA+IRK R P+PYKGKGV+Y+ E IRR
Sbjct  122  ITFAVETPTRFSVSGIDKQLVGEVAANIRKLRKPDPYKGKGVRYSGEKIRR  172



>ref|WP_035991895.1| 50S ribosomal protein L6 [Leptolyngbya sp. KIOST-1]
Length=179

 Score =   183 bits (465),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 92/171 (54%), Positives = 122/171 (71%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+PIPVP+ V+I ++GQD +VKGP GEL  T P  V + +E   VL V +  ++R 
Sbjct  2    SRIGKRPIPVPAKVSITIDGQDVQVKGPKGELSRTLPSGVVVVQEGDTVL-VNRRDDSRL  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A E HGL RTL  NM+ GV+ G+ K+L++ G+GYRA V+G+++ L+LG+SHPV    P G
Sbjct  61   ARERHGLCRTLVANMVEGVANGYQKRLEIQGIGYRAQVQGRNLNLSLGYSHPVVFEPPAG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            ++  VE NT + VSG DK  +G  AASIR  RPPEPYKGKGV+YA E +RR
Sbjct  121  IEFAVENNTNVIVSGIDKELVGNIAASIRASRPPEPYKGKGVRYAGEQVRR  171



>ref|WP_002733352.1| 50S ribosomal protein L6 [Microcystis aeruginosa]
 gb|ELP56436.1| ribosomal protein L6 [Microcystis aeruginosa TAIHU98]
Length=189

 Score =   184 bits (466),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 119/171 (70%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+PIP+P+ VT+ ++G    VKGP G L  T P  V + K+   +L  R+  ++R 
Sbjct  2    SRIGKRPIPIPNKVTVDIDGATVTVKGPKGTLQRTLPTAVAINKDGETLLVTRQD-DSRT  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A E HGL RTL  NM+ GV+ GF K+L + GVGYRA  +G  +VLN+G+S PV M +PDG
Sbjct  61   ARERHGLCRTLVANMVEGVATGFQKRLDIQGVGYRAQAQGSKLVLNVGYSKPVEMEMPDG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            + V VE NT++ VSG DK A+G  AA IR+ RPPEPYKGKG++Y  EV+RR
Sbjct  121  VSVAVENNTQVIVSGIDKEAVGNTAAKIREVRPPEPYKGKGIRYLGEVVRR  171



>ref|WP_018908047.1| 50S ribosomal protein L6 [Salinispora arenicola]
Length=180

 Score =   183 bits (465),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 118/171 (69%), Gaps = 0/171 (0%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIG++ IPVP+ V + ++GQ  KVKGP GEL  T    + +E+ E G L V +  E R+
Sbjct  2    SRIGRKSIPVPAGVDVTIDGQTVKVKGPKGELSHTLAEPITVERAEDGQLNVARPNEERK  61

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A E+HGL RTL  NMIVGV++G+ K L++ G GYR   +GKD+   LGFSHPV +  P+G
Sbjct  62   AKELHGLSRTLVANMIVGVTEGYRKSLEIAGTGYRVTAKGKDLEFALGFSHPVTVVAPEG  121

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +   VE+ T   V+G +K  +G+ AA+IRK RPPEPYKGKGVKY  EVIRR
Sbjct  122  ITFSVEKPTLFHVAGINKQLVGEVAANIRKIRPPEPYKGKGVKYQGEVIRR  172



>ref|WP_007356156.1| MULTISPECIES: 50S ribosomal protein L6 [Kamptonema]
 emb|CBN56952.1| 50S ribosomal protein L6 [ [[Oscillatoria] sp. PCC 6506]
Length=181

 Score =   183 bits (465),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 120/171 (70%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+PI +PS VT+ ++GQ   VKGP GEL    P EV LE E   +L  R+  E+R 
Sbjct  2    SRIGKRPISIPSKVTVTIDGQHVAVKGPKGELSRLLPAEVVLELEGETLLVTRRD-ESRT  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A ++HGL RTL  NM+ GVS GF ++L++ GVGYRA V+G++++LN+G+S PV M  P+G
Sbjct  61   ARQLHGLCRTLVSNMVEGVSNGFQRRLEIQGVGYRAQVQGRNLILNVGYSKPVEMPPPEG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +QV VE N  + VSG DK  +G  AA IR  RPPE YKGKG++Y  EV+RR
Sbjct  121  IQVAVEGNVNVIVSGIDKELVGNTAARIRAVRPPEVYKGKGIRYTGEVVRR  171



>ref|WP_016859434.1| 50S ribosomal protein L6 [Fischerella muscicola]
Length=182

 Score =   183 bits (465),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 122/171 (71%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+PI VP+ V +  +     VKGP GEL    P  V L  +E  +L V +  E+R 
Sbjct  2    SRIGKRPITVPAKVQVTFDNAKVVVKGPKGELSRELPANVILS-QEGEILTVDRRDESRV  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            + ++HGLFRTL  NM+ GVSKGF+++L++ GVGYRA V+G+++V+N+G+SH V++  P+G
Sbjct  61   SRQLHGLFRTLVANMVEGVSKGFERRLEIQGVGYRAQVQGRNLVMNMGYSHQVQIVPPEG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +Q  VE NT + VSGYDK  +G  AA IR  RPPEPYKGKG++YA EV+RR
Sbjct  121  VQFAVENNTNVIVSGYDKEVVGNTAAKIRAVRPPEPYKGKGIRYAGEVVRR  171



>ref|WP_015113417.1| 50S ribosomal protein L6 [Nostoc sp. PCC 7107]
 gb|AFY43203.1| LSU ribosomal protein L6P [Nostoc sp. PCC 7107]
Length=182

 Score =   183 bits (465),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 121/171 (71%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+PI +P+ V I ++G    VKGP GEL    P  V + +E   +  VRK  ++R 
Sbjct  2    SRIGKRPITIPAKVQITIDGTKVVVKGPKGELSRDLPVHVTVSQEGETLQVVRKD-DSRT  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            + +MHGL RTL  NM+ GVS+GF ++L++ GVGYRA V+G+++VLN+GFSH V +  PDG
Sbjct  61   SRQMHGLSRTLVANMVEGVSQGFQRRLEIQGVGYRAQVQGRNLVLNMGFSHQVNIEPPDG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +Q  VE NT + VSGYDK  +G  AA IR  RPPEPYKGKG++YA EV+RR
Sbjct  121  IQFAVEGNTNVIVSGYDKEIVGNTAAKIRAVRPPEPYKGKGIRYAGEVVRR  171



>ref|WP_017314774.1| 50S ribosomal protein L6 [Mastigocladopsis repens]
Length=182

 Score =   183 bits (465),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 122/171 (71%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+PI +P+ V + ++G    VKGP GEL    P  V L  +E   L V +  E+R 
Sbjct  2    SRIGKRPITIPAKVQVTIDGTKVVVKGPKGELSRDLPVNV-LVSQEGETLLVNRRDESRT  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            + ++HGL RTL  NM+ GVS+GF ++L++ GVGYRA V+G+++VLN+G+SH V++A PDG
Sbjct  61   SRQLHGLCRTLVANMVEGVSQGFQRRLEIQGVGYRAQVQGRNLVLNMGYSHQVQIAPPDG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +Q  VE NT + VSGY+K  +G  AA IR  RPPEPYKGKG++YA EV+RR
Sbjct  121  IQFAVENNTNVIVSGYNKEEVGNTAAKIRAVRPPEPYKGKGIRYAGEVVRR  171



>ref|WP_025781338.1| 50S ribosomal protein L6 [Candidatus Synechococcus spongiarum]
Length=179

 Score =   183 bits (464),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 93/172 (54%), Positives = 119/172 (69%), Gaps = 3/172 (2%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGKQP+P+P+NV +++EG+  +VKGP GEL  T P  V +++   G   V       R
Sbjct  2    SRIGKQPVPIPANVQVQLEGRTVQVKGPNGELRRTLPEGVAIDRH--GQTLVVTPTGASR  59

Query  446  ANEM-HGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPD  270
             N M HGL RTL  NM+ GV+KG+ K L++VGVGYRA V+GK +VL+ G+SHPV +A P 
Sbjct  60   MNRMRHGLSRTLVANMVEGVTKGYSKTLEMVGVGYRAQVKGKTLVLSAGYSHPVELAPPQ  119

Query  269  GLQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            G+  KVE NTRITVSG +K A+G  AA +R   PPEPYKGKG+KY  E I R
Sbjct  120  GITYKVENNTRITVSGAEKEAVGNEAAKVRAVSPPEPYKGKGIKYVAETILR  171



>ref|WP_008312941.1| 50S ribosomal protein L6 [Leptolyngbya sp. PCC 6406]
Length=179

 Score =   183 bits (464),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 92/171 (54%), Positives = 119/171 (70%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+PIP+PS VT+ ++GQ   VKGP GEL  T P  V++  +E   L V +  E+R 
Sbjct  2    SRIGKRPIPIPSKVTVSIDGQFVSVKGPKGELSRTLPTGVEI-IQEGDTLLVTRINESRM  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A   HGL RTL  NM+ GVS GF K+L++ GVGYRA ++G+ + ++LG+SHPV    P+G
Sbjct  61   ARARHGLCRTLVANMVEGVSNGFQKRLEIQGVGYRAQIQGQSLNMSLGYSHPVVFNPPEG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +Q  VE NT + VSG DK  +G  AASIR  RPPEPYKGKGV+YA E +RR
Sbjct  121  IQFIVENNTNVVVSGIDKEIVGNVAASIRAARPPEPYKGKGVRYAGEQVRR  171



>ref|WP_011430033.1| 50S ribosomal protein L6 [Synechococcus sp. JA-3-3Ab]
 sp|Q2JQN4.1|RL6_SYNJA RecName: Full=50S ribosomal protein L6 [Synechococcus sp. JA-3-3Ab]
 gb|ABC99352.1| ribosomal protein L6 [Synechococcus sp. JA-3-3Ab]
Length=181

 Score =   182 bits (463),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 121/171 (71%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+PI +P+ V +++EGQ   VKGP GEL  + P  + +  +E+  L+V +  E+R 
Sbjct  2    SRIGKRPIALPAKVEVQIEGQQISVKGPKGELSRSLPPLIAVH-QEAQTLKVSRVNESRP  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A ++HGL RTL  NM+ GVS+GF+++L+LVGVGYRA  +G  ++LN+G+SHPV +  P G
Sbjct  61   ARQLHGLCRTLVANMVDGVSRGFERRLELVGVGYRASTQGNKLILNVGYSHPVEIPFPPG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +Q+ VE N  I VSG DK  +G  AA IR  RPPEPYKGKG++Y  E +RR
Sbjct  121  IQIAVEGNNVIVVSGIDKELVGNTAARIRAVRPPEPYKGKGIRYVGEQVRR  171



>ref|WP_026732530.1| 50S ribosomal protein L6 [Fischerella sp. PCC 9605]
Length=182

 Score =   182 bits (463),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 88/171 (51%), Positives = 123/171 (72%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+PI VP  V + ++     VKGP GEL    P  V +  ++  +L V +  ++R 
Sbjct  2    SRIGKRPITVPPKVQVTLDNSKVVVKGPKGELSRELPVYVTVS-QDGEILTVTRRDDSRI  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            + +MHGLFRTL  NM+ GVSKGF+++L++ GVGYRA V+G++++LN+G+SH V++A P+G
Sbjct  61   SRQMHGLFRTLVANMVEGVSKGFERRLEIQGVGYRAQVQGRNLILNMGYSHQVQIAPPEG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +Q  VE NT + VSGYDK  +G  AA IR  RPPEPYKGKG++YA EV+RR
Sbjct  121  VQFAVENNTNVIVSGYDKEVVGNTAAKIRSVRPPEPYKGKGIRYAGEVVRR  171



>ref|WP_017297633.1| 50S ribosomal protein L6 [Nodosilinea nodulosa]
Length=179

 Score =   182 bits (463),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 92/171 (54%), Positives = 122/171 (71%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+PIPVP+ V+I ++GQD +VKGP GEL  T P  V + ++   +L  RK  ++R 
Sbjct  2    SRIGKRPIPVPAKVSITIDGQDVQVKGPKGELSRTLPSGVVIVQDGDTILVNRKD-DSRI  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A E HGL RTL  NM+ GVS G+ K+L++ G+GYRA V+G+++ L+LG+SHPV    P G
Sbjct  61   ARERHGLCRTLVANMVEGVSNGYQKRLEIQGIGYRAQVQGRNLNLSLGYSHPVVFEPPTG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            ++  VE NT + VSG DK  +G  AASIR  RPPEPYKGKGV+YA E +RR
Sbjct  121  IEFVVENNTNVIVSGIDKELVGNIAASIRASRPPEPYKGKGVRYAGEQVRR  171



>ref|WP_006618086.1| 50S ribosomal protein L6 [Arthrospira platensis]
 dbj|BAI90070.1| 50S ribosomal protein L6 [Arthrospira platensis NIES-39]
 gb|KDR56830.1| 50S ribosomal protein L6 [Arthrospira platensis str. Paraca]
Length=179

 Score =   182 bits (463),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 120/171 (70%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+PIP+P+ VT+ ++GQ   VKGP GEL    P EV L  E    L V++  E+  
Sbjct  2    SRIGKRPIPIPAKVTLTLDGQKVTVKGPKGELSRVLPNEVILSLE-GDTLIVKRRDESLV  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A + HGL RTL  NM+ GVS+GF+++L++ GVGYRA V+GK+++LN+G+S PV M  P+G
Sbjct  61   ARQRHGLCRTLVANMVDGVSQGFERRLEIQGVGYRAQVQGKNLILNVGYSKPVEMVPPEG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
              V VE NT + VSG +K  +G  AA IR  RPPEPYKGKG++YA E +RR
Sbjct  121  CSVAVENNTNVIVSGINKELVGNMAAKIRAVRPPEPYKGKGIRYAGEQVRR  171



>emb|CCQ65151.1| LSU ribosomal protein L6p (L9e) [Crocosphaera watsonii WH 0402]
Length=180

 Score =   182 bits (462),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 91/172 (53%), Positives = 122/172 (71%), Gaps = 2/172 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+PIP+P+ VTI ++GQ   VKGP G L +  P +V +++E   V+ V    ++R 
Sbjct  2    SRIGKKPIPLPNKVTIDIKGQHIAVKGPKGSLELDLPSKVSVKQEGENVV-VTTDDDSRT  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A E HGL RTL  NM+ GVSKGF+K+L + GVGYRA  +G  + LN+G+S+PV M +P G
Sbjct  61   ARERHGLSRTLVANMVEGVSKGFEKRLSIQGVGYRAQAQGTKLTLNVGYSNPVEMTMPKG  120

Query  266  LQVKVEEN-TRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            + VKVE N T +TVSG +K  +G  AA+IR  RPPEPYKGKG++Y DE +RR
Sbjct  121  VNVKVENNFTMVTVSGINKEVVGNTAATIRAVRPPEPYKGKGIRYVDEFVRR  172



>ref|WP_026797653.1| MULTISPECIES: 50S ribosomal protein L6 [Planktothrix]
 gb|KEI65642.1| RplF [Planktothrix agardhii NIVA-CYA 126/8]
Length=182

 Score =   182 bits (462),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 121/171 (71%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+PI VP  VT+ + GQ   VKGP GEL    P EV +E++   V  V++A E+R 
Sbjct  2    SRIGKRPISVPKQVTLTINGQQVIVKGPKGELSRVLPPEVVVEQDGETV-NVKRASESRT  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A + HGL RTL  NM+ GVS GF+++L++ GVGYRA V+G ++VLN+G+S PV M  P+G
Sbjct  61   ARQRHGLCRTLVFNMVEGVSNGFERRLEIQGVGYRAAVQGTNLVLNVGYSKPVEMIPPEG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            ++V VE NT + +SG DK  +G  AA +R  RPPEPYKGKG++Y  EV+RR
Sbjct  121  IRVAVENNTNVIISGIDKEIVGNMAAKVRAVRPPEPYKGKGIRYQGEVVRR  171



>ref|WP_016953005.1| 50S ribosomal protein L6 [Anabaena sp. PCC 7108]
Length=182

 Score =   182 bits (462),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/171 (51%), Positives = 121/171 (71%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+PI VP+ V + ++G    +KGP GEL    P  V + +E   +L  R+  ETR 
Sbjct  2    SRIGKRPITVPAKVQVAIDGTSVVIKGPKGELSRILPANVTVSQEGETLLVTRRD-ETRT  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            + ++HGL RTL  NM+ GVS+GF ++L++ GVGYRA V+G+++VLN+G+SH V++  PDG
Sbjct  61   SRQLHGLSRTLVANMVEGVSQGFQRRLEIQGVGYRAQVQGRNLVLNMGYSHQVQIEPPDG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +Q  VE  T + VSGYDK  +G  AA IR  RPPEPYKGKG++YA EV+RR
Sbjct  121  IQFAVEGTTNVIVSGYDKEIVGNTAAKIRAVRPPEPYKGKGIRYAGEVVRR  171



>ref|WP_027254766.1| 50S ribosomal protein L6 [Planktothrix agardhii]
Length=182

 Score =   182 bits (462),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 121/171 (71%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+PI VP  VT+ + GQ   VKGP GEL    P EV +E++   V  V++A E+R 
Sbjct  2    SRIGKRPISVPKQVTLTINGQQVIVKGPKGELSRVLPPEVVVEQDGETV-NVKRASESRT  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A + HGL RTL  NM+ GVS GF+++L++ GVGYRA V+G ++VLN+G+S PV M  P+G
Sbjct  61   ARQRHGLCRTLVFNMVEGVSNGFERRLEIQGVGYRAAVQGANLVLNVGYSKPVEMIPPEG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            ++V VE NT + +SG DK  +G  AA +R  RPPEPYKGKG++Y  EV+RR
Sbjct  121  IRVAVENNTNVIISGIDKEIVGNMAAKVRAVRPPEPYKGKGIRYLGEVVRR  171



>ref|WP_026786891.1| MULTISPECIES: 50S ribosomal protein L6 [Planktothrix]
Length=182

 Score =   182 bits (462),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 121/171 (71%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+PI VP  VT+ + GQ   VKGP GEL    P EV +E++   V  V++A E+R 
Sbjct  2    SRIGKRPISVPKQVTLTINGQQVIVKGPKGELSRVLPPEVVVEQDGETV-NVKRASESRT  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A + HGL RTL  NM+ GVS GF+++L++ GVGYRA V+G ++VLN+G+S PV M  P+G
Sbjct  61   ARQRHGLCRTLVFNMVEGVSNGFERRLEIQGVGYRAAVQGTNLVLNVGYSKPVEMIPPEG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            ++V VE NT + +SG DK  +G  AA +R  RPPEPYKGKG++Y  EV+RR
Sbjct  121  IRVAVENNTNVIISGIDKEIVGNMAAKVRAVRPPEPYKGKGIRYLGEVVRR  171



>ref|WP_025729639.1| 50S ribosomal protein L6 [Atopobacter phocae]
Length=178

 Score =   182 bits (461),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 83/171 (49%), Positives = 122/171 (71%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK  I VPSNV +K++  + +VKGP GEL  TY   + +E  ++ ++ V +  E + 
Sbjct  2    SRIGKMIIEVPSNVEVKIDNNEVQVKGPKGELSYTYSPSLTVEMNDN-IISVTRHDENKT  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
               +HG  R L +NM++GV++GF K+L L+GVGYRA ++G  +VLN+G+SHPV  +IP+G
Sbjct  61   TRALHGTTRALINNMVIGVTEGFKKELDLIGVGYRAQLQGSTLVLNVGYSHPVEFSIPEG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            L ++V  NT++ VSGYDK  +G+F+A +R  RPPEPYKGKG++Y DE + R
Sbjct  121  LLIEVPSNTKVIVSGYDKHKVGEFSAKVRAVRPPEPYKGKGIRYTDEYVIR  171



>ref|WP_016877819.1| 50S ribosomal protein L6 [Chlorogloeopsis fritschii]
Length=182

 Score =   182 bits (462),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 121/171 (71%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+PI VP+ V + ++G    VKGP GEL    P  V +  +E  +L V +  ++R 
Sbjct  2    SRIGKRPIAVPAKVQVTVDGTKVSVKGPKGELSRELPNNV-IVSQEGEILTVNRRDDSRT  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            + +MHGL RTL  NM+ GVSKGF+++L++ GVGYRA V+G+++VLN+G+SH V++  P+G
Sbjct  61   SRQMHGLSRTLVANMVEGVSKGFERRLEIQGVGYRAQVQGRNLVLNMGYSHQVQIVPPEG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +   VE NT + VSGYDK  +G  AA IR  RPPEPYKGKG++YA E +RR
Sbjct  121  VNFAVENNTNVIVSGYDKEVVGNTAAKIRAVRPPEPYKGKGIRYAGEAVRR  171



>ref|WP_017651207.1| 50S ribosomal protein L6 [Microchaete sp. PCC 7126]
Length=182

 Score =   182 bits (462),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/171 (51%), Positives = 122/171 (71%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+PI +P+ V + ++G    VKGP GEL    P  V +  +E  VL+V +  ETR 
Sbjct  2    SRIGKRPITIPAKVQVAIDGTKVVVKGPKGELSRNLPANV-IVSQEGEVLQVTRRDETRT  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            + ++HGL RTL  NM+ GVS+GF ++L++ GVGYRA V+G+++VLN+G+SH V++  P+G
Sbjct  61   SRQLHGLSRTLVANMVEGVSQGFQRRLEIQGVGYRAQVQGRNLVLNMGYSHQVQIEPPEG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +Q  VE  T + VSGYDK  +G  AA IR  RPPEPYKGKG++YA EV+RR
Sbjct  121  IQFAVEGTTNVIVSGYDKEIVGNIAAKIRAVRPPEPYKGKGIRYAGEVVRR  171



>ref|WP_002757583.1| 50S ribosomal protein L6 [Microcystis aeruginosa]
 emb|CCI00544.1| 50S ribosomal subunit protein L6 [Microcystis aeruginosa PCC 
9717]
Length=189

 Score =   182 bits (462),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 119/171 (70%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+PIP+P+ VT+ ++G    VKGP G L  T P  V + K+   +L  R+  ++R 
Sbjct  2    SRIGKRPIPIPNKVTVDIDGATVTVKGPKGTLQRTLPTAVAINKDGETLLVTRQD-DSRT  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A E HGL RTL  NM+ GV+ GF K+L + GVGYRA  +G  +VLN+G+S PV M +PDG
Sbjct  61   ARERHGLCRTLVANMVEGVATGFQKRLDIQGVGYRAQAQGSKLVLNVGYSKPVEMEMPDG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            + V VE +T++ VSG DK A+G  AA IR+ RPPEPYKGKG++Y  EV+RR
Sbjct  121  VSVAVENSTQVIVSGIDKEAVGNIAAKIREVRPPEPYKGKGIRYLGEVVRR  171



>ref|WP_027654160.1| 50S ribosomal protein L6 [Salinispora pacifica]
Length=180

 Score =   182 bits (461),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 117/171 (68%), Gaps = 0/171 (0%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIG++ IPVP+ V + + GQ   VKGP GEL  T    + +E+ E G L V +  + R+
Sbjct  2    SRIGRKSIPVPAGVDVTIAGQTVTVKGPKGELSHTIAEPITIERAEDGQLNVARPNDERK  61

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A E+HGL RTL  NMI+GV++G+ K L++ G GYR   +GKD+   LGFSHPV +A PDG
Sbjct  62   AKELHGLSRTLVANMIIGVTEGYRKSLEIAGTGYRVTAKGKDLEFALGFSHPVIVAAPDG  121

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +   VE+ T   V+G +K  +G+ AA+IRK RPPEPYKGKGVKY  EVIRR
Sbjct  122  ITFSVEKPTLFHVAGINKQLVGEVAANIRKIRPPEPYKGKGVKYQGEVIRR  172



>ref|WP_043368788.1| 50S ribosomal protein L6 [Cyanobium sp. PCC 7001]
Length=179

 Score =   182 bits (461),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 92/171 (54%), Positives = 116/171 (68%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK PIPVP  VT+ + G    VKGP GEL  T P  V + +E S ++ V    E+RR
Sbjct  2    SRIGKAPIPVPDKVTVSLSGLAVTVKGPKGELSRTLPEGVSVAQEGSTIV-VSPTSESRR  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            + E HGL RTL  NM+ GVS+G+ +KL++VGVGYRA V+GK +V++ G+SHPV M  PDG
Sbjct  61   SRERHGLCRTLVANMVEGVSQGYTRKLEIVGVGYRAAVQGKKLVVSAGYSHPVEMVPPDG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +   VE  T + VSG DK  +G  AA +R  RPPEPYKGKG+KYA E I R
Sbjct  121  VTFTVEGTTTVLVSGADKELVGNEAAKVRAIRPPEPYKGKGIKYAGERILR  171



>ref|WP_012184316.1| 50S ribosomal protein L6 [Salinispora arenicola]
 sp|A8M514.1|RL6_SALAI RecName: Full=50S ribosomal protein L6 [Salinispora arenicola 
CNS-205]
 gb|ABW00082.1| ribosomal protein L6 [Salinispora arenicola CNS-205]
Length=180

 Score =   182 bits (461),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 118/171 (69%), Gaps = 0/171 (0%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIG++ IPVP+ V + ++GQ  KVKGP GEL  T    + +E+ E G L V +  + R+
Sbjct  2    SRIGRKSIPVPAGVDVTIDGQTVKVKGPKGELSHTLAEPITVERAEDGQLNVARPNDERK  61

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A E+HGL RTL  NMIVGV++G+ K L++ G GYR   +GKD+   LGFSHPV +  P+G
Sbjct  62   AKELHGLSRTLVANMIVGVTEGYRKSLEIAGTGYRVTAKGKDLEFALGFSHPVTVVAPEG  121

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +   VE+ T   V+G +K  +G+ AA+IRK RPPEPYKGKGVKY  EVIRR
Sbjct  122  ITFSVEKPTLFHVAGINKQLVGEVAANIRKIRPPEPYKGKGVKYQGEVIRR  172



>ref|WP_012410711.1| 50S ribosomal protein L6 [Nostoc punctiforme]
 sp|B2ITP1.1|RL6_NOSP7 RecName: Full=50S ribosomal protein L6 [Nostoc punctiforme PCC 
73102]
 gb|ACC82749.1| ribosomal protein L6 [Nostoc punctiforme PCC 73102]
Length=182

 Score =   182 bits (461),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/171 (51%), Positives = 121/171 (71%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+PI +P+ V + + G +  VKGP GEL  T    V L  +E  +L V +  ETR 
Sbjct  2    SRIGKRPITIPAKVQVAINGTNIVVKGPKGELSRTLRDNVSLS-QEGEILHVNRRDETRT  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            + ++HGL RTL  NM+ GVS+GF ++L++ GVGYRA ++G+++VLN+G+SH V++  PDG
Sbjct  61   SKQLHGLSRTLVANMVEGVSQGFQRRLEIQGVGYRAQLQGRNLVLNMGYSHQVQIEPPDG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +Q  VE  T + VSGYDK  +G  AA IR  RPPEPYKGKG++YA EV+RR
Sbjct  121  IQFAVEGTTNVIVSGYDKEIVGNTAAKIRAVRPPEPYKGKGIRYAGEVVRR  171



>ref|WP_015105249.1| 50S ribosomal protein L6 [Saccharothrix espanaensis]
 emb|CCH35141.1| 50S ribosomal protein L6 [Saccharothrix espanaensis DSM 44229]
Length=179

 Score =   182 bits (461),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 119/171 (70%), Gaps = 0/171 (0%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK PI VPS V + + GQD  VKGP G L +T    + +EK E G L V++  + RR
Sbjct  2    SRIGKLPITVPSGVDVNIAGQDVNVKGPKGTLSLTIAEPIIIEKVEDGTLEVKRPNDERR  61

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            +  +HGL RTL  NM++GV++G++KK+++ GVGYR  ++G D+   LG+SHPV++  P G
Sbjct  62   SRSLHGLSRTLVQNMVIGVTQGYEKKMEIHGVGYRVALKGSDLEFALGYSHPVKVEAPAG  121

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +   VE  TR +VSG DK  +G+ AA+IRK R P+PYKGKGV+YA E IRR
Sbjct  122  ITFAVETPTRFSVSGIDKQLVGEVAANIRKLRKPDPYKGKGVRYAGEKIRR  172



>ref|WP_013139775.1| 50S ribosomal protein L6 [Segniliparus rotundus]
 gb|ADG99326.1| ribosomal protein L6 [Segniliparus rotundus DSM 44985]
Length=180

 Score =   182 bits (461),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 123/171 (72%), Gaps = 0/171 (0%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIG+ PI VP  V + ++GQ+ KVKGP GELG+T    +K+E+ + GVL V +  + RR
Sbjct  2    SRIGRAPIQVPPGVDVTIDGQNVKVKGPKGELGLTLVEPIKVERGDDGVLSVTRPDDERR  61

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
               +HGL RTL +N++VGV++G+ K+L++VGVGYR   +GKD+   LGFSH V +  P+G
Sbjct  62   NRSLHGLSRTLVNNLVVGVTEGYTKQLEIVGVGYRVQQKGKDLEFALGFSHSVPVQAPEG  121

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +   VE  T+ +VSG DK  +G+ AA+IRK + PEPYKGKG++YA EV+RR
Sbjct  122  VTFAVESPTKFSVSGIDKQKVGEVAANIRKLKKPEPYKGKGIRYAGEVVRR  172



>ref|WP_039727917.1| MULTISPECIES: 50S ribosomal protein L6 [Oscillatoriophycideae]
 gb|KIF15689.1| 50S ribosomal protein L6 [Aphanocapsa montana BDHKU210001]
 gb|KIF40613.1| 50S ribosomal protein L6 [Lyngbya confervoides BDU141951]
Length=179

 Score =   182 bits (461),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 117/171 (68%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+ IPVP+ VT+ ++GQ   VKGP GEL    P  V + + +S V  V  A E+RR
Sbjct  2    SRIGKRAIPVPAKVTVTIDGQAVTVKGPKGELSRVLPEGVVISQADSAVT-VSPASESRR  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            + E HGL RTL  NMI GV+ G+ K+L++ GVGYRA V+G  + ++LG+SHPV    P+G
Sbjct  61   SRERHGLCRTLVANMIEGVTNGYQKRLEIQGVGYRAQVQGTKLNMSLGYSHPVIFEPPEG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +Q  VE NT + VSG DK  +G  AA IR  RPPEPYKGKGV+YA E +RR
Sbjct  121  IQFAVENNTNVIVSGIDKEVVGNIAAKIRDARPPEPYKGKGVRYAGEYVRR  171



>ref|WP_015619007.1| 50S ribosomal protein L6 [Actinoplanes sp. N902-109]
 gb|AGL14449.1| 50S ribosomal protein L6 [Actinoplanes sp. N902-109]
Length=180

 Score =   182 bits (461),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 117/171 (68%), Gaps = 0/171 (0%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIG++ I VP+ V + + GQ  KVKGP GEL  T    + +EK E+G L V +  + R+
Sbjct  2    SRIGRKSITVPAGVDVTISGQTVKVKGPKGELSHTVAEPITVEKAENGELVVNRPNDERK  61

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A E+HGL RTL  NMIVGV++G+ K L++ G GYR   +GKD+   LGFSHPV +  P G
Sbjct  62   AKELHGLSRTLVANMIVGVTEGYKKTLEINGTGYRVTAKGKDLEFALGFSHPVNVPAPAG  121

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +   VE  T+ TV+G DK  +G+ AA+IRK RPPEPYKGKGVKY  EVIRR
Sbjct  122  ITFTVERPTQFTVAGIDKQLVGEVAANIRKIRPPEPYKGKGVKYQGEVIRR  172



>ref|WP_040931604.1| 50S ribosomal protein L6 [Prochloron didemni]
Length=180

 Score =   181 bits (460),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/172 (52%), Positives = 122/172 (71%), Gaps = 2/172 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+PI +P  VT+K+ GQ   VKGP GEL    P  V++ K+E   L VR+  ++R 
Sbjct  2    SRIGKRPIEIPKKVTVKINGQHIAVKGPKGELERVLPALVEV-KQEGETLLVRRENDSRT  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A E HGL RTL  NM+ GV+KGF+K+LQ++GVGYRA  +G  + LN+G+S PV M +P G
Sbjct  61   ARERHGLCRTLVANMVEGVAKGFEKRLQILGVGYRAQAQGSKLTLNVGYSKPVEMTMPKG  120

Query  266  LQVKVEE-NTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +QV+VE+ NT + +SG DK  +G  +A IR  RPPEPYKGKG++Y  E++RR
Sbjct  121  IQVQVEKGNTDLIISGIDKEVVGNISAQIRDVRPPEPYKGKGIRYLGEMVRR  172



>ref|WP_009767984.1| 50S ribosomal protein L6 [Oscillatoriales cyanobacterium JSC-12]
 gb|EKQ68873.1| LSU ribosomal protein L6P [Oscillatoriales cyanobacterium JSC-12]
Length=179

 Score =   181 bits (460),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/169 (52%), Positives = 121/169 (72%), Gaps = 1/169 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+PI +P+ VT+ ++GQ   VKGP GEL    P EV++ +E   VL V +  ++R 
Sbjct  2    SRIGKRPISIPNKVTVVIDGQSVTVKGPKGELSRVLPSEVEVVQEGETVL-VNRRDDSRV  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A + HGL RTL  NM+ GVS+GF ++L++ GVGYRA V+GK++ LN+G+SHPV++  P+G
Sbjct  61   ARQRHGLCRTLVANMVEGVSQGFQRRLEITGVGYRAQVQGKNLTLNMGYSHPVQIEPPEG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVI  120
            +Q  VE NT + V+G DK  +G  AA IR  RPPEPYKGKG++Y  EVI
Sbjct  121  IQFAVENNTNVIVTGIDKEIVGNTAARIRAVRPPEPYKGKGIRYTGEVI  169



>ref|WP_002796422.1| 50S ribosomal protein L6 [Microcystis aeruginosa]
 sp|B0JHY9.1|RL6_MICAN RecName: Full=50S ribosomal protein L6 [Microcystis aeruginosa 
NIES-843]
 dbj|BAG05551.1| 50S ribosomal protein L6 [Microcystis aeruginosa NIES-843]
 emb|CCI23388.1| 50S ribosomal subunit protein L6 [Microcystis aeruginosa PCC 
9809]
Length=189

 Score =   181 bits (460),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 119/171 (70%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+PIP+P+ VT+ ++G    VKGP G L  T P  V + K+   +L  R+  ++R 
Sbjct  2    SRIGKRPIPIPNKVTVDIDGATVTVKGPKGTLQRTLPTAVAINKDGETLLVTRQD-DSRT  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A E HGL RTL  NM+ GV+ GF K+L + GVGYRA  +G  +VLN+G+S PV M +PDG
Sbjct  61   ARERHGLCRTLVANMVEGVATGFQKRLDIQGVGYRAQAQGSKLVLNVGYSKPVEMEMPDG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            + V VE +T++ VSG DK A+G  AA IR+ RPPEPYKGKG++Y  EV+RR
Sbjct  121  VSVAVENSTQVIVSGIDKEAVGNTAAKIREVRPPEPYKGKGIRYLGEVVRR  171



>ref|WP_011628222.1| 50S ribosomal protein L6 [Alkalilimnicola ehrlichii]
 sp|Q0ABG0.1|RL6_ALKEH RecName: Full=50S ribosomal protein L6 [Alkalilimnicola ehrlichii 
MLHE-1]
 gb|ABI55827.1| LSU ribosomal protein L6P [Alkalilimnicola ehrlichii MLHE-1]
Length=177

 Score =   181 bits (459),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/167 (53%), Positives = 119/167 (71%), Gaps = 1/167 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SR+ K+P+ VPS V +K++GQD KVKGP GEL  T    V +E+ + G LRV+  ++ RR
Sbjct  2    SRVAKRPVKVPSGVEVKLDGQDVKVKGPKGELAWTVHDWVAVEQAD-GELRVQAQLDDRR  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A  + G  R L +NM+ GVS+GF++KL+L GVGYRA V+GK++ L LGFSHPV   +P+G
Sbjct  61   AVALAGTTRALLNNMVTGVSQGFERKLELRGVGYRAQVQGKNLNLTLGFSHPVDYPVPEG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADE  126
            + ++    T I V G DK  +G+ AA IR +RPPEPYKGKGV+YADE
Sbjct  121  ITIEAPSQTEIVVKGADKQQVGEVAAQIRAFRPPEPYKGKGVRYADE  167



>ref|WP_027649217.1| 50S ribosomal protein L6 [Salinispora pacifica]
Length=180

 Score =   181 bits (459),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 116/171 (68%), Gaps = 0/171 (0%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIG++ IPVP+ V + + GQ   VKGP GEL  T    + +E+ E G L V +  + R+
Sbjct  2    SRIGRKSIPVPAGVDVTIAGQTVTVKGPKGELSHTVAEPITIERAEDGQLNVARPNDERK  61

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A E+HGL RTL  NMIVGV++G+ K L++ G GYR   +GKD+   LGFSHPV +  P+G
Sbjct  62   AKELHGLSRTLVANMIVGVTEGYRKSLEIAGTGYRVTAKGKDLEFALGFSHPVTVVAPEG  121

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +   VE+ T   V+G DK  +G+ AA+IRK RPPEPYKGKGVKY  EVIRR
Sbjct  122  ITFSVEKPTLFHVAGIDKQLVGEVAANIRKIRPPEPYKGKGVKYQGEVIRR  172



>ref|WP_004273659.1| 50S ribosomal protein L6 [Nitrospirillum amazonense]
 gb|EGY00441.1| 50S ribosomal protein L6 [Nitrospirillum amazonense Y2]
Length=177

 Score =   181 bits (459),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 122/171 (71%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK P+PVP+ VT+++ GQD  VKG LG+L +T   ++     E+G + V+ A ++R+
Sbjct  2    SRIGKHPVPVPAGVTVQVTGQDVTVKGKLGQLSLTLVDDIS-ATLENGAVVVKPANDSRK  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A       RTL  NM+ GV  GF K L++ GVGY+A V+G++++LNLGFSH VR  IP G
Sbjct  61   ARVNWATSRTLLANMVKGVDTGFTKNLEITGVGYKAAVQGQELLLNLGFSHDVRFPIPAG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            + +K ++ T I+++G+DK  IGQ AA IR +RPPEPYKGKG++YADEVI R
Sbjct  121  ITMKCDKPTSISITGFDKQKIGQVAAEIRAYRPPEPYKGKGIRYADEVIIR  171



>ref|WP_034304256.1| 50S ribosomal protein L6 [Amycolatopsis lurida]
 gb|KFU83012.1| 50S ribosomal protein L6 [Amycolatopsis lurida NRRL 2430]
 gb|AJK51997.1| 50S ribosomal protein L6 [Amycolatopsis lurida NRRL 2430]
Length=179

 Score =   181 bits (459),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 88/171 (51%), Positives = 119/171 (70%), Gaps = 0/171 (0%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK P+ VPS V + +EGQ  KVKGP G L  T    + +EK E+G L V++  E R 
Sbjct  2    SRIGKLPVAVPSGVEVTIEGQQIKVKGPKGTLEHTIAEPITVEKAENGTLEVKRPDEERT  61

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            +  +HGL RTL +N++VGV++G++KKL++ GVGYR   +G D+   LG+SHPV++  P+G
Sbjct  62   SRALHGLTRTLVNNLVVGVTEGYEKKLEIHGVGYRVQAKGSDLEFALGYSHPVKIEAPEG  121

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +  KVE  TR +VSG DK  +GQ AA IRK R P+PYKGKG++Y  E IRR
Sbjct  122  ITFKVETPTRFSVSGIDKQKVGQIAAVIRKLRRPDPYKGKGLRYEGEKIRR  172



>ref|WP_006456930.1| 50S ribosomal protein L6 [Synechococcus sp. PCC 7335]
 gb|EDX87146.1| ribosomal protein L6, putative [Synechococcus sp. PCC 7335]
Length=178

 Score =   181 bits (459),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 90/173 (52%), Positives = 120/173 (69%), Gaps = 5/173 (3%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEK--EESGVLRVRKAMET  453
            SRIGKQP+P+P  VT+ ++GQ    KG  GEL   +P E+ +E+  EE  V RV    E+
Sbjct  2    SRIGKQPVPIPKGVTVTIDGQMLTAKGSKGELSREFPPEIAIEQTGEEVVVTRVN---ES  58

Query  452  RRANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIP  273
            R A + HGL RTL  NM+ GVSKG++KKL++ GVGYRA ++G+ +V+ LG+SHP+    P
Sbjct  59   RNARQRHGLVRTLVANMVEGVSKGYEKKLEIQGVGYRASLQGQKLVMALGYSHPIEFDPP  118

Query  272  DGLQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
             G+   VE+NT +TV+G DK  +G  AA +R  RPPEPYKGKGV+YA E IRR
Sbjct  119  SGITFAVEKNTNVTVTGIDKEIVGNTAAKVRAARPPEPYKGKGVRYAGEQIRR  171



>ref|WP_015129709.1| 50S ribosomal protein L6 [Calothrix sp. PCC 7507]
 gb|AFY33902.1| LSU ribosomal protein L6P [Calothrix sp. PCC 7507]
Length=182

 Score =   181 bits (459),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 86/171 (50%), Positives = 122/171 (71%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+PIP+P+ V + ++G    VKGP GEL  + P  V +  +E  +L V +  ETR 
Sbjct  2    SRIGKRPIPIPAKVQVAIDGTKVVVKGPKGELSRSLPVNV-IVSQEGEILHVTRRDETRT  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            + ++HGL RTL  NM+ GVS+GF ++L++ GVGYRA ++G+++VLN+G+SH V++  P+G
Sbjct  61   SRQLHGLSRTLVANMVEGVSQGFQRRLEIQGVGYRAQLQGRNLVLNMGYSHQVQIVPPEG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +Q  VE  T + VSGYDK  +G  AA IR  RPPEPYKGKG++Y  EV+RR
Sbjct  121  IQFAVEGTTNVIVSGYDKEIVGNTAAKIRAVRPPEPYKGKGIRYTGEVVRR  171



>gb|KIJ83485.1| 50S ribosomal protein L6 [Scytonema tolypothrichoides VB-61278]
Length=182

 Score =   181 bits (459),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 86/171 (50%), Positives = 122/171 (71%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+PI VP+ V + ++G    VKGP GEL    P  V + KE   +L+V +  E+R 
Sbjct  2    SRIGKRPITVPAKVEVSIDGTKVLVKGPKGELSRDLPPHVIVSKEGE-ILQVNRRDESRT  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            + +MHGL RTL  NM+ GVS GF ++L++ GVGYRA ++G++++LN+G+SH V++  P+G
Sbjct  61   SRQMHGLCRTLVANMVEGVSIGFQRRLEIQGVGYRAQIQGRNLILNMGYSHQVQIVPPEG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +Q  VE NT + +SGYDK  +G  AA IR  RPPEPYKGKG++YA E++RR
Sbjct  121  IQFAVENNTNVIISGYDKEVVGNTAAKIRAVRPPEPYKGKGIRYAGEMVRR  171



>ref|WP_039688659.1| 50S ribosomal protein L6 [Coriobacteriaceae bacterium 68-1-3]
 gb|AJC11806.1| 50S ribosomal protein L6 [Coriobacteriaceae bacterium 68-1-3]
Length=180

 Score =   181 bits (458),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 116/171 (68%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGKQPI VP+ VT+ ++G     KGP GEL   +P  + + K+E  V+ V +  ++R 
Sbjct  2    SRIGKQPITVPAGVTVTIDGTKVTTKGPKGELTREFP-SMMIIKQEGDVITVERPDDSRE  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A   HGL RTL  NM+ G +KGF KKLQLVGVGYRA ++GKD+ L LGFSHPV +  P+G
Sbjct  61   AKSYHGLVRTLVANMVEGSAKGFSKKLQLVGVGYRAALKGKDLDLQLGFSHPVVVPCPEG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +  +V   T I VSG  K  +GQ AA IRKWR PEPYKGKG++Y  E +RR
Sbjct  121  ITFEVPTQTEIVVSGPSKEQVGQVAADIRKWRKPEPYKGKGIRYEGEYVRR  171



>ref|WP_043965528.1| 50S ribosomal protein L6 [Micromonospora carbonacea]
 gb|KIR62988.1| 50S ribosomal protein L6 [Micromonospora carbonacea]
Length=180

 Score =   181 bits (458),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 116/171 (68%), Gaps = 0/171 (0%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIG++ IPVP+ V I ++GQ  KVKGP GEL       +  E+ E G L+V +  + R+
Sbjct  2    SRIGRKSIPVPAGVDITIDGQAVKVKGPKGELTHVLAEPITAERAEDGQLQVNRPNDERK  61

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A E+HGL RTL  NMIVGV++G  K L++ G GYR   +GKD+   LGFSHPV +  PDG
Sbjct  62   AKELHGLSRTLIANMIVGVTEGHRKSLEIAGTGYRVTAKGKDLEFALGFSHPVLVPAPDG  121

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +   VE+ T   V+G DK  +G+ AA+IRK RPPEPYKGKGVKY  EVIRR
Sbjct  122  ITFTVEKPTVFHVAGIDKQLVGEVAANIRKIRPPEPYKGKGVKYQGEVIRR  172



>ref|WP_009634242.1| 50S ribosomal protein L6 [Synechocystis sp. PCC 7509]
Length=179

 Score =   181 bits (458),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 88/171 (51%), Positives = 120/171 (70%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK PI VP+ VT+ ++G    VKGP GEL       V +E+E   +L V++  E+R 
Sbjct  2    SRIGKLPITVPNKVTVTIDGSHVAVKGPKGELSRVLSNTVTIEQEGDTLL-VKRRDESRP  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A +MHGL RTL  NM+ GVS+GF ++L++ GVGYRA V+G+ + LN+G+SHPV +  PDG
Sbjct  61   ARQMHGLSRTLVANMVEGVSQGFQRRLEIQGVGYRAQVQGRTLTLNVGYSHPVIIEPPDG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            + + VE NT + VSG++K  +G  AA IR  RPPEPYKGKG++YA E +RR
Sbjct  121  VTIAVETNTNVIVSGFNKEEVGNTAAKIRAVRPPEPYKGKGIRYAGEAVRR  171



>gb|AFC39969.1| ribosomal protein L6 [Porphyra umbilicalis]
Length=180

 Score =   181 bits (458),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 85/171 (50%), Positives = 121/171 (71%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+ I +P+N++ + +GQ   V GP G L  T P  + LE   + +L VR +  T++
Sbjct  2    SRIGKKIILLPTNLSTQFDGQTITVNGPKGTLSRTLPEGITLEINNATIL-VRTSGNTKK  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            AN++HGL RTL +NMI GVS GF KKLQ+ GVGYR+ ++  +++L++G+SH V +  P  
Sbjct  61   ANQLHGLSRTLINNMIEGVSNGFSKKLQIQGVGYRSQIDNNNLILSVGYSHVVTIQPPQN  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +++KVE NT ITV G DK  +GQ A++IR  RPPEPYKGKG++Y  EV+RR
Sbjct  121  IEIKVENNTNITVLGIDKEVVGQVASTIRSIRPPEPYKGKGIRYQGEVVRR  171



>ref|WP_026929011.1| 50S ribosomal protein L6 [Glycomyces tenuis]
Length=179

 Score =   181 bits (458),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 121/171 (71%), Gaps = 0/171 (0%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGKQPI VPS V +K++G    VKGP G+L    P  + +EK E G L+V +  + R+
Sbjct  2    SRIGKQPIQVPSGVDVKIDGATVTVKGPKGQLVRELPEPIGIEKNEDGSLQVTRPNDERK  61

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            +  +HGL R+L +NM+VGVS+G+ K L++ G GYRA  +GK + ++LGFSH +++  P+G
Sbjct  62   SRALHGLARSLVNNMVVGVSEGYTKSLEINGTGYRAQAKGKGVEMSLGFSHTIQVDAPEG  121

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +  KVE+ T + V G DK  +GQ A++IR+ RPPEPYKGKGVKY DE IRR
Sbjct  122  ISFKVEKPTLLHVEGIDKQLVGQVASNIRRLRPPEPYKGKGVKYVDERIRR  172



>ref|WP_024286973.1| 50S ribosomal protein L6 [Cellulomonas sp. KRMCY2]
Length=179

 Score =   180 bits (457),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 85/171 (50%), Positives = 118/171 (69%), Gaps = 0/171 (0%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK P+PVP+ V + ++G    VKGP G L  + P  +++ ++E G L V +  + R 
Sbjct  2    SRIGKVPVPVPTGVDVTIDGAQVTVKGPKGTLTHSIPSPIQVTRDEGGALVVTRPDDERA  61

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            +  +HGL RTL  N++VGV+ G+ KKL++VG GYR + +G D+   LGFSHPV +A P+G
Sbjct  62   SRSLHGLTRTLLSNLVVGVTDGYTKKLEIVGTGYRVVAKGSDLEFALGFSHPVNVAAPEG  121

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +   VE  TR +VSG DK  +G+ AA+IRK R PEPYKGKGV+YA EV+RR
Sbjct  122  ITFTVEAPTRFSVSGIDKQQVGEVAANIRKIRKPEPYKGKGVRYAGEVVRR  172



>ref|WP_027104281.1| 50S ribosomal protein L6 [Lachnospiraceae bacterium V9D3004]
Length=180

 Score =   180 bits (457),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 90/172 (52%), Positives = 121/172 (70%), Gaps = 2/172 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKM-EGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETR  450
            SRIG+ PI VP+ VT+ + E     VKGP GEL    P E+ +E E   V+ V++  + +
Sbjct  2    SRIGRMPIAVPAGVTVDIAENNSVTVKGPKGELNRVLPSEMTIEMEGDTVV-VKRPNDLK  60

Query  449  RANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPD  270
            R   +HGL RTL +NM++GV++G+ K L++ GVGYRA  +G  +VLNLG+SHPV M  P+
Sbjct  61   RMKSLHGLTRTLINNMVIGVTEGYQKVLEINGVGYRAAKQGNKLVLNLGYSHPVEMIDPE  120

Query  269  GLQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            GL+V VE+  +I V G DK  +GQ+AA IR+ R PEPYKGKG+KYADEVIRR
Sbjct  121  GLEVTVEDQNKIVVKGIDKEKVGQYAAEIREKRAPEPYKGKGIKYADEVIRR  172



>ref|WP_020691491.1| 50S ribosomal protein L6 [Aeromicrobium massiliense]
Length=180

 Score =   180 bits (457),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 89/172 (52%), Positives = 119/172 (69%), Gaps = 1/172 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK P+PVP+NVT+ ++GQD  VKGP GEL  +    + + K E G L V +  + RR
Sbjct  2    SRIGKIPVPVPANVTVTIDGQDVTVKGPKGELSHSVAEPITVAKSEDGSLLVERPNDERR  61

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIV-LNLGFSHPVRMAIPD  270
            +  +HGL RTL +NMIVGV+ G++KKL++VGVGYR + +G   + LNLGFSH V +  P+
Sbjct  62   SKALHGLSRTLVNNMIVGVTDGYEKKLEIVGVGYRVLAKGPSAIELNLGFSHSVPIEAPE  121

Query  269  GLQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            G+   VE  T+  V G DK  +G+ AA+IRK R PEPYKGKGV+YA E + R
Sbjct  122  GITFTVESATKFAVLGIDKQKVGEVAANIRKLRKPEPYKGKGVRYAGERVLR  173



>ref|WP_018784558.1| 50S ribosomal protein L6 [Micromonospora sp. CNB394]
Length=180

 Score =   180 bits (457),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 116/171 (68%), Gaps = 0/171 (0%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIG++ IPVP+ V I ++G+  KVKGP GEL       +  E+ E G L V +  + R+
Sbjct  2    SRIGRKSIPVPAGVDITIDGRTVKVKGPKGELSHVLAEPITAERGEDGELHVNRPNDERK  61

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A E+HGL RTL  NMIVGV++G+ K L++ G GYR   +GKD+   LGFSHPV +  PDG
Sbjct  62   AKELHGLSRTLVANMIVGVTEGYRKSLEIAGTGYRVTAKGKDLEFALGFSHPVLVPAPDG  121

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +   VE+ T   V+G DK  +G+ AA+IRK RPPEPYKGKGVKY  EVIRR
Sbjct  122  ITFTVEKPTLFHVAGIDKQQVGEVAANIRKIRPPEPYKGKGVKYQGEVIRR  172



>ref|WP_022874123.1| 50S ribosomal protein L6 [Arthrobacter sp. PAO19]
Length=178

 Score =   180 bits (457),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 88/171 (51%), Positives = 122/171 (71%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIG+ PI VP+NV + ++GQ   VKGP GEL IT    + + K+E+ V  VR   ++R 
Sbjct  2    SRIGRLPITVPANVELNIDGQLVAVKGPKGELSITVSAPITVSKDENTVTVVR-PNDSRE  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A  +HGL RTL +NMI+GV++G++KKL++ G GYR   +G D+ L LG+SHPV++A  DG
Sbjct  61   ARSLHGLTRTLINNMIIGVTEGYEKKLEIHGTGYRVQAKGADLELALGYSHPVKVAAVDG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +   VE N +ITV+G DK  +G+ AA+IRK R  EPYKGKG++YA E+IRR
Sbjct  121  ITYSVEGNNKITVAGIDKQHVGEVAANIRKLRKTEPYKGKGIRYAGEIIRR  171



>ref|WP_007031044.1| 50S ribosomal protein L6 [Amycolatopsis decaplanina]
 gb|EME60510.1| 50S ribosomal protein L6 [Amycolatopsis decaplanina DSM 44594]
Length=179

 Score =   180 bits (456),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 119/171 (70%), Gaps = 0/171 (0%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK P+ VPS V + +EGQ  KVKGP G L  T    + +E+ E G L+V++  E R 
Sbjct  2    SRIGKLPVAVPSGVEVTIEGQQIKVKGPKGTLEHTIAEPITVERAEDGTLQVKRPDEERT  61

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            +  +HGL RTL +N++VGV++G++KKL++ GVGYR   +G D+   LG+SHPV++  P+G
Sbjct  62   SRALHGLTRTLVNNLVVGVTEGYEKKLEIHGVGYRVQAKGSDLEFALGYSHPVKIEAPEG  121

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +  KVE  TR +VSG DK  +GQ AA IRK R P+PYKGKG++Y  E IRR
Sbjct  122  ITFKVETPTRFSVSGIDKQKVGQIAAVIRKLRRPDPYKGKGLRYEGEKIRR  172



>ref|WP_028085247.1| 50S ribosomal protein L6 [Dolichospermum circinale]
Length=182

 Score =   180 bits (457),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 88/171 (51%), Positives = 121/171 (71%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+PI VP+ V + ++G    VKGP GEL    P  V + +E   +L  R+  ETR 
Sbjct  2    SRIGKRPITVPAKVQVAIDGVKVVVKGPKGELSRQLPNNVIVSQEGETLLVTRRD-ETRT  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            + +MHGL RTL  NM+ GVS+GF ++L++ GVGYRA ++G+++VLN+G+SH V++  P+G
Sbjct  61   SRQMHGLSRTLVANMVEGVSQGFQRRLEIQGVGYRAQIQGRNLVLNMGYSHQVQIEPPEG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +Q  VE  T + VSGYDK  +G  AA IR  RPPEPYKGKG++YA EV+RR
Sbjct  121  IQFAVEGTTNVIVSGYDKEIVGNTAAKIRAVRPPEPYKGKGIRYAGEVVRR  171



>ref|WP_042104150.1| 50S ribosomal protein L6 [Parachlamydiaceae bacterium HS-T3]
Length=180

 Score =   180 bits (456),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 88/170 (52%), Positives = 119/170 (70%), Gaps = 1/170 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SR GKQPIPVP NV +K+ G +  VKGP G L       +K++     V+ V        
Sbjct  2    SRKGKQPIPVPKNVEVKVSGTNVSVKGPKGSLTQEIIPGIKVQLNND-VIDVVLPEGKEE  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
                HGLFR L +NM+VGV KGF++KL+++GVGYRA V+G+ + L +GFSHP ++ IP+G
Sbjct  61   MGNFHGLFRALINNMVVGVDKGFERKLEMIGVGYRAAVQGQLLDLQIGFSHPTKLPIPEG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIR  117
            +QVKV++NT IT+SG DK  +GQFAAS+R  RPPEPY+GKG++YA E +R
Sbjct  121  IQVKVDKNTLITISGIDKQQVGQFAASVRAIRPPEPYQGKGIRYAGEYVR  170



>ref|WP_028848728.1| 50S ribosomal protein L6 [Thermocrispum agreste]
Length=179

 Score =   180 bits (456),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/171 (50%), Positives = 119/171 (70%), Gaps = 0/171 (0%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGKQPI +PS V + + GQ   VKGP G L  T    +K+ K E G LRV +  + R+
Sbjct  2    SRIGKQPIAIPSGVDVTISGQQVTVKGPKGTLTHTVAEPIKVSKAEDGTLRVTRPDDERQ  61

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            +  +HGL RTL +N+I+GV++G++KK+++ GVGYR   +G D+  +LG+SHPV +  P+G
Sbjct  62   SRALHGLTRTLVNNLIIGVTEGYEKKMEIHGVGYRVQAKGSDLEFSLGYSHPVLIKAPEG  121

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +  KVE  T+ +VSG DK  +GQ AA IR+ R P+PYKGKGV+YA E IRR
Sbjct  122  ITFKVESPTKFSVSGIDKQKVGQVAAVIRRLRRPDPYKGKGVRYAGERIRR  172



>ref|WP_019174650.1| 50S ribosomal protein L6 [Brevibacterium massiliense]
Length=178

 Score =   179 bits (455),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 121/171 (71%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+PI VPS V +K++GQ   VKGP GEL  T    + +  E+ GV+ + +  E R 
Sbjct  2    SRIGKRPISVPSGVEVKIDGQTVNVKGPKGELSHTVAEPITVALED-GVITLERPNEERE  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            +  +HGL RT+ DNMI+GV++G++KKL++VG GYR   +G DI ++LG+SH + +A P G
Sbjct  61   SRALHGLSRTMVDNMIIGVTQGYEKKLEIVGTGYRVQAKGSDIEMSLGYSHSIPVAAPKG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +   VE N ++TVSG DK  +G+ AA+IRK R PEPYKGKGV+YA E +RR
Sbjct  121  ITFTVEGNNKLTVSGIDKQLVGEVAANIRKLRKPEPYKGKGVRYAGEQVRR  171



>ref|YP_009092968.1| ribosomal protein L6 (chloroplast) [Chaetoceros simplex]
 gb|AIR75359.1| ribosomal protein L6 (chloroplast) [Chaetoceros simplex]
Length=178

 Score =   179 bits (455),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 113/171 (66%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK PI +PS V +   G D  VKG  G L    P  + +E+ + G L V    +TR+
Sbjct  2    SRIGKLPISIPSGVDVTCNGLDVTVKGKFGTLQNQLPDSLSIEQTD-GRLIVSLQNQTRQ  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A  +HGL+RTL +NM++GVS+ F   L L GVGYRA V+GK IVLNLG+SHPV M IP+G
Sbjct  61   ARALHGLYRTLVNNMVIGVSEQFQLNLTLKGVGYRAAVQGKSIVLNLGYSHPVEMEIPEG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            + + V +N  I +   DK  +G FAA IR WRPPEPYKGKG+ Y  E+++R
Sbjct  121  ISIAVTKNVDINIKSCDKEQLGLFAAQIRAWRPPEPYKGKGIIYEGEIVKR  171



>ref|WP_018720668.1| 50S ribosomal protein L6 [Salinispora pacifica]
Length=180

 Score =   179 bits (455),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/171 (51%), Positives = 116/171 (68%), Gaps = 0/171 (0%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIG++ IPVP+ V + + GQ   VKGP GEL  T    + +E+ E G L V +  + R+
Sbjct  2    SRIGRKSIPVPAGVDVTIAGQTVTVKGPKGELSHTVAEPITIERAEDGQLNVARPNDERK  61

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A E+HGL RTL  NMIVGV++G+ K L++ G GYR   +GKD+   LGFSHPV +  P+G
Sbjct  62   AKELHGLSRTLVANMIVGVTEGYRKSLEIAGTGYRVTAKGKDLEFALGFSHPVTVVAPEG  121

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +   VE+ T   V+G +K  +G+ AA+IRK RPPEPYKGKGVKY  EVIRR
Sbjct  122  ITFSVEKPTLFHVAGINKQLVGEVAANIRKIRPPEPYKGKGVKYQGEVIRR  172



>ref|WP_008900997.1| MULTISPECIES: 50S ribosomal protein L6 [Peptoniphilus]
 gb|EFM26141.1| ribosomal protein L6 [Peptoniphilus duerdenii ATCC BAA-1640]
 gb|ERT63974.1| ribosomal protein L6 [Peptoniphilus sp. BV3AC2]
Length=178

 Score =   179 bits (455),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/171 (50%), Positives = 122/171 (71%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+PI +PSNVT+ ++G    VKGP GEL  T+   + +  E+ GVL V +  + ++
Sbjct  2    SRIGKKPIEIPSNVTVTIDGHTVTVKGPKGELKETFNENLTISLED-GVLEVTRPNDEKK  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
               +HGL RTL  NM+VGV++G+ K+L++VG GYRA  +GK + L LGFSHP+ +  P G
Sbjct  61   IRALHGLTRTLIYNMVVGVTEGYTKELEIVGTGYRAAKQGKKLALTLGFSHPLELEDPKG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            ++V+V    +I +SG DK  +GQ+AA IR +R PEPYKGKG+KY+DE+IRR
Sbjct  121  IEVEVPAPNKIIISGSDKQQVGQYAAHIRGYRRPEPYKGKGIKYSDEIIRR  171



>ref|WP_015805277.1| 50S ribosomal protein L6 [Actinosynnema mirum]
 gb|ACU40397.1| ribosomal protein L6 [Actinosynnema mirum DSM 43827]
Length=179

 Score =   179 bits (455),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/171 (50%), Positives = 119/171 (70%), Gaps = 0/171 (0%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK PI VPS V + ++GQ   VKGP G L +T    + LEK + G L V++  + RR
Sbjct  2    SRIGKLPITVPSGVDVNIDGQAVSVKGPKGTLNLTIAEPITLEKADDGTLEVKRPNDERR  61

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            +  +HGL RTL  NM+VGV++G++KK+++ GVGYR  ++G D+   LG+SHPV++  P G
Sbjct  62   SRSLHGLSRTLVQNMVVGVTQGYEKKMEIHGVGYRVALKGSDLEFALGYSHPVKVEAPAG  121

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +   VE  TR +V+G DK  +G+ AA+IRK R P+PYKGKGV+Y+ E IRR
Sbjct  122  ITFAVETPTRFSVAGIDKQLVGEVAANIRKLRKPDPYKGKGVRYSGEKIRR  172



>ref|WP_037270096.1| 50S ribosomal protein L6 [Rhodococcus rhodnii]
Length=179

 Score =   179 bits (455),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/171 (50%), Positives = 119/171 (70%), Gaps = 0/171 (0%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK PI VPS V +++EGQ   VKGP G L  T    +KLE+ E G L V++  + R+
Sbjct  2    SRIGKLPITVPSGVDVQIEGQTVNVKGPKGALTHTIAEPIKLERAEDGTLEVKRPNDERQ  61

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
               +HGL RTL +N+++GV+ G++KKL++ GVGYR  ++G D+   LG+SHP+++  P G
Sbjct  62   NRALHGLTRTLVNNLVIGVTAGYEKKLEIHGVGYRVQLKGSDLEFALGYSHPIKVEAPKG  121

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +   VE  TR +VSG DK  +G+ AA+IRK R P+PYKGKGV+YA E IRR
Sbjct  122  ITFTVETPTRFSVSGIDKQLVGEVAANIRKLRKPDPYKGKGVRYAGEKIRR  172



>ref|WP_018729116.1| 50S ribosomal protein L6 [Salinispora pacifica]
Length=180

 Score =   179 bits (455),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/171 (51%), Positives = 116/171 (68%), Gaps = 0/171 (0%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIG++ IPVP+ V + + GQ   VKGP GEL  T    + +E+ E G L V +  + R+
Sbjct  2    SRIGRKSIPVPAGVDVTIAGQTVTVKGPKGELSHTVAEPITIEQAEDGQLNVARPNDERK  61

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A E+HGL RTL  NMIVGV++G+ K L++ G GYR   +GKD+   LGFSHPV +  P+G
Sbjct  62   AKELHGLSRTLVANMIVGVTEGYRKSLEIAGTGYRVTAKGKDLEFALGFSHPVTVVAPEG  121

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +   VE+ T   V+G +K  +G+ AA+IRK RPPEPYKGKGVKY  EVIRR
Sbjct  122  ITFSVEKPTLFHVAGINKQLVGEVAANIRKIRPPEPYKGKGVKYQGEVIRR  172



>ref|WP_018682818.1| 50S ribosomal protein L6 [Actinokineospora enzanensis]
Length=179

 Score =   179 bits (455),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/171 (49%), Positives = 121/171 (71%), Gaps = 0/171 (0%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIG+ PIPVPS V + +EGQD  VKGP G L +     + +E+ E G L+V +  + R+
Sbjct  2    SRIGRLPIPVPSGVDVTIEGQDISVKGPKGTLALKVSEPITVERAEDGTLQVTRPNDERQ  61

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
               +HGL R+L +N++VGV+ G++KK+++ GVGYR + +G D+   LG+SHPV++A P+G
Sbjct  62   NRALHGLTRSLVNNIVVGVTAGYEKKMEIHGVGYRVVAKGSDLEFALGYSHPVKVAAPEG  121

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +   VE  T+ +V+G DK  +G+ AA+IRK R P+PYKGKGV+YA E IRR
Sbjct  122  ITFAVESPTKFSVAGIDKQRVGEVAANIRKLRKPDPYKGKGVRYAGEKIRR  172



>ref|WP_004820353.1| 50S ribosomal protein L6 [Peptoniphilus indolicus]
 gb|EGY80176.1| 50S ribosomal protein L6 [Peptoniphilus indolicus ATCC 29427]
Length=178

 Score =   179 bits (454),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/171 (49%), Positives = 120/171 (70%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+PI +PS V +K +G    VKGP GEL  T+   +K+  ++ G L V +  ++++
Sbjct  2    SRIGKKPIEIPSGVDVKFDGNTVTVKGPKGELSQTFDSSMKISLQD-GSLTVERPSDSKK  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
               +HGL RTL  NM+VGV++G+ K+L+++G GYRA   GK + LNLGFSHP+ +  P G
Sbjct  61   HKSLHGLVRTLIQNMVVGVTEGYKKELEIIGTGYRAAKNGKKLALNLGFSHPLELEDPAG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            ++ +V   T+I VSG DK  +GQ+AA IRK+R PEPYKGKG++Y DE +RR
Sbjct  121  IETEVPAPTKIVVSGIDKQQVGQYAALIRKYRQPEPYKGKGIRYVDEYVRR  171



>ref|WP_014349107.1| 50S ribosomal protein L6 [Nocardia cyriacigeorgica]
 ref|YP_005262279.1| 50S ribosomal protein L6 [Nocardia cyriacigeorgica GUH-2]
 emb|CCF61635.1| 50S ribosomal protein L6 [Nocardia cyriacigeorgica GUH-2]
Length=179

 Score =   179 bits (455),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/171 (50%), Positives = 119/171 (70%), Gaps = 0/171 (0%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGKQPI +PS V + + GQD  VKGP G+L +T    + + K E G L+V +  + RR
Sbjct  2    SRIGKQPIAIPSGVEVTINGQDIAVKGPKGQLSLTVSEPITITKGEDGQLQVARPDDERR  61

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            +  +HGL RTL  NMI GV+KG++KKL++ GVGYR  ++G+++   LG+SHPV    P G
Sbjct  62   SRALHGLTRTLVANMIEGVTKGYEKKLEIAGVGYRVALKGQNLEFALGYSHPVVAEPPQG  121

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +   VE  T+ +V+G DK  +G+ AA+IRK+R PEPYKGKG++YA E +RR
Sbjct  122  ITFAVESPTKFSVAGIDKQLVGEVAANIRKYRKPEPYKGKGIRYAGENVRR  172



>ref|WP_038992188.1| 50S ribosomal protein L6 [Arthrobacter sp. W1]
Length=178

 Score =   179 bits (454),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/171 (51%), Positives = 122/171 (71%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIG+ PI VP+NV + ++GQ   VKGP GEL IT    + + K+E+ V  V +  ++R 
Sbjct  2    SRIGRLPISVPANVELNVDGQLVAVKGPKGELSITVKAPITVAKDENTVT-VSRPNDSRE  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A  +HGL RTL +NMIVGV++G++KKL++ G GYR   +G D+ L LG+SHPV++A  DG
Sbjct  61   ARSLHGLTRTLINNMIVGVTEGYEKKLEIHGTGYRVQAKGADLELALGYSHPVKVAAVDG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +   VE N +ITV+G DK  +G+ AA+IRK R  EPYKGKG++YA E+IRR
Sbjct  121  ITFSVEGNNKITVAGIDKQHVGEVAANIRKLRKTEPYKGKGIRYAGEIIRR  171



>ref|WP_014440736.1| 50S ribosomal protein L6 [Actinoplanes missouriensis]
 dbj|BAL85838.1| putative ribosomal protein L6 [Actinoplanes missouriensis 431]
Length=179

 Score =   179 bits (454),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 117/171 (68%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIG++ IPVPS V I + GQ  KVKGP GEL  T    + +  ++ G L V +  + R+
Sbjct  2    SRIGRKSIPVPSGVDITITGQTVKVKGPKGELSHTVAEPITVS-QDGGELHVNRPNDERK  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A E+HGL RTL  NMI+GV++G+ K L++ G GYR   +GKD+   LGFSHPV +  P G
Sbjct  61   AKELHGLSRTLVANMIIGVTEGYKKTLEINGTGYRVTAKGKDLEFALGFSHPVNIVPPAG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +   VE+ T+ TVSG DK  +G+ AA+IRK RPPEPYKGKGVKY  EVIRR
Sbjct  121  ITFSVEKPTQFTVSGIDKQLVGEVAANIRKIRPPEPYKGKGVKYQGEVIRR  171



>ref|WP_035279546.1| 50S ribosomal protein L6 [Actinokineospora sp. EG49]
 gb|EWC63567.1| LSU ribosomal protein L6p (L9e) [Actinokineospora sp. EG49]
Length=179

 Score =   179 bits (454),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/171 (49%), Positives = 119/171 (70%), Gaps = 0/171 (0%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIG+ PIPVP+ V I ++GQ    KGP G L +T    + +E+ E G L V++  + R+
Sbjct  2    SRIGRLPIPVPTGVDITIDGQQLSAKGPKGTLTLTVSEPIVVERAEDGTLEVKRPNDERQ  61

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
               +HGL R+L +N++VGV+ GF+KKL++ GVGYR + +G D+   LGFSHPV++  P+G
Sbjct  62   NRALHGLTRSLVNNVVVGVTAGFEKKLEIHGVGYRVLAKGSDLEFALGFSHPVKVVAPEG  121

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +   VE  T+ +VSG DK  +G+ AA+IRK R P+PYKGKGV+YA E IRR
Sbjct  122  ITFAVESPTKFSVSGIDKQQVGEVAANIRKLRKPDPYKGKGVRYAGEKIRR  172



>ref|WP_037332683.1| 50S ribosomal protein L6 [Amycolatopsis sp. MJM2582]
 gb|KFZ82847.1| 50S ribosomal protein L6 [Amycolatopsis sp. MJM2582]
Length=179

 Score =   179 bits (454),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 118/171 (69%), Gaps = 0/171 (0%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK P+ VPS V + ++GQ  KVKGP G L  T    + +EK E G L V++  E R 
Sbjct  2    SRIGKLPVAVPSGVEVTIDGQQIKVKGPKGTLEHTIAEPITVEKAEDGTLEVKRPDEERT  61

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            +  +HGL RTL +N++VGV++G++KKL++ GVGYR   +G D+   LG+SHPV++  P+G
Sbjct  62   SRALHGLTRTLVNNLVVGVTEGYEKKLEIHGVGYRVQAKGSDLEFALGYSHPVKIEAPEG  121

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +  KVE  TR +VSG DK  +GQ AA IRK R P+PYKGKG++Y  E IRR
Sbjct  122  ITFKVETPTRFSVSGIDKQKVGQIAAVIRKLRRPDPYKGKGLRYEGEKIRR  172



>ref|WP_010311645.1| 50S ribosomal protein L6 [Synechococcus sp. CB0101]
Length=179

 Score =   179 bits (454),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 117/171 (68%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK PIPVP  VT+ + G D KVKGP GEL  T P  V + ++ S ++ V  A + RR
Sbjct  2    SRIGKAPIPVPGGVTVTLSGLDVKVKGPKGELSRTLPDGVTIAQDGSNLV-VSPASDNRR  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            + E HGL RTL  NM+ GVSKG+ +KL++VGVGYRA V+GK +V++ G+SH V M  PDG
Sbjct  61   SRERHGLCRTLVANMVEGVSKGYTRKLEIVGVGYRAAVQGKKLVVSAGYSHQVEMVPPDG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +   V+ NT + V+G DK  +G  AA +R  RPPEPYKGKG+KY  E I R
Sbjct  121  VTFAVDGNTTVLVTGADKELVGNEAAKVRAIRPPEPYKGKGIKYEGERILR  171



>ref|YP_003734607.1| ribosomal protein L6 [Kryptoperidinium foliaceum]
 gb|ADI40392.1| ribosomal protein L6 [Kryptoperidinium foliaceum]
Length=178

 Score =   179 bits (454),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/171 (51%), Positives = 116/171 (68%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK PI +P NVT+  +     V+G  G L    P  + +E++E+  L+V    E R 
Sbjct  2    SRIGKLPITIPDNVTVNCQNSQVTVQGKFGTLETNIPDTIGIEQDENS-LKVSLKSEARN  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
               +HGL+RTL +NM+VGVS+ FD  L L GVGYRA+V+GK+I LNLG+SHPV+M IP+ 
Sbjct  61   VRALHGLYRTLINNMVVGVSEQFDLTLILKGVGYRAVVQGKEITLNLGYSHPVKMEIPED  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            + V+VE+NT I +   DK  +G FAA+IR WR PEPYKGKG+ YA E I R
Sbjct  121  ISVEVEKNTTIKLKSCDKEKLGLFAANIRAWRRPEPYKGKGILYAGEQIIR  171



>ref|YP_007947829.1| ribosomal protein L6 (chloroplast) [Pyropia haitanensis]
 gb|AGG37078.1| ribosomal protein L6 (chloroplast) [Pyropia haitanensis]
Length=180

 Score =   179 bits (454),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/171 (50%), Positives = 120/171 (70%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+ I +P+N++ + +G    VKGP G L  T P  + LE     +  VR + +T+ 
Sbjct  2    SRIGKKIILLPANLSTQFDGHTITVKGPKGTLSRTLPAGINLEILNDKI-SVRTSKQTKM  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            AN++HGL RTL  NMI GVS GF KKLQ+ GVGYR+ ++ +D++L++G+SH V++  P+ 
Sbjct  61   ANQLHGLSRTLISNMIEGVSNGFTKKLQIQGVGYRSQIDNQDLILSVGYSHVVKIKPPEN  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +Q+ VE NT ITVSG DK  +GQ A++IR  RPPEPYKGKG++Y  E +RR
Sbjct  121  IQITVENNTNITVSGIDKEVVGQVASTIRSTRPPEPYKGKGIRYQGEFVRR  171



>ref|WP_018801042.1| 50S ribosomal protein L6 [Salinispora arenicola]
Length=180

 Score =   179 bits (454),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/171 (51%), Positives = 117/171 (68%), Gaps = 0/171 (0%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIG++ IPVP+ V + ++GQ  KVKGP G L  T    + +E+ E G L V +  + R+
Sbjct  2    SRIGRKSIPVPAGVDVTIDGQTVKVKGPKGVLSHTLAEPITVERAEDGQLNVARPNDERK  61

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A E+HGL RTL  NMIVGV++G+ K L++ G GYR   +GKD+   LGFSHPV +  P+G
Sbjct  62   AKELHGLSRTLVANMIVGVTEGYRKSLEIAGTGYRVTAKGKDLEFALGFSHPVTVVAPEG  121

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +   VE+ T   V+G +K  +G+ AA+IRK RPPEPYKGKGVKY  EVIRR
Sbjct  122  ITFSVEKPTLFHVAGINKQLVGEVAANIRKIRPPEPYKGKGVKYQGEVIRR  172



>ref|WP_025616601.1| 50S ribosomal protein L6 [Salinispora pacifica]
Length=180

 Score =   179 bits (454),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 116/171 (68%), Gaps = 0/171 (0%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIG++ IPVP+ V + + GQ   VKGP GEL  T    + +E+ E G L V +  + R+
Sbjct  2    SRIGRKSIPVPAGVDVTIAGQTVTVKGPKGELSHTIAEPITVERAEDGQLNVARPNDERK  61

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A E+HGL RTL  NMI+GV++G+ K L++ G GYR   +GKD+   LGFSHPV +  P+G
Sbjct  62   AKELHGLSRTLVANMIIGVTEGYRKSLEIAGTGYRVTAKGKDLEFALGFSHPVTVVAPEG  121

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +   VE+ T   V+G +K  +G+ AA+IRK RPPEPYKGKGVKY  EVIRR
Sbjct  122  ISFSVEKPTLFHVAGINKQLVGEVAANIRKIRPPEPYKGKGVKYQGEVIRR  172



>ref|WP_013324975.1| 50S ribosomal protein L6 [Cyanothece sp. PCC 7822]
 gb|ADN16937.1| ribosomal protein L6 [Cyanothece sp. PCC 7822]
Length=179

 Score =   179 bits (454),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 118/171 (69%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+PI +P+ VT+ +EG    VKGP GEL  T P  V +E  ++  LRV +  ++R 
Sbjct  2    SRIGKRPIEIPNKVTVNIEGSHVAVKGPKGELERTLPSMVNVELTDN-TLRVVRTDDSRV  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A + HGL RTL  NM+ GVS GF+K+L++ GVGYRA   G  + LN+G+S PV M +P G
Sbjct  61   ARQRHGLCRTLVFNMVEGVSNGFEKRLEIQGVGYRAAAAGSKLTLNVGYSKPVEMDMPQG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            + V VE+NT IT+SG DK  +G  AA IR  RPPEPYKGKG++Y  E++RR
Sbjct  121  ITVAVEKNTEITISGIDKEIVGNIAAKIRAVRPPEPYKGKGIRYKGELVRR  171



>ref|WP_026922777.1| 50S ribosomal protein L6 [Glycomyces arizonensis]
Length=179

 Score =   179 bits (453),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/171 (50%), Positives = 120/171 (70%), Gaps = 0/171 (0%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGKQPI VPS V +K++G    VKGP G+L    P  + +EK E G L+V +  + R+
Sbjct  2    SRIGKQPIQVPSGVDVKIDGATVTVKGPKGQLVRELPEPIGIEKNEDGSLQVTRPNDERK  61

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            +  +HGL R+L +NM+VGVS+G+ K L++ G GYRA  +GK + ++LGFSH +++  P+G
Sbjct  62   SRALHGLARSLVNNMVVGVSEGYKKSLEINGTGYRAQAKGKGVEMSLGFSHTIQVDAPEG  121

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +  +VE  T + V G DK  +GQ A++IR+ RPPEPYKGKGVKY DE IRR
Sbjct  122  ISFQVERPTLLHVEGIDKQLVGQVASNIRRLRPPEPYKGKGVKYVDERIRR  172



>ref|WP_017286247.1| 50S ribosomal protein L6 [Leptolyngbya boryana]
Length=182

 Score =   179 bits (454),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 88/171 (51%), Positives = 119/171 (70%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+PI +P+ VTI + GQ+  VKGP GEL    P  V + + E   + V +  ++R 
Sbjct  2    SRIGKRPITLPAKVTITINGQEVVVKGPKGELTRVLPAGVTI-RTEGDTVNVDRVNDSRM  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A E HGL RTL  NM+ GVS GF ++L++ GVGYRA V+GK++ +N+G+SHPV +  PDG
Sbjct  61   ARERHGLCRTLVANMVEGVSTGFSRRLEIQGVGYRAAVQGKNLNMNMGYSHPVLIEPPDG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +Q +VE N  +TV+G DK  +G  AA IR  RPPEPYKGKG++YA E +RR
Sbjct  121  IQFQVENNVNVTVTGIDKEIVGNTAAKIRAVRPPEPYKGKGIRYAGEKVRR  171



>ref|WP_007465267.1| 50S ribosomal protein L6 [Micromonospora lupini]
 emb|CCH21405.1| 50S ribosomal subunit protein L6 [Micromonospora lupini str. 
Lupac 08]
Length=180

 Score =   179 bits (453),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 115/171 (67%), Gaps = 0/171 (0%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIG++ IPVP+ V I ++GQ  KVKGP GEL  T    + +E+ E G L V +  + R+
Sbjct  2    SRIGRKSIPVPAGVDITIDGQTVKVKGPKGELQHTIADPITVERAEDGQLNVNRPNDERK  61

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A E+HGL RTL  NMIVGV++G+ K L++ G GYR   +G D+   LGFSHPV +  P G
Sbjct  62   AKELHGLSRTLVANMIVGVTEGYRKSLEIAGTGYRVTAKGSDLEFALGFSHPVVVPAPAG  121

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +   VE  T   V+G DK  +G+ AA+IRK RPPEPYKGKGVKY  EVIRR
Sbjct  122  ITFTVERPTLFHVAGIDKQQVGEVAANIRKIRPPEPYKGKGVKYQGEVIRR  172



>ref|WP_009344499.1| 50S ribosomal protein L6 [Raphidiopsis brookii]
 gb|EFA71779.1| Ribosomal protein L6 [Raphidiopsis brookii D9]
Length=182

 Score =   179 bits (453),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 119/171 (70%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+PI +P+ V + ++G    VKGP GEL    P  V + +    +L  R+  +TR 
Sbjct  2    SRIGKRPITIPAKVQVAIDGTKVVVKGPKGELSRDLPTHVTVSQSGETLLVTRRD-DTRT  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            + +MHGL RTL  NM+ GVS+GF ++L++ GVGYRA V+G ++VLN+G+SH V++  P G
Sbjct  61   SRQMHGLSRTLVANMVEGVSQGFQRRLEIQGVGYRAQVQGANLVLNIGYSHQVQIEPPAG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +Q  VE NT + VSGYDK  +G  AA IR  RPPEPYKGKG++YA EV+RR
Sbjct  121  VQFVVENNTNVIVSGYDKEVVGNTAAKIRAVRPPEPYKGKGIRYAGEVVRR  171



>ref|YP_009093384.1| ribosomal protein L6 (chloroplast) [Cerataulina daemon]
 gb|AIR76057.1| ribosomal protein L6 (chloroplast) [Cerataulina daemon]
Length=179

 Score =   179 bits (453),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 84/171 (49%), Positives = 116/171 (68%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK PI +P++V +   G +  VKG  G L  T P  +++  + +G+L V    +TR+
Sbjct  2    SRIGKLPIEIPASVDVNCTGLNLTVKGKFGTLQNTLPDVIEIT-QNNGILIVSTKNQTRQ  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A  +HGL+RTL +NMI+GVS+ F   L L GVGYRA V+GK +V+NLG+SHPV + IPD 
Sbjct  61   ARALHGLYRTLINNMIIGVSEQFQLNLTLQGVGYRASVQGKSLVINLGYSHPVNITIPDD  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            + V+V +NT I +    K  +G FAA +R WRPPEPYKGKG+ Y  EV++R
Sbjct  121  ISVEVVQNTTINIKSCHKENLGLFAAQVRSWRPPEPYKGKGILYQGEVVQR  171



>ref|WP_018726241.1| 50S ribosomal protein L6 [Salinispora pacifica]
Length=180

 Score =   179 bits (453),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 88/171 (51%), Positives = 116/171 (68%), Gaps = 0/171 (0%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIG++ IPVP+ V + + GQ   VKGP GEL  T    + +E+ E G L V +  + R+
Sbjct  2    SRIGRKSIPVPAGVDVTIAGQTVTVKGPKGELSHTVAEPITIERAEDGQLNVARPNDERK  61

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A E+HGL RTL  NMIVGV++G+ K L++ G GYR   +GKD+   LGFSHPV +  P+G
Sbjct  62   AKELHGLSRTLVANMIVGVTEGYRKSLEIAGTGYRVTAKGKDLEFALGFSHPVTVVPPEG  121

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +   VE+ T   V+G +K  +G+ AA+IRK RPPEPYKGKGVKY  EVIRR
Sbjct  122  ITFSVEKPTLFHVAGINKQLVGEVAANIRKIRPPEPYKGKGVKYQGEVIRR  172



>ref|WP_044561661.1| 50S ribosomal protein L6 [Azospirillum sp. B4]
Length=177

 Score =   179 bits (453),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 118/171 (69%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK P+ VP+ VT+++ GQD  VKG LG+L +T   ++     E G + V+   E+R 
Sbjct  2    SRIGKHPVAVPAGVTVQVTGQDVTVKGKLGQLSLTLVDDIS-ATLEGGAVVVKPRNESRT  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A       RTL  NM+ GV  GF K L++ GVGY+A V+G++++LNLGFSH VR  IP G
Sbjct  61   ARVNWATSRTLLANMVKGVDTGFTKNLEITGVGYKAAVQGQELLLNLGFSHDVRFPIPAG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            + +K ++ T IT+SG+DK  IGQ AA IR +RPPEPYKGKG+KYADEVI R
Sbjct  121  ITMKCDKPTSITISGFDKQKIGQVAAEIRAYRPPEPYKGKGIKYADEVIIR  171



>ref|WP_006276968.1| 50S ribosomal protein L6 [Cylindrospermopsis raciborskii]
 gb|EFA70172.1| Ribosomal protein L6 [Cylindrospermopsis raciborskii CS-505]
Length=182

 Score =   179 bits (453),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 119/171 (70%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+PI +P+ V + ++G    VKGP GEL    P  V + +    +L  R+  +TR 
Sbjct  2    SRIGKRPITIPAKVQVAIDGTKVVVKGPKGELSRDLPAHVTVSQSGETLLVTRRD-DTRT  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            + +MHGL RTL  NM+ GVS+GF ++L++ GVGYRA V+G ++VLN+G+SH V++  P G
Sbjct  61   SRQMHGLSRTLVANMVEGVSQGFQRRLEIQGVGYRAQVQGANLVLNIGYSHQVQIEPPAG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +Q  VE NT + VSGYDK  +G  AA IR  RPPEPYKGKG++YA EV+RR
Sbjct  121  VQFVVENNTNVIVSGYDKEVVGNTAAKIRAVRPPEPYKGKGIRYAGEVVRR  171



>ref|WP_030478310.1| 50S ribosomal protein L6 [Lentzea albidocapillata]
Length=179

 Score =   179 bits (453),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 86/171 (50%), Positives = 119/171 (70%), Gaps = 0/171 (0%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGKQPI VPS V + + GQD  +KGP G L +T    + +EK E G L V++  + RR
Sbjct  2    SRIGKQPIIVPSGVDVNIAGQDVSIKGPKGLLTLTLAEPIIVEKAEDGTLEVKRPNDERR  61

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
               +HGL RTL  NM+VGV++G++KK+++ GVGYR  ++G ++   LG+SHPV++  P G
Sbjct  62   NRALHGLSRTLVHNMVVGVTQGYEKKMEIHGVGYRVALKGSELEFALGYSHPVKVEAPAG  121

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +   VE  TR +VSG DK  +G+ AA+IRK R P+PYKGKGV+Y+ E IRR
Sbjct  122  ITFTVETPTRFSVSGIDKQLVGEVAANIRKLRKPDPYKGKGVRYSGEKIRR  172



>ref|WP_020633320.1| 50S ribosomal protein L6 [Amycolatopsis alba]
Length=179

 Score =   179 bits (453),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 119/171 (70%), Gaps = 0/171 (0%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK P+ VPS V + ++GQ  KVKGP G L  T    + +EK E+G L V++  E R 
Sbjct  2    SRIGKLPVAVPSGVEVTIDGQQIKVKGPKGTLEHTIAEPIIVEKAENGTLEVKRPDEERT  61

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            +  +HGL RTL +N++VGV++G++KKL++ GVGYR   +G D+   LG+SHPV++  P+G
Sbjct  62   SRALHGLTRTLVNNLVVGVTEGYEKKLEIHGVGYRVQAKGSDLEFALGYSHPVKIEAPEG  121

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +  KVE  TR +VSG DK  +GQ AA IRK R P+PYKGKG++Y  E IRR
Sbjct  122  ITFKVETPTRFSVSGIDKQKVGQIAAVIRKLRRPDPYKGKGLRYEGEKIRR  172



>ref|WP_036533248.1| 50S ribosomal protein L6 [Nocardia cyriacigeorgica]
Length=179

 Score =   179 bits (453),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 85/171 (50%), Positives = 119/171 (70%), Gaps = 0/171 (0%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGKQPI +PS V + + GQD  VKGP G+L +T    + + K + G L+V +  + RR
Sbjct  2    SRIGKQPIAIPSGVEVTINGQDVAVKGPKGQLSLTVSEPITVTKGDDGQLQVARPDDERR  61

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            +  +HGL RTL  NMI GV+KG++KKL++ GVGYR  ++G+++   LGFSHPV    P G
Sbjct  62   SRALHGLTRTLVANMIEGVTKGYEKKLEIAGVGYRVALKGQNLEFALGFSHPVVAEPPQG  121

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +   VE  T+ +V+G DK  +G+ AA+IRK+R PEPYKGKG++YA E +RR
Sbjct  122  ITFAVESPTKFSVAGIDKQLVGEVAANIRKYRKPEPYKGKGIRYAGENVRR  172



>ref|WP_018217052.1| 50S ribosomal protein L6 [Salinispora pacifica]
Length=180

 Score =   179 bits (453),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 88/171 (51%), Positives = 116/171 (68%), Gaps = 0/171 (0%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIG++ IPVP+ V + + GQ   VKGP GEL  T    + +E+ E G L V +  + R+
Sbjct  2    SRIGRKSIPVPAGVDVTIAGQTVTVKGPKGELSHTIAEPITIEQAEDGQLNVARPNDERK  61

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A E+HGL RTL  NMIVGV++G+ K L++ G GYR   +GKD+   LGFSHPV +  P+G
Sbjct  62   AKELHGLSRTLVANMIVGVTEGYRKSLEIAGTGYRVTAKGKDLEFALGFSHPVTVVPPEG  121

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +   VE+ T   V+G +K  +G+ AA+IRK RPPEPYKGKGVKY  EVIRR
Sbjct  122  ITFSVEKPTLFHVAGINKQLVGEVAANIRKIRPPEPYKGKGVKYQGEVIRR  172



>ref|XP_002950331.1| plastid/chloroplast ribosomal protein L6 [Volvox carteri f. nagariensis]
 gb|EFJ48532.1| plastid/chloroplast ribosomal protein L6 [Volvox carteri f. nagariensis]
Length=206

 Score =   179 bits (455),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 89/175 (51%), Positives = 124/175 (71%), Gaps = 1/175 (1%)
 Frame = -1

Query  644  TVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRK  465
            TV CK+SRIG+ PI VP  VT+ +EG   +VKGP G L       VK+E+ + G L++ K
Sbjct  20   TVVCKDSRIGRAPIVVPKGVTVTLEGNLVRVKGPNGALEQLLSPRVKVEQVD-GKLKITK  78

Query  464  AMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVR  285
              + R A   HGL RTL +N+++GVS GF+K++++VG GYRA V GK++ LN+G+S P  
Sbjct  79   LGDDRVAMSQHGLNRTLVNNIVIGVSTGFEKRMEMVGTGYRASVAGKELTLNVGYSKPRV  138

Query  284  MAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVI  120
            + IP+GL+V VE+NT + VSG +K  +G F A+IR+ RPPEPYKGKG++YA E I
Sbjct  139  LEIPEGLKVAVEKNTTLVVSGANKVQVGDFCATIRRQRPPEPYKGKGIRYAGEFI  193



>ref|WP_018222588.1| 50S ribosomal protein L6 [Salinispora pacifica]
Length=180

 Score =   178 bits (452),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 88/171 (51%), Positives = 115/171 (67%), Gaps = 0/171 (0%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIG++ IPVP+ V + + GQ   VKGP GEL  T    + +E+ E G L V +  + R 
Sbjct  2    SRIGRKSIPVPAGVDVTIAGQTVTVKGPKGELSHTVAEPITIERAEDGQLNVARPNDERT  61

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A E+HGL RTL  NMIVGV++G+ K L++ G GYR   +GKD+   LGFSHPV +  P+G
Sbjct  62   AKELHGLSRTLVANMIVGVTEGYRKSLEIAGTGYRVTAKGKDLEFALGFSHPVTVVAPEG  121

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +   VE+ T   V+G +K  +G+ AA+IRK RPPEPYKGKGVKY  EVIRR
Sbjct  122  ITFSVEKPTLFHVAGINKQLVGEVAANIRKIRPPEPYKGKGVKYQGEVIRR  172



>ref|WP_006100646.1| 50S ribosomal protein L6 [Coleofasciculus chthonoplastes]
 gb|EDX76158.1| ribosomal protein L6, putative [Coleofasciculus chthonoplastes 
PCC 7420]
Length=179

 Score =   178 bits (452),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 122/171 (71%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+PI +P+ VT+ +EGQ   VKGP GEL    P++V +E +E   + VR+  E+R 
Sbjct  2    SRIGKRPITIPNKVTVTIEGQQVTVKGPKGELQRVLPKQVTIE-QEGETIHVRRRDESRL  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A + HGL RTL  NM+ GVSKGF+++L + GVGYRA V+G++++LN+G+S PV +  P+ 
Sbjct  61   ARQRHGLSRTLVANMVEGVSKGFERRLAIQGVGYRAQVQGRNLILNVGYSQPVEIVPPED  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +Q+ VE NT + VSG +K  +G  AA IR  RPPE YKGKG++Y  E+IRR
Sbjct  121  VQLAVEGNTNVIVSGINKEIVGNTAAKIRAVRPPEVYKGKGIRYVGEMIRR  171



>ref|WP_007001493.1| 50S ribosomal protein L6 [Actinobaculum massiliense]
 gb|EKU94833.1| 50S ribosomal protein L6 [Actinobaculum massiliae ACS-171-V-Col2]
Length=178

 Score =   178 bits (452),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 114/171 (67%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIG+ PI VP+ V I + G D  VKGP GEL  T P  +   K E GV+ V +  + R 
Sbjct  2    SRIGRLPITVPAGVDIAINGNDVTVKGPKGELEHTIPAPIT-AKLEDGVITVERPNDERE  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            +  +HGL RTL  NMIVGV+ G+ KKL++VG GYR   +G  +   LG+SHP+ +  P+G
Sbjct  61   SRSLHGLTRTLIYNMIVGVTDGYQKKLEIVGTGYRVQAKGTSLEFALGYSHPITVDAPEG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +   VE N ++TVSG DK A+G+ AA IRK R PEPYKGKG+KYADE IRR
Sbjct  121  ITFTVEGNNKLTVSGTDKQAVGEIAAQIRKLRAPEPYKGKGIKYADETIRR  171



>ref|WP_008197245.1| 50S ribosomal protein L6 [Microcystis sp. T1-4]
 emb|CCI30702.1| 50S ribosomal subunit protein L6 [Microcystis sp. T1-4]
Length=186

 Score =   178 bits (452),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 88/171 (51%), Positives = 119/171 (70%), Gaps = 1/171 (1%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIGK+PIP+P+ VT+ ++G    VKGP G L  T P  V + K+   +L  R+  ++R 
Sbjct  2    SRIGKRPIPIPNQVTVDIDGATVTVKGPKGTLQRTLPTAVAINKDGETLLVTRQD-DSRT  60

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A E HGL RTL  NM+ GV+ GF K+L + GVGYRA ++   +VLN+G+S PV M +PDG
Sbjct  61   ARERHGLCRTLVANMVEGVATGFQKRLDIQGVGYRAQLQDGKLVLNVGYSKPVEMEMPDG  120

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            + V VE +T++ VSG DK A+G  AA IR+ RPPEPYKGKG++Y  EV+RR
Sbjct  121  VSVAVENSTQVIVSGIDKEAVGNTAAKIREVRPPEPYKGKGIRYLGEVVRR  171



>ref|WP_013288623.1| MULTISPECIES: 50S ribosomal protein L6 [Micromonospora]
 gb|ADL49018.1| ribosomal protein L6 [Micromonospora aurantiaca ATCC 27029]
 gb|ADU06154.1| ribosomal protein L6 [Micromonospora sp. L5]
 gb|EWM67463.1| 50S ribosomal protein L6 [Micromonospora sp. M42]
Length=180

 Score =   178 bits (452),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 116/171 (68%), Gaps = 0/171 (0%)
 Frame = -1

Query  626  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  447
            SRIG++ IPVP+ V I ++G+  KVKGP GEL       +  E+ E G L V +  + R+
Sbjct  2    SRIGRKSIPVPAGVDITIDGRTVKVKGPKGELSHVLAEPITAERGEDGELHVNRPNDERK  61

Query  446  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  267
            A E+HGL RTL  NMIVGV++G+ K L++ G GYR   +GKD+   LGFSHPV +  P+G
Sbjct  62   AKELHGLSRTLVANMIVGVTEGYRKSLEIAGTGYRVTAKGKDLEFALGFSHPVLVPAPEG  121

Query  266  LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR  114
            +   VE+ T   V+G DK  +G+ AA+IRK RPPEPYKGKGVKY  EVIRR
Sbjct  122  ITFTVEKPTLFHVAGIDKQQVGEVAANIRKIRPPEPYKGKGVKYQGEVIRR  172



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1260188911410