BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF001G04

Length=498
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009789305.1|  PREDICTED: serine carboxypeptidase II-2            226   2e-68   Nicotiana sylvestris
ref|XP_009630744.1|  PREDICTED: serine carboxypeptidase II-2            225   6e-68   Nicotiana tomentosiformis
ref|XP_006343604.1|  PREDICTED: serine carboxypeptidase II-2-like       224   7e-68   Solanum tuberosum [potatoes]
ref|XP_004242620.1|  PREDICTED: serine carboxypeptidase II-2            224   1e-67   Solanum lycopersicum
gb|EYU34325.1|  hypothetical protein MIMGU_mgv1a005646mg                215   5e-64   Erythranthe guttata [common monkey flower]
ref|XP_002275081.1|  PREDICTED: serine carboxypeptidase II-2            214   1e-63   Vitis vinifera
emb|CAN75200.1|  hypothetical protein VITISV_014887                     214   2e-63   Vitis vinifera
ref|XP_007202013.1|  hypothetical protein PRUPE_ppa005192mg             213   3e-63   Prunus persica
ref|XP_008243035.1|  PREDICTED: serine carboxypeptidase II-2            211   1e-62   Prunus mume [ume]
ref|XP_004287151.1|  PREDICTED: serine carboxypeptidase II-2            209   5e-62   Fragaria vesca subsp. vesca
ref|XP_007013884.1|  Serine carboxypeptidase-like 29                    207   7e-61   Theobroma cacao [chocolate]
emb|CDP02851.1|  unnamed protein product                                206   2e-60   Coffea canephora [robusta coffee]
ref|XP_011079368.1|  PREDICTED: serine carboxypeptidase II-2            204   4e-60   Sesamum indicum [beniseed]
ref|XP_010111113.1|  Serine carboxypeptidase-like 29                    204   8e-60   
ref|XP_009358402.1|  PREDICTED: serine carboxypeptidase II-2            204   1e-59   Pyrus x bretschneideri [bai li]
ref|XP_010273729.1|  PREDICTED: serine carboxypeptidase II-2            202   3e-59   Nelumbo nucifera [Indian lotus]
ref|XP_008394291.1|  PREDICTED: serine carboxypeptidase II-2            201   8e-59   
emb|CBI36578.3|  unnamed protein product                                200   2e-58   Vitis vinifera
ref|XP_002273324.2|  PREDICTED: serine carboxypeptidase II-2            201   2e-58   Vitis vinifera
ref|XP_010048771.1|  PREDICTED: serine carboxypeptidase II-2            199   4e-58   Eucalyptus grandis [rose gum]
ref|XP_010040844.1|  PREDICTED: serine carboxypeptidase II-2-like       199   5e-58   Eucalyptus grandis [rose gum]
ref|XP_011018073.1|  PREDICTED: serine carboxypeptidase II-2-like       197   5e-58   Populus euphratica
gb|AFK34001.1|  unknown                                                 192   5e-58   Medicago truncatula
ref|XP_007138291.1|  hypothetical protein PHAVU_009G196000g             197   3e-57   Phaseolus vulgaris [French bean]
ref|XP_011018071.1|  PREDICTED: serine carboxypeptidase II-2-like...    197   4e-57   Populus euphratica
ref|XP_002324616.2|  hypothetical protein POPTR_0018s11210g             196   5e-57   
gb|ABK24285.1|  unknown                                                 196   7e-57   Picea sitchensis
ref|XP_006453577.1|  hypothetical protein CICLE_v10008112mg             196   8e-57   Citrus clementina [clementine]
ref|XP_003595891.1|  Serine carboxypeptidase-like protein               196   8e-57   Medicago truncatula
ref|XP_006474032.1|  PREDICTED: serine carboxypeptidase-like 29-like    196   1e-56   Citrus sinensis [apfelsine]
ref|XP_002528403.1|  serine carboxypeptidase, putative                  195   2e-56   Ricinus communis
gb|KHG11306.1|  Serine carboxypeptidase-like 29                         195   2e-56   Gossypium arboreum [tree cotton]
gb|KEH38195.1|  serine carboxypeptidase-like protein                    194   3e-56   Medicago truncatula
gb|KHN02055.1|  Serine carboxypeptidase II-2                            194   4e-56   Glycine soja [wild soybean]
gb|KDP38717.1|  hypothetical protein JCGZ_04070                         194   4e-56   Jatropha curcas
ref|XP_003522937.2|  PREDICTED: serine carboxypeptidase II-2-like       194   5e-56   Glycine max [soybeans]
ref|XP_003595892.1|  Serine carboxypeptidase II-2                       194   6e-56   Medicago truncatula
gb|EPS71160.1|  hypothetical protein M569_03591                         193   6e-56   Genlisea aurea
ref|XP_003595890.1|  Serine carboxypeptidase II-2                       193   8e-56   Medicago truncatula
ref|XP_010687643.1|  PREDICTED: serine carboxypeptidase II-2            192   1e-55   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004488608.1|  PREDICTED: serine carboxypeptidase II-2-like       192   2e-55   Cicer arietinum [garbanzo]
ref|XP_003596536.1|  Serine carboxypeptidase                            193   3e-55   
ref|XP_009410194.1|  PREDICTED: serine carboxypeptidase II-2-like       191   4e-55   Musa acuminata subsp. malaccensis [pisang utan]
gb|AIN39846.1|  hypothetical protein                                    183   5e-55   Zoysia matrella [Japanese carpet grass]
ref|XP_008790132.1|  PREDICTED: serine carboxypeptidase II-2 isof...    191   8e-55   Phoenix dactylifera
gb|AES66787.2|  serine carboxypeptidase-like protein                    190   1e-54   Medicago truncatula
ref|XP_010905043.1|  PREDICTED: serine carboxypeptidase II-2            189   4e-54   Elaeis guineensis
gb|ACF84647.1|  unknown                                                 183   4e-54   Zea mays [maize]
ref|XP_004964646.1|  PREDICTED: serine carboxypeptidase II-2-like       187   2e-53   Setaria italica
gb|KJB76659.1|  hypothetical protein B456_012G098600                    187   2e-53   Gossypium raimondii
ref|XP_004162685.1|  PREDICTED: serine carboxypeptidase-like 29-like    185   1e-52   
ref|XP_004144720.1|  PREDICTED: serine carboxypeptidase-like 29-like    184   2e-52   Cucumis sativus [cucumbers]
ref|XP_006453578.1|  hypothetical protein CICLE_v10008112mg             185   2e-52   Citrus clementina [clementine]
gb|EMT26558.1|  putative Serine carboxypeptidase II-2                   182   2e-52   
gb|KGN61064.1|  hypothetical protein Csa_2G036620                       185   3e-52   Cucumis sativus [cucumbers]
ref|XP_006845388.1|  hypothetical protein AMTR_s00019p00053910          184   4e-52   Amborella trichopoda
ref|NP_001146398.1|  Serine carboxypeptidase K10B2.2 precursor          183   7e-52   Zea mays [maize]
dbj|BAJ99024.1|  predicted protein                                      182   9e-52   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008452541.1|  PREDICTED: serine carboxypeptidase II-2            182   1e-51   Cucumis melo [Oriental melon]
sp|P55748.1|CBP22_HORVU  RecName: Full=Serine carboxypeptidase II...    181   1e-51   Hordeum vulgare [barley]
ref|NP_001057009.1|  Os06g0186400                                       182   1e-51   
ref|XP_002324520.1|  serine carboxypeptidase S10 family protein         181   3e-51   
dbj|BAK02147.1|  predicted protein                                      180   8e-51   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010253608.1|  PREDICTED: serine carboxypeptidase-like 27         179   2e-50   Nelumbo nucifera [Indian lotus]
ref|XP_002312024.1|  serine carboxypeptidase S10 family protein         179   2e-50   Populus trichocarpa [western balsam poplar]
gb|KJB78938.1|  hypothetical protein B456_013G026200                    179   2e-50   Gossypium raimondii
ref|XP_011031767.1|  PREDICTED: serine carboxypeptidase-like 27         179   2e-50   Populus euphratica
ref|XP_010669644.1|  PREDICTED: serine carboxypeptidase-like 27         178   3e-50   Beta vulgaris subsp. vulgaris [field beet]
gb|ACG38162.1|  serine carboxypeptidase K10B2.2 precursor               178   5e-50   Zea mays [maize]
ref|XP_008654560.1|  PREDICTED: uncharacterized protein LOC100273...    178   5e-50   
gb|ACF79757.1|  unknown                                                 178   5e-50   Zea mays [maize]
ref|XP_003556225.1|  PREDICTED: serine carboxypeptidase-like 27-l...    177   5e-50   Glycine max [soybeans]
gb|KDP25725.1|  hypothetical protein JCGZ_23946                         177   8e-50   Jatropha curcas
ref|XP_009378094.1|  PREDICTED: serine carboxypeptidase-like 27         177   8e-50   Pyrus x bretschneideri [bai li]
gb|KJB76568.1|  hypothetical protein B456_012G094900                    173   8e-50   Gossypium raimondii
emb|CDX72270.1|  BnaC07g42920D                                          180   9e-50   
ref|XP_006655861.1|  PREDICTED: serine carboxypeptidase II-2-like       177   1e-49   Oryza brachyantha
ref|XP_003564183.1|  PREDICTED: serine carboxypeptidase II-2            177   1e-49   Brachypodium distachyon [annual false brome]
gb|KHG25905.1|  Serine carboxypeptidase-like 27                         177   1e-49   Gossypium arboreum [tree cotton]
ref|XP_008368824.1|  PREDICTED: serine carboxypeptidase-like 27         176   1e-49   Malus domestica [apple tree]
ref|XP_009395827.1|  PREDICTED: serine carboxypeptidase II-2-like       177   1e-49   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004968265.1|  PREDICTED: serine carboxypeptidase 2-like          177   2e-49   Setaria italica
ref|XP_009137969.1|  PREDICTED: serine carboxypeptidase-like 29         177   2e-49   Brassica rapa
ref|XP_010264739.1|  PREDICTED: serine carboxypeptidase-like 27         176   2e-49   Nelumbo nucifera [Indian lotus]
ref|XP_010526302.1|  PREDICTED: serine carboxypeptidase-like 29         176   2e-49   Tarenaya hassleriana [spider flower]
emb|CDY13387.1|  BnaA03g51050D                                          176   3e-49   Brassica napus [oilseed rape]
gb|ABK21145.1|  unknown                                                 173   3e-49   Picea sitchensis
ref|XP_002457307.1|  hypothetical protein SORBIDRAFT_03g005360          176   3e-49   Sorghum bicolor [broomcorn]
ref|XP_007219592.1|  hypothetical protein PRUPE_ppa023509mg             173   7e-49   
ref|XP_011040963.1|  PREDICTED: serine carboxypeptidase-like 27         174   1e-48   Populus euphratica
ref|XP_006589433.1|  PREDICTED: serine carboxypeptidase-like 27-like    174   2e-48   Glycine max [soybeans]
gb|KJB76563.1|  hypothetical protein B456_012G094900                    174   2e-48   Gossypium raimondii
gb|KHN17121.1|  Serine carboxypeptidase-like 27                         174   2e-48   Glycine soja [wild soybean]
gb|KJB76569.1|  hypothetical protein B456_012G094900                    173   2e-48   Gossypium raimondii
gb|KHG08205.1|  Serine carboxypeptidase-like 27                         173   2e-48   Gossypium arboreum [tree cotton]
ref|XP_011076996.1|  PREDICTED: serine carboxypeptidase-like 27         173   2e-48   Sesamum indicum [beniseed]
ref|XP_008233341.1|  PREDICTED: serine carboxypeptidase-like 27         173   2e-48   Prunus mume [ume]
ref|XP_009802382.1|  PREDICTED: serine carboxypeptidase-like 27         173   2e-48   Nicotiana sylvestris
ref|XP_007143689.1|  hypothetical protein PHAVU_007G093300g             173   2e-48   Phaseolus vulgaris [French bean]
ref|XP_009592854.1|  PREDICTED: serine carboxypeptidase-like 27         173   3e-48   Nicotiana tomentosiformis
dbj|BAK06862.1|  predicted protein                                      167   5e-48   Hordeum vulgare subsp. vulgare [two-rowed barley]
pdb|1BCR|B  Chain B, Complex Of The Wheat Serine Carboxypeptidase...    164   5e-48   Triticum aestivum [Canadian hard winter wheat]
pdb|3SC2|B  Chain B, Refined Atomic Model Of Wheat Serine Carboxy...    164   6e-48   unidentified
pdb|1WHT|B  Chain B, Structure Of The Complex Of L-Benzylsuccinat...    164   6e-48   Triticum aestivum [Canadian hard winter wheat]
pdb|1WHS|B  Chain B, Structure Of The Complex Of L-Benzylsuccinat...    164   6e-48   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002459313.1|  hypothetical protein SORBIDRAFT_02g002260          172   6e-48   Sorghum bicolor [broomcorn]
ref|XP_006350225.1|  PREDICTED: serine carboxypeptidase-like 27-like    172   7e-48   Solanum tuberosum [potatoes]
emb|CDY28217.1|  BnaA01g06320D                                          172   8e-48   Brassica napus [oilseed rape]
tpg|DAA53383.1|  TPA: hypothetical protein ZEAMMB73_784297              169   8e-48   
emb|CDY55623.1|  BnaC03g77560D                                          172   1e-47   Brassica napus [oilseed rape]
ref|XP_009127491.1|  PREDICTED: serine carboxypeptidase-like 29         172   1e-47   Brassica rapa
ref|XP_010527107.1|  PREDICTED: serine carboxypeptidase-like 29         165   1e-47   Tarenaya hassleriana [spider flower]
ref|XP_002315292.2|  serine carboxypeptidase S10 family protein         171   1e-47   Populus trichocarpa [western balsam poplar]
ref|XP_008805039.1|  PREDICTED: serine carboxypeptidase-like 27         171   1e-47   Phoenix dactylifera
gb|KFK29659.1|  hypothetical protein AALP_AA7G162000                    172   1e-47   Arabis alpina [alpine rockcress]
emb|CDX68696.1|  BnaC01g07570D                                          172   1e-47   
ref|XP_004496292.1|  PREDICTED: serine carboxypeptidase-like 27-l...    171   1e-47   Cicer arietinum [garbanzo]
ref|NP_001044713.1|  Os01g0833500                                       171   2e-47   
gb|EAY76388.1|  hypothetical protein OsI_04319                          171   2e-47   Oryza sativa Indica Group [Indian rice]
ref|XP_010908844.1|  PREDICTED: serine carboxypeptidase-like 27         171   2e-47   Elaeis guineensis
ref|XP_002457308.1|  hypothetical protein SORBIDRAFT_03g005370          171   2e-47   Sorghum bicolor [broomcorn]
emb|CAN70886.1|  hypothetical protein VITISV_009829                     169   2e-47   Vitis vinifera
emb|CDY28216.1|  BnaA01g06330D                                          171   3e-47   Brassica napus [oilseed rape]
gb|KDO48447.1|  hypothetical protein CISIN_1g012819mg                   171   3e-47   Citrus sinensis [apfelsine]
gb|AFK43035.1|  unknown                                                 170   3e-47   Medicago truncatula
ref|XP_003591950.1|  Serine carboxypeptidase-like protein               170   3e-47   Medicago truncatula
emb|CDX68695.1|  BnaC01g07580D                                          171   3e-47   
dbj|BAH20278.1|  AT4G30810                                              168   3e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006850617.1|  hypothetical protein AMTR_s00034p00161680          170   4e-47   Amborella trichopoda
ref|XP_003560871.1|  PREDICTED: serine carboxypeptidase 2-like          171   4e-47   Brachypodium distachyon [annual false brome]
ref|XP_003564543.1|  PREDICTED: serine carboxypeptidase-like 27         170   5e-47   Brachypodium distachyon [annual false brome]
ref|XP_009127511.1|  PREDICTED: serine carboxypeptidase-like 29         170   5e-47   Brassica rapa
ref|XP_004236634.1|  PREDICTED: serine carboxypeptidase-like 27         170   5e-47   Solanum lycopersicum
ref|XP_003591947.1|  Serine carboxypeptidase-like protein               170   5e-47   Medicago truncatula
ref|XP_008381976.1|  PREDICTED: serine carboxypeptidase-like 27         170   5e-47   
ref|XP_004307401.1|  PREDICTED: serine carboxypeptidase-like 27         170   5e-47   Fragaria vesca subsp. vesca
ref|XP_008446902.1|  PREDICTED: serine carboxypeptidase-like 27         170   5e-47   Cucumis melo [Oriental melon]
emb|CDO99730.1|  unnamed protein product                                169   6e-47   Coffea canephora [robusta coffee]
ref|XP_006410747.1|  hypothetical protein EUTSA_v10016650mg             169   7e-47   Eutrema salsugineum [saltwater cress]
dbj|BAO04184.1|  hypothetical protein                                   169   8e-47   Delphinium grandiflorum
tpg|DAA53384.1|  TPA: serine carboxypeptidase K10B2.2                   169   1e-46   
ref|XP_004968264.1|  PREDICTED: serine carboxypeptidase-like 27-like    169   1e-46   Setaria italica
ref|XP_010525795.1|  PREDICTED: serine carboxypeptidase-like 29         164   1e-46   Tarenaya hassleriana [spider flower]
ref|NP_001150676.1|  serine carboxypeptidase K10B2.2 precursor          169   1e-46   Zea mays [maize]
gb|AAV43957.1|  putative serine carboxypeptidase II                     169   1e-46   Oryza sativa Japonica Group [Japonica rice]
emb|CDY35977.1|  BnaA05g29730D                                          169   1e-46   Brassica napus [oilseed rape]
ref|XP_004970465.1|  PREDICTED: serine carboxypeptidase-like 27-like    169   1e-46   Setaria italica
ref|XP_006436271.1|  hypothetical protein CICLE_v10031497mg             169   1e-46   Citrus clementina [clementine]
ref|XP_006644961.1|  PREDICTED: serine carboxypeptidase-like 27-like    169   1e-46   Oryza brachyantha
ref|XP_006645520.1|  PREDICTED: serine carboxypeptidase II-1-like       167   1e-46   Oryza brachyantha
ref|XP_006407773.1|  hypothetical protein EUTSA_v10020705mg             169   1e-46   Eutrema salsugineum [saltwater cress]
emb|CDY23258.1|  BnaA08g12880D                                          169   2e-46   Brassica napus [oilseed rape]
ref|XP_009147010.1|  PREDICTED: serine carboxypeptidase-like 27 i...    168   2e-46   
ref|XP_004142401.1|  PREDICTED: serine carboxypeptidase-like 27-like    168   2e-46   Cucumis sativus [cucumbers]
ref|XP_008673013.1|  PREDICTED: LOC100285510 isoform X1                 168   2e-46   
ref|XP_009333715.1|  PREDICTED: serine carboxypeptidase-like 27         168   2e-46   Pyrus x bretschneideri [bai li]
ref|NP_001151874.1|  LOC100285510 precursor                             168   2e-46   
ref|NP_567854.1|  serine carboxypeptidase-like 29                       169   2e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009147009.1|  PREDICTED: serine carboxypeptidase-like 27 i...    168   2e-46   Brassica rapa
ref|XP_010486379.1|  PREDICTED: serine carboxypeptidase-like 27         168   2e-46   Camelina sativa [gold-of-pleasure]
emb|CDY28004.1|  BnaC05g44060D                                          168   2e-46   Brassica napus [oilseed rape]
ref|XP_002274723.1|  PREDICTED: serine carboxypeptidase-like 27         168   2e-46   Vitis vinifera
emb|CAN74854.1|  hypothetical protein VITISV_028701                     168   2e-46   Vitis vinifera
ref|XP_010464446.1|  PREDICTED: serine carboxypeptidase-like 27         168   3e-46   Camelina sativa [gold-of-pleasure]
ref|XP_002458719.1|  hypothetical protein SORBIDRAFT_03g038940          168   3e-46   Sorghum bicolor [broomcorn]
dbj|BAJ99174.1|  predicted protein                                      167   4e-46   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009410600.1|  PREDICTED: serine carboxypeptidase-like 27 i...    167   4e-46   
emb|CAI64396.1|  serine carboxypeptidase II                             162   4e-46   Triticum aestivum [Canadian hard winter wheat]
gb|KFK38250.1|  hypothetical protein AALP_AA3G088900                    167   4e-46   Arabis alpina [alpine rockcress]
gb|EEC69980.1|  hypothetical protein OsI_00486                          167   5e-46   Oryza sativa Indica Group [Indian rice]
ref|NP_001042076.1|  Os01g0158200                                       167   5e-46   
ref|XP_006297635.1|  hypothetical protein CARUB_v10013654mg             167   5e-46   
dbj|BAB08188.1|  unnamed protein product                                167   7e-46   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002869361.1|  hypothetical protein ARALYDRAFT_491673             167   7e-46   
ref|XP_009410601.1|  PREDICTED: serine carboxypeptidase-like 27 i...    167   8e-46   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010547376.1|  PREDICTED: serine carboxypeptidase-like 27         166   9e-46   Tarenaya hassleriana [spider flower]
ref|XP_010541227.1|  PREDICTED: serine carboxypeptidase-like 29         164   9e-46   
ref|NP_187456.1|  serine carboxypeptidase-like 27                       166   9e-46   Arabidopsis thaliana [mouse-ear cress]
gb|EMS47606.1|  Serine carboxypeptidase-like 27                         166   1e-45   Triticum urartu
ref|XP_009108967.1|  PREDICTED: serine carboxypeptidase-like 29         167   1e-45   
ref|XP_009414289.1|  PREDICTED: serine carboxypeptidase-like 27         166   1e-45   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010460785.1|  PREDICTED: serine carboxypeptidase-like 27         166   1e-45   Camelina sativa [gold-of-pleasure]
ref|XP_008789080.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    166   1e-45   
gb|EYU39589.1|  hypothetical protein MIMGU_mgv1a0101822mg               157   1e-45   Erythranthe guttata [common monkey flower]
ref|XP_006655142.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    166   2e-45   
ref|XP_010920885.1|  PREDICTED: serine carboxypeptidase-like 27         166   2e-45   Elaeis guineensis
ref|XP_003591949.1|  Serine carboxypeptidase-like protein               165   2e-45   
ref|XP_006412667.1|  hypothetical protein EUTSA_v10025076mg             166   3e-45   Eutrema salsugineum [saltwater cress]
gb|EMT12249.1|  Serine carboxypeptidase 2                               165   4e-45   
ref|XP_002882565.1|  hypothetical protein ARALYDRAFT_478140             164   4e-45   Arabidopsis lyrata subsp. lyrata
gb|KDO59486.1|  hypothetical protein CISIN_1g0120681mg                  163   5e-45   Citrus sinensis [apfelsine]
sp|P08819.2|CBP2_WHEAT  RecName: Full=Serine carboxypeptidase 2; ...    164   6e-45   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003566533.2|  PREDICTED: serine carboxypeptidase 2-like          164   6e-45   Brachypodium distachyon [annual false brome]
ref|XP_006470942.1|  PREDICTED: serine carboxypeptidase II-2-like       161   7e-45   
ref|XP_006286217.1|  hypothetical protein CARUB_v10007783mg             164   9e-45   Capsella rubella
ref|XP_010447670.1|  PREDICTED: serine carboxypeptidase-like 29         164   9e-45   Camelina sativa [gold-of-pleasure]
ref|XP_006453596.1|  hypothetical protein CICLE_v10008182mg             164   1e-44   Citrus clementina [clementine]
ref|XP_010438130.1|  PREDICTED: serine carboxypeptidase-like 29         164   1e-44   Camelina sativa [gold-of-pleasure]
ref|XP_009141519.1|  PREDICTED: serine carboxypeptidase-like 26         163   1e-44   Brassica rapa
ref|XP_006474013.1|  PREDICTED: serine carboxypeptidase 24-like         164   1e-44   Citrus sinensis [apfelsine]
ref|XP_009386999.1|  PREDICTED: serine carboxypeptidase-like 27         163   2e-44   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY32091.1|  BnaC04g44750D                                          163   2e-44   Brassica napus [oilseed rape]
emb|CDY40438.1|  BnaA04g20790D                                          163   2e-44   Brassica napus [oilseed rape]
prf||1408163B  CPase II B                                               155   2e-44
ref|XP_010937832.1|  PREDICTED: serine carboxypeptidase-like 27         163   2e-44   Elaeis guineensis
gb|ACA61621.1|  hypothetical protein AP7_B10.1                          162   3e-44   Arabidopsis lyrata subsp. petraea
gb|EMS66624.1|  Serine carboxypeptidase II-1                            159   6e-44   Triticum urartu
gb|KCW65386.1|  hypothetical protein EUGRSUZ_G02816                     161   7e-44   Eucalyptus grandis [rose gum]
gb|EMT21139.1|  putative Serine carboxypeptidase II-1                   160   8e-44   
sp|P55747.1|CBP21_HORVU  RecName: Full=Serine carboxypeptidase II...    158   8e-44   Hordeum vulgare [barley]
ref|XP_004962519.1|  PREDICTED: serine carboxypeptidase 2-like          161   9e-44   Setaria italica
ref|XP_007154876.1|  hypothetical protein PHAVU_003G155400g             159   1e-43   Phaseolus vulgaris [French bean]
ref|XP_002881414.1|  hypothetical protein ARALYDRAFT_482550             160   1e-43   
ref|XP_010067290.1|  PREDICTED: serine carboxypeptidase-like 27         162   1e-43   Eucalyptus grandis [rose gum]
emb|CDP11023.1|  unnamed protein product                                160   2e-43   Coffea canephora [robusta coffee]
ref|XP_003566409.1|  PREDICTED: serine carboxypeptidase II-1            160   2e-43   
gb|KHN42831.1|  Serine carboxypeptidase 24                              160   2e-43   Glycine soja [wild soybean]
ref|XP_003519151.1|  PREDICTED: serine carboxypeptidase 24-like i...    160   2e-43   Glycine max [soybeans]
gb|EMT08964.1|  Serine carboxypeptidase 2                               159   3e-43   
ref|XP_007009787.1|  Serine carboxypeptidase-like 27 isoform 1          161   3e-43   
emb|CDM82001.1|  unnamed protein product                                160   3e-43   Triticum aestivum [Canadian hard winter wheat]
ref|XP_007011905.1|  Alpha/beta-Hydrolases superfamily protein          159   4e-43   
ref|XP_011469672.1|  PREDICTED: serine carboxypeptidase-like 27 i...    159   5e-43   Fragaria vesca subsp. vesca
emb|CAA18212.1|  SERINE CARBOXYPEPTIDASE II-like protein                158   5e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004307399.1|  PREDICTED: serine carboxypeptidase-like 27 i...    159   6e-43   Fragaria vesca subsp. vesca
ref|XP_008649461.1|  PREDICTED: serine carboxypeptidase 2-like is...    159   6e-43   Zea mays [maize]
gb|ACU19747.1|  unknown                                                 155   6e-43   Glycine max [soybeans]
ref|XP_008352213.1|  PREDICTED: serine carboxypeptidase 24-like         156   8e-43   
ref|XP_010548637.1|  PREDICTED: serine carboxypeptidase 24              159   9e-43   Tarenaya hassleriana [spider flower]
dbj|BAK02399.1|  predicted protein                                      158   9e-43   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006841720.1|  hypothetical protein AMTR_s00003p00256450          157   9e-43   
ref|XP_009792407.1|  PREDICTED: serine carboxypeptidase 24-like         158   1e-42   Nicotiana sylvestris
ref|XP_010432944.1|  PREDICTED: serine carboxypeptidase-like 29         158   1e-42   Camelina sativa [gold-of-pleasure]
ref|XP_010505098.1|  PREDICTED: serine carboxypeptidase-like 26         158   1e-42   Camelina sativa [gold-of-pleasure]
gb|KJB76567.1|  hypothetical protein B456_012G094900                    158   1e-42   Gossypium raimondii
ref|XP_006294202.1|  hypothetical protein CARUB_v10023198mg             157   1e-42   Capsella rubella
ref|XP_003549539.1|  PREDICTED: serine carboxypeptidase 24-like         157   2e-42   Glycine max [soybeans]
ref|XP_010323187.1|  PREDICTED: serine carboxypeptidase 24 isofor...    156   2e-42   
ref|XP_010656616.1|  PREDICTED: serine carboxypeptidase 24 isofor...    156   2e-42   
ref|XP_010509560.1|  PREDICTED: serine carboxypeptidase-like 26         157   2e-42   Camelina sativa [gold-of-pleasure]
ref|XP_008645971.1|  PREDICTED: serine carboxypeptidase-like 34         150   3e-42   Zea mays [maize]
emb|CAA70815.1|  serine carboxypeptidase II, CP-MII                     157   3e-42   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDP02317.1|  unnamed protein product                                157   3e-42   Coffea canephora [robusta coffee]
ref|XP_008649460.1|  PREDICTED: serine carboxypeptidase 2-like is...    157   3e-42   Zea mays [maize]
ref|XP_010516783.1|  PREDICTED: serine carboxypeptidase-like 26         156   4e-42   Camelina sativa [gold-of-pleasure]
emb|CDY39224.1|  BnaA03g50360D                                          157   5e-42   Brassica napus [oilseed rape]
ref|XP_009631140.1|  PREDICTED: serine carboxypeptidase 24-like         156   5e-42   Nicotiana tomentosiformis
ref|XP_010323186.1|  PREDICTED: serine carboxypeptidase 24 isofor...    156   6e-42   
ref|XP_004242603.2|  PREDICTED: serine carboxypeptidase 24 isofor...    156   6e-42   Solanum lycopersicum
ref|XP_002275684.1|  PREDICTED: serine carboxypeptidase 24 isofor...    156   7e-42   Vitis vinifera
ref|XP_008394313.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    156   7e-42   
ref|XP_009137947.1|  PREDICTED: serine carboxypeptidase 24              156   7e-42   Brassica rapa
emb|CAN79972.1|  hypothetical protein VITISV_010072                     155   7e-42   Vitis vinifera
gb|KJB07561.1|  hypothetical protein B456_001G032600                    155   9e-42   Gossypium raimondii
ref|XP_010432964.1|  PREDICTED: serine carboxypeptidase 24 isofor...    155   1e-41   
ref|XP_002869369.1|  hypothetical protein ARALYDRAFT_491690             155   1e-41   Arabidopsis lyrata subsp. lyrata
ref|XP_010108549.1|  Serine carboxypeptidase 24                         156   1e-41   
ref|XP_008230880.1|  PREDICTED: serine carboxypeptidase-like 25         151   1e-41   
ref|XP_002983919.1|  serine carboxypeptidase-like enzyme                155   1e-41   
sp|P08818.2|CBP2_HORVU  RecName: Full=Serine carboxypeptidase 2; ...    155   1e-41   Hordeum vulgare [barley]
ref|XP_008654561.1|  PREDICTED: uncharacterized protein LOC100273...    155   1e-41   Zea mays [maize]
gb|KDP38690.1|  hypothetical protein JCGZ_04043                         150   1e-41   Jatropha curcas
emb|CDM84839.1|  unnamed protein product                                150   1e-41   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009358427.1|  PREDICTED: serine carboxypeptidase 24              155   1e-41   Pyrus x bretschneideri [bai li]
ref|XP_006343642.1|  PREDICTED: serine carboxypeptidase 24-like         155   1e-41   Solanum tuberosum [potatoes]
ref|XP_010265560.1|  PREDICTED: serine carboxypeptidase 24-like i...    154   2e-41   Nelumbo nucifera [Indian lotus]
ref|XP_010432963.1|  PREDICTED: serine carboxypeptidase 24 isofor...    155   2e-41   Camelina sativa [gold-of-pleasure]
gb|AAP76507.1|  carboxypeptidase D                                      146   2e-41   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010447693.1|  PREDICTED: serine carboxypeptidase 24-like         155   2e-41   Camelina sativa [gold-of-pleasure]
ref|XP_004137284.1|  PREDICTED: serine carboxypeptidase-like 25-like    155   2e-41   Cucumis sativus [cucumbers]
ref|XP_011009402.1|  PREDICTED: serine carboxypeptidase-like 25 i...    154   2e-41   Populus euphratica
gb|KHG14577.1|  Serine carboxypeptidase 24 -like protein                155   2e-41   Gossypium arboreum [tree cotton]
ref|XP_010265559.1|  PREDICTED: serine carboxypeptidase 24-like i...    155   2e-41   Nelumbo nucifera [Indian lotus]
gb|AFK37459.1|  unknown                                                 155   2e-41   Lotus japonicus
gb|KJB07564.1|  hypothetical protein B456_001G032600                    155   2e-41   Gossypium raimondii
ref|XP_004489523.1|  PREDICTED: serine carboxypeptidase-like 25-like    155   2e-41   Cicer arietinum [garbanzo]
gb|KJB07559.1|  hypothetical protein B456_001G032600                    155   2e-41   Gossypium raimondii
ref|XP_006285794.1|  hypothetical protein CARUB_v10007268mg             155   2e-41   Capsella rubella
gb|KJB07563.1|  hypothetical protein B456_001G032600                    155   2e-41   Gossypium raimondii
ref|NP_194790.1|  serine carboxypeptidase 24                            154   2e-41   
ref|XP_010669643.1|  PREDICTED: serine carboxypeptidase-like 28         155   2e-41   
gb|AAK44013.1|AF370198_1  putative serine carboxypeptidase II           154   2e-41   
ref|XP_002960751.1|  serine carboxypeptidase-like enzyme                154   3e-41   
ref|XP_008460256.1|  PREDICTED: serine carboxypeptidase-like 25 i...    153   3e-41   
ref|XP_007204505.1|  hypothetical protein PRUPE_ppa019210mg             154   3e-41   
gb|KFK36474.1|  hypothetical protein AALP_AA4G129400                    154   3e-41   
gb|KHN13367.1|  Serine carboxypeptidase-like 27                         155   3e-41   
ref|XP_003548016.1|  PREDICTED: serine carboxypeptidase-like 27-like    155   3e-41   
ref|XP_004232164.1|  PREDICTED: serine carboxypeptidase-like 25         154   3e-41   
ref|XP_006412682.1|  hypothetical protein EUTSA_v10025119mg             154   3e-41   
ref|XP_009365880.1|  PREDICTED: serine carboxypeptidase-like 25         154   3e-41   
gb|KFK29637.1|  hypothetical protein AALP_AA7G159500                    154   4e-41   
gb|KHG16869.1|  Serine carboxypeptidase-like 25                         154   4e-41   
ref|XP_004304228.1|  PREDICTED: serine carboxypeptidase-like 25         154   5e-41   
gb|ACF87497.1|  unknown                                                 150   5e-41   
ref|XP_011009401.1|  PREDICTED: serine carboxypeptidase-like 25 i...    154   5e-41   
gb|KJB75608.1|  hypothetical protein B456_012G048700                    154   5e-41   
ref|XP_006297594.1|  hypothetical protein CARUB_v10013616mg             154   5e-41   
ref|XP_008243007.1|  PREDICTED: serine carboxypeptidase 24              154   5e-41   
ref|XP_002306020.2|  serine carboxypeptidase S10 family protein         154   7e-41   
ref|XP_008460255.1|  PREDICTED: serine carboxypeptidase-like 25 i...    153   7e-41   
ref|XP_008443850.1|  PREDICTED: serine carboxypeptidase 24-like i...    154   7e-41   
ref|XP_008443851.1|  PREDICTED: serine carboxypeptidase 24-like i...    153   7e-41   
ref|XP_008443849.1|  PREDICTED: serine carboxypeptidase 24-like i...    154   7e-41   
gb|AES62200.2|  serine carboxypeptidase-like protein                    154   7e-41   
emb|CDP10248.1|  unnamed protein product                                153   8e-41   
gb|AAC63669.1|  putative serine carboxypeptidase II                     152   1e-40   
ref|NP_179979.4|  serine carboxypeptidase-like 23                       152   1e-40   
ref|NP_181121.1|  serine carboxypeptidase-like 26                       153   1e-40   
ref|XP_011033395.1|  PREDICTED: serine carboxypeptidase 24-like         153   1e-40   
ref|XP_002280058.1|  PREDICTED: serine carboxypeptidase-like 25         153   1e-40   
emb|CBI21207.3|  unnamed protein product                                153   1e-40   
ref|XP_002308408.1|  BRI1 SUPPRESSOR 1 family protein                   153   1e-40   
sp|O82229.2|SCP23_ARATH  RecName: Full=Putative serine carboxypep...    152   1e-40   
ref|XP_006373361.1|  hypothetical protein POPTR_0017s12960g             150   1e-40   
ref|XP_004288721.2|  PREDICTED: serine carboxypeptidase 24              153   1e-40   
ref|XP_011079399.1|  PREDICTED: serine carboxypeptidase 24              152   1e-40   
ref|XP_006338367.1|  PREDICTED: serine carboxypeptidase-like 25-like    152   1e-40   
ref|XP_004161865.1|  PREDICTED: serine carboxypeptidase 24-like         152   1e-40   
ref|XP_004146676.1|  PREDICTED: serine carboxypeptidase 24-like         152   2e-40   
gb|ABR16596.1|  unknown                                                 153   2e-40   
ref|XP_002312023.1|  hypothetical protein POPTR_0008s04130g             152   2e-40   
ref|XP_010273635.1|  PREDICTED: serine carboxypeptidase 24-like         152   2e-40   
ref|XP_007032750.1|  Serine carboxypeptidase-like 25 isoform 3          151   2e-40   
ref|XP_008357779.1|  PREDICTED: serine carboxypeptidase-like 25 i...    152   2e-40   
ref|XP_008357780.1|  PREDICTED: serine carboxypeptidase-like 25 i...    152   2e-40   
gb|KEH21654.1|  serine carboxypeptidase-like protein                    152   2e-40   
gb|KDO62276.1|  hypothetical protein CISIN_1g0418331mg                  143   3e-40   
ref|XP_007216267.1|  hypothetical protein PRUPE_ppa017321mg             152   3e-40   
ref|XP_002527614.1|  serine carboxypeptidase, putative                  151   3e-40   
dbj|BAD19262.1|  putative carboxypeptidase D                            150   3e-40   
ref|XP_006845845.1|  hypothetical protein AMTR_s00154p00033550          151   5e-40   
ref|XP_006408447.1|  hypothetical protein EUTSA_v10020652mg             151   5e-40   
ref|XP_009771074.1|  PREDICTED: serine carboxypeptidase-like 25         151   5e-40   
ref|XP_009596929.1|  PREDICTED: serine carboxypeptidase-like 25         151   5e-40   
ref|XP_006482750.1|  PREDICTED: serine carboxypeptidase-like 25-l...    151   5e-40   
ref|XP_002529402.1|  serine carboxypeptidase, putative                  151   5e-40   
ref|XP_010549997.1|  PREDICTED: serine carboxypeptidase-like 25         151   6e-40   
ref|XP_006482749.1|  PREDICTED: serine carboxypeptidase-like 25-l...    151   7e-40   
ref|XP_006431295.1|  hypothetical protein CICLE_v10011605mg             151   7e-40   
ref|XP_006482748.1|  PREDICTED: serine carboxypeptidase-like 25-l...    151   7e-40   
ref|XP_010942076.1|  PREDICTED: serine carboxypeptidase 24 isofor...    149   7e-40   
ref|XP_002452974.1|  hypothetical protein SORBIDRAFT_04g035810          151   7e-40   
emb|CBI31484.3|  unnamed protein product                                151   7e-40   
ref|XP_002325127.2|  BRI1 SUPPRESSOR 1 family protein                   150   8e-40   
ref|XP_006482747.1|  PREDICTED: serine carboxypeptidase-like 25-l...    150   8e-40   
ref|XP_010032541.1|  PREDICTED: serine carboxypeptidase-like 25         151   8e-40   
ref|XP_002274699.1|  PREDICTED: serine carboxypeptidase-like 28         150   8e-40   
ref|XP_002324116.2|  serine carboxypeptidase S10 family protein         150   9e-40   
ref|XP_007139483.1|  hypothetical protein PHAVU_008G033300g             150   9e-40   
ref|XP_007032748.1|  Serine carboxypeptidase-like 25 isoform 1          151   1e-39   
ref|NP_001150705.1|  LOC100284338 precursor                             150   1e-39   
ref|XP_006373364.1|  hypothetical protein POPTR_0017s12960g             150   1e-39   
gb|EAY87844.1|  hypothetical protein OsI_09265                          150   1e-39   
ref|NP_001048377.1|  Os02g0794500                                       150   1e-39   
ref|XP_006845380.1|  hypothetical protein AMTR_s00019p00043630          150   1e-39   
dbj|BAJ85578.1|  predicted protein                                      150   1e-39   
ref|XP_010260044.1|  PREDICTED: serine carboxypeptidase-like 25 i...    150   2e-39   
ref|XP_006294162.1|  hypothetical protein CARUB_v10023155mg             150   2e-39   
dbj|BAD25095.1|  putative carboxypeptidase D                            147   2e-39   
ref|XP_011031766.1|  PREDICTED: serine carboxypeptidase-like 27         149   2e-39   
gb|EYU44197.1|  hypothetical protein MIMGU_mgv1a005600mg                149   2e-39   
gb|KDP27243.1|  hypothetical protein JCGZ_19942                         149   2e-39   
dbj|BAJ92218.1|  predicted protein                                      150   2e-39   
ref|NP_186860.1|  serine carboxypeptidase-like 25                       149   2e-39   
ref|XP_003570294.1|  PREDICTED: serine carboxypeptidase 24              149   2e-39   
ref|XP_010089631.1|  Serine carboxypeptidase-like 25                    149   2e-39   
gb|AAM65698.1|  putative serine carboxypeptidase II                     149   2e-39   
ref|XP_010485446.1|  PREDICTED: serine carboxypeptidase-like 25         149   3e-39   
ref|XP_011040962.1|  PREDICTED: serine carboxypeptidase-like 27         149   3e-39   
gb|EYU27945.1|  hypothetical protein MIMGU_mgv1a005674mg                149   4e-39   
ref|XP_006296368.1|  hypothetical protein CARUB_v10025540mg             148   4e-39   
ref|XP_010942075.1|  PREDICTED: serine carboxypeptidase 24 isofor...    149   4e-39   
emb|CDO99728.1|  unnamed protein product                                149   4e-39   
gb|KDO52736.1|  hypothetical protein CISIN_1g0420602mg                  145   4e-39   
ref|XP_010463602.1|  PREDICTED: serine carboxypeptidase-like 25         149   5e-39   
ref|XP_010445019.1|  PREDICTED: serine carboxypeptidase-like 25         148   5e-39   
ref|XP_009399563.1|  PREDICTED: serine carboxypeptidase 24-like         148   5e-39   
ref|XP_010067797.1|  PREDICTED: serine carboxypeptidase-like 40 i...    146   6e-39   
gb|KCW78823.1|  hypothetical protein EUGRSUZ_C00253                     147   6e-39   
ref|XP_002315293.2|  hypothetical protein POPTR_0010s22700g             148   6e-39   
ref|XP_002878712.1|  hypothetical protein ARALYDRAFT_320208             148   7e-39   
ref|XP_004954211.1|  PREDICTED: serine carboxypeptidase 24-like         148   7e-39   
ref|XP_006404896.1|  hypothetical protein EUTSA_v10000274mg             144   7e-39   
ref|XP_004158226.1|  PREDICTED: serine carboxypeptidase-like 34-like    147   7e-39   
ref|XP_006648043.1|  PREDICTED: serine carboxypeptidase 24-like         147   8e-39   
ref|XP_003552566.1|  PREDICTED: serine carboxypeptidase-like 25-l...    148   8e-39   
gb|EEC73659.1|  hypothetical protein OsI_08191                          148   8e-39   
gb|KHN13554.1|  Serine carboxypeptidase-like 25                         148   8e-39   
ref|XP_002884303.1|  hypothetical protein ARALYDRAFT_477440             148   9e-39   
ref|NP_001047514.1|  Os02g0634700                                       148   9e-39   
gb|KFK27639.1|  hypothetical protein AALP_AA8G409500                    148   9e-39   
ref|XP_011098746.1|  PREDICTED: serine carboxypeptidase-like 25         147   9e-39   
ref|XP_011000079.1|  PREDICTED: serine carboxypeptidase-like 25         147   9e-39   
ref|XP_002521402.1|  serine carboxypeptidase, putative                  148   9e-39   
ref|NP_001145702.1|  hypothetical protein                               145   1e-38   
ref|XP_011018040.1|  PREDICTED: serine carboxypeptidase 24-like i...    147   1e-38   
ref|NP_001152245.1|  lysosomal protective protein precursor             148   1e-38   
gb|AFK36150.1|  unknown                                                 143   1e-38   
ref|XP_008677402.1|  PREDICTED: lysosomal protective protein isof...    147   1e-38   
ref|NP_001077950.1|  serine carboxypeptidase-like 22                    146   1e-38   
gb|KHN41581.1|  Serine carboxypeptidase-like 25                         147   1e-38   
ref|XP_003530438.1|  PREDICTED: serine carboxypeptidase-like 25-l...    147   1e-38   
gb|ABR16997.1|  unknown                                                 147   1e-38   
ref|XP_010258045.1|  PREDICTED: serine carboxypeptidase-like 25         147   2e-38   
emb|CDX76845.1|  BnaC08g34310D                                          146   2e-38   
ref|XP_010429355.1|  PREDICTED: putative serine carboxypeptidase-...    147   2e-38   
ref|XP_010047069.1|  PREDICTED: serine carboxypeptidase 24-like         146   2e-38   
gb|KHG11032.1|  Serine carboxypeptidase-like 28                         142   2e-38   
ref|XP_010551814.1|  PREDICTED: serine carboxypeptidase-like 25 i...    146   2e-38   
ref|NP_179978.2|  serine carboxypeptidase-like 22                       146   2e-38   
ref|XP_010551812.1|  PREDICTED: serine carboxypeptidase-like 25 i...    146   2e-38   
emb|CDY43258.1|  BnaC05g48510D                                          146   2e-38   
ref|XP_010068957.1|  PREDICTED: serine carboxypeptidase-like 40         147   3e-38   
ref|XP_010067794.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    146   3e-38   
ref|XP_009147382.1|  PREDICTED: serine carboxypeptidase-like 25         146   3e-38   
ref|XP_011083950.1|  PREDICTED: serine carboxypeptidase 24-like i...    145   3e-38   
ref|XP_004135953.1|  PREDICTED: serine carboxypeptidase-like 34-like    146   3e-38   
ref|XP_007032749.1|  Serine carboxypeptidase-like 25 isoform 2          146   3e-38   
emb|CDY34805.1|  BnaA09g41720D                                          147   3e-38   
gb|EPS67928.1|  hypothetical protein M569_06845                         146   3e-38   
gb|AAC63668.1|  putative serine carboxypeptidase II                     146   3e-38   
ref|XP_008810326.1|  PREDICTED: serine carboxypeptidase 24              145   3e-38   
gb|EMT11707.1|  Serine carboxypeptidase-like 27                         147   3e-38   
ref|XP_010067796.1|  PREDICTED: serine carboxypeptidase-like 40 i...    147   3e-38   
gb|ACU21427.1|  unknown                                                 142   3e-38   
gb|KFK37671.1|  hypothetical protein AALP_AA3G013500                    146   3e-38   
ref|XP_002452495.1|  hypothetical protein SORBIDRAFT_04g026900          146   4e-38   
ref|XP_009117259.1|  PREDICTED: serine carboxypeptidase-like 22         145   5e-38   
gb|KFK32686.1|  hypothetical protein AALP_AA6G275800                    145   5e-38   
ref|XP_009420309.1|  PREDICTED: serine carboxypeptidase 24-like         145   5e-38   
ref|XP_011083949.1|  PREDICTED: serine carboxypeptidase 24-like i...    145   6e-38   
ref|XP_008643436.1|  PREDICTED: hypothetical protein isoform X2         145   7e-38   
ref|XP_008643435.1|  PREDICTED: hypothetical protein isoform X1         145   7e-38   
ref|XP_004953203.1|  PREDICTED: serine carboxypeptidase-like 34-like    145   8e-38   
gb|KDP25724.1|  hypothetical protein JCGZ_23945                         145   8e-38   
ref|XP_006437593.1|  hypothetical protein CICLE_v10031313mg             145   9e-38   
ref|XP_006484531.1|  PREDICTED: serine carboxypeptidase-like 34-like    145   9e-38   
ref|XP_003572740.1|  PREDICTED: serine carboxypeptidase-like 34         145   9e-38   
ref|XP_010112534.1|  Serine carboxypeptidase-like 34                    145   9e-38   
ref|XP_008461360.1|  PREDICTED: serine carboxypeptidase-like 34         145   1e-37   
ref|XP_011096266.1|  PREDICTED: serine carboxypeptidase-like 31         145   1e-37   
emb|CDY46950.1|  BnaA02g32960D                                          145   1e-37   
emb|CDY40802.1|  BnaC02g41710D                                          145   1e-37   
ref|XP_007223035.1|  hypothetical protein PRUPE_ppa005368mg             144   1e-37   
ref|XP_010472396.1|  PREDICTED: serine carboxypeptidase-like 22         144   1e-37   
ref|XP_009130122.1|  PREDICTED: serine carboxypeptidase-like 34         145   1e-37   
ref|XP_010429353.1|  PREDICTED: serine carboxypeptidase-like 22         144   1e-37   
ref|XP_010274881.1|  PREDICTED: serine carboxypeptidase-like 34         144   2e-37   
ref|XP_006648863.1|  PREDICTED: serine carboxypeptidase-like 34-like    143   2e-37   
gb|KCW76300.1|  hypothetical protein EUGRSUZ_D00674                     139   2e-37   
ref|XP_008224993.1|  PREDICTED: serine carboxypeptidase-like 31         144   2e-37   
ref|NP_197712.2|  serine carboxypeptidase-like 34                       143   3e-37   
ref|XP_009413121.1|  PREDICTED: serine carboxypeptidase-like 34         144   3e-37   
ref|XP_009800559.1|  PREDICTED: serine carboxypeptidase-like 31 i...    144   3e-37   
gb|ABF70080.1|  serine carboxypeptidase (carboxypeptidase D), put...    144   3e-37   
ref|XP_009800560.1|  PREDICTED: serine carboxypeptidase-like 31 i...    143   3e-37   
emb|CDY65614.1|  BnaCnng47980D                                          140   3e-37   
ref|XP_009591368.1|  PREDICTED: serine carboxypeptidase-like 31 i...    143   3e-37   
ref|XP_009591367.1|  PREDICTED: serine carboxypeptidase-like 31 i...    143   3e-37   
gb|AFK45951.1|  unknown                                                 139   4e-37   
gb|KDO75848.1|  hypothetical protein CISIN_1g0117381mg                  136   4e-37   
ref|XP_010417140.1|  PREDICTED: serine carboxypeptidase-like 22         143   5e-37   
ref|XP_004297735.1|  PREDICTED: serine carboxypeptidase-like 34         143   5e-37   
ref|XP_010031922.1|  PREDICTED: serine carboxypeptidase-like 34         143   5e-37   
ref|XP_010933315.1|  PREDICTED: serine carboxypeptidase-like 34         142   5e-37   
ref|XP_010278297.1|  PREDICTED: serine carboxypeptidase-like 31         143   6e-37   
ref|XP_010475996.1|  PREDICTED: serine carboxypeptidase-like 31         136   6e-37   
ref|XP_001772135.1|  predicted protein                                  142   6e-37   
ref|XP_002451122.1|  hypothetical protein SORBIDRAFT_05g024440          143   6e-37   
ref|XP_003593501.1|  Serine carboxypeptidase-like protein               142   7e-37   
ref|XP_003529304.1|  PREDICTED: serine carboxypeptidase-like 31-l...    142   7e-37   
ref|XP_002872043.1|  SCPL34                                             143   7e-37   
ref|XP_006583804.1|  PREDICTED: serine carboxypeptidase-like 31-l...    142   8e-37   
ref|NP_851062.2|  serine carboxypeptidase-like 34                       142   8e-37   
ref|XP_010067291.1|  PREDICTED: serine carboxypeptidase-like 28         142   8e-37   
ref|XP_002440854.1|  hypothetical protein SORBIDRAFT_09g008660          142   9e-37   
gb|KJB76572.1|  hypothetical protein B456_012G095000                    142   9e-37   
ref|XP_006394590.1|  hypothetical protein EUTSA_v10004057mg             142   1e-36   
gb|KJB79850.1|  hypothetical protein B456_013G069700                    142   1e-36   
ref|XP_010054359.1|  PREDICTED: serine carboxypeptidase-like 31         139   1e-36   
gb|KJB76571.1|  hypothetical protein B456_012G095000                    142   1e-36   
ref|XP_010670278.1|  PREDICTED: serine carboxypeptidase-like 25         142   1e-36   
ref|XP_003537768.1|  PREDICTED: serine carboxypeptidase-like 34-like    142   1e-36   
gb|KJB76570.1|  hypothetical protein B456_012G095000                    142   1e-36   
ref|XP_010068958.1|  PREDICTED: serine carboxypeptidase-like 40         142   1e-36   
ref|XP_003542771.1|  PREDICTED: serine carboxypeptidase-like 31-like    142   1e-36   
gb|EPS59460.1|  hypothetical protein M569_15347                         138   1e-36   
ref|XP_006590795.1|  PREDICTED: serine carboxypeptidase-like 34-like    142   1e-36   
gb|KEH30582.1|  serine carboxypeptidase-like protein                    142   1e-36   
ref|XP_003607259.1|  Serine carboxypeptidase-like protein               142   1e-36   
ref|XP_007159281.1|  hypothetical protein PHAVU_002G224800g             140   1e-36   
ref|XP_007131611.1|  hypothetical protein PHAVU_011G027900g             140   2e-36   
ref|XP_010686577.1|  PREDICTED: serine carboxypeptidase-like 31         141   2e-36   
ref|XP_007025718.1|  Serine carboxypeptidase-like 31                    141   2e-36   
ref|XP_010316720.1|  PREDICTED: serine carboxypeptidase-like 31         141   2e-36   
ref|XP_002517751.1|  serine carboxypeptidase, putative                  141   2e-36   
gb|KJB66671.1|  hypothetical protein B456_010G151300                    141   2e-36   
ref|XP_011460258.1|  PREDICTED: serine carboxypeptidase-like 31         141   3e-36   
ref|XP_010067798.1|  PREDICTED: serine carboxypeptidase-like 40         141   3e-36   



>ref|XP_009789305.1| PREDICTED: serine carboxypeptidase II-2 [Nicotiana sylvestris]
Length=470

 Score =   226 bits (577),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQ+ALHVH  NSS +WV CS+EV   WKD P TVLDVY+ LI +GLRI VFSGDTDAVI
Sbjct  330  EVQEALHVHKRNSSFKWVACSEEVSSGWKDSPKTVLDVYRELIQSGLRIWVFSGDTDAVI  389

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVTSTRYSIDALKLPT SPWR WYD+GQVGGWTQEY+GLTFV VRGAGHEVALH PK AL
Sbjct  390  PVTSTRYSIDALKLPTISPWRAWYDDGQVGGWTQEYKGLTFVTVRGAGHEVALHRPKQAL  449

Query  136  TXVESFLAGTSMPGXQRIXDS  74
            T V+SFLAG SMP  Q+I DS
Sbjct  450  TLVKSFLAGASMPSLQQISDS  470



>ref|XP_009630744.1| PREDICTED: serine carboxypeptidase II-2 [Nicotiana tomentosiformis]
Length=470

 Score =   225 bits (573),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQ+ALHVH  NSS +WV CSDEV   WKD P TVLDVY+ LI +GLRI VFSGDTDAVI
Sbjct  330  EVQEALHVHKRNSSFKWVACSDEVSSGWKDSPKTVLDVYRELIRSGLRIWVFSGDTDAVI  389

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVTSTRYSIDALKLPT +PWR WYD+GQVGGWTQEY+GLTFV VRGAGHEVALH PK AL
Sbjct  390  PVTSTRYSIDALKLPTVAPWRAWYDDGQVGGWTQEYKGLTFVTVRGAGHEVALHRPKQAL  449

Query  136  TXVESFLAGTSMPGXQRIXDS  74
            T V+SFLAG+SMP  + I DS
Sbjct  450  TLVKSFLAGSSMPSLELISDS  470



>ref|XP_006343604.1| PREDICTED: serine carboxypeptidase II-2-like [Solanum tuberosum]
Length=465

 Score =   224 bits (572),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQ ALHVH  NSS +WVTCS+EV   WKD P +VLDVY+ LI +GLRI VFSGDTDAVI
Sbjct  325  EVQNALHVHKRNSSFKWVTCSEEVSSGWKDSPMSVLDVYRELIKSGLRIWVFSGDTDAVI  384

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVTSTRYSIDALKLPT +PWR WYD+GQVGGWTQEY+GLTFV VRGAGHEVALH PK AL
Sbjct  385  PVTSTRYSIDALKLPTVAPWRAWYDDGQVGGWTQEYKGLTFVTVRGAGHEVALHRPKQAL  444

Query  136  TXVESFLAGTSMPGXQRIXDS  74
            T V+SFLAGTSMP  + I DS
Sbjct  445  TLVKSFLAGTSMPSLELISDS  465



>ref|XP_004242620.1| PREDICTED: serine carboxypeptidase II-2 [Solanum lycopersicum]
Length=465

 Score =   224 bits (571),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQ ALHVH  NSS +WVTCS+EV   WKD P TVLDVY+ LI +GLRI VFSGDTDAVI
Sbjct  325  EVQSALHVHMRNSSFKWVTCSEEVSSGWKDSPNTVLDVYRELIKSGLRIWVFSGDTDAVI  384

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVTSTRYSI+ALKLPT +PWR WYD+GQVGGWTQEY+GLTFV VRGAGHEVALH PK AL
Sbjct  385  PVTSTRYSINALKLPTVAPWRAWYDDGQVGGWTQEYKGLTFVTVRGAGHEVALHRPKQAL  444

Query  136  TXVESFLAGTSMPGXQRIXDS  74
            T V+SFLAGTSMP  + I DS
Sbjct  445  TLVKSFLAGTSMPSLELISDS  465



>gb|EYU34325.1| hypothetical protein MIMGU_mgv1a005646mg [Erythranthe guttata]
Length=476

 Score =   215 bits (547),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 101/141 (72%), Positives = 118/141 (84%), Gaps = 0/141 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALHVHT NSS +W TCS+ V + W+D P +VL+VY+ LI +GLR+ +FSGDTDAVI
Sbjct  336  EVQKALHVHTRNSSLKWETCSNTVNENWQDSPKSVLNVYRELIHSGLRVWIFSGDTDAVI  395

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVTSTRY+IDALKLPT SPWR WYD+GQVGGWTQEY+GLTFV VRGAGHEV LH PK AL
Sbjct  396  PVTSTRYNIDALKLPTVSPWRAWYDDGQVGGWTQEYKGLTFVTVRGAGHEVPLHRPKQAL  455

Query  136  TXVESFLAGTSMPGXQRIXDS  74
            T V+SFL+G SMP  + + DS
Sbjct  456  TLVKSFLSGISMPKLELVSDS  476



>ref|XP_002275081.1| PREDICTED: serine carboxypeptidase II-2 [Vitis vinifera]
 emb|CBI36573.3| unnamed protein product [Vitis vinifera]
Length=469

 Score =   214 bits (544),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 115/141 (82%), Gaps = 0/141 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQ+ALHV+T N+  +W TCSDEV   WKD P TVLDVY+ LI AGLRI +FSGDTDA+I
Sbjct  329  EVQQALHVYTDNAPSKWATCSDEVSATWKDSPKTVLDVYRELIHAGLRIWIFSGDTDAII  388

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVTSTRYS+DALKLPT  PWR WYD+GQVGGW+QEY GLTFV VRGAGHEV LH PK AL
Sbjct  389  PVTSTRYSVDALKLPTVGPWRAWYDDGQVGGWSQEYAGLTFVTVRGAGHEVPLHKPKQAL  448

Query  136  TXVESFLAGTSMPGXQRIXDS  74
            T + +FL GTSMP  +++ DS
Sbjct  449  TLINAFLKGTSMPSLEQLADS  469



>emb|CAN75200.1| hypothetical protein VITISV_014887 [Vitis vinifera]
Length=524

 Score =   214 bits (546),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 115/141 (82%), Gaps = 0/141 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQ+ALHV+T N+  +W TCSDEV   WKD P TVLDVY+ LI AGLRI +FSGDTDA+I
Sbjct  384  EVQQALHVYTDNAPSKWATCSDEVSATWKDSPKTVLDVYRELIHAGLRIWIFSGDTDAII  443

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVTSTRYS+DALKLPT  PWR WYD+GQVGGW+QEY GLTFV VRGAGHEV LH PK AL
Sbjct  444  PVTSTRYSVDALKLPTVGPWRAWYDDGQVGGWSQEYAGLTFVTVRGAGHEVPLHKPKQAL  503

Query  136  TXVESFLAGTSMPGXQRIXDS  74
            T + +FL GTSMP  +++ DS
Sbjct  504  TLINAFLKGTSMPSLEQLADS  524



>ref|XP_007202013.1| hypothetical protein PRUPE_ppa005192mg [Prunus persica]
 gb|EMJ03212.1| hypothetical protein PRUPE_ppa005192mg [Prunus persica]
Length=473

 Score =   213 bits (542),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 117/141 (83%), Gaps = 0/141 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALHV+  ++  +W TCSD VY  W+D P TVLDVY+ LI +GLRI +FSGDTD+VI
Sbjct  333  EVQKALHVNPNHAPSKWATCSDVVYTTWQDSPRTVLDVYKELIHSGLRIWMFSGDTDSVI  392

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVTSTRYSIDALKLPT  PWRPWYD+GQVGGWTQEY GLTFV+VRGAGHEV LH PK AL
Sbjct  393  PVTSTRYSIDALKLPTVKPWRPWYDDGQVGGWTQEYAGLTFVSVRGAGHEVPLHKPKQAL  452

Query  136  TXVESFLAGTSMPGXQRIXDS  74
            T +++FL+G+SMP  + + DS
Sbjct  453  TLIKAFLSGSSMPSSELVSDS  473



>ref|XP_008243035.1| PREDICTED: serine carboxypeptidase II-2 [Prunus mume]
Length=473

 Score =   211 bits (537),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 117/141 (83%), Gaps = 0/141 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALHV+  ++  +W TCSD VY  W+D P TVLDVY+ LI +GLRI +FSGDTD+VI
Sbjct  333  EVQKALHVNPNHAPSKWATCSDVVYTTWQDSPRTVLDVYKELIHSGLRIWMFSGDTDSVI  392

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVTSTRYSIDALKLPT  PWRPWY++GQVGGWTQEY GLTFV+VRGAGHEV LH PK AL
Sbjct  393  PVTSTRYSIDALKLPTVKPWRPWYEDGQVGGWTQEYAGLTFVSVRGAGHEVPLHKPKQAL  452

Query  136  TXVESFLAGTSMPGXQRIXDS  74
            T +++FL+G+SMP  + + DS
Sbjct  453  TLIKAFLSGSSMPSSELVSDS  473



>ref|XP_004287151.1| PREDICTED: serine carboxypeptidase II-2 [Fragaria vesca subsp. 
vesca]
Length=470

 Score =   209 bits (533),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 114/141 (81%), Gaps = 0/141 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALHV   ++  +W TCSD VY  WKD P TVLDVY+ LI +GLRI +FSGDTDAVI
Sbjct  330  EVQKALHVDRHHAPSKWETCSDVVYTTWKDSPRTVLDVYRELIHSGLRIWMFSGDTDAVI  389

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVTSTRYSID+LKLPT  PWR WYD GQVGGWTQEY GLTFV+VRGAGHEV LH PKLAL
Sbjct  390  PVTSTRYSIDSLKLPTVKPWRAWYDEGQVGGWTQEYAGLTFVSVRGAGHEVPLHKPKLAL  449

Query  136  TXVESFLAGTSMPGXQRIXDS  74
              +++FL+G+SMP  Q + DS
Sbjct  450  ALIKNFLSGSSMPSLQLVSDS  470



>ref|XP_007013884.1| Serine carboxypeptidase-like 29 [Theobroma cacao]
 gb|EOY31503.1| Serine carboxypeptidase-like 29 [Theobroma cacao]
Length=476

 Score =   207 bits (526),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 113/141 (80%), Gaps = 0/141 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALHV    +  +W TCSD V   WKD P T+LDVY+ LI  GLRI +FSGD DAVI
Sbjct  336  EVQKALHVLPEVAPSKWETCSDIVSTNWKDSPRTMLDVYRELIHVGLRIWIFSGDADAVI  395

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVTSTRYSIDALKLPT  PWR WYD+GQVGGWTQEY GL FV+VRGAGHEV LH PKLAL
Sbjct  396  PVTSTRYSIDALKLPTVKPWRAWYDDGQVGGWTQEYAGLNFVSVRGAGHEVPLHRPKLAL  455

Query  136  TXVESFLAGTSMPGXQRIXDS  74
            T V++FL+GTSMPG +++ DS
Sbjct  456  TLVKAFLSGTSMPGLEQVSDS  476



>emb|CDP02851.1| unnamed protein product [Coffea canephora]
Length=472

 Score =   206 bits (523),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 93/141 (66%), Positives = 115/141 (82%), Gaps = 0/141 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            +VQ ALHV+  ++S +W TCSD+VY+ WKD P +VL++Y  L+ AG+RI VFSGDTDAV+
Sbjct  332  KVQHALHVYNRSNSFKWATCSDDVYNNWKDSPRSVLNIYHELLNAGIRIWVFSGDTDAVL  391

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVTSTRYS+DALKL T  PWRPWYD+GQVGGWTQ+YEGL FV VRGAGHEV LH PK AL
Sbjct  392  PVTSTRYSLDALKLRTVGPWRPWYDDGQVGGWTQQYEGLNFVTVRGAGHEVPLHRPKQAL  451

Query  136  TXVESFLAGTSMPGXQRIXDS  74
            T  +SF++G S+P  ++I DS
Sbjct  452  TLFKSFISGNSLPQLEQISDS  472



>ref|XP_011079368.1| PREDICTED: serine carboxypeptidase II-2 [Sesamum indicum]
Length=474

 Score =   204 bits (520),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 115/141 (82%), Gaps = 1/141 (1%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQ A+HVH+ NS  +W TCSD V + WKD P +VL+VY+ L+ +G+RI +FSGDTDAVI
Sbjct  333  EVQNAIHVHSKNSPLKWETCSDAVNENWKDSPRSVLNVYRELLHSGIRIWIFSGDTDAVI  392

Query  316  PVTSTRYSIDALKLPTXSPWRPWY-DNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLA  140
            PVTSTRYSIDALKLPT SPWR WY D+GQVGGWTQEYEGLTFV VRGAGHEV LH PK A
Sbjct  393  PVTSTRYSIDALKLPTVSPWRAWYDDDGQVGGWTQEYEGLTFVTVRGAGHEVPLHKPKQA  452

Query  139  LTXVESFLAGTSMPGXQRIXD  77
            LT ++S+L+G SMP  + + D
Sbjct  453  LTLIKSYLSGNSMPKLELVSD  473



>ref|XP_010111113.1| Serine carboxypeptidase-like 29 [Morus notabilis]
 gb|EXC30159.1| Serine carboxypeptidase-like 29 [Morus notabilis]
Length=495

 Score =   204 bits (520),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 111/141 (79%), Gaps = 0/141 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQ+ALHV   ++  +W TCSD VY  WKD P TVLD+Y  LI + LRI VFSGDTDAVI
Sbjct  355  EVQRALHVDPDHAPSKWDTCSDLVYSTWKDSPTTVLDIYHELIHSSLRIWVFSGDTDAVI  414

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            P+TSTRYSIDALKLPT  PWR WYD+G+VGGWTQEYEGLTFV+VRGAGHEV LH PK AL
Sbjct  415  PITSTRYSIDALKLPTVCPWRAWYDDGEVGGWTQEYEGLTFVSVRGAGHEVPLHKPKQAL  474

Query  136  TXVESFLAGTSMPGXQRIXDS  74
            T ++SFL+G  MP    + DS
Sbjct  475  TLIKSFLSGLPMPNLNLVSDS  495



>ref|XP_009358402.1| PREDICTED: serine carboxypeptidase II-2 [Pyrus x bretschneideri]
Length=482

 Score =   204 bits (518),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 112/138 (81%), Gaps = 0/138 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALHV   ++  +W TCSD V   WKD P TVLDVY+ LI +GLRI +FSGD DAVI
Sbjct  333  EVQKALHVDPDHAPSKWATCSDVVSMTWKDSPRTVLDVYKELIHSGLRIWMFSGDNDAVI  392

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            P+TSTRYSIDALKLPT  PWR WYD+GQVGGWTQEY GLTFV+VRGAGHEV LH PK AL
Sbjct  393  PITSTRYSIDALKLPTVKPWRAWYDDGQVGGWTQEYAGLTFVSVRGAGHEVPLHKPKQAL  452

Query  136  TXVESFLAGTSMPGXQRI  83
            T ++SFL+G+SMP  +++
Sbjct  453  TLIKSFLSGSSMPASEQL  470



>ref|XP_010273729.1| PREDICTED: serine carboxypeptidase II-2 [Nelumbo nucifera]
Length=485

 Score =   202 bits (515),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 109/141 (77%), Gaps = 0/141 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALHVH   +  +W TCSD V + WKD P TVLD+Y  LI AGLRI +FSGDTDAVI
Sbjct  345  EVQKALHVHPEVAPTKWETCSDVVNENWKDSPKTVLDIYHELIGAGLRIWIFSGDTDAVI  404

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVTSTRYSIDALKLPT  PWR WYD GQVGGWTQ+Y GL FV+VRGAGHEV LH PKLAL
Sbjct  405  PVTSTRYSIDALKLPTIGPWRAWYDEGQVGGWTQQYVGLNFVSVRGAGHEVPLHKPKLAL  464

Query  136  TXVESFLAGTSMPGXQRIXDS  74
            + +++FL+G  MP      DS
Sbjct  465  SLIKAFLSGRQMPTLTEYSDS  485



>ref|XP_008394291.1| PREDICTED: serine carboxypeptidase II-2 [Malus domestica]
Length=482

 Score =   201 bits (512),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 111/138 (80%), Gaps = 0/138 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALH    ++  +W TCSD V   WKD P TVLDVY+ LI +GLRI +FSGD DAVI
Sbjct  333  EVQKALHXDPGHAPSKWATCSDVVSMTWKDSPRTVLDVYKELIHSGLRIWMFSGDNDAVI  392

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            P+TSTRYSIDALKLPT  PWR WYD+GQVGGWTQEY GLTFV+VRGAGHEV LH PK AL
Sbjct  393  PITSTRYSIDALKLPTVKPWRAWYDDGQVGGWTQEYAGLTFVSVRGAGHEVPLHKPKQAL  452

Query  136  TXVESFLAGTSMPGXQRI  83
            T ++SFL+G+SMP  +++
Sbjct  453  TLIKSFLSGSSMPASEQL  470



>emb|CBI36578.3| unnamed protein product [Vitis vinifera]
Length=470

 Score =   200 bits (509),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/141 (67%), Positives = 112/141 (79%), Gaps = 0/141 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQ+ALHV+  N++ +W TCSDEV   WKD P +VL++Y+ LI A LRI +FSGDTDAVI
Sbjct  330  EVQQALHVYVDNATFKWATCSDEVSTTWKDSPRSVLNIYRELIHARLRIWIFSGDTDAVI  389

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVTSTRYSIDALKLPT SPWR WYD+GQVGGWTQ+Y GLTFV VRGAGHEV LH PK A 
Sbjct  390  PVTSTRYSIDALKLPTVSPWRAWYDDGQVGGWTQDYAGLTFVTVRGAGHEVPLHKPKQAF  449

Query  136  TXVESFLAGTSMPGXQRIXDS  74
            T  ++FL+G  MP  +++  S
Sbjct  450  TLFKAFLSGAPMPYMEQVSYS  470



>ref|XP_002273324.2| PREDICTED: serine carboxypeptidase II-2 [Vitis vinifera]
Length=510

 Score =   201 bits (511),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/141 (67%), Positives = 112/141 (79%), Gaps = 0/141 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQ+ALHV+  N++ +W TCSDEV   WKD P +VL++Y+ LI A LRI +FSGDTDAVI
Sbjct  370  EVQQALHVYVDNATFKWATCSDEVSTTWKDSPRSVLNIYRELIHARLRIWIFSGDTDAVI  429

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVTSTRYSIDALKLPT SPWR WYD+GQVGGWTQ+Y GLTFV VRGAGHEV LH PK A 
Sbjct  430  PVTSTRYSIDALKLPTVSPWRAWYDDGQVGGWTQDYAGLTFVTVRGAGHEVPLHKPKQAF  489

Query  136  TXVESFLAGTSMPGXQRIXDS  74
            T  ++FL+G  MP  +++  S
Sbjct  490  TLFKAFLSGAPMPYMEQVSYS  510



>ref|XP_010048771.1| PREDICTED: serine carboxypeptidase II-2 [Eucalyptus grandis]
 gb|KCW81143.1| hypothetical protein EUGRSUZ_C02514 [Eucalyptus grandis]
Length=473

 Score =   199 bits (507),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 112/141 (79%), Gaps = 0/141 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQ ALHV+   +  +W TCSD V + WKD P TVLD+Y+ L+  GLRI +FSGDTDAVI
Sbjct  333  EVQTALHVNKAFAPAKWDTCSDLVSENWKDAPRTVLDIYRELMREGLRIWMFSGDTDAVI  392

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVTSTRY+ID+LKLPT  P+R WYD+G VGGWTQEY GLTFV+VRGAGHEV LH PKLAL
Sbjct  393  PVTSTRYTIDSLKLPTVKPFRAWYDDGTVGGWTQEYAGLTFVSVRGAGHEVPLHRPKLAL  452

Query  136  TXVESFLAGTSMPGXQRIXDS  74
              +++FLAGTSMP  Q + DS
Sbjct  453  ALIKAFLAGTSMPSLQLVSDS  473



>ref|XP_010040844.1| PREDICTED: serine carboxypeptidase II-2-like [Eucalyptus grandis]
 gb|KCW44872.1| hypothetical protein EUGRSUZ_L01547 [Eucalyptus grandis]
Length=473

 Score =   199 bits (506),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 112/141 (79%), Gaps = 0/141 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQ ALHV+   +  +W TCSD V + WKD P TVLD+Y+ L+  GLRI +FSGDTDAVI
Sbjct  333  EVQTALHVNKAFAPAKWDTCSDLVNENWKDAPRTVLDIYRELMREGLRIWMFSGDTDAVI  392

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVTSTRY+ID+LKLPT  P+R WYD+G VGGWTQEY GLTFV+VRGAGHEV LH PKLAL
Sbjct  393  PVTSTRYTIDSLKLPTVKPFRAWYDDGTVGGWTQEYAGLTFVSVRGAGHEVPLHRPKLAL  452

Query  136  TXVESFLAGTSMPGXQRIXDS  74
              +++FLAGTSMP  Q + DS
Sbjct  453  ALIKAFLAGTSMPSLQLVSDS  473



>ref|XP_011018073.1| PREDICTED: serine carboxypeptidase II-2-like [Populus euphratica]
Length=371

 Score =   197 bits (500),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 108/141 (77%), Gaps = 0/141 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALHV    +   W TCS+ V   WKD P TVLD+Y+ LI +GL + VFSGDTDAVI
Sbjct  231  EVQKALHVSPEFAPARWETCSEVVNINWKDSPRTVLDIYKELIRSGLHLWVFSGDTDAVI  290

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVTSTRYSIDALKLPT  PW  WYD+GQVGGWTQEY GLTFV VRGAGHEV LH PK AL
Sbjct  291  PVTSTRYSIDALKLPTVKPWGAWYDDGQVGGWTQEYAGLTFVVVRGAGHEVPLHKPKQAL  350

Query  136  TXVESFLAGTSMPGXQRIXDS  74
            T V++FL+GT MP  Q + DS
Sbjct  351  TLVKAFLSGTPMPTLQLVSDS  371



>gb|AFK34001.1| unknown [Medicago truncatula]
Length=239

 Score =   192 bits (489),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 107/133 (80%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQ+ALHV   +   +W TCSD V   WKD P +VL++Y+ LI  GLRI +FSG+TDAVI
Sbjct  96   EVQRALHVDPDHKPDKWQTCSDVVGTNWKDSPTSVLNIYRELIPTGLRIWIFSGNTDAVI  155

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PV STRYSI+ALKLPT SPWR WYD+G+VGGWTQEY GLTFV VRGAGHEV LH PKLAL
Sbjct  156  PVASTRYSINALKLPTLSPWRAWYDDGEVGGWTQEYAGLTFVNVRGAGHEVPLHRPKLAL  215

Query  136  TXVESFLAGTSMP  98
            T +++FL GTSMP
Sbjct  216  TLIKAFLEGTSMP  228



>ref|XP_007138291.1| hypothetical protein PHAVU_009G196000g [Phaseolus vulgaris]
 gb|ESW10285.1| hypothetical protein PHAVU_009G196000g [Phaseolus vulgaris]
Length=472

 Score =   197 bits (501),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 107/141 (76%), Gaps = 0/141 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQ ALHV   +    W TCSD VY  WKD P +VLD+Y  LI  GL+I VFSG+TD VI
Sbjct  332  EVQTALHVDLDHKPATWETCSDVVYTNWKDSPRSVLDIYHELIGMGLKIWVFSGNTDVVI  391

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVTSTRYSI ALKLPT SPWR WYD+G+VGGWTQEY GLTFV VRGAGHEV LH PKLAL
Sbjct  392  PVTSTRYSISALKLPTLSPWRAWYDDGEVGGWTQEYAGLTFVIVRGAGHEVPLHKPKLAL  451

Query  136  TXVESFLAGTSMPGXQRIXDS  74
            T V++FLAGTSMP    +  S
Sbjct  452  TLVQTFLAGTSMPNLDLLSTS  472



>ref|XP_011018071.1| PREDICTED: serine carboxypeptidase II-2-like isoform X1 [Populus 
euphratica]
Length=478

 Score =   197 bits (500),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 108/141 (77%), Gaps = 0/141 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALHV    +   W TCS+ V   WKD P TVLD+Y+ LI +GL + VFSGDTDAVI
Sbjct  338  EVQKALHVSPEFAPARWETCSEVVNINWKDSPRTVLDIYKELIRSGLHLWVFSGDTDAVI  397

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVTSTRYSIDALKLPT  PW  WYD+GQVGGWTQEY GLTFV VRGAGHEV LH PK AL
Sbjct  398  PVTSTRYSIDALKLPTVKPWGAWYDDGQVGGWTQEYAGLTFVVVRGAGHEVPLHKPKQAL  457

Query  136  TXVESFLAGTSMPGXQRIXDS  74
            T V++FL+GT MP  Q + DS
Sbjct  458  TLVKAFLSGTPMPTLQLVSDS  478



>ref|XP_002324616.2| hypothetical protein POPTR_0018s11210g [Populus trichocarpa]
 gb|EEF03181.2| hypothetical protein POPTR_0018s11210g [Populus trichocarpa]
Length=466

 Score =   196 bits (499),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 108/141 (77%), Gaps = 0/141 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALHV    +   W TCS+ V   WKD P TVLD+Y+ LI +GL + VFSGDTDAVI
Sbjct  326  EVQKALHVSPEFAPARWETCSEVVNINWKDSPRTVLDIYKELIHSGLHVWVFSGDTDAVI  385

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVTSTRYSIDALKLPT  PW  WYD+GQVGGWTQEY GLTFV VRGAGHEV LH PK AL
Sbjct  386  PVTSTRYSIDALKLPTVKPWGAWYDDGQVGGWTQEYAGLTFVVVRGAGHEVPLHKPKQAL  445

Query  136  TXVESFLAGTSMPGXQRIXDS  74
            T V++FL+GT MP  Q + DS
Sbjct  446  TLVKAFLSGTPMPTLQLVSDS  466



>gb|ABK24285.1| unknown [Picea sitchensis]
Length=450

 Score =   196 bits (497),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 94/141 (67%), Positives = 105/141 (74%), Gaps = 0/141 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALH + T     W TCSD V D W D P ++L +YQ LI AGLRI +FSGDTDAVI
Sbjct  309  EVQKALHANVTGIPYRWTTCSDAVADHWGDSPRSMLPIYQELIKAGLRIWMFSGDTDAVI  368

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVTSTRYSI+ALKLPT + W PWYDNGQVGGWTQ YEGLTFV VRGAGHEV LH P+ A 
Sbjct  369  PVTSTRYSINALKLPTVTQWHPWYDNGQVGGWTQVYEGLTFVTVRGAGHEVPLHEPRKAF  428

Query  136  TXVESFLAGTSMPGXQRIXDS  74
            T  ESFL G  MP   ++ D+
Sbjct  429  TVFESFLEGKPMPVSPKLVDT  449



>ref|XP_006453577.1| hypothetical protein CICLE_v10008112mg [Citrus clementina]
 gb|ESR66817.1| hypothetical protein CICLE_v10008112mg [Citrus clementina]
Length=474

 Score =   196 bits (498),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 109/141 (77%), Gaps = 0/141 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALHV    +  +W TCS  V + W D P TVLD+Y+ LI +GLRI +FSGDTDAVI
Sbjct  332  EVQKALHVIPAVAPAKWETCSGVVNNNWLDSPRTVLDIYRELIHSGLRIWMFSGDTDAVI  391

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVTSTRYSIDAL LPT  PWR WYD+GQVGGWTQEY GLTFV VRGAGHEV LH PK AL
Sbjct  392  PVTSTRYSIDALNLPTVKPWRAWYDDGQVGGWTQEYAGLTFVTVRGAGHEVPLHRPKPAL  451

Query  136  TXVESFLAGTSMPGXQRIXDS  74
            T ++SFL+G SMP  +R+  S
Sbjct  452  TLIKSFLSGRSMPCLERVSHS  472



>ref|XP_003595891.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AES66142.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=473

 Score =   196 bits (498),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 109/133 (82%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQ+ALHV+  +   +W TCSD V   WKD P +VL++Y+ LI  GLRI +FSG+TDA+I
Sbjct  330  EVQRALHVNPDHKPDKWQTCSDVVGTNWKDSPRSVLNIYRELIPTGLRIWIFSGNTDAII  389

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVTSTRYSI+ALKLPT SPWR WYD+G+VGGWTQEY GLTFV VRGAGHEV LH PKLAL
Sbjct  390  PVTSTRYSINALKLPTVSPWRAWYDDGEVGGWTQEYAGLTFVNVRGAGHEVPLHRPKLAL  449

Query  136  TXVESFLAGTSMP  98
            T +++FL GTSMP
Sbjct  450  TLIKAFLEGTSMP  462



>ref|XP_006474032.1| PREDICTED: serine carboxypeptidase-like 29-like [Citrus sinensis]
Length=474

 Score =   196 bits (497),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 108/141 (77%), Gaps = 0/141 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALHV    +  +W TCS  V + W D P TVLD+Y+ LI +GLRI +FSGDTDAVI
Sbjct  332  EVQKALHVIPAVAPAKWETCSGVVNNNWLDSPRTVLDIYRELIHSGLRIWMFSGDTDAVI  391

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVTSTRYSIDAL LPT  PWR WYD GQVGGWTQEY GLTFV VRGAGHEV LH PK AL
Sbjct  392  PVTSTRYSIDALNLPTVKPWRAWYDEGQVGGWTQEYSGLTFVTVRGAGHEVPLHRPKPAL  451

Query  136  TXVESFLAGTSMPGXQRIXDS  74
            T ++SFL+G SMP  +R+  S
Sbjct  452  TLIKSFLSGRSMPCLKRVSHS  472



>ref|XP_002528403.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF33996.1| serine carboxypeptidase, putative [Ricinus communis]
Length=480

 Score =   195 bits (496),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 108/141 (77%), Gaps = 0/141 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALHV    +  +W TCSD V + WKD P TVLD+Y  LI +G+RI VFSGDTDAVI
Sbjct  340  EVQKALHVSKEFAPSKWETCSDLVNNNWKDSPRTVLDIYHELIHSGIRIWVFSGDTDAVI  399

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVTSTRYSIDALKL T  PW  WYD+ QVGGWTQEY GL FV VRGAGHEV LH PKLAL
Sbjct  400  PVTSTRYSIDALKLRTTKPWHAWYDDRQVGGWTQEYAGLAFVVVRGAGHEVPLHRPKLAL  459

Query  136  TXVESFLAGTSMPGXQRIXDS  74
            T +++FL+GTSMP  + +  S
Sbjct  460  TLIKAFLSGTSMPTLEPVSSS  480



>gb|KHG11306.1| Serine carboxypeptidase-like 29 [Gossypium arboreum]
Length=487

 Score =   195 bits (496),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/134 (70%), Positives = 106/134 (79%), Gaps = 0/134 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQK+LHV    +  +W TCSD V   WKD P T+LDVY+ LI  GLRI +FSGDTDAVI
Sbjct  336  EVQKSLHVLPEAAPSKWETCSDIVNTNWKDSPITMLDVYRELIHEGLRIWIFSGDTDAVI  395

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            P+TSTRYSIDALKL T  PWR WYD+GQVGGWTQEYEGL FV+VRGAGHEV LH PK AL
Sbjct  396  PITSTRYSIDALKLATMKPWRAWYDDGQVGGWTQEYEGLKFVSVRGAGHEVPLHRPKQAL  455

Query  136  TXVESFLAGTSMPG  95
            T  ++FL+GTSMP 
Sbjct  456  TLFKAFLSGTSMPA  469



>gb|KEH38195.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=441

 Score =   194 bits (492),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 106/133 (80%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQ+ LHV       +W TCS  V   WKD P TVLD+Y+ LI  GLRI +FSG+TDAVI
Sbjct  300  EVQRILHVDPDYKPAKWETCSTVVNTNWKDSPRTVLDIYRELIPTGLRIWIFSGNTDAVI  359

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVTSTRY+I+ALKLPT SPWR WYD+G+VGGWTQEY GLTFV VRGAGHEV LH PKLAL
Sbjct  360  PVTSTRYTINALKLPTVSPWRAWYDDGEVGGWTQEYAGLTFVNVRGAGHEVPLHRPKLAL  419

Query  136  TXVESFLAGTSMP  98
            T +++FLAGTSMP
Sbjct  420  TLIKAFLAGTSMP  432



>gb|KHN02055.1| Serine carboxypeptidase II-2 [Glycine soja]
Length=469

 Score =   194 bits (493),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 94/141 (67%), Positives = 106/141 (75%), Gaps = 0/141 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            +VQ  LHV   +    W TCSDEV+  WKD P TVL++Y  LI  GLRI VFSG+TD VI
Sbjct  329  DVQTVLHVDPDHKPATWETCSDEVFTNWKDSPRTVLNIYHELIQMGLRIWVFSGNTDVVI  388

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVTSTRYSI AL LPT SPWR WYD+G+VGGWTQEY GLTFV VRGAGHEV LH PKLAL
Sbjct  389  PVTSTRYSIKALDLPTVSPWRAWYDDGEVGGWTQEYAGLTFVVVRGAGHEVPLHSPKLAL  448

Query  136  TXVESFLAGTSMPGXQRIXDS  74
            T  ++FLAGTSMP  + +  S
Sbjct  449  TLFKAFLAGTSMPNLELVGAS  469



>gb|KDP38717.1| hypothetical protein JCGZ_04070 [Jatropha curcas]
Length=478

 Score =   194 bits (493),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 94/141 (67%), Positives = 107/141 (76%), Gaps = 0/141 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALHV       +W TCSD V + WKD P TVL++Y  LI +GLRI +FSGDTDAVI
Sbjct  338  EVQKALHVSPEFLPSKWETCSDLVNENWKDSPRTVLNIYHELIHSGLRIWMFSGDTDAVI  397

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVTSTRYSIDALKLPT  PW  WYD+GQVGGWTQEY GL FV VRGAGHEV LH PKLAL
Sbjct  398  PVTSTRYSIDALKLPTTKPWHAWYDDGQVGGWTQEYAGLNFVVVRGAGHEVPLHRPKLAL  457

Query  136  TXVESFLAGTSMPGXQRIXDS  74
              +++FL+G SMP  + +  S
Sbjct  458  ALIKTFLSGVSMPTHELVSAS  478



>ref|XP_003522937.2| PREDICTED: serine carboxypeptidase II-2-like [Glycine max]
Length=483

 Score =   194 bits (493),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 94/141 (67%), Positives = 106/141 (75%), Gaps = 0/141 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            +VQ  LHV   +    W TCSDEV+  WKD P TVL++Y  LI  GLRI VFSG+TD VI
Sbjct  343  DVQTVLHVDPDHKPATWETCSDEVFTNWKDSPRTVLNIYHELIQMGLRIWVFSGNTDVVI  402

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVTSTRYSI AL LPT SPWR WYD+G+VGGWTQEY GLTFV VRGAGHEV LH PKLAL
Sbjct  403  PVTSTRYSIKALDLPTVSPWRAWYDDGEVGGWTQEYAGLTFVVVRGAGHEVPLHSPKLAL  462

Query  136  TXVESFLAGTSMPGXQRIXDS  74
            T  ++FLAGTSMP  + +  S
Sbjct  463  TLFKAFLAGTSMPNLELVGAS  483



>ref|XP_003595892.1| Serine carboxypeptidase II-2 [Medicago truncatula]
 gb|AES66143.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=472

 Score =   194 bits (492),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 106/133 (80%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQ+ LHV       +W TCS  V   WKD P TVLD+Y+ LI  GLRI +FSG+TDAVI
Sbjct  331  EVQRILHVDPDYKPAKWETCSTVVNTNWKDSPRTVLDIYRELIPTGLRIWIFSGNTDAVI  390

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVTSTRY+I+ALKLPT SPWR WYD+G+VGGWTQEY GLTFV VRGAGHEV LH PKLAL
Sbjct  391  PVTSTRYTINALKLPTVSPWRAWYDDGEVGGWTQEYAGLTFVNVRGAGHEVPLHRPKLAL  450

Query  136  TXVESFLAGTSMP  98
            T +++FLAGTSMP
Sbjct  451  TLIKAFLAGTSMP  463



>gb|EPS71160.1| hypothetical protein M569_03591, partial [Genlisea aurea]
Length=441

 Score =   193 bits (490),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 107/133 (80%), Gaps = 2/133 (2%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQ ALH+ + NS  +W TCSD V + WKD P +VL+VY+ L  AGLRI  FSGDTD+VI
Sbjct  307  EVQDALHIRSKNS--QWETCSDLVNENWKDSPSSVLNVYRKLFPAGLRIWFFSGDTDSVI  364

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PV STRYSI+AL+LPT SPWR WY++GQVGGWT+EYEGLT V VRGAGHEVALH PKL+L
Sbjct  365  PVASTRYSINALRLPTVSPWRAWYNDGQVGGWTEEYEGLTLVTVRGAGHEVALHKPKLSL  424

Query  136  TXVESFLAGTSMP  98
            T V+SFL G  MP
Sbjct  425  TLVDSFLRGNPMP  437



>ref|XP_003595890.1| Serine carboxypeptidase II-2 [Medicago truncatula]
 gb|ACJ85268.1| unknown [Medicago truncatula]
 gb|AES66141.1| serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AFK36219.1| unknown [Medicago truncatula]
Length=473

 Score =   193 bits (491),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 107/133 (80%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQ+ALHV   +   +W TCSD V   WKD P +VL++Y+ LI  GLRI +FSG+TDAVI
Sbjct  330  EVQRALHVDPDHKPDKWQTCSDVVGTNWKDSPTSVLNIYRELIPTGLRIWIFSGNTDAVI  389

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PV STRYSI+ALKLPT SPWR WYD+G+VGGWTQEY GLTFV VRGAGHEV LH PKLAL
Sbjct  390  PVASTRYSINALKLPTLSPWRAWYDDGEVGGWTQEYAGLTFVNVRGAGHEVPLHRPKLAL  449

Query  136  TXVESFLAGTSMP  98
            T +++FL GTSMP
Sbjct  450  TLIKAFLEGTSMP  462



>ref|XP_010687643.1| PREDICTED: serine carboxypeptidase II-2 [Beta vulgaris subsp. 
vulgaris]
Length=475

 Score =   192 bits (489),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 93/141 (66%), Positives = 110/141 (78%), Gaps = 0/141 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQ+ALHV+   +  +W TCS  V   W+D   +VLD+Y  L+ AGLRI +FSGDTDAVI
Sbjct  335  EVQQALHVNPQFAPVKWETCSGLVNSNWQDSSRSVLDIYHELMDAGLRIWMFSGDTDAVI  394

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVTSTRY+IDALKLPT  PW  WYD+GQVGGWTQEY+GLTFV VRGAGHEV LH  KL+L
Sbjct  395  PVTSTRYNIDALKLPTIKPWHAWYDDGQVGGWTQEYKGLTFVVVRGAGHEVPLHRAKLSL  454

Query  136  TXVESFLAGTSMPGXQRIXDS  74
            T V+SFLAG SMP  +++ DS
Sbjct  455  TLVKSFLAGESMPTLEQVSDS  475



>ref|XP_004488608.1| PREDICTED: serine carboxypeptidase II-2-like [Cicer arietinum]
Length=485

 Score =   192 bits (489),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 106/133 (80%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQ+ LHV   +   +W TCSD V   WKD P TVLD+Y+ LI  GLRI +FSG+TD+VI
Sbjct  343  EVQRILHVDPHHKPEKWETCSDLVNINWKDSPRTVLDIYRELIPTGLRIWMFSGNTDSVI  402

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVTSTRY+IDALKLPT SPWR WYD+G+VGGW QEY GLTFV +RGAGHEV LH PKLAL
Sbjct  403  PVTSTRYTIDALKLPTVSPWRAWYDDGEVGGWIQEYAGLTFVTIRGAGHEVPLHKPKLAL  462

Query  136  TXVESFLAGTSMP  98
            T  ++FLAGTSMP
Sbjct  463  TLFKAFLAGTSMP  475



>ref|XP_003596536.1| Serine carboxypeptidase [Medicago truncatula]
Length=562

 Score =   193 bits (491),  Expect = 3e-55, Method: Composition-based stats.
 Identities = 92/132 (70%), Positives = 104/132 (79%), Gaps = 0/132 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQ+ LHVH  +   +W TCS  V   WKD P TVL++Y+ LI  GLRI +FSG+TDAV+
Sbjct  419  EVQRILHVHPDHRPAKWQTCSVVVAINWKDSPRTVLNIYRELIPTGLRIWMFSGNTDAVL  478

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVTSTRYSIDALKLPT SPWR WYD+G+V GWTQEY GLTFV VRGAGHEV LH PKLAL
Sbjct  479  PVTSTRYSIDALKLPTVSPWRAWYDDGEVAGWTQEYAGLTFVNVRGAGHEVPLHRPKLAL  538

Query  136  TXVESFLAGTSM  101
               +SFLAGTSM
Sbjct  539  ALFKSFLAGTSM  550



>ref|XP_009410194.1| PREDICTED: serine carboxypeptidase II-2-like [Musa acuminata 
subsp. malaccensis]
Length=473

 Score =   191 bits (486),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 109/141 (77%), Gaps = 0/141 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALH++   +  +W TCSD V + WKD   +VL +Y  LI  GLRI +FSGDTDAVI
Sbjct  333  EVQKALHINPAFAPSKWETCSDVVNENWKDSARSVLHIYHELIGYGLRIWMFSGDTDAVI  392

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVTSTRY+ID+LKLPT +PW PWYD+GQVGGWTQ Y+GLTFV VRGAGHEV LH PKLAL
Sbjct  393  PVTSTRYNIDSLKLPTVTPWHPWYDDGQVGGWTQVYKGLTFVTVRGAGHEVPLHQPKLAL  452

Query  136  TXVESFLAGTSMPGXQRIXDS  74
               +SFL+G+SMP    + DS
Sbjct  453  VLFKSFLSGSSMPTFTGLDDS  473



>gb|AIN39846.1| hypothetical protein [Zoysia matrella]
Length=172

 Score =   183 bits (464),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 91/134 (68%), Positives = 103/134 (77%), Gaps = 1/134 (1%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALHV    S  +W TCS+ V   W DC  +VL +Y  LI  GLRI VFSGDTDAVI
Sbjct  30   EVQKALHVSPVISKSKWETCSEVVNTHWGDCERSVLHIYHELIQYGLRIWVFSGDTDAVI  89

Query  316  PVTSTRYSIDALKLPTXSPWRPWYD-NGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLA  140
            PVTSTRYS+DALKLPT +PW  WYD +G+VGGWT+ YEGLTFV VRGAGHEV LH PK A
Sbjct  90   PVTSTRYSVDALKLPTVTPWHAWYDEDGEVGGWTEGYEGLTFVTVRGAGHEVPLHRPKQA  149

Query  139  LTXVESFLAGTSMP  98
            LT ++SFLAG+ MP
Sbjct  150  LTLIKSFLAGSPMP  163



>ref|XP_008790132.1| PREDICTED: serine carboxypeptidase II-2 isoform X1 [Phoenix dactylifera]
Length=473

 Score =   191 bits (484),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 91/141 (65%), Positives = 106/141 (75%), Gaps = 0/141 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALHV+   +  +W TCSD V + WKDCP +VL +Y  LI  GLRI +FSGDTDAVI
Sbjct  333  EVQKALHVNPAVAPSKWETCSDIVNENWKDCPRSVLHIYHELIQYGLRIWMFSGDTDAVI  392

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PV STRYS+D+LKLPT +PW  WYD+GQVGGWTQ Y+GLTFV VRGAGHEV LH PK AL
Sbjct  393  PVASTRYSVDSLKLPTVTPWHAWYDDGQVGGWTQVYKGLTFVTVRGAGHEVPLHRPKQAL  452

Query  136  TXVESFLAGTSMPGXQRIXDS  74
               +SFL+G+ MP      DS
Sbjct  453  VLFKSFLSGSPMPTLSEFDDS  473



>gb|AES66787.2| serine carboxypeptidase-like protein [Medicago truncatula]
Length=474

 Score =   190 bits (483),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 92/132 (70%), Positives = 104/132 (79%), Gaps = 0/132 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQ+ LHVH  +   +W TCS  V   WKD P TVL++Y+ LI  GLRI +FSG+TDAV+
Sbjct  331  EVQRILHVHPDHRPAKWQTCSVVVAINWKDSPRTVLNIYRELIPTGLRIWMFSGNTDAVL  390

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVTSTRYSIDALKLPT SPWR WYD+G+V GWTQEY GLTFV VRGAGHEV LH PKLAL
Sbjct  391  PVTSTRYSIDALKLPTVSPWRAWYDDGEVAGWTQEYAGLTFVNVRGAGHEVPLHRPKLAL  450

Query  136  TXVESFLAGTSM  101
               +SFLAGTSM
Sbjct  451  ALFKSFLAGTSM  462



>ref|XP_010905043.1| PREDICTED: serine carboxypeptidase II-2 [Elaeis guineensis]
Length=471

 Score =   189 bits (479),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 91/141 (65%), Positives = 106/141 (75%), Gaps = 0/141 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALHV+   +  EW TCSD V + WKD P +VL +Y  LI  GLRI +FSGDTDAVI
Sbjct  331  EVQKALHVNPVVAPSEWETCSDVVNENWKDSPRSVLHIYHELIHYGLRIWMFSGDTDAVI  390

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVTSTRY++D+LKLPT +PW  WYD+GQVGGWTQ Y+GLTFV VRGAGHEV LH PK AL
Sbjct  391  PVTSTRYNVDSLKLPTVTPWHAWYDDGQVGGWTQVYKGLTFVTVRGAGHEVPLHRPKQAL  450

Query  136  TXVESFLAGTSMPGXQRIXDS  74
               +SFL+G+ MP      DS
Sbjct  451  VLFKSFLSGSPMPTLSEFVDS  471



>gb|ACF84647.1| unknown [Zea mays]
Length=257

 Score =   183 bits (464),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 90/134 (67%), Positives = 101/134 (75%), Gaps = 1/134 (1%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALHV+T     +W TCS+ V   W DC  +VL +Y  LI  GLRI VFSGDTDAVI
Sbjct  115  EVQKALHVNTVIGKSKWETCSEAVNTHWGDCERSVLHIYHELIQYGLRIWVFSGDTDAVI  174

Query  316  PVTSTRYSIDALKLPTXSPWRPWY-DNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLA  140
            PVTSTRYSIDALKLPT +PW  WY D+G+VGGWTQ Y GL FV VRGAGHEV LH PK A
Sbjct  175  PVTSTRYSIDALKLPTITPWHAWYDDDGEVGGWTQGYRGLNFVTVRGAGHEVPLHRPKQA  234

Query  139  LTXVESFLAGTSMP  98
            LT ++SFL G+ MP
Sbjct  235  LTLIKSFLTGSPMP  248



>ref|XP_004964646.1| PREDICTED: serine carboxypeptidase II-2-like [Setaria italica]
Length=474

 Score =   187 bits (475),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 93/134 (69%), Positives = 103/134 (77%), Gaps = 1/134 (1%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALHV+      +W TCS  V + W DC  +VL +Y  LI  GLRI VFSGDTDAVI
Sbjct  332  EVQKALHVNPVIGKSKWETCSGVVNNHWGDCERSVLHIYHELIQYGLRIWVFSGDTDAVI  391

Query  316  PVTSTRYSIDALKLPTXSPWRPWY-DNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLA  140
            PVTSTRYSIDALKLPT +PW  WY DNG+VGGW+Q YEGLTFV VRGAGHEV LH PK A
Sbjct  392  PVTSTRYSIDALKLPTVTPWHAWYDDNGEVGGWSQGYEGLTFVTVRGAGHEVPLHRPKQA  451

Query  139  LTXVESFLAGTSMP  98
            LT ++SFLAGT MP
Sbjct  452  LTLIKSFLAGTPMP  465



>gb|KJB76659.1| hypothetical protein B456_012G098600 [Gossypium raimondii]
Length=487

 Score =   187 bits (475),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 102/132 (77%), Gaps = 0/132 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQK+LHV    +  +W TCSD V   WKD P T+LDVY+ L   GLRI +FSGDTDAVI
Sbjct  336  EVQKSLHVLPEAAPSKWETCSDIVNTNWKDSPITMLDVYRELTREGLRICIFSGDTDAVI  395

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            P+TSTRYSIDALKL T  PW  WYD+GQVGGWTQEYEGL FV+VRGAGHEV LH PK AL
Sbjct  396  PITSTRYSIDALKLATVKPWHAWYDDGQVGGWTQEYEGLKFVSVRGAGHEVPLHRPKQAL  455

Query  136  TXVESFLAGTSM  101
               ++FL+GTSM
Sbjct  456  ALFKAFLSGTSM  467



>ref|XP_004162685.1| PREDICTED: serine carboxypeptidase-like 29-like [Cucumis sativus]
Length=468

 Score =   185 bits (469),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 105/141 (74%), Gaps = 0/141 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQ+ALHV    +  +W TCS  +   WKD   +VLD+Y+ LI AGLRI VFSGDTDAV+
Sbjct  328  EVQQALHVDPKFAPSKWETCSYLINGNWKDSAGSVLDIYRELIQAGLRIWVFSGDTDAVL  387

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            P+TSTRYS+DALKLP    WRPWYD GQVGGW QEYEG+T V+VRGAGHEV LH PKLAL
Sbjct  388  PITSTRYSVDALKLPVIGSWRPWYDGGQVGGWIQEYEGVTLVSVRGAGHEVPLHQPKLAL  447

Query  136  TXVESFLAGTSMPGXQRIXDS  74
              ++SFLAG S+   Q   D+
Sbjct  448  QLIKSFLAGNSLSPLQLHSDT  468



>ref|XP_004144720.1| PREDICTED: serine carboxypeptidase-like 29-like [Cucumis sativus]
Length=468

 Score =   184 bits (468),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 105/141 (74%), Gaps = 0/141 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQ+ALHV    +  +W TCS  +   WKD   +VLD+Y+ LI AGLRI VFSGDTDAV+
Sbjct  328  EVQQALHVDPKFAPSKWETCSYLINGNWKDSAGSVLDIYRELIQAGLRIWVFSGDTDAVL  387

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            P+TSTRYS+DALKLP    WRPWYD GQVGGW QEYEG+T V+VRGAGHEV LH PKLAL
Sbjct  388  PITSTRYSVDALKLPVIGSWRPWYDGGQVGGWIQEYEGVTLVSVRGAGHEVPLHQPKLAL  447

Query  136  TXVESFLAGTSMPGXQRIXDS  74
              ++SFLAG S+   Q   D+
Sbjct  448  QLIKSFLAGNSLSPLQLHSDT  468



>ref|XP_006453578.1| hypothetical protein CICLE_v10008112mg [Citrus clementina]
 gb|ESR66818.1| hypothetical protein CICLE_v10008112mg [Citrus clementina]
Length=491

 Score =   185 bits (469),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 96/158 (61%), Positives = 109/158 (69%), Gaps = 17/158 (11%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTC-----------------SDEVYDFWKDCPXTVLDVYQXLI  368
            EVQKALHV    +  +W TC                 S  V + W D P TVLD+Y+ LI
Sbjct  332  EVQKALHVIPAVAPAKWETCRWHQQYTLVISLFLLLCSGVVNNNWLDSPRTVLDIYRELI  391

Query  367  TAGLRIXVFSGDTDAVIPVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVA  188
             +GLRI +FSGDTDAVIPVTSTRYSIDAL LPT  PWR WYD+GQVGGWTQEY GLTFV 
Sbjct  392  HSGLRIWMFSGDTDAVIPVTSTRYSIDALNLPTVKPWRAWYDDGQVGGWTQEYAGLTFVT  451

Query  187  VRGAGHEVALHXPKLALTXVESFLAGTSMPGXQRIXDS  74
            VRGAGHEV LH PK ALT ++SFL+G SMP  +R+  S
Sbjct  452  VRGAGHEVPLHRPKPALTLIKSFLSGRSMPCLERVSHS  489



>gb|EMT26558.1| putative Serine carboxypeptidase II-2 [Aegilops tauschii]
Length=389

 Score =   182 bits (463),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/134 (66%), Positives = 103/134 (77%), Gaps = 1/134 (1%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALHV+      +W TCS+ +   WKDC  +VL +Y  LI  GLRI +FSGDTDAVI
Sbjct  247  EVQKALHVNPVIGKSKWETCSEVINTNWKDCDRSVLHIYHELIQYGLRIWMFSGDTDAVI  306

Query  316  PVTSTRYSIDALKLPTXSPWRPWY-DNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLA  140
            PVTSTRYSIDALKLPT +PW  WY D+G+VGGWTQ Y+GL FV VRGAGHEV LH PK A
Sbjct  307  PVTSTRYSIDALKLPTVTPWHAWYDDDGEVGGWTQGYKGLNFVTVRGAGHEVPLHRPKQA  366

Query  139  LTXVESFLAGTSMP  98
            LT ++SFLAG+ MP
Sbjct  367  LTLIKSFLAGSPMP  380



>gb|KGN61064.1| hypothetical protein Csa_2G036620 [Cucumis sativus]
Length=542

 Score =   185 bits (470),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 105/141 (74%), Gaps = 0/141 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQ+ALHV    +  +W TCS  +   WKD   +VLD+Y+ LI AGLRI VFSGDTDAV+
Sbjct  402  EVQQALHVDPKFAPSKWETCSYLINGNWKDSAGSVLDIYRELIQAGLRIWVFSGDTDAVL  461

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            P+TSTRYS+DALKLP    WRPWYD GQVGGW QEYEG+T V+VRGAGHEV LH PKLAL
Sbjct  462  PITSTRYSVDALKLPVIGSWRPWYDGGQVGGWIQEYEGVTLVSVRGAGHEVPLHQPKLAL  521

Query  136  TXVESFLAGTSMPGXQRIXDS  74
              ++SFLAG S+   Q   D+
Sbjct  522  QLIKSFLAGNSLSPLQLHSDT  542



>ref|XP_006845388.1| hypothetical protein AMTR_s00019p00053910 [Amborella trichopoda]
 gb|ERN07063.1| hypothetical protein AMTR_s00019p00053910 [Amborella trichopoda]
Length=473

 Score =   184 bits (466),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 86/133 (65%), Positives = 104/133 (78%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALHV+   +  +W TCSD V   W+D   ++L +Y  LI  GLRI +FSGDTDA+I
Sbjct  331  EVQKALHVNPAFAPSKWKTCSDVVGVNWRDSVKSILPIYHELIHEGLRIWMFSGDTDAII  390

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVTSTRY+IDAL+LPT +PW  WYDNGQVGGWTQ Y+GLTFV VRGAGHEVALH P+LAL
Sbjct  391  PVTSTRYNIDALRLPTVTPWHAWYDNGQVGGWTQVYKGLTFVTVRGAGHEVALHKPRLAL  450

Query  136  TXVESFLAGTSMP  98
              +++FL G+ MP
Sbjct  451  RLIKAFLVGSPMP  463



>ref|NP_001146398.1| Serine carboxypeptidase K10B2.2 precursor [Zea mays]
 gb|ACG39493.1| serine carboxypeptidase K10B2.2 precursor [Zea mays]
 gb|ACL53886.1| unknown [Zea mays]
 gb|AFW85536.1| Serine carboxypeptidase K10B2.2 [Zea mays]
Length=474

 Score =   183 bits (464),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 90/134 (67%), Positives = 101/134 (75%), Gaps = 1/134 (1%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALHV+T     +W TCS+ V   W DC  +VL +Y  LI  GLRI VFSGDTDAVI
Sbjct  332  EVQKALHVNTVIGKSKWETCSEAVNTHWGDCERSVLHIYHELIQYGLRIWVFSGDTDAVI  391

Query  316  PVTSTRYSIDALKLPTXSPWRPWY-DNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLA  140
            PVTSTRYSIDALKLPT +PW  WY D+G+VGGWTQ Y GL FV VRGAGHEV LH PK A
Sbjct  392  PVTSTRYSIDALKLPTITPWHAWYDDDGEVGGWTQGYRGLNFVTVRGAGHEVPLHRPKQA  451

Query  139  LTXVESFLAGTSMP  98
            LT ++SFL G+ MP
Sbjct  452  LTLIKSFLTGSPMP  465



>dbj|BAJ99024.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=469

 Score =   182 bits (463),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 89/134 (66%), Positives = 103/134 (77%), Gaps = 1/134 (1%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALHV+      +W TCS+ +   WKDC  +VL +Y  LI  GLRI +FSGDTDAVI
Sbjct  327  EVQKALHVNPVIGKSKWETCSEVINTNWKDCERSVLHIYHELIQYGLRIWMFSGDTDAVI  386

Query  316  PVTSTRYSIDALKLPTXSPWRPWY-DNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLA  140
            PVTSTRYSIDALKLPT +PW  WY D+G+VGGWTQ Y+GL FV VRGAGHEV LH PK A
Sbjct  387  PVTSTRYSIDALKLPTVTPWHAWYDDDGEVGGWTQGYKGLNFVTVRGAGHEVPLHRPKQA  446

Query  139  LTXVESFLAGTSMP  98
            LT ++SFLAG+ MP
Sbjct  447  LTLIKSFLAGSPMP  460



>ref|XP_008452541.1| PREDICTED: serine carboxypeptidase II-2 [Cucumis melo]
Length=468

 Score =   182 bits (463),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 88/141 (62%), Positives = 104/141 (74%), Gaps = 0/141 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQ+ALHV    +  +W TCS  +   WKD   +VLD+Y+ LI AGLRI VFSGDTDAV+
Sbjct  328  EVQQALHVDPKFAPSKWETCSYVINGNWKDSAGSVLDIYRELIQAGLRIWVFSGDTDAVL  387

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            P+TSTRYS+DALKLP   PWR WYD GQVGGW QEYEG+T V+VRGAGHEV LH PKLAL
Sbjct  388  PITSTRYSVDALKLPVIGPWRAWYDEGQVGGWIQEYEGVTLVSVRGAGHEVPLHQPKLAL  447

Query  136  TXVESFLAGTSMPGXQRIXDS  74
               ++FLAG S+   Q   D+
Sbjct  448  QLFKAFLAGNSLSPLQLHSDT  468



>sp|P55748.1|CBP22_HORVU RecName: Full=Serine carboxypeptidase II-2; AltName: Full=CP-MII.2; 
Contains: RecName: Full=Serine carboxypeptidase II-2 
chain A; Contains: RecName: Full=Serine carboxypeptidase II-2 
chain B; Flags: Precursor, partial [Hordeum vulgare]
 gb|AAB31590.1| CP-MII.2=serine carboxypeptidase [Hordeum vulgare=barley, cv. 
Alexis, aleurone, Peptide, 436 aa]
 emb|CAB59202.1| serine carboxylase II-2 [Hordeum vulgare subsp. vulgare]
Length=436

 Score =   181 bits (460),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 89/134 (66%), Positives = 102/134 (76%), Gaps = 1/134 (1%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALHV+      +W TCS+ +   WKDC  +VL +Y  LI  GLRI +FSGDTDAVI
Sbjct  294  EVQKALHVNPVIGKSKWETCSEVINTNWKDCERSVLHIYHELIQYGLRIWMFSGDTDAVI  353

Query  316  PVTSTRYSIDALKLPTXSPWRPWY-DNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLA  140
            PVTSTRYSIDALKLPT +PW  WY D+G+VGGWTQ Y+GL FV VRGAGHEV LH PK A
Sbjct  354  PVTSTRYSIDALKLPTVTPWHAWYDDDGEVGGWTQGYKGLNFVTVRGAGHEVPLHRPKQA  413

Query  139  LTXVESFLAGTSMP  98
            LT ++SFLAG  MP
Sbjct  414  LTLIKSFLAGRPMP  427



>ref|NP_001057009.1| Os06g0186400 [Oryza sativa Japonica Group]
 dbj|BAD72445.1| putative serine carboxylase II-2 [Oryza sativa Japonica Group]
 dbj|BAD72446.1| putative serine carboxylase II-2 [Oryza sativa Japonica Group]
 dbj|BAF18923.1| Os06g0186400 [Oryza sativa Japonica Group]
 gb|EAZ36073.1| hypothetical protein OsJ_20382 [Oryza sativa Japonica Group]
 dbj|BAG90330.1| unnamed protein product [Oryza sativa Japonica Group]
Length=484

 Score =   182 bits (462),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 103/137 (75%), Gaps = 1/137 (1%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALHV    +  +W TCSD V   WKDC  +VL +Y  LI  GLRI VFSGDTDAV+
Sbjct  342  EVQKALHVSPIINKSKWETCSDVVNTNWKDCERSVLHIYHELIQYGLRIWVFSGDTDAVL  401

Query  316  PVTSTRYSIDALKLPTXSPWRPWY-DNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLA  140
            PVTSTRYSI+ALKLPT +PW  WY D+G+VGGWTQ Y+GL FV VRGAGHEV LH PK A
Sbjct  402  PVTSTRYSINALKLPTVTPWNAWYDDDGEVGGWTQGYKGLNFVTVRGAGHEVPLHRPKQA  461

Query  139  LTXVESFLAGTSMPGXQ  89
            L  ++SFLAG+ MP  Q
Sbjct  462  LILIKSFLAGSPMPSVQ  478



>ref|XP_002324520.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
 gb|EEF03085.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
Length=470

 Score =   181 bits (460),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 93/145 (64%), Positives = 103/145 (71%), Gaps = 4/145 (3%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEV----YDFWKDCPXTVLDVYQXLITAGLRIXVFSGDT  329
            EVQKALHV    +   W TC             D P TVLD+Y+ LI +GL + VFSGDT
Sbjct  326  EVQKALHVSPEFAPARWETCRGATCPHHLTLIFDSPRTVLDIYKELIHSGLHVWVFSGDT  385

Query  328  DAVIPVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXP  149
            DAVIPVTSTRYSIDALKLPT  PW  WYD+GQVGGWTQEY GLTFV VRGAGHEV LH P
Sbjct  386  DAVIPVTSTRYSIDALKLPTVKPWGAWYDDGQVGGWTQEYAGLTFVVVRGAGHEVPLHKP  445

Query  148  KLALTXVESFLAGTSMPGXQRIXDS  74
            K ALT V++FL+GT MP  Q + DS
Sbjct  446  KQALTLVKAFLSGTPMPTLQLVSDS  470



>dbj|BAK02147.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=469

 Score =   180 bits (456),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 88/134 (66%), Positives = 102/134 (76%), Gaps = 1/134 (1%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALHV+      +W TCS+ +   WKDC  +VL +Y  LI  GL I +FSGDTDAVI
Sbjct  327  EVQKALHVNPVIGKSKWETCSEVINTNWKDCERSVLHIYHELIQYGLHIWMFSGDTDAVI  386

Query  316  PVTSTRYSIDALKLPTXSPWRPWY-DNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLA  140
            PVTSTRYSIDALKLPT +PW  WY D+G+VGGWTQ Y+GL FV VRGAGHEV LH PK A
Sbjct  387  PVTSTRYSIDALKLPTVTPWHAWYDDDGEVGGWTQGYKGLNFVTVRGAGHEVPLHRPKQA  446

Query  139  LTXVESFLAGTSMP  98
            LT ++SFLAG+ MP
Sbjct  447  LTLIKSFLAGSPMP  460



>ref|XP_010253608.1| PREDICTED: serine carboxypeptidase-like 27 [Nelumbo nucifera]
Length=458

 Score =   179 bits (454),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/133 (65%), Positives = 99/133 (74%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQK+LH + T  S  W TCSD V D+W D P ++L +YQ LI AGLRI VFSGDTDAV+
Sbjct  325  EVQKSLHANVTGISYPWKTCSDIVGDYWADSPLSMLPIYQELIAAGLRIWVFSGDTDAVV  384

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TRYSIDALKLPT   W PWYDNG+VGGW+Q Y+GLTFV V GAGHEV LH P+ A 
Sbjct  385  PVTATRYSIDALKLPTVINWYPWYDNGKVGGWSQVYKGLTFVTVTGAGHEVPLHRPREAF  444

Query  136  TXVESFLAGTSMP  98
               +SFL    MP
Sbjct  445  ILFKSFLENKPMP  457



>ref|XP_002312024.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
 gb|EEE89391.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
Length=460

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 99/134 (74%), Gaps = 0/134 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALH + T     W TCSD V D+W D P ++L +Y+ LI AGLRI V+SGDTDAV+
Sbjct  324  EVQKALHANVTGIPYPWKTCSDIVGDYWADSPLSMLPIYKELIAAGLRIWVYSGDTDAVV  383

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TRYSIDALKLPT   W PWYDNG+VGGW+Q Y+GL+FV V GAGHEV LH P+ A 
Sbjct  384  PVTATRYSIDALKLPTIINWYPWYDNGKVGGWSQVYKGLSFVTVTGAGHEVPLHRPRQAF  443

Query  136  TXVESFLAGTSMPG  95
                SFL   SMPG
Sbjct  444  ILFRSFLKNKSMPG  457



>gb|KJB78938.1| hypothetical protein B456_013G026200 [Gossypium raimondii]
Length=470

 Score =   179 bits (454),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/133 (64%), Positives = 99/133 (74%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALH + T    +W TCSD V   W D P ++L +YQ LI AG+RI V+SGDTDAV+
Sbjct  323  EVQKALHANVTGIPYQWETCSDVVGYNWTDSPLSMLPIYQELIAAGIRIWVYSGDTDAVV  382

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TRYSIDALKLPT + W PWYDNG+VGGW+QEY+GLTFV V GAGHEV LH P+ A 
Sbjct  383  PVTATRYSIDALKLPTINKWHPWYDNGKVGGWSQEYKGLTFVTVTGAGHEVPLHRPRQAF  442

Query  136  TXVESFLAGTSMP  98
                SFL   SMP
Sbjct  443  ILFRSFLENKSMP  455



>ref|XP_011031767.1| PREDICTED: serine carboxypeptidase-like 27 [Populus euphratica]
Length=460

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/134 (63%), Positives = 100/134 (75%), Gaps = 0/134 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALH + T    +W TCSD V D+W D P ++L +Y+ L+ AGLRI V+SGDTDAV+
Sbjct  324  EVQKALHANVTGIPYQWKTCSDIVGDYWADSPLSMLPIYKELMAAGLRIWVYSGDTDAVV  383

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TRYSIDALKLPT   W PWYDNG+VGGW+Q Y+GL+FV V GAGHEV LH P+ A 
Sbjct  384  PVTATRYSIDALKLPTIINWYPWYDNGKVGGWSQVYKGLSFVTVTGAGHEVPLHRPRQAF  443

Query  136  TXVESFLAGTSMPG  95
                SFL   SMPG
Sbjct  444  ILFRSFLENKSMPG  457



>ref|XP_010669644.1| PREDICTED: serine carboxypeptidase-like 27 [Beta vulgaris subsp. 
vulgaris]
Length=456

 Score =   178 bits (452),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 100/133 (75%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            +VQ ALH ++T  S  W TCSD V ++W + P T+L +YQ LI AGLRI V+SGDTDAV+
Sbjct  320  DVQLALHANSTKISYPWSTCSDIVGNYWSESPLTMLPIYQELIAAGLRIWVYSGDTDAVV  379

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            P+T+TRYSIDALKLPT + W PWYDNG+VGGW+Q YEGLTFV ++GAGHEV LH P+ A 
Sbjct  380  PITATRYSIDALKLPTVTNWYPWYDNGRVGGWSQVYEGLTFVTIKGAGHEVPLHRPRQAF  439

Query  136  TXVESFLAGTSMP  98
                 FL   SMP
Sbjct  440  ILFNHFLKNKSMP  452



>gb|ACG38162.1| serine carboxypeptidase K10B2.2 precursor [Zea mays]
 gb|ACG38177.1| serine carboxypeptidase K10B2.2 precursor [Zea mays]
Length=463

 Score =   178 bits (451),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 98/133 (74%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQ+ALH + T     WVTCSD VYDFWKD P ++L +Y+ LI AG+RI VFSGD D+V+
Sbjct  322  EVQRALHANVTGIPYPWVTCSDPVYDFWKDSPRSMLPIYRELIAAGIRIWVFSGDADSVV  381

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            P+T+TRYSIDAL LPT + W PWYD+ +VGGW Q YEGLT V VRGAGHEV LH P+  L
Sbjct  382  PLTATRYSIDALFLPTITNWYPWYDDEEVGGWCQVYEGLTLVTVRGAGHEVPLHRPRQGL  441

Query  136  TXVESFLAGTSMP  98
               E FL G  MP
Sbjct  442  KLFEHFLRGEPMP  454



>ref|XP_008654560.1| PREDICTED: uncharacterized protein LOC100273202 isoform X1 [Zea 
mays]
 gb|ACF86547.1| unknown [Zea mays]
 gb|AFW80078.1| serine carboxypeptidase K10B2.2 [Zea mays]
Length=463

 Score =   178 bits (451),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 98/133 (74%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQ+ALH + T     WVTCSD VYDFWKD P ++L +Y+ LI AG+RI VFSGD D+V+
Sbjct  322  EVQRALHANVTGIPYPWVTCSDPVYDFWKDSPRSMLPIYRELIAAGIRIWVFSGDADSVV  381

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            P+T+TRYSIDAL LPT + W PWYD+ +VGGW Q YEGLT V VRGAGHEV LH P+  L
Sbjct  382  PLTATRYSIDALFLPTITNWYPWYDDEEVGGWCQVYEGLTLVTVRGAGHEVPLHRPRQGL  441

Query  136  TXVESFLAGTSMP  98
               E FL G  MP
Sbjct  442  KLFEHFLRGEPMP  454



>gb|ACF79757.1| unknown [Zea mays]
Length=463

 Score =   178 bits (451),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 98/133 (74%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQ+ALH + T     WVTCSD VYDFWKD P ++L +Y+ LI AG+RI VFSGD D+V+
Sbjct  322  EVQRALHANVTGIPYPWVTCSDPVYDFWKDSPRSMLPIYRELIAAGIRIWVFSGDADSVV  381

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            P+T+TRYSIDAL LPT + W PWYD+ +VGGW Q YEGLT V VRGAGHEV LH P+  L
Sbjct  382  PLTATRYSIDALFLPTITNWYPWYDDEEVGGWCQVYEGLTLVTVRGAGHEVPLHRPRQGL  441

Query  136  TXVESFLAGTSMP  98
               E FL G  MP
Sbjct  442  KLFEHFLRGEPMP  454



>ref|XP_003556225.1| PREDICTED: serine carboxypeptidase-like 27-like isoform 1 [Glycine 
max]
 gb|KHN00830.1| Serine carboxypeptidase-like 27 [Glycine soja]
Length=460

 Score =   177 bits (450),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 98/133 (74%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALH + T     W  CSD V ++W D P ++L +YQ LI+AGLRI V+SGDTDAV+
Sbjct  325  EVQKALHANVTGIPYAWKACSDIVGNYWTDSPLSMLPIYQELISAGLRIWVYSGDTDAVV  384

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TRYSIDALKLPT   W PWYDNG+VGGW+Q Y+GLT V VRGAGHEV LH P+ A 
Sbjct  385  PVTATRYSIDALKLPTIINWYPWYDNGKVGGWSQVYKGLTLVTVRGAGHEVPLHRPRQAF  444

Query  136  TXVESFLAGTSMP  98
                SFL   SMP
Sbjct  445  ILFRSFLENKSMP  457



>gb|KDP25725.1| hypothetical protein JCGZ_23946 [Jatropha curcas]
Length=456

 Score =   177 bits (449),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 100/133 (75%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALH + T  S  W TCSD V ++W D P ++L +Y+ LI AGL+I V+SGDTDAV+
Sbjct  323  EVQKALHANATGISYPWKTCSDIVGNYWADAPLSMLPIYKELIAAGLKIWVYSGDTDAVV  382

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TRYSIDALKLPT + W PWYDNG+VGGW+Q Y+GLTFV V GAGHEV LH P+ A 
Sbjct  383  PVTATRYSIDALKLPTITNWSPWYDNGKVGGWSQVYKGLTFVTVTGAGHEVPLHRPRQAF  442

Query  136  TXVESFLAGTSMP  98
               +SFL    MP
Sbjct  443  ILFKSFLENKPMP  455



>ref|XP_009378094.1| PREDICTED: serine carboxypeptidase-like 27 [Pyrus x bretschneideri]
Length=455

 Score =   177 bits (449),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 102/133 (77%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            +VQKALH + T  S  W TCSD V ++W D P ++L +Y+ LI AGLRI VFSGDTD+V+
Sbjct  322  DVQKALHANVTRVSYPWKTCSDIVGNYWADSPLSILPIYRELIAAGLRIWVFSGDTDSVV  381

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TRYSIDALKLPT + W PW +NG+VGGW+Q Y+GLTFV V GAGHEV LH P+LA+
Sbjct  382  PVTATRYSIDALKLPTITNWYPWNNNGKVGGWSQVYKGLTFVTVTGAGHEVPLHRPRLAV  441

Query  136  TXVESFLAGTSMP  98
                SFLA  +MP
Sbjct  442  ILFRSFLASKAMP  454



>gb|KJB76568.1| hypothetical protein B456_012G094900 [Gossypium raimondii]
Length=304

 Score =   173 bits (439),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 97/133 (73%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALH + T  S  W TCSD V ++W D P ++L +Y+ LI AGLRI V+SGDTDAV+
Sbjct  171  EVQKALHANVTALSYPWQTCSDIVGNYWTDAPLSMLPIYKELIAAGLRIWVYSGDTDAVV  230

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TRYSIDALKLPT   W PWYDNG+VGGW+Q Y+GLT V V GAGHEV LH P+ A 
Sbjct  231  PVTATRYSIDALKLPTVINWYPWYDNGKVGGWSQAYKGLTLVTVTGAGHEVPLHRPRQAF  290

Query  136  TXVESFLAGTSMP  98
                SFL    MP
Sbjct  291  ILFRSFLENKLMP  303



>emb|CDX72270.1| BnaC07g42920D [Brassica napus]
Length=667

 Score =   180 bits (456),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 91/152 (60%), Positives = 108/152 (71%), Gaps = 0/152 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQ+ALHV    +  +W  CSD V + WKD P +VL++Y  LI AGLRI VFSGD DAV+
Sbjct  327  EVQEALHVPPGLAPSKWDVCSDVVSENWKDSPSSVLNIYHELIAAGLRIWVFSGDADAVV  386

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVTSTRYSIDALKL   SP+ PWY +GQVGGWTQEY+GL FV VRGAGHEV LH PK AL
Sbjct  387  PVTSTRYSIDALKLHPVSPYGPWYIDGQVGGWTQEYDGLNFVTVRGAGHEVPLHRPKEAL  446

Query  136  TXVESFLAGTSMPGXQRIXDS*LFSPXGEERE  41
               ++F++GTS+P  +    S      GEE E
Sbjct  447  ALFQAFISGTSLPTPENSIRSDKSELVGEEIE  478



>ref|XP_006655861.1| PREDICTED: serine carboxypeptidase II-2-like [Oryza brachyantha]
Length=484

 Score =   177 bits (450),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 88/134 (66%), Positives = 101/134 (75%), Gaps = 1/134 (1%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALH     +  +W TCSD V   WKDC  +VL +Y  LI  GLRI VFSGDTDAV+
Sbjct  342  EVQKALHASPIINKSKWETCSDIVNTNWKDCERSVLHIYHELIQYGLRIWVFSGDTDAVL  401

Query  316  PVTSTRYSIDALKLPTXSPWRPWYD-NGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLA  140
            PVTSTRYSIDALKL T +PW  WYD +G+VGGWTQ Y+GL FV+VRGAGHEV LH PK A
Sbjct  402  PVTSTRYSIDALKLLTVTPWSAWYDEDGEVGGWTQGYKGLNFVSVRGAGHEVPLHRPKQA  461

Query  139  LTXVESFLAGTSMP  98
            L  ++SFLAG +MP
Sbjct  462  LILIKSFLAGRAMP  475



>ref|XP_003564183.1| PREDICTED: serine carboxypeptidase II-2 [Brachypodium distachyon]
Length=474

 Score =   177 bits (449),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/134 (65%), Positives = 102/134 (76%), Gaps = 1/134 (1%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALHV+      +W TCS  + + W D   +VL +Y  LI  GLRI +FSGDTDAVI
Sbjct  332  EVQKALHVNPVIGKSKWETCSGVINNNWGDSERSVLHIYHELIQYGLRIWMFSGDTDAVI  391

Query  316  PVTSTRYSIDALKLPTXSPWRPWY-DNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLA  140
            PVTSTRYSI+ALKLPT +PW  WY D+G+VGGWTQ Y+GLTFV VRGAGHEV LH PK A
Sbjct  392  PVTSTRYSINALKLPTVAPWHAWYDDDGEVGGWTQGYQGLTFVTVRGAGHEVPLHRPKQA  451

Query  139  LTXVESFLAGTSMP  98
            LT ++SFLAG+ MP
Sbjct  452  LTLIKSFLAGSPMP  465



>gb|KHG25905.1| Serine carboxypeptidase-like 27 [Gossypium arboreum]
Length=470

 Score =   177 bits (448),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 99/133 (74%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALH + T    +W TCSD +   W D P ++L +YQ LI AG+RI V+SGDTDAV+
Sbjct  323  EVQKALHANVTGIPYQWETCSDVIGYNWTDSPLSMLPIYQELIAAGIRIWVYSGDTDAVV  382

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TRYSIDALKLPT + W PWY+NG+VGGW+QEY+GLTFV V GAGHEV LH P+ A 
Sbjct  383  PVTATRYSIDALKLPTINKWHPWYENGKVGGWSQEYKGLTFVTVTGAGHEVPLHRPRQAF  442

Query  136  TXVESFLAGTSMP  98
                SFL   SMP
Sbjct  443  ILFRSFLENKSMP  455



>ref|XP_008368824.1| PREDICTED: serine carboxypeptidase-like 27 [Malus domestica]
Length=455

 Score =   176 bits (447),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 100/133 (75%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            +VQKALH + T  S  W TCSD V ++W D P ++L +Y+ LI AGLRI VFSGDTD+V+
Sbjct  322  DVQKALHANVTRVSYPWKTCSDIVGNYWADSPLSMLPIYKELIAAGLRIWVFSGDTDSVV  381

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TRYSIDALKLPT + W PW DNG+VGGW+Q Y+GLTFV V GAGHEV LH P+LA 
Sbjct  382  PVTATRYSIDALKLPTITNWYPWNDNGKVGGWSQVYKGLTFVTVTGAGHEVPLHRPRLAF  441

Query  136  TXVESFLAGTSMP  98
                SFL   +MP
Sbjct  442  ILFRSFLGSKAMP  454



>ref|XP_009395827.1| PREDICTED: serine carboxypeptidase II-2-like [Musa acuminata 
subsp. malaccensis]
Length=476

 Score =   177 bits (448),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 103/133 (77%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQK LHV+   +  +WVTCSD V   +KD   +VL +Y+ LI+ GLRI +FSGDTDAVI
Sbjct  335  EVQKVLHVNPAFAPSKWVTCSDFVDKNYKDSSRSVLPIYRELISHGLRIWMFSGDTDAVI  394

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PV STRY+IDALKLPT +PW  WYD+GQVGGWTQ Y+GLTFV VRGAGHE++L  PK AL
Sbjct  395  PVASTRYNIDALKLPTVTPWHAWYDDGQVGGWTQVYKGLTFVTVRGAGHEISLLRPKSAL  454

Query  136  TXVESFLAGTSMP  98
              +++FL+G  MP
Sbjct  455  VLIKAFLSGNPMP  467



>ref|XP_004968265.1| PREDICTED: serine carboxypeptidase 2-like [Setaria italica]
Length=523

 Score =   177 bits (450),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 97/132 (73%), Gaps = 0/132 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALH + T     WV CSD +YD+WKD P ++L +Y+ LI AG+RI VFSGD D+V+
Sbjct  382  EVQKALHANVTGIPYAWVACSDPIYDYWKDSPKSMLPIYRELIAAGIRIWVFSGDADSVV  441

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            P+T+TRYSIDAL LPT + W PWYDNG+VGGW Q Y+GLT V VRGAGHEVALH P+  L
Sbjct  442  PLTATRYSIDALSLPTVTNWYPWYDNGEVGGWCQVYKGLTLVTVRGAGHEVALHRPRQGL  501

Query  136  TXVESFLAGTSM  101
               E FL    M
Sbjct  502  KLFEHFLRDEPM  513



>ref|XP_009137969.1| PREDICTED: serine carboxypeptidase-like 29 [Brassica rapa]
Length=476

 Score =   177 bits (448),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/132 (64%), Positives = 101/132 (77%), Gaps = 0/132 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQ+ALHV    +  +W  CSD+V   WKD P +VL++Y  LI AGLRI VFSGD DAV+
Sbjct  327  EVQEALHVPPGLAPSKWDVCSDDVSRNWKDSPSSVLNIYHELIAAGLRIWVFSGDADAVV  386

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVTSTRYSIDALKL   SP+ PWY +GQVGGWTQEY+GL FV VRGAGHEV LH PK AL
Sbjct  387  PVTSTRYSIDALKLHPVSPYGPWYIDGQVGGWTQEYDGLNFVTVRGAGHEVPLHRPKEAL  446

Query  136  TXVESFLAGTSM  101
               ++F++GTS+
Sbjct  447  ALFQAFISGTSL  458



>ref|XP_010264739.1| PREDICTED: serine carboxypeptidase-like 27 [Nelumbo nucifera]
Length=458

 Score =   176 bits (446),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 99/133 (74%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALH + T  S  W TCSD V D+W D P ++L +Y+ LI AGLRI VFSGDTDAV+
Sbjct  325  EVQKALHANLTAISYPWKTCSDIVGDYWADSPLSMLPIYEELIAAGLRIWVFSGDTDAVV  384

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            P+T+TRYSIDALKLPT   W PWYD+G+VGGW+Q Y+GLTFV VRGAGHEV LH P+  L
Sbjct  385  PLTATRYSIDALKLPTVMNWYPWYDHGKVGGWSQVYKGLTFVTVRGAGHEVPLHRPRQVL  444

Query  136  TXVESFLAGTSMP  98
               + FL    MP
Sbjct  445  ILFKYFLENKPMP  457



>ref|XP_010526302.1| PREDICTED: serine carboxypeptidase-like 29 [Tarenaya hassleriana]
Length=489

 Score =   176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 99/133 (74%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQ ALHV    +  +W TCSD V + WKD P +VL++Y  LI AGL I VFSGD DAV+
Sbjct  334  EVQTALHVPPELAPSKWETCSDTVGNHWKDSPRSVLNIYHELIAAGLHIWVFSGDADAVV  393

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVTSTRYSIDAL L   +PWRPWY +GQVGGWTQ+Y GL FV VRGAGHEV LH PK AL
Sbjct  394  PVTSTRYSIDALNLRPLNPWRPWYIDGQVGGWTQQYVGLNFVTVRGAGHEVPLHRPKQAL  453

Query  136  TXVESFLAGTSMP  98
               ++F++G S+P
Sbjct  454  ALFKAFVSGNSLP  466



>emb|CDY13387.1| BnaA03g51050D [Brassica napus]
Length=476

 Score =   176 bits (446),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 85/132 (64%), Positives = 100/132 (76%), Gaps = 0/132 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQ+ALHV    +  +W  CSD+V   WKD P +VL++Y  LI AGLRI VFSGD DAV+
Sbjct  327  EVQEALHVPPGLAPSKWDVCSDDVSRNWKDSPSSVLNIYHELIAAGLRIWVFSGDADAVV  386

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVTSTRYSIDALKL   SP+ PWY +GQVGGWTQEY+GL FV VRGAGHEV LH PK AL
Sbjct  387  PVTSTRYSIDALKLHPVSPYGPWYIDGQVGGWTQEYDGLNFVTVRGAGHEVPLHRPKEAL  446

Query  136  TXVESFLAGTSM  101
               ++F+ GTS+
Sbjct  447  ALFQAFITGTSL  458



>gb|ABK21145.1| unknown [Picea sitchensis]
Length=343

 Score =   173 bits (438),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 98/133 (74%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKA H + T+ S  W TCSD +  +W+D P ++L +YQ L+ AG+RI VFSGDTDAV+
Sbjct  202  EVQKAFHANVTSISYSWTTCSDILEKYWQDSPRSMLPIYQELLRAGIRIWVFSGDTDAVV  261

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TRYSIDAL+L T   W PWYDN +VGGWTQ Y+GLT V +RGAGHEV LH P+ A 
Sbjct  262  PVTATRYSIDALRLRTIVNWYPWYDNQEVGGWTQIYKGLTLVTIRGAGHEVPLHQPRKAF  321

Query  136  TXVESFLAGTSMP  98
               ++FL G  MP
Sbjct  322  ILFKAFLKGKPMP  334



>ref|XP_002457307.1| hypothetical protein SORBIDRAFT_03g005360 [Sorghum bicolor]
 gb|EES02427.1| hypothetical protein SORBIDRAFT_03g005360 [Sorghum bicolor]
Length=463

 Score =   176 bits (445),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 97/133 (73%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALH + T     WVTCSD VYDFWKD P ++L +Y+ LI AGLRI VFSGD D+V+
Sbjct  322  EVQKALHANVTGIPYPWVTCSDPVYDFWKDSPRSMLPIYRELIAAGLRIWVFSGDADSVV  381

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            P+T+TRYSIDAL LPT + W PWYD+ +VGGW Q Y+GLT V +RGAGHEV LH P+  L
Sbjct  382  PLTATRYSIDALFLPTVTNWYPWYDDEEVGGWCQVYKGLTLVTIRGAGHEVPLHRPRQGL  441

Query  136  TXVESFLAGTSMP  98
               E FL    MP
Sbjct  442  KLFEHFLRDEPMP  454



>ref|XP_007219592.1| hypothetical protein PRUPE_ppa023509mg, partial [Prunus persica]
 gb|EMJ20791.1| hypothetical protein PRUPE_ppa023509mg, partial [Prunus persica]
Length=397

 Score =   173 bits (439),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 97/132 (73%), Gaps = 0/132 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQ+A H + T  S  W TCSD V  +W D P ++L +Y+ LI AGLRI V+SGDTDAV+
Sbjct  264  EVQRAFHANVTGISYPWQTCSDIVGTYWADSPLSMLPIYRELIAAGLRIWVYSGDTDAVV  323

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TRYSIDALKLPT + W PWYDNG+VGGW Q Y+GLTFV V GAGHEV LH P+ A 
Sbjct  324  PVTATRYSIDALKLPTITNWSPWYDNGKVGGWNQIYKGLTFVTVTGAGHEVPLHRPRQAF  383

Query  136  TXVESFLAGTSM  101
               +SFL G  M
Sbjct  384  IVFKSFLEGKPM  395



>ref|XP_011040963.1| PREDICTED: serine carboxypeptidase-like 27 [Populus euphratica]
Length=460

 Score =   174 bits (442),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 84/134 (63%), Positives = 98/134 (73%), Gaps = 0/134 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALH + T     W TCS+ V D+W D P ++L +Y+ LI AGLRI V+SGDTDAV+
Sbjct  324  EVQKALHANVTGIPYPWETCSNIVGDYWADSPLSMLPIYKELIAAGLRIWVYSGDTDAVV  383

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TRYSIDALKLPT   W PWYD+G+VGGW+Q Y GLTFV V GAGHEV LH P+ A 
Sbjct  384  PVTATRYSIDALKLPTIINWYPWYDSGKVGGWSQVYTGLTFVTVTGAGHEVPLHRPRQAF  443

Query  136  TXVESFLAGTSMPG  95
                SFL   SMPG
Sbjct  444  ILFMSFLGNKSMPG  457



>ref|XP_006589433.1| PREDICTED: serine carboxypeptidase-like 27-like [Glycine max]
Length=460

 Score =   174 bits (440),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 97/133 (73%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKA H + T     W  CSD V ++W D P ++L +Y+ LI+AGLRI V+SGDTDAV+
Sbjct  325  EVQKAFHANVTGIPYAWKACSDIVGNYWTDSPLSMLPIYRELISAGLRIWVYSGDTDAVV  384

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            P+T+TRYSIDALKLPT   W PWYDNG+VGGW+Q Y+GLT V VRGAGHEV LH P+ A 
Sbjct  385  PMTATRYSIDALKLPTIINWYPWYDNGKVGGWSQVYKGLTLVTVRGAGHEVPLHRPRQAF  444

Query  136  TXVESFLAGTSMP  98
                SFL   SMP
Sbjct  445  ILFRSFLENKSMP  457



>gb|KJB76563.1| hypothetical protein B456_012G094900 [Gossypium raimondii]
Length=452

 Score =   174 bits (440),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 97/133 (73%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALH + T  S  W TCSD V ++W D P ++L +Y+ LI AGLRI V+SGDTDAV+
Sbjct  319  EVQKALHANVTALSYPWQTCSDIVGNYWTDAPLSMLPIYKELIAAGLRIWVYSGDTDAVV  378

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TRYSIDALKLPT   W PWYDNG+VGGW+Q Y+GLT V V GAGHEV LH P+ A 
Sbjct  379  PVTATRYSIDALKLPTVINWYPWYDNGKVGGWSQAYKGLTLVTVTGAGHEVPLHRPRQAF  438

Query  136  TXVESFLAGTSMP  98
                SFL    MP
Sbjct  439  ILFRSFLENKLMP  451



>gb|KHN17121.1| Serine carboxypeptidase-like 27 [Glycine soja]
Length=459

 Score =   174 bits (440),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 97/133 (73%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKA H + T     W  CSD V ++W D P ++L +Y+ LI+AGLRI V+SGDTDAV+
Sbjct  324  EVQKAFHANVTGIPYAWKACSDIVGNYWTDSPLSMLPIYRELISAGLRIWVYSGDTDAVV  383

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            P+T+TRYSIDALKLPT   W PWYDNG+VGGW+Q Y+GLT V VRGAGHEV LH P+ A 
Sbjct  384  PMTATRYSIDALKLPTIINWYPWYDNGKVGGWSQVYKGLTLVTVRGAGHEVPLHRPRQAF  443

Query  136  TXVESFLAGTSMP  98
                SFL   SMP
Sbjct  444  ILFRSFLENKSMP  456



>gb|KJB76569.1| hypothetical protein B456_012G094900 [Gossypium raimondii]
Length=451

 Score =   173 bits (439),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 97/133 (73%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALH + T  S  W TCSD V ++W D P ++L +Y+ LI AGLRI V+SGDTDAV+
Sbjct  318  EVQKALHANVTALSYPWQTCSDIVGNYWTDAPLSMLPIYKELIAAGLRIWVYSGDTDAVV  377

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TRYSIDALKLPT   W PWYDNG+VGGW+Q Y+GLT V V GAGHEV LH P+ A 
Sbjct  378  PVTATRYSIDALKLPTVINWYPWYDNGKVGGWSQAYKGLTLVTVTGAGHEVPLHRPRQAF  437

Query  136  TXVESFLAGTSMP  98
                SFL    MP
Sbjct  438  ILFRSFLENKLMP  450



>gb|KHG08205.1| Serine carboxypeptidase-like 27 [Gossypium arboreum]
Length=452

 Score =   173 bits (439),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 97/133 (73%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALH + T  S  W TCSD V ++W D P ++L +Y+ LI AGLRI V+SGDTDAV+
Sbjct  319  EVQKALHANVTALSYPWQTCSDIVGNYWTDAPLSMLPIYKELIAAGLRIWVYSGDTDAVV  378

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TRYSIDALKLPT   W PWYDNG+VGGW+Q Y+GLT V V GAGHEV LH P+ A 
Sbjct  379  PVTATRYSIDALKLPTIINWYPWYDNGKVGGWSQAYKGLTLVTVTGAGHEVPLHRPRQAF  438

Query  136  TXVESFLAGTSMP  98
                SFL    MP
Sbjct  439  ILFRSFLENKLMP  451



>ref|XP_011076996.1| PREDICTED: serine carboxypeptidase-like 27 [Sesamum indicum]
Length=461

 Score =   173 bits (439),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 96/133 (72%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQ ALH + T  S  W +CSD V ++W D P +VL +YQ LI AG RI VFSGDTDAV+
Sbjct  328  EVQNALHANVTRISYPWQSCSDIVGNYWADTPLSVLPIYQELIAAGHRIWVFSGDTDAVV  387

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TRYSIDALKLPT + W PWYDNG+VGGW+Q Y+GLT V V GAGHEV LH P+ A 
Sbjct  388  PVTATRYSIDALKLPTITKWYPWYDNGKVGGWSQVYKGLTLVTVTGAGHEVPLHRPRQAF  447

Query  136  TXVESFLAGTSMP  98
                SFL    MP
Sbjct  448  ILFRSFLENKPMP  460



>ref|XP_008233341.1| PREDICTED: serine carboxypeptidase-like 27 [Prunus mume]
 ref|XP_008233342.1| PREDICTED: serine carboxypeptidase-like 27 [Prunus mume]
Length=455

 Score =   173 bits (439),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 96/132 (73%), Gaps = 0/132 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQ+A H + T  S  W TCSD V  +W D P ++L +Y+ LI AGLRI V+SGDTDAV+
Sbjct  322  EVQRAFHANVTGISYPWQTCSDIVGTYWADSPLSMLPIYRELIAAGLRIWVYSGDTDAVV  381

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TRYSIDALKLPT + W PWYDNG+VGGW Q Y+GLTFV V GAGHEV LH P+ A 
Sbjct  382  PVTATRYSIDALKLPTITNWSPWYDNGKVGGWNQIYKGLTFVTVTGAGHEVPLHRPRQAF  441

Query  136  TXVESFLAGTSM  101
                SFL G  M
Sbjct  442  IVFRSFLEGKPM  453



>ref|XP_009802382.1| PREDICTED: serine carboxypeptidase-like 27 [Nicotiana sylvestris]
Length=456

 Score =   173 bits (439),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 98/133 (74%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKA H + T  +  W TCSD V ++W D P ++L +YQ LI+AGLRI VFSGDTD+V+
Sbjct  323  EVQKAFHANVTKVAYPWKTCSDIVGNYWADSPLSMLPIYQELISAGLRIWVFSGDTDSVV  382

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TRYSIDALKLPT + W PWYDN +VGGW+Q Y+GLT V V GAGHEV LH P+ A 
Sbjct  383  PVTATRYSIDALKLPTITNWYPWYDNKKVGGWSQVYKGLTLVTVTGAGHEVPLHRPRQAF  442

Query  136  TXVESFLAGTSMP  98
              + SFL    MP
Sbjct  443  ILLRSFLENKPMP  455



>ref|XP_007143689.1| hypothetical protein PHAVU_007G093300g [Phaseolus vulgaris]
 gb|ESW15683.1| hypothetical protein PHAVU_007G093300g [Phaseolus vulgaris]
Length=459

 Score =   173 bits (439),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 96/133 (72%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKA H + T    EW  CSD V ++W D P ++L +YQ LI AG RI V+SGDTDAV+
Sbjct  325  EVQKAFHANVTGIPYEWKACSDIVGNYWTDSPLSMLPIYQELIRAGYRIWVYSGDTDAVV  384

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TRYSIDALKLPT   W PWYD+G+VGGW+Q Y+GLT V VRGAGHEV LH P+ A 
Sbjct  385  PVTATRYSIDALKLPTIINWYPWYDSGKVGGWSQVYKGLTMVTVRGAGHEVPLHRPREAF  444

Query  136  TXVESFLAGTSMP  98
                SFL   SMP
Sbjct  445  ILFSSFLQNKSMP  457



>ref|XP_009592854.1| PREDICTED: serine carboxypeptidase-like 27 [Nicotiana tomentosiformis]
Length=456

 Score =   173 bits (438),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 97/133 (73%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKA H + T  +  W TCSD V ++W D P ++L +YQ LI AGLRI VFSGDTD+V+
Sbjct  323  EVQKAFHANVTKVAYPWKTCSDIVGNYWADSPLSMLPIYQELIAAGLRIWVFSGDTDSVV  382

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TRYSIDALKLPT + W PWYDN +VGGW+Q Y+GLT V V GAGHEV LH P+ A 
Sbjct  383  PVTATRYSIDALKLPTITNWYPWYDNKKVGGWSQVYKGLTLVTVTGAGHEVPLHRPRQAF  442

Query  136  TXVESFLAGTSMP  98
              + SFL    MP
Sbjct  443  ILLRSFLENKPMP  455



>dbj|BAK06862.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=228

 Score =   167 bits (422),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 94/133 (71%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQ ALH +TT     W TCSD V  +W D P ++L +Y  LI AG+RI VFSGDTDAV+
Sbjct  94   EVQTALHANTTGIKYPWKTCSDIVGSYWADSPRSMLPIYHELIAAGIRIWVFSGDTDAVV  153

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            P+T+TRYSI ALKLPT   W PWYD+G+VGGW+Q Y+GLT V V GAGHEV LH P+ AL
Sbjct  154  PITATRYSISALKLPTLMNWYPWYDHGKVGGWSQVYKGLTLVTVAGAGHEVPLHRPRQAL  213

Query  136  TXVESFLAGTSMP  98
                 FL  T MP
Sbjct  214  ILFRHFLKDTPMP  226



>pdb|1BCR|B Chain B, Complex Of The Wheat Serine Carboxypeptidase, Cpdw-ii, 
With The Microbial Peptide Aldehyde Inhibitor, Antipain, 
And Arginine At Room Temperature
 pdb|1BCS|B Chain B, Complex Of The Wheat Serine Carboxypeptidase, Cpdw-Ii, 
With The Microbial Peptide Aldehyde Inhibitor, Chymostatin, 
And Arginine At 100 Degrees Kelvin
 prf||1408164B CPase II B
Length=160

 Score =   164 bits (416),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 78/138 (57%), Positives = 99/138 (72%), Gaps = 1/138 (1%)
 Frame = -3

Query  496  EVQKALHVHTTNS-SXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAV  320
            +VQ ALH + T + +  W TCSD +   W D P ++L +Y+ LI AGLRI VFSGDTDAV
Sbjct  20   DVQMALHANVTGAMNYTWATCSDTINTHWHDAPRSMLPIYRELIAAGLRIWVFSGDTDAV  79

Query  319  IPVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLA  140
            +P+T+TRYSI AL LPT + W PWYD+ +VGGW+Q Y+GLT V+VRGAGHEV LH P+ A
Sbjct  80   VPLTATRYSIGALGLPTTTSWYPWYDDQEVGGWSQVYKGLTLVSVRGAGHEVPLHRPRQA  139

Query  139  LTXVESFLAGTSMPGXQR  86
            L   + FL G  MPG  +
Sbjct  140  LVLFQYFLQGKPMPGQTK  157



>pdb|3SC2|B Chain B, Refined Atomic Model Of Wheat Serine Carboxypeptidase 
Ii At 2.2- Angstroms Resolution
Length=152

 Score =   164 bits (415),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 98/135 (73%), Gaps = 1/135 (1%)
 Frame = -3

Query  496  EVQKALHVHTTNS-SXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAV  320
            +VQ ALH + T + +  W TCSD +   W D P ++L +Y+ LI AGLRI VFSGDTDAV
Sbjct  18   DVQMALHANVTGAMNYTWATCSDTINTHWHDAPRSMLPIYRELIAAGLRIWVFSGDTDAV  77

Query  319  IPVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLA  140
            +P+T+TRYSI AL LPT + W PWYD+ +VGGW+Q Y+GLT V+VRGAGHEV LH P+ A
Sbjct  78   VPLTATRYSIGALGLPTTTSWYPWYDDQEVGGWSQVYKGLTLVSVRGAGHEVPLHRPRQA  137

Query  139  LTXVESFLAGTSMPG  95
            L   + FL G  MPG
Sbjct  138  LVLFQYFLQGKPMPG  152



>pdb|1WHT|B Chain B, Structure Of The Complex Of L-Benzylsuccinate With Wheat 
Serine Carboxypeptidase Ii At 2.0 Angstroms Resolution
Length=153

 Score =   164 bits (415),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 98/135 (73%), Gaps = 1/135 (1%)
 Frame = -3

Query  496  EVQKALHVHTTNS-SXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAV  320
            +VQ ALH + T + +  W TCSD +   W D P ++L +Y+ LI AGLRI VFSGDTDAV
Sbjct  18   DVQMALHANVTGAMNYTWATCSDTINTHWHDAPRSMLPIYRELIAAGLRIWVFSGDTDAV  77

Query  319  IPVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLA  140
            +P+T+TRYSI AL LPT + W PWYD+ +VGGW+Q Y+GLT V+VRGAGHEV LH P+ A
Sbjct  78   VPLTATRYSIGALGLPTTTSWYPWYDDQEVGGWSQVYKGLTLVSVRGAGHEVPLHRPRQA  137

Query  139  LTXVESFLAGTSMPG  95
            L   + FL G  MPG
Sbjct  138  LVLFQYFLQGKPMPG  152



>pdb|1WHS|B Chain B, Structure Of The Complex Of L-Benzylsuccinate With Wheat 
Serine Carboxypeptidase Ii At 2.0 Angstroms Resolution
Length=153

 Score =   164 bits (415),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 98/135 (73%), Gaps = 1/135 (1%)
 Frame = -3

Query  496  EVQKALHVHTTNS-SXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAV  320
            +VQ ALH + T + +  W TCSD +   W D P ++L +Y+ LI AGLRI VFSGDTDAV
Sbjct  18   DVQMALHANVTGAMNYTWATCSDTINTHWHDAPRSMLPIYRELIAAGLRIWVFSGDTDAV  77

Query  319  IPVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLA  140
            +P+T+TRYSI AL LPT + W PWYD+ +VGGW+Q Y+GLT V+VRGAGHEV LH P+ A
Sbjct  78   VPLTATRYSIGALGLPTTTSWYPWYDDQEVGGWSQVYKGLTLVSVRGAGHEVPLHRPRQA  137

Query  139  LTXVESFLAGTSMPG  95
            L   + FL G  MPG
Sbjct  138  LVLFQYFLQGKPMPG  152



>ref|XP_002459313.1| hypothetical protein SORBIDRAFT_02g002260 [Sorghum bicolor]
 gb|EER95834.1| hypothetical protein SORBIDRAFT_02g002260 [Sorghum bicolor]
Length=478

 Score =   172 bits (437),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 96/133 (72%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQ+ALH + T  +  W TCSD +   W D P ++L +Y+ LI AGLRI VFSGDTDAVI
Sbjct  340  EVQRALHANLTGINYPWATCSDLINTNWGDSPKSMLPIYKELIAAGLRIWVFSGDTDAVI  399

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            P+TSTRYS+DAL LPT + W PWYD  QVGGW+Q YEGLT V VRGAGHEV LH P+ AL
Sbjct  400  PLTSTRYSVDALGLPTTTSWYPWYDKKQVGGWSQVYEGLTLVTVRGAGHEVPLHRPRQAL  459

Query  136  TXVESFLAGTSMP  98
               + FL G  MP
Sbjct  460  ILFQQFLKGEPMP  472



>ref|XP_006350225.1| PREDICTED: serine carboxypeptidase-like 27-like [Solanum tuberosum]
Length=456

 Score =   172 bits (435),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 96/133 (72%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKA H + T  +  W TCSD V D+W D P ++L +YQ LI AGLRI VFSGDTD+V+
Sbjct  323  EVQKAFHANVTKIAYPWKTCSDIVGDYWDDSPLSMLPIYQELIAAGLRIWVFSGDTDSVV  382

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            P+T+TRYSIDALKLPT + W PWYDN +VGGW+Q Y+GLT V + GAGHEV LH P+ A 
Sbjct  383  PLTATRYSIDALKLPTITNWYPWYDNKKVGGWSQLYKGLTLVTITGAGHEVPLHRPRQAF  442

Query  136  TXVESFLAGTSMP  98
                SFL    MP
Sbjct  443  ILFRSFLENKPMP  455



>emb|CDY28217.1| BnaA01g06320D [Brassica napus]
Length=468

 Score =   172 bits (436),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 100/132 (76%), Gaps = 0/132 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            +VQKALHV    +  +W TCS  V + WKD P +VLD+Y  LI AGLRI VFSGD DA++
Sbjct  332  KVQKALHVPPKVAPSKWDTCSKVVGEHWKDSPSSVLDIYHELIAAGLRIWVFSGDADAIV  391

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVTSTRYSI+AL L T SP+ PWY +GQVGGW+Q+Y GL FV VRG+GHEVALH PK AL
Sbjct  392  PVTSTRYSINALNLSTTSPYGPWYIDGQVGGWSQQYAGLNFVIVRGSGHEVALHRPKEAL  451

Query  136  TXVESFLAGTSM  101
               ++F++GT +
Sbjct  452  ALFKAFISGTPL  463



>tpg|DAA53383.1| TPA: hypothetical protein ZEAMMB73_784297 [Zea mays]
Length=340

 Score =   169 bits (428),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 95/133 (71%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQ A H + T     WV CSD +Y++WKD P ++L +Y+ LI+AGLRI VFSGDTD+V+
Sbjct  199  EVQDAFHANVTGIPYAWVGCSDPIYEYWKDSPRSMLPIYRELISAGLRIWVFSGDTDSVV  258

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            P+T+TRYSIDAL LPT + W PWY + +VGGW Q YEGLT V VRGAGHEV LH P   L
Sbjct  259  PLTATRYSIDALSLPTITKWYPWYYDEEVGGWCQVYEGLTLVTVRGAGHEVPLHRPPQGL  318

Query  136  TXVESFLAGTSMP  98
               E FL G  MP
Sbjct  319  KLFEHFLRGEPMP  331



>emb|CDY55623.1| BnaC03g77560D [Brassica napus]
Length=477

 Score =   172 bits (436),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 99/132 (75%), Gaps = 0/132 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQ+ALHV    +  +W TCSD V + WKDC  +VL++Y  LI AGLRI VFSGD DAV+
Sbjct  328  EVQEALHVPPGLAPSKWDTCSDVVNEHWKDCSSSVLNIYHELIAAGLRIWVFSGDADAVV  387

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TRYSIDAL L   SP+ PWY +GQVGGWTQ+Y GL FV VRGAGHEV LH PK AL
Sbjct  388  PVTATRYSIDALNLRPLSPYGPWYIDGQVGGWTQQYAGLNFVTVRGAGHEVPLHRPKEAL  447

Query  136  TXVESFLAGTSM  101
               ++F++GT +
Sbjct  448  ALFKAFISGTPL  459



>ref|XP_009127491.1| PREDICTED: serine carboxypeptidase-like 29 [Brassica rapa]
Length=480

 Score =   172 bits (436),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 100/132 (76%), Gaps = 0/132 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            +VQKALHV    +  +W TCS  V + WKD P +VLD+Y  LI AGLRI VFSGD DA++
Sbjct  344  KVQKALHVPPKVAPSKWDTCSKVVGEHWKDSPSSVLDIYHELIAAGLRIWVFSGDADAIV  403

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVTSTRYSI+AL L T SP+ PWY +GQVGGW+Q+Y GL FV VRG+GHEVALH PK AL
Sbjct  404  PVTSTRYSINALNLSTISPYGPWYIDGQVGGWSQQYAGLNFVIVRGSGHEVALHRPKEAL  463

Query  136  TXVESFLAGTSM  101
               ++F++GT +
Sbjct  464  ALFKAFISGTPL  475



>ref|XP_010527107.1| PREDICTED: serine carboxypeptidase-like 29, partial [Tarenaya 
hassleriana]
Length=207

 Score =   165 bits (417),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/137 (57%), Positives = 97/137 (71%), Gaps = 0/137 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALHV    +  +W  CSD V + W D P +VL++Y  LI AGLRI VFSGD DAV+
Sbjct  52   EVQKALHVPPEFAPSKWDICSDTVSEHWIDSPPSVLNIYHELIAAGLRIWVFSGDADAVV  111

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TRYSI+AL L   SPW  WY +GQV GWTQ+Y GL FV VRGAGHEV LH PK +L
Sbjct  112  PVTATRYSIEALNLRPLSPWYSWYMDGQVAGWTQQYAGLNFVTVRGAGHEVPLHRPKQSL  171

Query  136  TXVESFLAGTSMPGXQR  86
               ++F++G  +P  ++
Sbjct  172  ELFKAFVSGNPLPTSEK  188



>ref|XP_002315292.2| serine carboxypeptidase S10 family protein [Populus trichocarpa]
 gb|EEF01463.2| serine carboxypeptidase S10 family protein [Populus trichocarpa]
Length=460

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/134 (62%), Positives = 97/134 (72%), Gaps = 0/134 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALH + T     W TCS+ V D+W D P ++L +Y+ LI AGLRI V+SGDTDAV+
Sbjct  324  EVQKALHANVTGIPYPWETCSNIVGDYWADSPLSMLPIYKELIAAGLRIWVYSGDTDAVV  383

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TRYSIDALKLPT   W PWYD+G+VGGW+Q Y GLTFV V GAGHEV L  P+ A 
Sbjct  384  PVTATRYSIDALKLPTIINWYPWYDSGKVGGWSQVYTGLTFVTVTGAGHEVPLRRPRQAF  443

Query  136  TXVESFLAGTSMPG  95
                SFL   SMPG
Sbjct  444  ILFMSFLGNKSMPG  457



>ref|XP_008805039.1| PREDICTED: serine carboxypeptidase-like 27 [Phoenix dactylifera]
Length=461

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 97/133 (73%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQ+ALH + T     W TCSD V ++W D P ++L +YQ LI AG+RI VFSGDTDAV+
Sbjct  328  EVQRALHANVTGIHYAWDTCSDIVGNYWADSPRSMLPIYQELIAAGVRIWVFSGDTDAVV  387

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TRYSIDALKLPT   W PWYD+G+VGGW+Q Y+GLTFV + GAGHEV LH P+ AL
Sbjct  388  PVTATRYSIDALKLPTLLRWYPWYDHGKVGGWSQVYKGLTFVTITGAGHEVPLHRPRQAL  447

Query  136  TXVESFLAGTSMP  98
                 FL    MP
Sbjct  448  ILFRHFLQNKPMP  460



>gb|KFK29659.1| hypothetical protein AALP_AA7G162000 [Arabis alpina]
Length=478

 Score =   172 bits (435),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 99/132 (75%), Gaps = 0/132 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EV+ ALHV +  +S +W TCSD V + WKDC  +VL++Y  LI AGLRI VFSGD DAV+
Sbjct  327  EVKTALHVPSRLASAKWDTCSDVVNEHWKDCSSSVLNIYHELIAAGLRIWVFSGDADAVV  386

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVTSTRYSIDAL L   S + PWY +GQVGGWTQ+Y GL FV VRGAGHEV LH PK AL
Sbjct  387  PVTSTRYSIDALNLRPLSTYGPWYMDGQVGGWTQQYAGLNFVTVRGAGHEVPLHRPKEAL  446

Query  136  TXVESFLAGTSM  101
               ++F++GT +
Sbjct  447  ALFKAFISGTQL  458



>emb|CDX68696.1| BnaC01g07570D [Brassica napus]
Length=504

 Score =   172 bits (436),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 100/132 (76%), Gaps = 0/132 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            +VQKALHV    +  +W TCS  V + WKD P +VLD+Y  LI AGLRI VFSGD DA++
Sbjct  368  KVQKALHVPPQVAPSKWDTCSKVVGEHWKDSPSSVLDIYHELIAAGLRIWVFSGDADAIV  427

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVTSTRYSI+AL L T SP+ PWY +GQVGGW+Q+Y GL FV VRG+GHEVALH PK AL
Sbjct  428  PVTSTRYSINALNLSTLSPYGPWYIDGQVGGWSQQYAGLNFVIVRGSGHEVALHRPKEAL  487

Query  136  TXVESFLAGTSM  101
               ++F++GT +
Sbjct  488  ALFKAFISGTPL  499



>ref|XP_004496292.1| PREDICTED: serine carboxypeptidase-like 27-like isoform X1 [Cicer 
arietinum]
Length=462

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 98/133 (74%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALH + T  S  W TCSD V ++W D P ++L +YQ LI A LRI V+SGDTDAV+
Sbjct  326  EVQKALHANVTGISYPWKTCSDIVGNYWTDSPLSMLPIYQELINASLRIWVYSGDTDAVV  385

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            P+T+TR+SIDALKLPT   W PWYD+G+VGGW+Q Y+GLTFV VRGAGHEV LH P+ + 
Sbjct  386  PLTATRHSIDALKLPTIINWYPWYDSGKVGGWSQVYKGLTFVTVRGAGHEVPLHRPRESF  445

Query  136  TXVESFLAGTSMP  98
                SFL    MP
Sbjct  446  ILFRSFLENKYMP  458



>ref|NP_001044713.1| Os01g0833500 [Oryza sativa Japonica Group]
 dbj|BAD73778.1| putative serine carboxypeptidase II [Oryza sativa Japonica Group]
 dbj|BAF06627.1| Os01g0833500 [Oryza sativa Japonica Group]
 gb|EAZ14049.1| hypothetical protein OsJ_03974 [Oryza sativa Japonica Group]
 dbj|BAG93392.1| unnamed protein product [Oryza sativa Japonica Group]
Length=454

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 96/133 (72%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQ A+H +TT     W TCSD V  +W D P ++L +YQ LI AG+RI VFSGDTDAV+
Sbjct  320  EVQIAMHANTTGIQYSWKTCSDIVGSYWADSPKSMLPIYQELIAAGIRIWVFSGDTDAVV  379

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TRYSIDALKLPT   W PWYD+G+VGGW+Q Y+GLT V + GAGHEV LH P+ AL
Sbjct  380  PVTATRYSIDALKLPTMVNWYPWYDHGKVGGWSQVYKGLTLVTIAGAGHEVPLHRPREAL  439

Query  136  TXVESFLAGTSMP  98
                 FL  T MP
Sbjct  440  ILFRHFLQNTPMP  452



>gb|EAY76388.1| hypothetical protein OsI_04319 [Oryza sativa Indica Group]
Length=454

 Score =   171 bits (432),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 96/133 (72%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQ A+H +TT     W TCSD V  +W D P ++L +YQ LI AG+RI VFSGDTDAV+
Sbjct  320  EVQIAMHANTTGIQYSWKTCSDIVGSYWADSPKSMLPIYQELIAAGIRIWVFSGDTDAVV  379

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TRYSIDALKLPT   W PWYD+G+VGGW+Q Y+GLT V + GAGHEV LH P+ AL
Sbjct  380  PVTATRYSIDALKLPTLVNWYPWYDHGKVGGWSQVYKGLTLVTIAGAGHEVPLHRPREAL  439

Query  136  TXVESFLAGTSMP  98
                 FL  T MP
Sbjct  440  ILFRHFLQNTPMP  452



>ref|XP_010908844.1| PREDICTED: serine carboxypeptidase-like 27 [Elaeis guineensis]
Length=462

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 97/133 (73%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQ+ALH + T     W TCSD V ++W D P ++L +YQ LI AG+RI VFSGDTDAV+
Sbjct  329  EVQRALHANVTGIRYAWDTCSDIVGNYWADSPRSMLPIYQELIAAGVRIWVFSGDTDAVV  388

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TRYSIDAL+LPT   W PWYD+G+VGGW+Q Y+GLTFV + GAGHEV LH P+ AL
Sbjct  389  PVTATRYSIDALELPTLRRWYPWYDHGKVGGWSQVYKGLTFVTITGAGHEVPLHRPRQAL  448

Query  136  TXVESFLAGTSMP  98
                 FL    MP
Sbjct  449  ILFRHFLQNKPMP  461



>ref|XP_002457308.1| hypothetical protein SORBIDRAFT_03g005370 [Sorghum bicolor]
 gb|EES02428.1| hypothetical protein SORBIDRAFT_03g005370 [Sorghum bicolor]
Length=467

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/133 (59%), Positives = 98/133 (74%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQ+A H + T     W+ CSD VY++W+D P ++L +Y+ LI+AGLRI VFSGDTD+V+
Sbjct  326  EVQEAFHANVTGIPYAWIGCSDPVYEYWQDSPRSMLPIYRELISAGLRIWVFSGDTDSVV  385

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            P+T+TRYSIDAL LPT + W PWY + +VGGW Q YEGLT V VRGAGHEV LH P+  L
Sbjct  386  PLTATRYSIDALSLPTITKWYPWYYDEEVGGWCQVYEGLTLVTVRGAGHEVPLHRPRQGL  445

Query  136  TXVESFLAGTSMP  98
              +E FL G  MP
Sbjct  446  KLLEHFLQGEPMP  458



>emb|CAN70886.1| hypothetical protein VITISV_009829 [Vitis vinifera]
Length=379

 Score =   169 bits (428),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 91/114 (80%), Gaps = 0/114 (0%)
 Frame = -3

Query  415  WKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVIPVTSTRYSIDALKLPTXSPWRPWYDNG  236
            WKD P +VLDVY+ LI A LRI +FSGDTDAVIPVTSTRYSIDALKLPT SPWR WYD+G
Sbjct  266  WKDSPRSVLDVYRELIHARLRIWIFSGDTDAVIPVTSTRYSIDALKLPTVSPWRAWYDDG  325

Query  235  QVGGWTQEYEGLTFVAVRGAGHEVALHXPKLALTXVESFLAGTSMPGXQRIXDS  74
            QVGGWTQ+Y GLTFV VRGAGHEV LH PK A T  ++FL+G  MP  ++   S
Sbjct  326  QVGGWTQDYAGLTFVTVRGAGHEVPLHKPKQAFTLFKAFLSGAPMPYMEQXSXS  379



>emb|CDY28216.1| BnaA01g06330D [Brassica napus]
Length=481

 Score =   171 bits (433),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 98/132 (74%), Gaps = 0/132 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQ+ALHV    +  +W TC+  V + W DC  +VLD+Y  LI AG+RI VFSGD DAV+
Sbjct  331  EVQRALHVPPEVAPSKWDTCNYVVNENWNDCASSVLDIYHELIAAGIRIWVFSGDADAVV  390

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVTSTRYSIDAL L T SP+ PWY +GQVGGWTQ+Y GL FV VRGAGHEV LH PK AL
Sbjct  391  PVTSTRYSIDALNLSTTSPYGPWYIDGQVGGWTQQYAGLNFVTVRGAGHEVPLHRPKEAL  450

Query  136  TXVESFLAGTSM  101
               ++F++GT +
Sbjct  451  ALFKAFISGTPL  462



>gb|KDO48447.1| hypothetical protein CISIN_1g012819mg [Citrus sinensis]
Length=456

 Score =   171 bits (432),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 96/133 (72%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALH + T  S  W TCS+ V D W D P ++L +Y+ LI AGL+I VFSGDTDAV+
Sbjct  323  EVQKALHANVTGISYPWRTCSEIVGDNWTDSPLSMLPIYKELIAAGLKIWVFSGDTDAVV  382

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TRYSIDALKLPT   W PWYDN +VGGW+Q Y+GLTFV V GAGHEV LH P+ A 
Sbjct  383  PVTATRYSIDALKLPTVINWYPWYDNRKVGGWSQVYKGLTFVTVTGAGHEVPLHRPRQAF  442

Query  136  TXVESFLAGTSMP  98
                SFL    MP
Sbjct  443  ILFRSFLENKPMP  455



>gb|AFK43035.1| unknown [Medicago truncatula]
Length=459

 Score =   170 bits (431),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 96/133 (72%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALH + T     W TCSD V ++W D P ++L +Y  LI AGLRI VFSGDTD+V+
Sbjct  324  EVQKALHANVTGIPYIWKTCSDIVGNYWTDSPLSMLPIYHELINAGLRIWVFSGDTDSVV  383

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            P+T+TRYSIDALKLPT   W PWYD+G+VGGW+Q Y+GLT V +RGAGHEV LH P+ A 
Sbjct  384  PLTATRYSIDALKLPTIINWYPWYDSGKVGGWSQVYKGLTLVTIRGAGHEVPLHKPREAF  443

Query  136  TXVESFLAGTSMP  98
                SFL    MP
Sbjct  444  ILFRSFLENKDMP  456



>ref|XP_003591950.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AES62201.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=459

 Score =   170 bits (431),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 96/133 (72%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALH + T     W TCSD V ++W D P ++L +Y  LI AGLRI VFSGDTD+V+
Sbjct  324  EVQKALHANVTGIPYIWKTCSDIVGNYWTDSPLSMLPIYHELINAGLRIWVFSGDTDSVV  383

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            P+T+TRYSIDALKLPT   W PWYD+G+VGGW+Q Y+GLT V +RGAGHEV LH P+ A 
Sbjct  384  PLTATRYSIDALKLPTIINWYPWYDSGKVGGWSQVYKGLTLVTIRGAGHEVPLHKPREAF  443

Query  136  TXVESFLAGTSMP  98
                SFL    MP
Sbjct  444  ILFRSFLENKDMP  456



>emb|CDX68695.1| BnaC01g07580D [Brassica napus]
Length=481

 Score =   171 bits (432),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 98/132 (74%), Gaps = 0/132 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQ+ALHV    +  +W TC+  V + W DC  +VLD+Y  LI AG+RI VFSGD DAV+
Sbjct  331  EVQRALHVPPEVAPSKWDTCNYVVNENWNDCASSVLDIYHELIAAGIRIWVFSGDADAVV  390

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVTSTRYSIDAL L T SP+ PWY +GQVGGWTQ+Y GL FV VRGAGHEV LH PK AL
Sbjct  391  PVTSTRYSIDALNLSTTSPYGPWYIDGQVGGWTQQYAGLNFVTVRGAGHEVPLHRPKEAL  450

Query  136  TXVESFLAGTSM  101
               ++F++GT +
Sbjct  451  ALFKAFISGTPL  462



>dbj|BAH20278.1| AT4G30810 [Arabidopsis thaliana]
Length=373

 Score =   168 bits (426),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 97/132 (73%), Gaps = 0/132 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALHV    +  +W TCSD V + W D P +VL++Y  LI AGLRI VFSGD DAV+
Sbjct  224  EVQKALHVPPGLAPSKWDTCSDVVSEHWNDSPSSVLNIYHELIAAGLRIWVFSGDADAVV  283

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVTSTRYSIDAL L   S + PWY +GQVGGW+Q+Y GL FV VRGAGHEV LH PK AL
Sbjct  284  PVTSTRYSIDALNLRPLSAYGPWYLDGQVGGWSQQYAGLNFVTVRGAGHEVPLHRPKQAL  343

Query  136  TXVESFLAGTSM  101
               ++F++GT +
Sbjct  344  ALFKAFISGTPL  355



>ref|XP_006850617.1| hypothetical protein AMTR_s00034p00161680 [Amborella trichopoda]
 gb|ERN12198.1| hypothetical protein AMTR_s00034p00161680 [Amborella trichopoda]
Length=461

 Score =   170 bits (431),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 96/132 (73%), Gaps = 0/132 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALH + T     W TCSD V + W+D P ++L +YQ LI AG RI VFSGDTD+V+
Sbjct  327  EVQKALHANVTGIPYPWATCSDVVGNNWQDSPKSMLPIYQELIAAGFRIWVFSGDTDSVV  386

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TRYS+DALKLPT + W PWYDNG+VGGW+Q Y GLTFV + GAGHEV LH P+ A 
Sbjct  387  PVTATRYSLDALKLPTLTNWYPWYDNGKVGGWSQVYRGLTFVTITGAGHEVPLHRPRQAF  446

Query  136  TXVESFLAGTSM  101
               +SFL    +
Sbjct  447  ILFKSFLQNMPL  458



>ref|XP_003560871.1| PREDICTED: serine carboxypeptidase 2-like [Brachypodium distachyon]
Length=482

 Score =   171 bits (432),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 98/135 (73%), Gaps = 1/135 (1%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALH + T  +  W  CSD +   W D P ++L +Y+ +I AGLRI VFSGDTD+V+
Sbjct  340  EVQKALHANVTGINYAWAACSDTINGNWSDSPRSMLSIYKEIIQAGLRIWVFSGDTDSVV  399

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQ-VGGWTQEYEGLTFVAVRGAGHEVALHXPKLA  140
            P T+TRYSIDAL LPT + W PWYD+ Q VGGW+Q YEGLT V VRGAGHEVALH P+ A
Sbjct  400  PSTATRYSIDALVLPTTTDWYPWYDDNQEVGGWSQVYEGLTLVTVRGAGHEVALHRPRQA  459

Query  139  LTXVESFLAGTSMPG  95
            L   ++FL G  MPG
Sbjct  460  LILFQNFLQGKPMPG  474



>ref|XP_003564543.1| PREDICTED: serine carboxypeptidase-like 27 [Brachypodium distachyon]
Length=451

 Score =   170 bits (430),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 95/133 (71%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQ ALH +TT     W TCSD V  +W D P ++L +YQ LI AG+RI VFSGDTDAV+
Sbjct  317  EVQMALHANTTGIQYPWKTCSDIVGSYWADSPKSMLPIYQELIAAGIRIWVFSGDTDAVV  376

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TRYSI ALKLPT   W PWYD+G+VGGW+Q Y+GLT V V GAGHEV LH P+ AL
Sbjct  377  PVTATRYSIKALKLPTLMNWYPWYDHGKVGGWSQVYKGLTLVTVTGAGHEVPLHRPRQAL  436

Query  136  TXVESFLAGTSMP  98
                 FL  T MP
Sbjct  437  ILFRHFLKDTPMP  449



>ref|XP_009127511.1| PREDICTED: serine carboxypeptidase-like 29 [Brassica rapa]
Length=481

 Score =   170 bits (431),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 98/132 (74%), Gaps = 0/132 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQ+ALHV    +  +W TC+  V + W DC  +VLD+Y  LI AG+RI VFSGD DAV+
Sbjct  331  EVQRALHVPPEVAPSKWDTCNYVVNENWNDCASSVLDIYHELIAAGIRIWVFSGDADAVV  390

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVTSTRYSIDAL L + SP+ PWY +GQVGGWTQ+Y GL FV VRGAGHEV LH PK AL
Sbjct  391  PVTSTRYSIDALNLSSTSPYGPWYTDGQVGGWTQQYAGLNFVTVRGAGHEVPLHRPKEAL  450

Query  136  TXVESFLAGTSM  101
               ++F++GT +
Sbjct  451  ALFKAFISGTPL  462



>ref|XP_004236634.1| PREDICTED: serine carboxypeptidase-like 27 [Solanum lycopersicum]
Length=456

 Score =   170 bits (430),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 95/133 (71%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKA H + T  +  W TCSD V D+W D P ++L +Y  LI AGLRI VFSGDTD+V+
Sbjct  323  EVQKAFHANVTKIAYPWKTCSDIVGDYWDDSPLSMLPIYHELIAAGLRIWVFSGDTDSVV  382

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            P+T+TRYSIDALKLPT + W PWYDN +VGGW+Q Y+GLT V + GAGHEV LH P+ A 
Sbjct  383  PLTATRYSIDALKLPTITNWYPWYDNKKVGGWSQIYKGLTLVTITGAGHEVPLHRPRQAF  442

Query  136  TXVESFLAGTSMP  98
                SFL    MP
Sbjct  443  ILFRSFLENKPMP  455



>ref|XP_003591947.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AES62198.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=458

 Score =   170 bits (430),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 95/133 (71%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALH + T  S  W  CS  V+D+W D P ++L +YQ LI A LRI V+SGDTDAVI
Sbjct  324  EVQKALHANVTGISYAWKACSGTVWDYWTDSPLSMLPIYQELINADLRIWVYSGDTDAVI  383

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            P+T+TRYSI ALKLPT   W PWYDNG+V GW+Q Y+GLT V VRGAGHEV LH P+ A 
Sbjct  384  PLTATRYSIGALKLPTIMNWYPWYDNGKVCGWSQVYKGLTLVTVRGAGHEVPLHRPREAF  443

Query  136  TXVESFLAGTSMP  98
                SFL   +MP
Sbjct  444  ILFRSFLENKNMP  456



>ref|XP_008381976.1| PREDICTED: serine carboxypeptidase-like 27 [Malus domestica]
Length=455

 Score =   170 bits (430),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 98/133 (74%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            +VQKALH + T  S  W TCSD V ++W D P ++L +Y+ LI AGL+I VFSGDTD+V+
Sbjct  322  DVQKALHANVTKVSYPWQTCSDXVGNYWADSPLSMLPIYKELIAAGLKIWVFSGDTDSVV  381

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TRYSIDALKLPT + W PW DNG+VGG +Q Y+GLTFV V GAGHEV LH P+LA 
Sbjct  382  PVTATRYSIDALKLPTITNWFPWNDNGKVGGRSQIYKGLTFVTVTGAGHEVPLHRPRLAF  441

Query  136  TXVESFLAGTSMP  98
                SFL    MP
Sbjct  442  ILFRSFLESKPMP  454



>ref|XP_004307401.1| PREDICTED: serine carboxypeptidase-like 27 [Fragaria vesca subsp. 
vesca]
 ref|XP_011469671.1| PREDICTED: serine carboxypeptidase-like 27 [Fragaria vesca subsp. 
vesca]
Length=458

 Score =   170 bits (430),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 98/133 (74%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALH + T  S  W TCSD V ++W D P ++L +YQ LI AGL+I V+SGDTDAV+
Sbjct  325  EVQKALHANVTGLSYPWKTCSDFVGNYWSDSPRSMLPIYQELIAAGLKIWVYSGDTDAVV  384

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TRYSIDALKLPT + W PW D+G+VGGW+Q Y+GLT V + GAGHEV LH P+ A 
Sbjct  385  PVTATRYSIDALKLPTINNWSPWSDSGKVGGWSQIYKGLTLVTITGAGHEVPLHRPREAF  444

Query  136  TXVESFLAGTSMP  98
               +SFL    MP
Sbjct  445  ILFKSFLENKPMP  457



>ref|XP_008446902.1| PREDICTED: serine carboxypeptidase-like 27 [Cucumis melo]
Length=457

 Score =   170 bits (430),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 98/133 (74%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            +VQKA H + T  +  W TCSD V ++W D P ++L +YQ LI +G+RI VFSGDTD+V+
Sbjct  324  DVQKAFHANVTGITYPWSTCSDLVGNYWADSPLSMLPIYQELIVSGIRIWVFSGDTDSVV  383

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TRYSIDALKLPT S W PWYD+G+VGGW+Q Y+GLTFV V GAGHEV LH P+ A 
Sbjct  384  PVTATRYSIDALKLPTISNWYPWYDHGKVGGWSQIYKGLTFVTVAGAGHEVPLHRPREAF  443

Query  136  TXVESFLAGTSMP  98
                SFL    +P
Sbjct  444  ILFRSFLEDKPLP  456



>emb|CDO99730.1| unnamed protein product [Coffea canephora]
Length=461

 Score =   169 bits (429),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 96/133 (72%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQ+A H +TT     W TCSD V  +W D P +VL +YQ L+ AGL+I VFSGDTD+V+
Sbjct  327  EVQEAFHANTTGIPYPWKTCSDTVGIYWTDAPLSVLPIYQGLMAAGLKIWVFSGDTDSVV  386

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            P+T+TRYSIDALKLPT + W PWYDN +VGGW+Q Y+GL FV V GAGHEV LH P+LA 
Sbjct  387  PITATRYSIDALKLPTITNWYPWYDNKRVGGWSQVYKGLIFVTVTGAGHEVPLHRPRLAY  446

Query  136  TXVESFLAGTSMP  98
                SFL    MP
Sbjct  447  ILFRSFLENEPMP  459



>ref|XP_006410747.1| hypothetical protein EUTSA_v10016650mg [Eutrema salsugineum]
 gb|ESQ52200.1| hypothetical protein EUTSA_v10016650mg [Eutrema salsugineum]
Length=449

 Score =   169 bits (428),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 96/132 (73%), Gaps = 0/132 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKA+H +TT  + +W TCSD V + W D P ++L +Y+ LI AG+RI VFSGDTD+V+
Sbjct  318  EVQKAMHANTTGLAYQWKTCSDIVGEKWSDSPLSMLPIYKELIAAGIRIWVFSGDTDSVV  377

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT TRYSI ALKLP  S W PWYDNGQVGGW+Q Y+GLT V + GAGHEV LH P+   
Sbjct  378  PVTGTRYSIRALKLPPVSKWYPWYDNGQVGGWSQVYKGLTLVTIHGAGHEVPLHRPRRGF  437

Query  136  TXVESFLAGTSM  101
               +SFLA   M
Sbjct  438  LLFKSFLANKPM  449



>dbj|BAO04184.1| hypothetical protein [Delphinium grandiflorum]
Length=456

 Score =   169 bits (428),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 97/133 (73%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALH + T     W TC+D + D WKD P ++L +Y+ LI AG+RI VFSGDTD+V+
Sbjct  323  EVQKALHANVTGIPYPWATCNDIIGDNWKDSPRSMLPIYRELIAAGIRIWVFSGDTDSVV  382

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TRYS+D L+LPT   W PWYDNGQ+GGW++ Y+GL+ + VRGAGHEV LH P+ A 
Sbjct  383  PVTATRYSLDTLELPTLVKWHPWYDNGQMGGWSEVYDGLSLIVVRGAGHEVPLHAPRKAY  442

Query  136  TXVESFLAGTSMP  98
               +SFL    MP
Sbjct  443  IMFKSFLENKPMP  455



>tpg|DAA53384.1| TPA: serine carboxypeptidase K10B2.2 [Zea mays]
Length=474

 Score =   169 bits (428),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 95/133 (71%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQ A H + T     WV CSD +Y++WKD P ++L +Y+ LI+AGLRI VFSGDTD+V+
Sbjct  333  EVQDAFHANVTGIPYAWVGCSDPIYEYWKDSPRSMLPIYRELISAGLRIWVFSGDTDSVV  392

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            P+T+TRYSIDAL LPT + W PWY + +VGGW Q YEGLT V VRGAGHEV LH P   L
Sbjct  393  PLTATRYSIDALSLPTITKWYPWYYDEEVGGWCQVYEGLTLVTVRGAGHEVPLHRPPQGL  452

Query  136  TXVESFLAGTSMP  98
               E FL G  MP
Sbjct  453  KLFEHFLRGEPMP  465



>ref|XP_004968264.1| PREDICTED: serine carboxypeptidase-like 27-like [Setaria italica]
Length=463

 Score =   169 bits (428),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 92/133 (69%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALH + T     WV CSD +Y +WKD P ++L +Y+ LI AG RI VFSGD DAV+
Sbjct  322  EVQKALHANVTGIPYAWVACSDPIYKYWKDSPRSMLPIYRELIAAGKRIWVFSGDADAVV  381

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            P+  TRYSIDAL LPT S W  WYD G+VGGW Q Y+GLT V +RGAGHEV LH P+L L
Sbjct  382  PLPGTRYSIDALFLPTISNWYAWYDQGEVGGWCQVYKGLTLVTIRGAGHEVPLHRPRLGL  441

Query  136  TXVESFLAGTSMP  98
               E FL    MP
Sbjct  442  KLFEHFLRDEPMP  454



>ref|XP_010525795.1| PREDICTED: serine carboxypeptidase-like 29, partial [Tarenaya 
hassleriana]
Length=277

 Score =   164 bits (416),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/137 (57%), Positives = 97/137 (71%), Gaps = 0/137 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALHV    +  +W  CSD V + W D P +VL++Y  LI AGLRI VFSGD DAV+
Sbjct  122  EVQKALHVPPEFAPSKWDICSDTVSEHWIDSPPSVLNIYHELIAAGLRIWVFSGDADAVV  181

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TRYSI+AL L   SPW  WY +GQV GWTQ+Y GL FV VRGAGHEV LH PK +L
Sbjct  182  PVTATRYSIEALNLRPLSPWYSWYMDGQVAGWTQQYAGLNFVTVRGAGHEVPLHRPKQSL  241

Query  136  TXVESFLAGTSMPGXQR  86
               ++F++G  +P  ++
Sbjct  242  ELFKAFVSGNPLPTSEK  258



>ref|NP_001150676.1| serine carboxypeptidase K10B2.2 precursor [Zea mays]
 gb|ACG39970.1| serine carboxypeptidase K10B2.2 precursor [Zea mays]
Length=484

 Score =   169 bits (429),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 95/133 (71%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQ A H + T     WV CSD +Y++WKD P ++L +Y+ LI+AGLRI VFSGDTD+V+
Sbjct  343  EVQDAFHANVTGIPYAWVGCSDPIYEYWKDSPRSMLPIYRELISAGLRIWVFSGDTDSVV  402

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            P+T+TRYSIDAL LPT + W PWY + +VGGW Q YEGLT V VRGAGHEV LH P   L
Sbjct  403  PLTATRYSIDALSLPTITKWYPWYYDEEVGGWCQVYEGLTLVTVRGAGHEVPLHRPPQGL  462

Query  136  TXVESFLAGTSMP  98
               E FL G  MP
Sbjct  463  KLFEHFLRGEPMP  475



>gb|AAV43957.1| putative serine carboxypeptidase II [Oryza sativa Japonica Group]
Length=483

 Score =   169 bits (428),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 96/133 (72%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQ+ALH + T  +  W TCSD + D W+D P +VL +Y  LI AGLRI VFSGDTDAV+
Sbjct  341  EVQRALHANVTGINYTWATCSDILNDNWRDSPRSVLPIYHELIAAGLRIWVFSGDTDAVV  400

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            P+T+TRYSIDAL LPT   W PWYD  +VGGW+Q Y+GL+ V VRGAGHEV LH P+ AL
Sbjct  401  PLTATRYSIDALGLPTTVSWYPWYDAMKVGGWSQVYKGLSLVTVRGAGHEVPLHRPRQAL  460

Query  136  TXVESFLAGTSMP  98
               + FL G  MP
Sbjct  461  ILFKHFLQGKPMP  473



>emb|CDY35977.1| BnaA05g29730D [Brassica napus]
Length=459

 Score =   169 bits (427),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 97/133 (73%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALH + T  S  W +CSD V ++W D P ++L +Y+ LI AGL+I VFSGDTDAV+
Sbjct  325  EVQKALHANVTRLSYSWKSCSDIVGNYWTDSPVSMLPIYRELIAAGLKIWVFSGDTDAVV  384

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            P+T+TRYSIDALKL T + W PWYD+G+VGGW+Q Y+GLT V V GAGHEV LH P+ A 
Sbjct  385  PITATRYSIDALKLATITNWYPWYDHGKVGGWSQVYKGLTLVTVTGAGHEVPLHRPRQAF  444

Query  136  TXVESFLAGTSMP  98
                SFL    MP
Sbjct  445  IIFRSFLENKPMP  457



>ref|XP_004970465.1| PREDICTED: serine carboxypeptidase-like 27-like [Setaria italica]
Length=457

 Score =   169 bits (427),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 95/133 (71%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQ ALH +TT     W TCSD V  +W D P ++L +YQ LI AG++I VFSGDTDAV+
Sbjct  323  EVQMALHANTTGIHYPWQTCSDIVGTYWADSPRSMLPIYQELIAAGMKIWVFSGDTDAVV  382

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TRYSIDALKLPT   W PWYD+G+VGGW+Q Y+GLT V + GAGHEV LH P+ AL
Sbjct  383  PVTATRYSIDALKLPTLVNWYPWYDHGKVGGWSQVYKGLTLVTIAGAGHEVPLHRPRQAL  442

Query  136  TXVESFLAGTSMP  98
                 FL    MP
Sbjct  443  IMFRHFLKNKPMP  455



>ref|XP_006436271.1| hypothetical protein CICLE_v10031497mg [Citrus clementina]
 ref|XP_006485878.1| PREDICTED: serine carboxypeptidase-like 27-like [Citrus sinensis]
 gb|ESR49511.1| hypothetical protein CICLE_v10031497mg [Citrus clementina]
Length=456

 Score =   169 bits (427),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 96/133 (72%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALH + T  S  W TCS+ V D W D P ++L +Y+ LI AGL+I VFSGDTDAV+
Sbjct  323  EVQKALHANVTWISYPWRTCSEIVGDNWTDSPLSMLPIYKELIAAGLKIWVFSGDTDAVV  382

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TRYSIDALKLPT   W PWYDN +VGGW+Q Y+GLTFV V GAGHEV LH P+ A 
Sbjct  383  PVTATRYSIDALKLPTVINWYPWYDNRKVGGWSQVYKGLTFVTVTGAGHEVPLHRPRQAF  442

Query  136  TXVESFLAGTSMP  98
                SFL    MP
Sbjct  443  ILFRSFLENKPMP  455



>ref|XP_006644961.1| PREDICTED: serine carboxypeptidase-like 27-like [Oryza brachyantha]
Length=455

 Score =   169 bits (427),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 95/133 (71%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQ A+H +TT     W TCSD V  +W D P ++L +YQ LI AG+RI VFSGDTDAV+
Sbjct  321  EVQIAMHANTTGIQYPWKTCSDIVGSYWADSPKSMLPIYQELIAAGIRIWVFSGDTDAVV  380

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TRYSIDALKLPT   W PWYD+G+VGGW+Q Y+GLT V V GAGHEV LH P+ AL
Sbjct  381  PVTATRYSIDALKLPTLVNWYPWYDHGKVGGWSQVYKGLTLVTVTGAGHEVPLHRPREAL  440

Query  136  TXVESFLAGTSMP  98
                 FL    MP
Sbjct  441  ILFRHFLQNIPMP  453



>ref|XP_006645520.1| PREDICTED: serine carboxypeptidase II-1-like [Oryza brachyantha]
Length=412

 Score =   167 bits (424),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 95/133 (71%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKA H + T     W TCSD+++ +WKD P ++L +Y+ LI AGLRI VFSGD D+V+
Sbjct  271  EVQKAFHANVTGIPYAWTTCSDDLFYYWKDSPRSMLPIYRELIAAGLRIWVFSGDADSVV  330

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            P+T+TRYSIDAL LPT + W PWYD+ +V GW Q Y+GLT V +RGAGHEV LH P+ AL
Sbjct  331  PLTATRYSIDALHLPTVTNWYPWYDDDEVAGWCQVYQGLTLVTIRGAGHEVPLHRPRQAL  390

Query  136  TXVESFLAGTSMP  98
               E FL    MP
Sbjct  391  KLFEHFLQDNPMP  403



>ref|XP_006407773.1| hypothetical protein EUTSA_v10020705mg [Eutrema salsugineum]
 gb|ESQ49226.1| hypothetical protein EUTSA_v10020705mg [Eutrema salsugineum]
Length=456

 Score =   169 bits (427),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 97/133 (73%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALH + T     W +CSD V  +W+D P ++L +Y+ LITAGL+I VFSGDTDAV+
Sbjct  322  EVQKALHANVTRLPYPWKSCSDIVGSYWRDSPVSMLPIYRELITAGLKIWVFSGDTDAVV  381

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TRYSIDALKL T + W PWYD+G+VGGW+Q Y+GLT V V GAGHEV LH P+ A 
Sbjct  382  PVTATRYSIDALKLATITNWYPWYDHGKVGGWSQVYKGLTLVTVAGAGHEVPLHRPRQAF  441

Query  136  TXVESFLAGTSMP  98
                SFL    MP
Sbjct  442  ILFRSFLESKPMP  454



>emb|CDY23258.1| BnaA08g12880D [Brassica napus]
Length=478

 Score =   169 bits (427),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 98/132 (74%), Gaps = 0/132 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQ+ALHV    +  +W TCSD V + WKD   +VL++Y  LI AGLRI VFSGD DAV+
Sbjct  329  EVQEALHVPPGLAPSKWDTCSDVVNEHWKDSSSSVLNIYHELIAAGLRIWVFSGDADAVV  388

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TRYSIDAL L   SP+ PWY +GQVGGWTQ+Y GL FV VRGAGHEV LH PK AL
Sbjct  389  PVTATRYSIDALNLRPLSPYGPWYIDGQVGGWTQQYAGLNFVTVRGAGHEVPLHRPKEAL  448

Query  136  TXVESFLAGTSM  101
               ++F++GT +
Sbjct  449  ALFKAFISGTQL  460



>ref|XP_009147010.1| PREDICTED: serine carboxypeptidase-like 27 isoform X2 [Brassica 
rapa]
Length=450

 Score =   168 bits (426),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 97/133 (73%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALH + T  S  W +CSD V ++W D P ++L +Y+ LI AGL+I VFSGDTDAV+
Sbjct  316  EVQKALHANVTRLSYPWKSCSDIVGNYWTDSPVSMLPIYRELIAAGLKIWVFSGDTDAVV  375

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            P+T+TRYSIDALKL T + W PWYD+G+VGGW+Q Y+GLT V V GAGHEV LH P+ A 
Sbjct  376  PITATRYSIDALKLATITNWYPWYDHGKVGGWSQVYKGLTLVTVTGAGHEVPLHRPRQAF  435

Query  136  TXVESFLAGTSMP  98
                SFL    MP
Sbjct  436  IIFRSFLENKPMP  448



>ref|XP_004142401.1| PREDICTED: serine carboxypeptidase-like 27-like [Cucumis sativus]
 ref|XP_004157517.1| PREDICTED: serine carboxypeptidase-like 27-like [Cucumis sativus]
 gb|KGN52285.1| hypothetical protein Csa_5G623490 [Cucumis sativus]
Length=455

 Score =   168 bits (426),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/133 (59%), Positives = 98/133 (74%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            +VQ+A H + T  +  W TCSD V ++W D P ++L +YQ LI +G+RI VFSGDTD+V+
Sbjct  322  DVQEAFHANVTGITYPWSTCSDLVGNYWADSPLSMLPIYQELIGSGIRIWVFSGDTDSVV  381

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TRYSIDALKLPT S W PWYD+G+VGGW+Q Y+GLTFV V GAGHEV LH P+ A 
Sbjct  382  PVTATRYSIDALKLPTLSNWYPWYDHGKVGGWSQIYKGLTFVTVAGAGHEVPLHRPREAF  441

Query  136  TXVESFLAGTSMP  98
                SFL    +P
Sbjct  442  ILFRSFLENKPLP  454



>ref|XP_008673013.1| PREDICTED: LOC100285510 isoform X1 [Zea mays]
 gb|ACR34277.1| unknown [Zea mays]
 tpg|DAA56985.1| TPA: virulence protein Nf314 [Zea mays]
Length=467

 Score =   168 bits (426),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 95/133 (71%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQ ALH +TT     W TCSD V  +W D P ++L +YQ LI AG++I VFSGDTDAV+
Sbjct  333  EVQMALHANTTGIHYPWQTCSDIVGSYWADSPRSMLPIYQELIAAGIKIWVFSGDTDAVV  392

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TRYSIDALKLPT   W PWYD+G+VGGW+Q Y+GLT + + GAGHEV LH P+ AL
Sbjct  393  PVTATRYSIDALKLPTLVNWYPWYDHGKVGGWSQVYKGLTLITIAGAGHEVPLHRPRQAL  452

Query  136  TXVESFLAGTSMP  98
                 FL    MP
Sbjct  453  IMFRHFLQNKPMP  465



>ref|XP_009333715.1| PREDICTED: serine carboxypeptidase-like 27 [Pyrus x bretschneideri]
Length=455

 Score =   168 bits (426),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 97/133 (73%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            +VQKALH + T  S  W TCSD V ++W D P ++L +Y+ LI AGL+I VFSGDTD+V+
Sbjct  322  DVQKALHANVTKVSYPWQTCSDIVGNYWADSPLSMLPIYKELIAAGLKIWVFSGDTDSVV  381

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TRYSIDALKLPT + W PW DNG+VGG  Q Y+GLTFV V GAGHEV LH P+LA 
Sbjct  382  PVTATRYSIDALKLPTITNWFPWNDNGKVGGRCQIYKGLTFVTVTGAGHEVPLHRPRLAF  441

Query  136  TXVESFLAGTSMP  98
                SFL    MP
Sbjct  442  ILFRSFLESKPMP  454



>ref|NP_001151874.1| LOC100285510 precursor [Zea mays]
 gb|ACG44727.1| virulence-related protein Nf314 [Zea mays]
Length=467

 Score =   168 bits (426),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 95/133 (71%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQ ALH +TT     W TCSD V  +W D P ++L +YQ LI AG++I VFSGDTDAV+
Sbjct  333  EVQMALHANTTGIHYPWQTCSDIVGSYWADSPRSMLPIYQELIAAGIKIWVFSGDTDAVV  392

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TRYSIDALKLPT   W PWYD+G+VGGW+Q Y+GLT + + GAGHEV LH P+ AL
Sbjct  393  PVTATRYSIDALKLPTLVNWYPWYDHGKVGGWSQVYKGLTLITIAGAGHEVPLHRPRQAL  452

Query  136  TXVESFLAGTSMP  98
                 FL    MP
Sbjct  453  IMFRHFLQNKPMP  465



>ref|NP_567854.1| serine carboxypeptidase-like 29 [Arabidopsis thaliana]
 sp|Q949Q7.1|SCP29_ARATH RecName: Full=Serine carboxypeptidase-like 29; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAK93635.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AAM91708.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AEE85811.1| serine carboxypeptidase-like 29 [Arabidopsis thaliana]
Length=479

 Score =   169 bits (427),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 97/132 (73%), Gaps = 0/132 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALHV    +  +W TCSD V + W D P +VL++Y  LI AGLRI VFSGD DAV+
Sbjct  330  EVQKALHVPPGLAPSKWDTCSDVVSEHWNDSPSSVLNIYHELIAAGLRIWVFSGDADAVV  389

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVTSTRYSIDAL L   S + PWY +GQVGGW+Q+Y GL FV VRGAGHEV LH PK AL
Sbjct  390  PVTSTRYSIDALNLRPLSAYGPWYLDGQVGGWSQQYAGLNFVTVRGAGHEVPLHRPKQAL  449

Query  136  TXVESFLAGTSM  101
               ++F++GT +
Sbjct  450  ALFKAFISGTPL  461



>ref|XP_009147009.1| PREDICTED: serine carboxypeptidase-like 27 isoform X1 [Brassica 
rapa]
Length=459

 Score =   168 bits (426),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 97/133 (73%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALH + T  S  W +CSD V ++W D P ++L +Y+ LI AGL+I VFSGDTDAV+
Sbjct  325  EVQKALHANVTRLSYPWKSCSDIVGNYWTDSPVSMLPIYRELIAAGLKIWVFSGDTDAVV  384

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            P+T+TRYSIDALKL T + W PWYD+G+VGGW+Q Y+GLT V V GAGHEV LH P+ A 
Sbjct  385  PITATRYSIDALKLATITNWYPWYDHGKVGGWSQVYKGLTLVTVTGAGHEVPLHRPRQAF  444

Query  136  TXVESFLAGTSMP  98
                SFL    MP
Sbjct  445  IIFRSFLENKPMP  457



>ref|XP_010486379.1| PREDICTED: serine carboxypeptidase-like 27 [Camelina sativa]
Length=459

 Score =   168 bits (426),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 97/133 (73%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALH + T     W  CSD V ++W+D P ++L +Y+ LITAGL+I VFSGDTDAV+
Sbjct  325  EVQKALHANVTRLPYPWKACSDIVGNYWEDSPLSMLPIYRELITAGLKIWVFSGDTDAVV  384

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            P+T+TRYSIDALKL T + W PWYD+G+VGGW+Q Y+GLT V V GAGHEV LH P+ A 
Sbjct  385  PITATRYSIDALKLATITNWYPWYDHGKVGGWSQVYKGLTLVTVAGAGHEVPLHRPRQAF  444

Query  136  TXVESFLAGTSMP  98
                SFL    MP
Sbjct  445  ILFRSFLENKPMP  457



>emb|CDY28004.1| BnaC05g44060D [Brassica napus]
Length=459

 Score =   168 bits (425),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 97/133 (73%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALH + T  S  W +CSD V ++W D P ++L +Y+ LI AGL+I VFSGDTDAV+
Sbjct  325  EVQKALHANVTRLSYPWKSCSDIVGNYWTDSPVSMLPIYRELIAAGLKIWVFSGDTDAVV  384

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            P+T+TRYSIDALKL T + W PWYD+G+VGGW+Q Y+GLT V V GAGHEV LH P+ A 
Sbjct  385  PITATRYSIDALKLATITNWYPWYDHGKVGGWSQVYKGLTLVTVTGAGHEVPLHRPRQAF  444

Query  136  TXVESFLAGTSMP  98
                SFL    MP
Sbjct  445  IIFRSFLENKPMP  457



>ref|XP_002274723.1| PREDICTED: serine carboxypeptidase-like 27 [Vitis vinifera]
 emb|CBI31485.3| unnamed protein product [Vitis vinifera]
Length=456

 Score =   168 bits (425),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 95/133 (71%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQ ALH + T  S  W TCS+ V  +W D P ++L +YQ LI AGLRI VFSGDTDAV+
Sbjct  323  EVQTALHANVTQVSYPWRTCSNIVGIYWADSPLSMLPIYQELIAAGLRIWVFSGDTDAVV  382

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TRYSIDALKLPT + W  WYDN +VGGW+Q Y+GLTFV V GAGHEV LH P+ A 
Sbjct  383  PVTATRYSIDALKLPTITNWYAWYDNHKVGGWSQVYKGLTFVTVTGAGHEVPLHRPRQAY  442

Query  136  TXVESFLAGTSMP  98
                SFL    MP
Sbjct  443  ILFRSFLENKPMP  455



>emb|CAN74854.1| hypothetical protein VITISV_028701 [Vitis vinifera]
Length=452

 Score =   168 bits (425),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 95/133 (71%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQ ALH + T  S  W TCS+ V  +W D P ++L +YQ LI AGLRI VFSGDTDAV+
Sbjct  319  EVQTALHANVTQVSYPWRTCSNIVGIYWADSPLSMLPIYQELIAAGLRIWVFSGDTDAVV  378

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TRYSIDALKLPT + W  WYDN +VGGW+Q Y+GLTFV V GAGHEV LH P+ A 
Sbjct  379  PVTATRYSIDALKLPTITNWYXWYDNHKVGGWSQVYKGLTFVTVTGAGHEVPLHRPRQAY  438

Query  136  TXVESFLAGTSMP  98
                SFL    MP
Sbjct  439  ILFRSFLENKPMP  451



>ref|XP_010464446.1| PREDICTED: serine carboxypeptidase-like 27 [Camelina sativa]
Length=459

 Score =   168 bits (425),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 97/133 (73%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALH + T     W  CSD V ++W+D P ++L +Y+ LITAGL+I VFSGDTDAV+
Sbjct  325  EVQKALHANVTRLPYPWKACSDIVGNYWEDSPLSMLPIYRELITAGLKIWVFSGDTDAVV  384

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            P+T+TRYSIDALKL T + W PWYD+G+VGGW+Q Y+GLT V V GAGHEV LH P+ A 
Sbjct  385  PITATRYSIDALKLTTITNWYPWYDHGKVGGWSQVYKGLTLVTVAGAGHEVPLHRPRQAF  444

Query  136  TXVESFLAGTSMP  98
                SFL    MP
Sbjct  445  ILFRSFLENKPMP  457



>ref|XP_002458719.1| hypothetical protein SORBIDRAFT_03g038940 [Sorghum bicolor]
 gb|EES03839.1| hypothetical protein SORBIDRAFT_03g038940 [Sorghum bicolor]
Length=467

 Score =   168 bits (425),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 95/133 (71%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQ A+H +TT     W TCSD V  +W D P ++L +YQ LI AG++I VFSGDTDAV+
Sbjct  333  EVQMAMHANTTGLHYPWQTCSDIVGSYWADSPRSMLPIYQELIAAGIKIWVFSGDTDAVV  392

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TRYSIDALKLPT   W PWYD+G+VGGW+Q Y+GLT V + GAGHEV LH P+ AL
Sbjct  393  PVTATRYSIDALKLPTVVNWYPWYDHGKVGGWSQVYKGLTLVTIAGAGHEVPLHRPRQAL  452

Query  136  TXVESFLAGTSMP  98
                 FL    MP
Sbjct  453  IMFRHFLQNKPMP  465



>dbj|BAJ99174.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=444

 Score =   167 bits (423),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 94/133 (71%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQ ALH +TT     W TCSD V  +W D P ++L +Y  LI AG+RI VFSGDTDAV+
Sbjct  310  EVQTALHANTTGIKYPWKTCSDIVGSYWADSPRSMLPIYHELIAAGIRIWVFSGDTDAVV  369

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            P+T+TRYSI ALKLPT   W PWYD+G+VGGW+Q Y+GLT V V GAGHEV LH P+ AL
Sbjct  370  PITATRYSISALKLPTLMNWYPWYDHGKVGGWSQVYKGLTLVTVAGAGHEVPLHRPRQAL  429

Query  136  TXVESFLAGTSMP  98
                 FL  T MP
Sbjct  430  ILFRHFLKDTPMP  442



>ref|XP_009410600.1| PREDICTED: serine carboxypeptidase-like 27 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=465

 Score =   167 bits (424),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 95/136 (70%), Gaps = 0/136 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQ+ALH + T     W TCSD V ++W D P ++L +YQ LI AGLRI +FSGDTDAV+
Sbjct  324  EVQRALHANVTGIQYPWDTCSDIVGNYWADSPRSMLPIYQELIAAGLRIWMFSGDTDAVV  383

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TRYSIDAL L T   W PWYD G+VGGW+Q Y+GLTFV + GAGHEV LH P+ A+
Sbjct  384  PVTATRYSIDALNLQTLISWYPWYDKGKVGGWSQVYKGLTFVTIMGAGHEVPLHHPRQAM  443

Query  136  TXVESFLAGTSMPGXQ  89
                 FL    MP  Q
Sbjct  444  ILFRQFLKNRPMPRCQ  459



>emb|CAI64396.1| serine carboxypeptidase II [Triticum aestivum]
Length=260

 Score =   162 bits (411),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 98/135 (73%), Gaps = 1/135 (1%)
 Frame = -3

Query  496  EVQKALHVHTTNS-SXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAV  320
            +VQ ALH + T + +  W TCSD +   W D P ++L +Y+ LI AGLRI VFSGDTDAV
Sbjct  118  DVQTALHANVTGAMNYTWSTCSDTINTHWHDAPRSMLPIYRELIAAGLRIWVFSGDTDAV  177

Query  319  IPVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLA  140
            +P+T+TRYSI AL LPT + W PWYD+ +VGGW+Q Y+GLT V+VRGAGHEV LH P+ A
Sbjct  178  VPLTATRYSIGALGLPTTTSWYPWYDDQEVGGWSQVYKGLTLVSVRGAGHEVPLHRPRQA  237

Query  139  LTXVESFLAGTSMPG  95
            L   + FL G  MPG
Sbjct  238  LVLFQYFLQGKPMPG  252



>gb|KFK38250.1| hypothetical protein AALP_AA3G088900 [Arabis alpina]
Length=461

 Score =   167 bits (423),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 96/133 (72%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALH + T     W +CSD V  +W D P ++L +Y+ LITAGL+I VFSGDTDAV+
Sbjct  327  EVQKALHANVTRLPYPWKSCSDIVGSYWTDSPVSMLPIYRELITAGLKIWVFSGDTDAVV  386

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TRYSIDALKL T + W PWYD+G+VGGW+Q Y+GLT V V GAGHEV LH P+ A 
Sbjct  387  PVTATRYSIDALKLETITNWYPWYDHGKVGGWSQVYKGLTLVTVAGAGHEVPLHRPRQAF  446

Query  136  TXVESFLAGTSMP  98
                SFL    MP
Sbjct  447  ILFRSFLENKPMP  459



>gb|EEC69980.1| hypothetical protein OsI_00486 [Oryza sativa Indica Group]
Length=474

 Score =   167 bits (424),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 95/133 (71%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKA H + T     W TCSD+++ +WKD P ++L +Y+ LI AGLRI VFSGD D+V+
Sbjct  333  EVQKAFHANVTGIPYAWTTCSDDLFYYWKDSPRSMLPIYRELIAAGLRIWVFSGDADSVV  392

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            P+T+TRYSIDAL LPT + W PWYD+ +V GW Q Y+GLT V +RGAGHEV LH P+ AL
Sbjct  393  PLTATRYSIDALYLPTVTNWYPWYDDEEVAGWCQVYQGLTLVTIRGAGHEVPLHRPRQAL  452

Query  136  TXVESFLAGTSMP  98
               E FL    MP
Sbjct  453  KLFEHFLQDKPMP  465



>ref|NP_001042076.1| Os01g0158200 [Oryza sativa Japonica Group]
 dbj|BAD61439.1| putative carboxypeptidase D [Oryza sativa Japonica Group]
 dbj|BAF03990.1| Os01g0158200 [Oryza sativa Japonica Group]
 gb|EAZ10621.1| hypothetical protein OsJ_00453 [Oryza sativa Japonica Group]
 dbj|BAG92359.1| unnamed protein product [Oryza sativa Japonica Group]
Length=471

 Score =   167 bits (423),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 95/133 (71%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKA H + T     W TCSD+++ +WKD P ++L +Y+ LI AGLRI VFSGD D+V+
Sbjct  330  EVQKAFHANVTGIPYAWTTCSDDLFYYWKDSPRSMLPIYRELIAAGLRIWVFSGDADSVV  389

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            P+T+TRYSIDAL LPT + W PWYD+ +V GW Q Y+GLT V +RGAGHEV LH P+ AL
Sbjct  390  PLTATRYSIDALYLPTVTNWYPWYDDEEVAGWCQVYQGLTLVTIRGAGHEVPLHRPRQAL  449

Query  136  TXVESFLAGTSMP  98
               E FL    MP
Sbjct  450  KLFEHFLQDKPMP  462



>ref|XP_006297635.1| hypothetical protein CARUB_v10013654mg [Capsella rubella]
 gb|EOA30533.1| hypothetical protein CARUB_v10013654mg [Capsella rubella]
Length=460

 Score =   167 bits (423),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 96/133 (72%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALH + T     W  CSD V  +W D P ++L +Y+ LITAGL+I VFSGDTDAV+
Sbjct  326  EVQKALHANVTRLRYPWKACSDIVGSYWTDSPMSMLPIYRELITAGLKIWVFSGDTDAVV  385

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TRYS+DALKL T + W PWYD+G+VGGW+Q Y+GLT V V GAGHEV LH P+ A 
Sbjct  386  PVTATRYSVDALKLATITNWYPWYDHGKVGGWSQVYKGLTLVTVAGAGHEVPLHRPRQAF  445

Query  136  TXVESFLAGTSMP  98
               +SFL    MP
Sbjct  446  ILFKSFLENKPMP  458



>dbj|BAB08188.1| unnamed protein product [Oryza sativa Japonica Group]
Length=490

 Score =   167 bits (423),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 95/133 (71%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKA H + T     W TCSD+++ +WKD P ++L +Y+ LI AGLRI VFSGD D+V+
Sbjct  330  EVQKAFHANVTGIPYAWTTCSDDLFYYWKDSPRSMLPIYRELIAAGLRIWVFSGDADSVV  389

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            P+T+TRYSIDAL LPT + W PWYD+ +V GW Q Y+GLT V +RGAGHEV LH P+ AL
Sbjct  390  PLTATRYSIDALYLPTVTNWYPWYDDEEVAGWCQVYQGLTLVTIRGAGHEVPLHRPRQAL  449

Query  136  TXVESFLAGTSMP  98
               E FL    MP
Sbjct  450  KLFEHFLQDKPMP  462



>ref|XP_002869361.1| hypothetical protein ARALYDRAFT_491673 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45620.1| hypothetical protein ARALYDRAFT_491673 [Arabidopsis lyrata subsp. 
lyrata]
Length=479

 Score =   167 bits (423),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 96/132 (73%), Gaps = 0/132 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALHV    +  +W TCSD V + W D P +VL++Y  LI AGLRI VFSGD DAV+
Sbjct  330  EVQKALHVPAGLAPSKWDTCSDVVNEHWNDSPSSVLNIYHELIAAGLRIWVFSGDADAVV  389

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVTSTRYSIDAL L   S + PWY +GQVGGW+Q+Y GL FV VRGAGHEV LH PK A 
Sbjct  390  PVTSTRYSIDALNLRPLSVYGPWYLDGQVGGWSQQYAGLNFVTVRGAGHEVPLHRPKQAF  449

Query  136  TXVESFLAGTSM  101
               ++F++GT +
Sbjct  450  ALFKAFISGTPL  461



>ref|XP_009410601.1| PREDICTED: serine carboxypeptidase-like 27 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=457

 Score =   167 bits (422),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 78/133 (59%), Positives = 94/133 (71%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQ+ALH + T     W TCSD V ++W D P ++L +YQ LI AGLRI +FSGDTDAV+
Sbjct  324  EVQRALHANVTGIQYPWDTCSDIVGNYWADSPRSMLPIYQELIAAGLRIWMFSGDTDAVV  383

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TRYSIDAL L T   W PWYD G+VGGW+Q Y+GLTFV + GAGHEV LH P+ A+
Sbjct  384  PVTATRYSIDALNLQTLISWYPWYDKGKVGGWSQVYKGLTFVTIMGAGHEVPLHHPRQAM  443

Query  136  TXVESFLAGTSMP  98
                 FL    MP
Sbjct  444  ILFRQFLKNRPMP  456



>ref|XP_010547376.1| PREDICTED: serine carboxypeptidase-like 27 [Tarenaya hassleriana]
 ref|XP_010547377.1| PREDICTED: serine carboxypeptidase-like 27 [Tarenaya hassleriana]
 ref|XP_010547378.1| PREDICTED: serine carboxypeptidase-like 27 [Tarenaya hassleriana]
Length=457

 Score =   166 bits (421),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 78/133 (59%), Positives = 95/133 (71%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
             VQKALH + T     W  CSD V  +W D P ++L +Y+ LI AG++I VFSGDTDAV+
Sbjct  323  NVQKALHANVTRLPYPWKACSDIVGSYWTDSPVSMLPIYKELIAAGVKIWVFSGDTDAVV  382

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TRYSI+ALKLPT + W PWYD G+VGGW+Q Y+GLTFV+V GAGHEV LH P+ A 
Sbjct  383  PVTATRYSINALKLPTITNWYPWYDQGKVGGWSQVYKGLTFVSVAGAGHEVPLHRPRQAF  442

Query  136  TXVESFLAGTSMP  98
                SFL    MP
Sbjct  443  ILFRSFLEDKPMP  455



>ref|XP_010541227.1| PREDICTED: serine carboxypeptidase-like 29 [Tarenaya hassleriana]
Length=346

 Score =   164 bits (415),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 96/137 (70%), Gaps = 0/137 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALHV    +  +W  CSD V + W D P +VL++Y  LI  GLRI VFSGD DAV+
Sbjct  191  EVQKALHVPPEFAPSKWDICSDTVSEHWNDSPPSVLNIYHELIAVGLRIWVFSGDADAVV  250

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TRYSI+AL L   SPW  WY +GQV GWTQ+Y GL FV VRGAGHEV LH PK +L
Sbjct  251  PVTATRYSIEALNLRPLSPWYSWYMDGQVAGWTQQYAGLNFVTVRGAGHEVPLHRPKQSL  310

Query  136  TXVESFLAGTSMPGXQR  86
               ++F++G  +P  ++
Sbjct  311  ELFKAFVSGNPLPTSEK  327



>ref|NP_187456.1| serine carboxypeptidase-like 27 [Arabidopsis thaliana]
 sp|Q9SFB5.1|SCP27_ARATH RecName: Full=Serine carboxypeptidase-like 27; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAF21209.1|AC013483_33 putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AAT71955.1| At3g07990 [Arabidopsis thaliana]
 gb|AAU95440.1| At3g07990 [Arabidopsis thaliana]
 gb|AEE74628.1| serine carboxypeptidase-like 27 [Arabidopsis thaliana]
Length=459

 Score =   166 bits (421),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 78/133 (59%), Positives = 96/133 (72%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            +VQKALH + T  S  W  CSD V  +W D P ++L +Y+ LITAGL+I VFSGDTDAV+
Sbjct  325  DVQKALHANVTRLSYPWKACSDIVGSYWDDSPLSMLPIYKELITAGLKIWVFSGDTDAVV  384

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            P+T+TRYS+DALKL T + W PWYD+G+VGGW+Q Y+GLT V V GAGHEV LH P+ A 
Sbjct  385  PITATRYSVDALKLATITNWYPWYDHGKVGGWSQVYKGLTLVTVAGAGHEVPLHRPRQAF  444

Query  136  TXVESFLAGTSMP  98
                SFL    MP
Sbjct  445  ILFRSFLESKPMP  457



>gb|EMS47606.1| Serine carboxypeptidase-like 27 [Triticum urartu]
Length=470

 Score =   166 bits (421),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 94/133 (71%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQ ALH +TT     W TCSD V  +W D P ++L +Y  LI AG++I VFSGDTDAV+
Sbjct  336  EVQAALHANTTGIKYPWKTCSDIVGSYWADSPRSMLPIYHELIAAGIKIWVFSGDTDAVV  395

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TRYSI ALKLPT   W PWYD+G+VGGW+Q Y+GLT V V GAGHEV LH P+ AL
Sbjct  396  PVTATRYSISALKLPTLMNWYPWYDHGKVGGWSQVYKGLTLVTVAGAGHEVPLHRPRQAL  455

Query  136  TXVESFLAGTSMP  98
                 FL  T MP
Sbjct  456  ILFRHFLKDTPMP  468



>ref|XP_009108967.1| PREDICTED: serine carboxypeptidase-like 29 [Brassica rapa]
Length=477

 Score =   167 bits (422),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 97/132 (73%), Gaps = 0/132 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQ+ALHV    +  +W TCSD V + WKD   +VL++Y  LI AGLRI VFSGD DAV+
Sbjct  328  EVQEALHVPPGLAPSKWDTCSDVVNENWKDSSSSVLNIYHELIAAGLRIWVFSGDADAVV  387

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TRYSIDAL L   SP+ PWY +GQVGGWTQ+Y GL FV VRGAGHEV LH PK  L
Sbjct  388  PVTATRYSIDALNLRPLSPYGPWYIDGQVGGWTQQYAGLNFVTVRGAGHEVPLHRPKEGL  447

Query  136  TXVESFLAGTSM  101
               ++F++GT +
Sbjct  448  ALFKAFISGTPL  459



>ref|XP_009414289.1| PREDICTED: serine carboxypeptidase-like 27 [Musa acuminata subsp. 
malaccensis]
Length=472

 Score =   166 bits (421),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 94/133 (71%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALH + T     W TCSD + D W D P +VL +Y  LI AGLRI VFSGDTD+V+
Sbjct  339  EVQKALHANVTGIPYSWETCSDTIGDNWGDSPKSVLPIYHELIAAGLRIWVFSGDTDSVV  398

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            P+T+TRYSIDALKL T   W PWY +G+VGGW+Q YEGLTFV V GAGHEV LH P+ AL
Sbjct  399  PLTATRYSIDALKLKTLKNWYPWYYDGKVGGWSQIYEGLTFVTVTGAGHEVPLHRPRQAL  458

Query  136  TXVESFLAGTSMP  98
               + FL    MP
Sbjct  459  ILFKRFLKNKPMP  471



>ref|XP_010460785.1| PREDICTED: serine carboxypeptidase-like 27 [Camelina sativa]
Length=457

 Score =   166 bits (420),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/133 (59%), Positives = 96/133 (72%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALH + T     W  CSD V ++W+D P ++L +Y+ LITAGL+I VFSGDTDAV+
Sbjct  323  EVQKALHANVTRLPYPWKACSDIVGNYWEDSPLSMLPIYRELITAGLKIWVFSGDTDAVV  382

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            P+T+TRYSIDALKL T + W PWYD+G+V GW+Q Y+GLT V V GAGHEV LH P+ A 
Sbjct  383  PITATRYSIDALKLATITNWYPWYDHGKVAGWSQVYKGLTLVTVAGAGHEVPLHRPRQAF  442

Query  136  TXVESFLAGTSMP  98
                SFL    MP
Sbjct  443  ILFRSFLENKPMP  455



>ref|XP_008789080.1| PREDICTED: LOW QUALITY PROTEIN: serine carboxypeptidase-like 
27 [Phoenix dactylifera]
Length=473

 Score =   166 bits (421),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 94/133 (71%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQ ALH + T     W TCS+ V + W D P ++L +Y+ LI AGLRI VFSGDTD+V+
Sbjct  338  EVQMALHANVTGIPYPWNTCSNIVGNHWADSPRSMLPIYRELIAAGLRIWVFSGDTDSVV  397

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TRYSIDAL L T   W PWYDNG+VGGWTQ YEGLTFV V GAGHEV LH P+ AL
Sbjct  398  PVTATRYSIDALNLSTVISWYPWYDNGKVGGWTQVYEGLTFVTVXGAGHEVPLHRPRQAL  457

Query  136  TXVESFLAGTSMP  98
               + FL    MP
Sbjct  458  VLFKHFLQNRPMP  470



>gb|EYU39589.1| hypothetical protein MIMGU_mgv1a0101822mg, partial [Erythranthe 
guttata]
Length=136

 Score =   157 bits (398),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 91/132 (69%), Gaps = 0/132 (0%)
 Frame = -3

Query  493  VQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVIP  314
            VQKALH + T     WVTCSD +   W D P ++L + + LI AGLRI VFSGDTDAV+P
Sbjct  1    VQKALHANVTGIPYPWVTCSDVIRGSWTDSPRSMLPIIKQLIDAGLRIWVFSGDTDAVLP  60

Query  313  VTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLALT  134
            +T+TRYSI AL L   + W  WYD  +VGGW+Q YEGLT+V VRGAGHEV L  PKLALT
Sbjct  61   LTATRYSIKALNLKANTSWYAWYDKQKVGGWSQVYEGLTYVTVRGAGHEVPLTRPKLALT  120

Query  133  XVESFLAGTSMP  98
                FLA   MP
Sbjct  121  LFRHFLADQIMP  132



>ref|XP_006655142.1| PREDICTED: LOW QUALITY PROTEIN: serine carboxypeptidase 2-like 
[Oryza brachyantha]
Length=469

 Score =   166 bits (420),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/141 (57%), Positives = 94/141 (67%), Gaps = 0/141 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQ ALH + T  +  W TCSD + + W+D P TVL +Y  LI AGLRI VFSGDTDAV+
Sbjct  324  EVQTALHANVTGINYTWATCSDILNNNWRDSPRTVLPIYHELIAAGLRIWVFSGDTDAVV  383

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            P+T TRYSIDAL LPT   W PWYD  +VGGW+Q Y+GLT V VRGAGHEV LH P+ A 
Sbjct  384  PLTGTRYSIDALGLPTTINWYPWYDAIKVGGWSQVYKGLTLVTVRGAGHEVPLHRPRQAF  443

Query  136  TXVESFLAGTSMPGXQRIXDS  74
                 FL G  MP    I  +
Sbjct  444  ILFNHFLKGKPMPNAPTIKSA  464



>ref|XP_010920885.1| PREDICTED: serine carboxypeptidase-like 27 [Elaeis guineensis]
Length=506

 Score =   166 bits (421),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 95/133 (71%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALH + T     W TCS+ V  +W D P ++L +Y+ LI AGLRI VFSGDTD+V+
Sbjct  344  EVQKALHANVTGIPYPWDTCSNIVGIYWADSPRSMLPIYRELIAAGLRIWVFSGDTDSVV  403

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            P+T+TRYSIDAL L T   W PWYD+G+VGGWTQ YEGLTFV VRGAGHEV LH P+ AL
Sbjct  404  PLTATRYSIDALNLSTVISWYPWYDHGKVGGWTQVYEGLTFVTVRGAGHEVPLHRPRQAL  463

Query  136  TXVESFLAGTSMP  98
                 FL    MP
Sbjct  464  ILFRHFLQDKLMP  476



>ref|XP_003591949.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 ref|XP_003638560.1| Serine carboxypeptidase-like protein [Medicago truncatula]
Length=461

 Score =   165 bits (418),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 96/135 (71%), Gaps = 2/135 (1%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALH + T     W TCSD V ++W D P ++L +Y  LI AGLRI VFSGDTD+V+
Sbjct  324  EVQKALHANVTGIPYIWKTCSDIVGNYWTDSPLSMLPIYHELINAGLRIWVFSGDTDSVV  383

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQ--VGGWTQEYEGLTFVAVRGAGHEVALHXPKL  143
            P+T+TRYSIDALKLPT   W PWYD+G+  VGGW+Q Y+GLT V +RGAGHEV LH P+ 
Sbjct  384  PLTATRYSIDALKLPTIINWYPWYDSGKVGVGGWSQVYKGLTLVTIRGAGHEVPLHKPRE  443

Query  142  ALTXVESFLAGTSMP  98
            A     SFL    MP
Sbjct  444  AFILFRSFLENKDMP  458



>ref|XP_006412667.1| hypothetical protein EUTSA_v10025076mg [Eutrema salsugineum]
 gb|ESQ54120.1| hypothetical protein EUTSA_v10025076mg [Eutrema salsugineum]
Length=480

 Score =   166 bits (419),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 98/132 (74%), Gaps = 0/132 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EV++ALHV    +S +W TCS+ V + W D P +VL++Y  LI AGLRI VFSGD DAV+
Sbjct  331  EVKEALHVPPGLASSKWDTCSNVVNEHWNDSPSSVLNIYHELIAAGLRIWVFSGDADAVV  390

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TRYSIDAL L   S + PWY +GQVGGWTQ+Y GL FV VRGAGHEV LH PK AL
Sbjct  391  PVTATRYSIDALNLRPLSTYGPWYIDGQVGGWTQQYAGLNFVTVRGAGHEVPLHRPKEAL  450

Query  136  TXVESFLAGTSM  101
               ++F++GT +
Sbjct  451  ALFKAFISGTPL  462



>gb|EMT12249.1| Serine carboxypeptidase 2 [Aegilops tauschii]
Length=468

 Score =   165 bits (417),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 78/138 (57%), Positives = 99/138 (72%), Gaps = 1/138 (1%)
 Frame = -3

Query  496  EVQKALHVHTTNS-SXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAV  320
            +VQ ALH + T + +  W TCSD +   W D P ++L +Y+ LI AGLRI VFSGDTDAV
Sbjct  326  DVQMALHANVTGAMNYTWTTCSDTINTHWHDAPRSMLPIYRELIAAGLRIWVFSGDTDAV  385

Query  319  IPVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLA  140
            +P+T+TRYSI AL LPT + W PWYD+ +VGGW+Q Y+GLT V+VRGAGHEV LH P+ A
Sbjct  386  VPLTATRYSIGALGLPTTTSWHPWYDDQEVGGWSQVYKGLTLVSVRGAGHEVPLHRPRQA  445

Query  139  LTXVESFLAGTSMPGXQR  86
            L   + FL G  MPG  +
Sbjct  446  LVLFQYFLQGKPMPGQTK  463



>ref|XP_002882565.1| hypothetical protein ARALYDRAFT_478140 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58824.1| hypothetical protein ARALYDRAFT_478140 [Arabidopsis lyrata subsp. 
lyrata]
Length=456

 Score =   164 bits (416),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 96/133 (72%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            +VQKALH + T     W  CSD V  +W+D P ++L +Y+ LITAGL+I +FSGDTDAV+
Sbjct  322  DVQKALHANVTRLPYPWKACSDIVGSYWEDSPLSMLPIYRELITAGLKIWIFSGDTDAVV  381

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TRYS+DALKL T + W PWYD+G+VGGW+Q Y+GLT V V GAGHEV LH P+ A 
Sbjct  382  PVTATRYSVDALKLATITNWYPWYDHGKVGGWSQVYKGLTLVTVAGAGHEVPLHRPRQAF  441

Query  136  TXVESFLAGTSMP  98
                SFL    MP
Sbjct  442  ILFRSFLDSKPMP  454



>gb|KDO59486.1| hypothetical protein CISIN_1g0120681mg, partial [Citrus sinensis]
Length=381

 Score =   163 bits (412),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 76/138 (55%), Positives = 94/138 (68%), Gaps = 0/138 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALH + T    +W  CSD + + WKD   +VL  Y+ LI AGL+I VFSGDTD+V+
Sbjct  241  EVQKALHANVTGIPYKWTACSDVLINNWKDSEDSVLPTYKQLIAAGLKIWVFSGDTDSVV  300

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TR+S+  L LP  +PW PWY   QVGGWT+ Y+GLTF  VRGAGHEV L  P+ AL
Sbjct  301  PVTATRFSLSHLNLPIKTPWYPWYSGNQVGGWTEVYKGLTFATVRGAGHEVPLFQPRRAL  360

Query  136  TXVESFLAGTSMPGXQRI  83
                SFLAG  +P  + I
Sbjct  361  ILFRSFLAGKQLPKSRHI  378



>sp|P08819.2|CBP2_WHEAT RecName: Full=Serine carboxypeptidase 2; AltName: Full=CPDW-II; 
Short=CP-WII; AltName: Full=Carboxypeptidase D; AltName: 
Full=Serine carboxypeptidase II; Contains: RecName: Full=Serine 
carboxypeptidase 2 chain A; AltName: Full=Serine carboxypeptidase 
II chain A; Contains: RecName: Full=Serine carboxypeptidase 
2 chain B; AltName: Full=Serine carboxypeptidase II 
chain B; Flags: Precursor [Triticum aestivum]
Length=444

 Score =   164 bits (415),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 78/138 (57%), Positives = 99/138 (72%), Gaps = 1/138 (1%)
 Frame = -3

Query  496  EVQKALHVHTTNS-SXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAV  320
            +VQ ALH + T + +  W TCSD +   W D P ++L +Y+ LI AGLRI VFSGDTDAV
Sbjct  304  DVQMALHANVTGAMNYTWATCSDTINTHWHDAPRSMLPIYRELIAAGLRIWVFSGDTDAV  363

Query  319  IPVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLA  140
            +P+T+TRYSI AL LPT + W PWYD+ +VGGW+Q Y+GLT V+VRGAGHEV LH P+ A
Sbjct  364  VPLTATRYSIGALGLPTTTSWYPWYDDQEVGGWSQVYKGLTLVSVRGAGHEVPLHRPRQA  423

Query  139  LTXVESFLAGTSMPGXQR  86
            L   + FL G  MPG  +
Sbjct  424  LVLFQYFLQGKPMPGQTK  441



>ref|XP_003566533.2| PREDICTED: serine carboxypeptidase 2-like [Brachypodium distachyon]
Length=466

 Score =   164 bits (416),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 96/133 (72%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQ+ALH + T  +  W TCSD +   W D P ++L +Y+ LI AGLRI VFSGDTDAV+
Sbjct  325  EVQRALHANVTGINYTWATCSDTINKNWGDAPRSMLPIYKELIQAGLRIWVFSGDTDAVV  384

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            P+T+TRYSIDAL LPT   W PW D+ +VGGW+Q Y+GLT V +RGAGHEV LH P+ AL
Sbjct  385  PLTATRYSIDALDLPTTIGWYPWSDSKEVGGWSQVYKGLTLVTIRGAGHEVPLHRPRQAL  444

Query  136  TXVESFLAGTSMP  98
               ++FL G  +P
Sbjct  445  IMFQNFLRGMPLP  457



>ref|XP_006470942.1| PREDICTED: serine carboxypeptidase II-2-like [Citrus sinensis]
Length=315

 Score =   161 bits (407),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 89/166 (54%), Positives = 100/166 (60%), Gaps = 28/166 (17%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCS------------------DEVYDFWKDCPXTVLDVYQXL  371
            EVQKALHV    +  +W TC                     V + W D P  VLD+Y  L
Sbjct  145  EVQKALHVIPAVALAKWETCRWHQQHALMIFFIFTALQWGVVNNNWLDSPRIVLDIYHEL  204

Query  370  ITAGLRIXVFSGDTDAVIPVTSTRYSIDALKLPTXSPWRPWYDNGQVGG----------W  221
            I +GLRI +FSGDTDAVIPVTSTRYSIDAL LPT  PWR WYD GQV            W
Sbjct  205  IHSGLRIWMFSGDTDAVIPVTSTRYSIDALNLPTVKPWRAWYDEGQVNYTTKPFITYILW  264

Query  220  TQEYEGLTFVAVRGAGHEVALHXPKLALTXVESFLAGTSMPGXQRI  83
            TQEY GLT V VRGA HEV LH PK ALT ++SFL+G SMP  +R+
Sbjct  265  TQEYAGLTLVTVRGADHEVPLHRPKPALTLIKSFLSGRSMPCLERV  310



>ref|XP_006286217.1| hypothetical protein CARUB_v10007783mg [Capsella rubella]
 gb|EOA19115.1| hypothetical protein CARUB_v10007783mg [Capsella rubella]
Length=479

 Score =   164 bits (415),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 79/138 (57%), Positives = 97/138 (70%), Gaps = 0/138 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQ+ALHV    +  +W TCSD V + W D   +VL++Y  LI AGLRI VFSGD DAV+
Sbjct  330  EVQRALHVPPGLAPSKWDTCSDVVNEHWNDSSSSVLNIYHELIAAGLRIWVFSGDADAVV  389

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVTSTRYSIDAL L   S + PWY +GQVGGW+Q+Y GL FV VRGAGHEV LH PK AL
Sbjct  390  PVTSTRYSIDALNLRPLSAYGPWYSDGQVGGWSQQYAGLNFVTVRGAGHEVPLHRPKQAL  449

Query  136  TXVESFLAGTSMPGXQRI  83
               ++F++G  +   + I
Sbjct  450  ELFKAFISGAPLSTHENI  467



>ref|XP_010447670.1| PREDICTED: serine carboxypeptidase-like 29 [Camelina sativa]
Length=479

 Score =   164 bits (415),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 96/132 (73%), Gaps = 0/132 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALHV    +  +W TCS+ V   WKD   +VL++Y  LI AGLRI VFSGD DAV+
Sbjct  330  EVQKALHVPPGLAPSKWDTCSNVVNGHWKDSSSSVLNIYHELIAAGLRIWVFSGDADAVV  389

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVTSTRYSIDAL L   S + PWY +GQVGGW+Q+Y GL FV VRGAGHEV LH PK AL
Sbjct  390  PVTSTRYSIDALNLRPLSAYGPWYLDGQVGGWSQQYAGLKFVTVRGAGHEVPLHRPKQAL  449

Query  136  TXVESFLAGTSM  101
               ++F++GT +
Sbjct  450  ALFKAFISGTPL  461



>ref|XP_006453596.1| hypothetical protein CICLE_v10008182mg [Citrus clementina]
 gb|ESR66836.1| hypothetical protein CICLE_v10008182mg [Citrus clementina]
Length=471

 Score =   164 bits (414),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/138 (55%), Positives = 94/138 (68%), Gaps = 0/138 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALH + T    +W  CSD + + WKD   +VL  Y+ LI AGL+I VFSGDTD+V+
Sbjct  331  EVQKALHANVTGIPYKWTACSDVLINNWKDSEDSVLPTYKQLIAAGLKIWVFSGDTDSVV  390

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TR+S+  L LP  +PW PWY   QVGGWT+ Y+GLTF  VRGAGHEV L  P+ AL
Sbjct  391  PVTATRFSVSHLNLPIKTPWYPWYSGNQVGGWTEVYKGLTFATVRGAGHEVPLFQPRRAL  450

Query  136  TXVESFLAGTSMPGXQRI  83
                SFLAG  +P  + I
Sbjct  451  ILFRSFLAGKQLPKSRHI  468



>ref|XP_010438130.1| PREDICTED: serine carboxypeptidase-like 29 [Camelina sativa]
Length=498

 Score =   164 bits (415),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 96/132 (73%), Gaps = 0/132 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALHV    +  +W TCS+ V   WKD   +VL++Y  LI AGLRI VFSGD DAV+
Sbjct  349  EVQKALHVPPGLAPSKWDTCSNVVNGHWKDSSSSVLNIYHELIAAGLRIWVFSGDADAVV  408

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVTSTRYSIDAL L   S + PWY +GQVGGW+Q+Y GL FV VRGAGHEV LH PK AL
Sbjct  409  PVTSTRYSIDALNLRPLSAYGPWYLDGQVGGWSQQYAGLNFVTVRGAGHEVPLHRPKQAL  468

Query  136  TXVESFLAGTSM  101
               ++F++GT +
Sbjct  469  ALFKAFISGTPL  480



>ref|XP_009141519.1| PREDICTED: serine carboxypeptidase-like 26 [Brassica rapa]
Length=447

 Score =   163 bits (413),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 93/132 (70%), Gaps = 0/132 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKA+H +TT  +  W TCSD V + W D P ++L +Y+ LI AGLRI VFSGDTD+V+
Sbjct  316  EVQKAMHANTTGLAYPWKTCSDIVGEKWADSPLSMLPIYKELIGAGLRIWVFSGDTDSVV  375

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT TRYSI ALKL   S W PWYDNGQVGGW+Q Y+GLT V + GAGHEV LH P+   
Sbjct  376  PVTGTRYSIRALKLQPVSKWYPWYDNGQVGGWSQVYKGLTLVTIHGAGHEVPLHRPRRGF  435

Query  136  TXVESFLAGTSM  101
               +SFL    M
Sbjct  436  LLFQSFLNNKPM  447



>ref|XP_006474013.1| PREDICTED: serine carboxypeptidase 24-like [Citrus sinensis]
Length=471

 Score =   164 bits (414),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/138 (55%), Positives = 94/138 (68%), Gaps = 0/138 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALH + T    +W  CSD + + WKD   +VL  Y+ LI AGL+I VFSGDTD+V+
Sbjct  331  EVQKALHANVTGIPYKWTACSDVLINNWKDSEDSVLPTYKQLIAAGLKIWVFSGDTDSVV  390

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TR+S+  L LP  +PW PWY   QVGGWT+ Y+GLTF  VRGAGHEV L  P+ AL
Sbjct  391  PVTATRFSLSHLNLPIKTPWYPWYSGNQVGGWTEVYKGLTFATVRGAGHEVPLFQPRRAL  450

Query  136  TXVESFLAGTSMPGXQRI  83
                SFLAG  +P  + I
Sbjct  451  ILFRSFLAGKQLPKSRHI  468



>ref|XP_009386999.1| PREDICTED: serine carboxypeptidase-like 27 [Musa acuminata subsp. 
malaccensis]
Length=474

 Score =   163 bits (413),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 96/134 (72%), Gaps = 0/134 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            +VQ+A+H + T     W TCSD + + W D P ++L +Y+ LI AGLRI VFSGDTDAV+
Sbjct  339  DVQRAMHANVTGIPYGWDTCSDTISENWGDSPKSMLPIYRELIAAGLRIWVFSGDTDAVV  398

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            P+T+TRYSIDAL+L T   W PWYD+G+VGGW+Q Y+GLT+V V GAGHEV LH P+ AL
Sbjct  399  PLTATRYSIDALRLRTLEKWYPWYDHGKVGGWSQIYKGLTYVTVTGAGHEVPLHRPRQAL  458

Query  136  TXVESFLAGTSMPG  95
               E FL    MP 
Sbjct  459  MLFEHFLKNKPMPA  472



>emb|CDY32091.1| BnaC04g44750D [Brassica napus]
Length=447

 Score =   163 bits (412),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 93/132 (70%), Gaps = 0/132 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKA+H +TT  +  W TCSD V + W D P ++L +Y+ LI AGLRI VFSGDTD+V+
Sbjct  316  EVQKAMHANTTGLAYPWKTCSDIVGEKWADSPLSMLPIYKELIGAGLRIWVFSGDTDSVV  375

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            P+T TRYSI ALKL   S W PWYDNGQVGGW+Q Y+GLT V + GAGHEV LH P+   
Sbjct  376  PITGTRYSIRALKLQPVSKWYPWYDNGQVGGWSQVYKGLTLVTIHGAGHEVPLHRPRRGF  435

Query  136  TXVESFLAGTSM  101
               +SFL    M
Sbjct  436  LLFQSFLNNKPM  447



>emb|CDY40438.1| BnaA04g20790D [Brassica napus]
Length=447

 Score =   163 bits (412),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 92/132 (70%), Gaps = 0/132 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKA+H +TT  +  W TCSD V + W D P ++L +Y+ LI AGLRI VFSGDTD+V+
Sbjct  316  EVQKAMHANTTGLAYPWKTCSDIVGEKWADSPLSMLPIYKELIGAGLRIWVFSGDTDSVV  375

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT TRYSI ALKL   S W PWYDNGQVGGW+Q Y GLT V + GAGHEV LH P+   
Sbjct  376  PVTGTRYSIRALKLQPVSKWYPWYDNGQVGGWSQVYNGLTLVTIHGAGHEVPLHRPRRGF  435

Query  136  TXVESFLAGTSM  101
               +SFL    M
Sbjct  436  LLFQSFLNNKPM  447



>prf||1408163B CPase II B
Length=159

 Score =   155 bits (392),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 96/136 (71%), Gaps = 2/136 (1%)
 Frame = -3

Query  496  EVQKALHVHTTNS-SXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAV  320
            +VQ ALH + T + +  W  CSD +   W D P ++L +Y+ LI AGLRI VFSGDTDAV
Sbjct  20   DVQTALHANVTGAMNYTWXZCSDTINTHWHDAPRSMLPIYRELIAAGLRIWVFSGDTDAV  79

Query  319  IPVTSTRYSIDALKLPTXSPWRPWYDNGQ-VGGWTQEYEGLTFVAVRGAGHEVALHXPKL  143
            +P+T+TRYSI AL L T + W PWYD+ Q VGGW+Q Y+GLT V+VRGAGHEV LH P+ 
Sbjct  80   VPLTATRYSIGALGLATTTSWYPWYDDLQEVGGWSQVYKGLTLVSVRGAGHEVPLHRPRQ  139

Query  142  ALTXVESFLAGTSMPG  95
            AL   + FL G  MPG
Sbjct  140  ALILFQQFLQGKPMPG  155



>ref|XP_010937832.1| PREDICTED: serine carboxypeptidase-like 27 [Elaeis guineensis]
Length=470

 Score =   163 bits (412),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 93/133 (70%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALH + T     W TCS+ V  +W D P ++L +Y+ LI AGLRI VFSGDTD+V+
Sbjct  335  EVQKALHANVTGIPYPWDTCSNIVGKYWTDSPRSMLPIYRELIAAGLRIWVFSGDTDSVV  394

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            P+T+TRYSIDAL L T   W  WYD G VGGWTQ Y+GLTFV VRGAGHEV LH P+ AL
Sbjct  395  PLTATRYSIDALNLSTVISWYAWYDQGMVGGWTQVYKGLTFVTVRGAGHEVPLHRPRQAL  454

Query  136  TXVESFLAGTSMP  98
               + FL    MP
Sbjct  455  VLFKHFLQNRPMP  467



>gb|ACA61621.1| hypothetical protein AP7_B10.1 [Arabidopsis lyrata subsp. petraea]
Length=450

 Score =   162 bits (410),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 94/133 (71%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKA+H + T  S  W TCSD V + W D P ++L +Y+ LI AGLRI VFSGDTD+V+
Sbjct  317  EVQKAMHANITGLSYPWKTCSDIVGEKWADSPLSMLPIYKELIAAGLRIWVFSGDTDSVV  376

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            P+T TRYSI ALKLP  S W PW D+GQVGGW+Q Y+GLT V + GAGHEV LH P+ A 
Sbjct  377  PITGTRYSIRALKLPPLSKWYPWNDDGQVGGWSQVYKGLTLVTIHGAGHEVPLHRPRRAY  436

Query  136  TXVESFLAGTSMP  98
               +SFL    +P
Sbjct  437  LLFQSFLDNKPLP  449



>gb|EMS66624.1| Serine carboxypeptidase II-1 [Triticum urartu]
Length=357

 Score =   159 bits (403),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 91/133 (68%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKA   + T     W  CSD ++++WKD P ++L +Y+ LI AG+RI VFSGD D+V+
Sbjct  216  EVQKAFRANVTGIPYAWTGCSDVLFEYWKDSPRSMLPIYRELIAAGIRIWVFSGDADSVV  275

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            P+T TRYSIDAL LPT + W PWYD  +V GW Q Y+GLT V +RGAGHEV LH P+ AL
Sbjct  276  PLTGTRYSIDALYLPTVTNWYPWYDEEEVAGWCQVYKGLTLVTIRGAGHEVPLHRPRQAL  335

Query  136  TXVESFLAGTSMP  98
               E FL    MP
Sbjct  336  KLFEHFLQDKPMP  348



>gb|KCW65386.1| hypothetical protein EUGRSUZ_G02816 [Eucalyptus grandis]
Length=467

 Score =   161 bits (408),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 93/132 (70%), Gaps = 0/132 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALH + T     W TCSD V ++W D P ++L +YQ LI AGLRI V+SGDTDAV+
Sbjct  334  EVQKALHANVTGLPYAWKTCSDIVGNYWADSPLSMLPIYQELIAAGLRIWVYSGDTDAVV  393

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT++RYSIDALKL T   W PW DNG+VGGW+Q Y+GLTFV V GAGHEV L  P+ A 
Sbjct  394  PVTASRYSIDALKLATVINWYPWTDNGKVGGWSQVYKGLTFVTVTGAGHEVPLLRPRQAF  453

Query  136  TXVESFLAGTSM  101
                SFL    M
Sbjct  454  ILFRSFLENKPM  465



>gb|EMT21139.1| putative Serine carboxypeptidase II-1 [Aegilops tauschii]
Length=419

 Score =   160 bits (406),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 91/133 (68%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKA   + T     W +CSD ++++WKD P ++L +Y  LI AG+RI VFSGD D+V+
Sbjct  278  EVQKAFRANVTGIPYAWTSCSDVLFEYWKDSPRSMLPIYHELIAAGIRIWVFSGDADSVV  337

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            P+T TRYSIDAL LPT + W PWYD  +V GW Q Y+GLT V +RGAGHEV LH P+ AL
Sbjct  338  PLTGTRYSIDALYLPTVTNWYPWYDEEEVAGWCQVYKGLTLVTIRGAGHEVPLHRPRQAL  397

Query  136  TXVESFLAGTSMP  98
               E FL    MP
Sbjct  398  KLFEHFLQDKPMP  410



>sp|P55747.1|CBP21_HORVU RecName: Full=Serine carboxypeptidase II-1; AltName: Full=CP-MII.1; 
Contains: RecName: Full=Serine carboxypeptidase II-1 
chain A; Contains: RecName: Full=Serine carboxypeptidase II-1 
chain B; Flags: Precursor, partial [Hordeum vulgare]
 gb|AAB31591.1| CP-MII.1=serine carboxypeptidase [Hordeum vulgare=barley, cv. 
Alexis, aleurone, Peptide, 324 aa]
 emb|CAB58992.1| serine carboxypeptidase II-1 [Hordeum vulgare subsp. vulgare]
Length=324

 Score =   158 bits (400),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 90/133 (68%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKA   + T     W  CSD + D WKD P ++L +Y+ LI AG+RI VFSGD D+V+
Sbjct  183  EVQKAFRANVTGIPYSWTACSDVLSDHWKDSPRSMLPIYRELIAAGIRIWVFSGDADSVV  242

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            P+T+TRYSIDAL LPT + W PWYD  +V GW Q Y+GLT V +RGAGHEV LH P+ AL
Sbjct  243  PLTATRYSIDALYLPTVTNWYPWYDEEEVAGWCQVYKGLTLVTIRGAGHEVPLHRPQQAL  302

Query  136  TXVESFLAGTSMP  98
               E FL    MP
Sbjct  303  KLFEHFLQDKPMP  315



>ref|XP_004962519.1| PREDICTED: serine carboxypeptidase 2-like [Setaria italica]
Length=490

 Score =   161 bits (408),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 93/133 (70%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQ+ALH + T  +  W TCS  +   W D P ++L +Y+ LI AGLRI V+SGDTD+V+
Sbjct  352  EVQRALHANVTGINYTWTTCSGIINTNWGDSPRSMLPIYKELIAAGLRIWVYSGDTDSVV  411

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            P+T+TRYSIDAL LPT   W PWYD  +VGGW+Q Y+GLT V +RGAGHEV LH PK AL
Sbjct  412  PLTATRYSIDALGLPTVVSWYPWYDKKEVGGWSQVYKGLTLVTIRGAGHEVPLHRPKQAL  471

Query  136  TXVESFLAGTSMP  98
                 FL G  MP
Sbjct  472  ILFRHFLHGKPMP  484



>ref|XP_007154876.1| hypothetical protein PHAVU_003G155400g, partial [Phaseolus vulgaris]
 gb|ESW26870.1| hypothetical protein PHAVU_003G155400g, partial [Phaseolus vulgaris]
Length=371

 Score =   159 bits (402),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 93/133 (70%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKA+H + TN   +W  CS+ +   WKD   +VL +Y+ LI AGL+I VFSGDTD+V+
Sbjct  237  EVQKAMHANLTNIPYKWTACSEVLLKNWKDSEISVLPIYKELIAAGLKIWVFSGDTDSVV  296

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TR+S++ L L   + W PWY  GQVGGWT+ Y GLTF  VRGAGHEV L  PK A 
Sbjct  297  PVTATRFSLNHLNLSIKTRWYPWYSGGQVGGWTEVYNGLTFATVRGAGHEVPLFQPKRAY  356

Query  136  TXVESFLAGTSMP  98
            T  +SFLAG  +P
Sbjct  357  TLFKSFLAGKELP  369



>ref|XP_002881414.1| hypothetical protein ARALYDRAFT_482550 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57673.1| hypothetical protein ARALYDRAFT_482550 [Arabidopsis lyrata subsp. 
lyrata]
Length=450

 Score =   160 bits (406),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 93/133 (70%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKA+H + T  S  W  CSD V + W D P ++L +Y+ LI AGLRI VFSGDTD+V+
Sbjct  317  EVQKAMHANITGLSYPWKGCSDIVGEKWADSPLSMLPIYKELIAAGLRIWVFSGDTDSVV  376

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            P+T TRYSI ALKLP  S W PW D+GQVGGW+Q Y+GLT V + GAGHEV LH P+ A 
Sbjct  377  PITGTRYSIRALKLPPLSKWYPWNDDGQVGGWSQVYKGLTLVTIHGAGHEVPLHRPRRAF  436

Query  136  TXVESFLAGTSMP  98
               +SFL    +P
Sbjct  437  LLFQSFLDNKPLP  449



>ref|XP_010067290.1| PREDICTED: serine carboxypeptidase-like 27 [Eucalyptus grandis]
Length=528

 Score =   162 bits (409),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 93/132 (70%), Gaps = 0/132 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALH + T     W TCSD V ++W D P ++L +YQ LI AGLRI V+SGDTDAV+
Sbjct  395  EVQKALHANVTGLPYAWKTCSDIVGNYWADSPLSMLPIYQELIAAGLRIWVYSGDTDAVV  454

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT++RYSIDALKL T   W PW DNG+VGGW+Q Y+GLTFV V GAGHEV L  P+ A 
Sbjct  455  PVTASRYSIDALKLATVINWYPWTDNGKVGGWSQVYKGLTFVTVTGAGHEVPLLRPRQAF  514

Query  136  TXVESFLAGTSM  101
                SFL    M
Sbjct  515  ILFRSFLENKPM  526



>emb|CDP11023.1| unnamed protein product [Coffea canephora]
Length=487

 Score =   160 bits (406),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 101/140 (72%), Gaps = 2/140 (1%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQ+ALHV    S  +W TC   V+  WKD   ++L+  + L T+G+RI ++SG+TDAVI
Sbjct  349  EVQQALHVR--GSPVKWETCGLTVHYAWKDSARSLLNTIKELTTSGIRIWIYSGNTDAVI  406

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            P+TSTRYS+ AL LPT   + PWY++GQVGGWTQ+YEGLTFVAV  AGHEV LH PK AL
Sbjct  407  PITSTRYSLRALNLPTVGSYLPWYEDGQVGGWTQQYEGLTFVAVNAAGHEVPLHKPKQAL  466

Query  136  TXVESFLAGTSMPGXQRIXD  77
            T  ++FLAGT +   ++  D
Sbjct  467  TIFKAFLAGTPLATSKQFSD  486



>ref|XP_003566409.1| PREDICTED: serine carboxypeptidase II-1 [Brachypodium distachyon]
 ref|XP_003568700.1| PREDICTED: serine carboxypeptidase II-1 [Brachypodium distachyon]
Length=469

 Score =   160 bits (405),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 92/133 (69%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKA H + T     W  CSD++++ WKD P ++L +Y  LI AG+RI VFSGD D+V+
Sbjct  328  EVQKAFHANVTGMPYAWNPCSDDLFEHWKDSPRSMLPIYHELIAAGIRIWVFSGDADSVV  387

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            P+T+TRYSIDAL LPT + W PWY+  +V GW Q Y+GLT V +RGAGHEV LH P+ AL
Sbjct  388  PLTATRYSIDALYLPTVTNWYPWYEEEEVAGWCQVYKGLTLVTIRGAGHEVPLHRPQQAL  447

Query  136  TXVESFLAGTSMP  98
               E FL    MP
Sbjct  448  KLFEHFLQDKPMP  460



>gb|KHN42831.1| Serine carboxypeptidase 24 [Glycine soja]
Length=460

 Score =   160 bits (405),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 93/133 (70%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQ A+H + TN   +W  CSD +   WKD   +VL +Y+ LI AGLRI VFSGDTD+V+
Sbjct  326  EVQIAMHANVTNIPYKWTACSDVLLKNWKDSEISVLPIYKELIAAGLRIWVFSGDTDSVV  385

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TR+S++ L L T + W PWY  GQVGGWT+ Y+GLTF  VRGAGHEV L  PK A 
Sbjct  386  PVTATRFSLNHLNLRTRTRWYPWYSGGQVGGWTEVYDGLTFATVRGAGHEVPLFQPKRAY  445

Query  136  TXVESFLAGTSMP  98
               +SFLAG  +P
Sbjct  446  ILFKSFLAGNELP  458



>ref|XP_003519151.1| PREDICTED: serine carboxypeptidase 24-like isoform 1 [Glycine 
max]
Length=461

 Score =   160 bits (404),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 93/133 (70%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQ A+H + TN   +W  CSD +   WKD   +VL +Y+ LI AGLRI VFSGDTD+V+
Sbjct  327  EVQIAMHANVTNIPYKWTACSDVLLKNWKDSEISVLPIYKELIAAGLRIWVFSGDTDSVV  386

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TR+S++ L L T + W PWY  GQVGGWT+ Y+GLTF  VRGAGHEV L  PK A 
Sbjct  387  PVTATRFSLNHLNLRTRTRWYPWYSGGQVGGWTEVYDGLTFATVRGAGHEVPLFQPKRAY  446

Query  136  TXVESFLAGTSMP  98
               +SFLAG  +P
Sbjct  447  ILFKSFLAGNELP  459



>gb|EMT08964.1| Serine carboxypeptidase 2 [Aegilops tauschii]
Length=389

 Score =   159 bits (401),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 96/135 (71%), Gaps = 1/135 (1%)
 Frame = -3

Query  496  EVQKALHVHTTNS-SXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAV  320
            +VQ+ALH + T +    W TCS  +   W D P ++L +Y+ LI AGLRI VFSGDTDAV
Sbjct  247  DVQRALHANVTGAMDYTWATCSHTINTHWHDTPRSMLPIYKELIAAGLRIWVFSGDTDAV  306

Query  319  IPVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLA  140
            +P+ +TR+SI AL LPT + W PWYD+ +VGGW+Q Y+GLT V++RGAGHEV LH P+ A
Sbjct  307  VPLAATRHSIGALGLPTTTSWYPWYDDQEVGGWSQVYKGLTLVSIRGAGHEVPLHRPRQA  366

Query  139  LTXVESFLAGTSMPG  95
            L   + FL G  MPG
Sbjct  367  LVLFQQFLQGKPMPG  381



>ref|XP_007009787.1| Serine carboxypeptidase-like 27 isoform 1 [Theobroma cacao]
 gb|EOY18597.1| Serine carboxypeptidase-like 27 isoform 1 [Theobroma cacao]
Length=552

 Score =   161 bits (407),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 84/166 (51%), Positives = 97/166 (58%), Gaps = 33/166 (20%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALH + T  S  W TCSD V ++W D P ++L +Y+ LI AG RI V+SGDTDAV+
Sbjct  386  EVQKALHANVTGISYPWQTCSDLVGNYWADAPLSMLPIYKELIAAGFRIWVYSGDTDAVV  445

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNG---------------------------------  236
            PVT+TRYSIDALKLPT + W PWYDNG                                 
Sbjct  446  PVTATRYSIDALKLPTVTNWYPWYDNGKVSTDNVIQFLELVSVEIGLHRCLSHQISHFLI  505

Query  235  QVGGWTQEYEGLTFVAVRGAGHEVALHXPKLALTXVESFLAGTSMP  98
            QVGGW+Q Y GLTFV V GAGHEV LH P+ A     SFL    MP
Sbjct  506  QVGGWSQAYRGLTFVTVTGAGHEVPLHRPRQAFILFRSFLENKPMP  551



>emb|CDM82001.1| unnamed protein product [Triticum aestivum]
Length=463

 Score =   160 bits (404),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 91/133 (68%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKA   + T     W  CSD ++++WKD P ++L +Y+ LI AG+RI VFSGD D+V+
Sbjct  322  EVQKAFRANVTGIPYAWTGCSDVLFEYWKDSPRSMLPIYRELIAAGIRIWVFSGDADSVV  381

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            P+T TRYSIDAL LPT + W PWYD  +V GW Q Y+GLT V +RGAGHEV LH P+ AL
Sbjct  382  PLTGTRYSIDALYLPTVTNWYPWYDEEEVAGWCQVYKGLTLVTIRGAGHEVPLHRPRQAL  441

Query  136  TXVESFLAGTSMP  98
               E FL    MP
Sbjct  442  KLFEHFLQDKPMP  454



>ref|XP_007011905.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY29524.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=465

 Score =   159 bits (403),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 92/133 (69%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            +VQKA+H +TT    +W  CSD +   WKD   +VL +Y+ LI AGLRI VFSGDTD+V+
Sbjct  331  DVQKAMHANTTGIPYKWTACSDVLIKNWKDSENSVLPIYKELIAAGLRIWVFSGDTDSVV  390

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TR+S+  L L   +PW PWY   QVGGWT+ Y+GLTF  VRGAGHEV L  PK A 
Sbjct  391  PVTATRFSLSHLNLHIKTPWYPWYSGNQVGGWTEVYQGLTFATVRGAGHEVPLFQPKRAF  450

Query  136  TXVESFLAGTSMP  98
               +SFLAG  +P
Sbjct  451  ILYKSFLAGKELP  463



>ref|XP_011469672.1| PREDICTED: serine carboxypeptidase-like 27 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=455

 Score =   159 bits (402),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 95/133 (71%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALH + T  S  W TCSD + + W D P ++L +YQ LI AGL+I V+SGDTDAV+
Sbjct  322  EVQKALHANVTGLSYPWKTCSDIIGNNWSDSPRSMLPIYQELIAAGLKIWVYSGDTDAVV  381

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TRYSIDALKLPT + W PWYD+G+VGG +Q Y+GLT V + GAGH V L  P+ A 
Sbjct  382  PVTATRYSIDALKLPTIANWSPWYDSGKVGGRSQIYKGLTLVTITGAGHLVPLLRPREAF  441

Query  136  TXVESFLAGTSMP  98
               +SFL    MP
Sbjct  442  ILFKSFLENKPMP  454



>emb|CAA18212.1| SERINE CARBOXYPEPTIDASE II-like protein [Arabidopsis thaliana]
 emb|CAB79799.1| SERINE CARBOXYPEPTIDASE II-like protein [Arabidopsis thaliana]
Length=425

 Score =   158 bits (400),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 95/132 (72%), Gaps = 9/132 (7%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALH+        W+ CSD V + W D P +VL++Y  LI AGLRI VFSGD DAV+
Sbjct  285  EVQKALHL--------WL-CSDVVSEHWNDSPSSVLNIYHELIAAGLRIWVFSGDADAVV  335

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVTSTRYSIDAL L   S + PWY +GQVGGW+Q+Y GL FV VRGAGHEV LH PK AL
Sbjct  336  PVTSTRYSIDALNLRPLSAYGPWYLDGQVGGWSQQYAGLNFVTVRGAGHEVPLHRPKQAL  395

Query  136  TXVESFLAGTSM  101
               ++F++GT +
Sbjct  396  ALFKAFISGTPL  407



>ref|XP_004307399.1| PREDICTED: serine carboxypeptidase-like 27 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=458

 Score =   159 bits (402),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 95/133 (71%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALH + T  S  W TCSD + + W D P ++L +YQ LI AGL+I V+SGDTDAV+
Sbjct  325  EVQKALHANVTGLSYPWKTCSDIIGNNWSDSPRSMLPIYQELIAAGLKIWVYSGDTDAVV  384

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TRYSIDALKLPT + W PWYD+G+VGG +Q Y+GLT V + GAGH V L  P+ A 
Sbjct  385  PVTATRYSIDALKLPTIANWSPWYDSGKVGGRSQIYKGLTLVTITGAGHLVPLLRPREAF  444

Query  136  TXVESFLAGTSMP  98
               +SFL    MP
Sbjct  445  ILFKSFLENKPMP  457



>ref|XP_008649461.1| PREDICTED: serine carboxypeptidase 2-like isoform X2 [Zea mays]
 gb|AFW77518.1| hypothetical protein ZEAMMB73_509500 [Zea mays]
Length=491

 Score =   159 bits (403),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 95/144 (66%), Gaps = 11/144 (8%)
 Frame = -3

Query  496  EVQKALHVHTTNS-----SXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGD  332
            EVQ+ALH + T       +  W TCSD + + W D P +VL +Y+ LI AGLRI VFSGD
Sbjct  341  EVQRALHANVTAGAGGAMNYTWATCSDTINNNWGDSPKSVLHIYKELIAAGLRIWVFSGD  400

Query  331  TDAVIPVTSTRYSIDALKLPTXSPWRPWYD------NGQVGGWTQEYEGLTFVAVRGAGH  170
            TDAV+P+T+TRYSIDAL LPT   W PWYD        +VGGW+Q YEGLT V VRGAGH
Sbjct  401  TDAVVPLTATRYSIDALNLPTVVSWYPWYDAKEQKQQQEVGGWSQVYEGLTLVTVRGAGH  460

Query  169  EVALHXPKLALTXVESFLAGTSMP  98
            EV LH P+ AL     FL G  MP
Sbjct  461  EVPLHRPRQALILFRHFLRGKPMP  484



>gb|ACU19747.1| unknown [Glycine max]
Length=282

 Score =   155 bits (391),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 90/133 (68%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALH + T     W  C+D + + W D P ++L +YQ LI  G+RI VFSGDTD+V+
Sbjct  111  EVQKALHANVTGIPYSWAGCNDVIVENWGDSPLSMLSIYQELIEGGIRIWVFSGDTDSVV  170

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT++RYSI AL L T   W  WYDN +VGGW+Q YEGLT V VRGAGHEV LH P+   
Sbjct  171  PVTASRYSIRALNLSTIINWYAWYDNDEVGGWSQVYEGLTLVTVRGAGHEVPLHKPRQGF  230

Query  136  TXVESFLAGTSMP  98
               ++FL   +MP
Sbjct  231  ILFKTFLEDKNMP  243



>ref|XP_008352213.1| PREDICTED: serine carboxypeptidase 24-like, partial [Malus domestica]
Length=332

 Score =   156 bits (394),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 93/133 (70%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            +VQKA+H + T    +W  CSD +Y++W D   +VL  Y+ LI AGLRI VFSGDTD+V+
Sbjct  197  DVQKAMHANVTRIPYKWTACSDVLYEYWXDSEYSVLPTYKELIAAGLRIWVFSGDTDSVV  256

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TR+S++ L L   +PW PWY   QVGGWT+ Y+GLTF  VRGAGHEV L   +  L
Sbjct  257  PVTATRFSLNHLNLTIKTPWYPWYSGRQVGGWTEVYDGLTFATVRGAGHEVPLIQAERGL  316

Query  136  TXVESFLAGTSMP  98
            T  +SFLAG  +P
Sbjct  317  TLFKSFLAGKKLP  329



>ref|XP_010548637.1| PREDICTED: serine carboxypeptidase 24 [Tarenaya hassleriana]
Length=466

 Score =   159 bits (401),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 91/133 (68%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            +VQ+A H + T    +W  CSD +   W+D   +VL +Y+ LITAGLRI VFSGDTD+V+
Sbjct  331  DVQRAFHANLTRIPYKWTACSDVLIKNWRDSDSSVLPIYKELITAGLRIWVFSGDTDSVV  390

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TR+S+  L LP  + W PWY   QV GWT+EY+GLTF  VRGAGHEV L  PK AL
Sbjct  391  PVTATRFSLSHLNLPVKTRWYPWYSGKQVAGWTEEYKGLTFATVRGAGHEVPLFQPKRAL  450

Query  136  TXVESFLAGTSMP  98
                SFLAG  +P
Sbjct  451  VLFRSFLAGKKLP  463



>dbj|BAK02399.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92622.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=463

 Score =   158 bits (400),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 90/133 (68%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKA   + T     W  CSD + D WKD P ++L +Y+ LI AG+RI VFSGD D+V+
Sbjct  322  EVQKAFRANVTGIPYSWTACSDVLSDHWKDSPRSMLPIYRELIAAGIRIWVFSGDADSVV  381

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            P+T+TRYSIDAL LPT + W PWYD  +V GW Q Y+GLT V +RGAGHEV LH P+ AL
Sbjct  382  PLTATRYSIDALYLPTVTNWYPWYDEEEVAGWCQVYKGLTLVTIRGAGHEVPLHRPQQAL  441

Query  136  TXVESFLAGTSMP  98
               E FL    MP
Sbjct  442  KLFEHFLQDKPMP  454



>ref|XP_006841720.1| hypothetical protein AMTR_s00003p00256450 [Amborella trichopoda]
 gb|ERN03395.1| hypothetical protein AMTR_s00003p00256450 [Amborella trichopoda]
Length=395

 Score =   157 bits (397),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 93/133 (70%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            +VQ+ALHV   N    W  C++E+++ W D   +VL +Y+ LI AGLRI V+SGDTD  +
Sbjct  257  DVQRALHVTDGNHLRNWTICNEEIFNGWADSKPSVLSIYKKLIAAGLRIWVYSGDTDGRV  316

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PV STRYS++AL +PT SPWRPWY + QV GW QEY+GLTF   +GAGH V +  PK +L
Sbjct  317  PVLSTRYSLNALGIPTLSPWRPWYHDKQVSGWVQEYDGLTFATFKGAGHAVPIFKPKSSL  376

Query  136  TXVESFLAGTSMP  98
               +SFL G S+P
Sbjct  377  AFFKSFLFGESLP  389



>ref|XP_009792407.1| PREDICTED: serine carboxypeptidase 24-like [Nicotiana sylvestris]
Length=468

 Score =   158 bits (400),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 92/133 (69%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            +VQKA+H +TT  S  W  CSD +   WKD   ++L +Y+ L+ AGLRI VFSGDTD+V+
Sbjct  334  DVQKAMHANTTGISYSWTACSDILLKNWKDSDDSMLPIYKKLMAAGLRIWVFSGDTDSVV  393

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TR+S+  L L   +PW PWY   QVGGWT+ Y+GLTF  VRGAGHEV L  P+ A 
Sbjct  394  PVTATRFSLSHLNLKIKTPWYPWYSGSQVGGWTEVYDGLTFATVRGAGHEVPLFQPRRAF  453

Query  136  TXVESFLAGTSMP  98
               +SFLAG  +P
Sbjct  454  ILFQSFLAGKELP  466



>ref|XP_010432944.1| PREDICTED: serine carboxypeptidase-like 29 [Camelina sativa]
Length=480

 Score =   158 bits (400),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 95/132 (72%), Gaps = 0/132 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKALHV    +  +W TCS+ V   WKD   +VL++Y  LI AGLRI VFSGD DAV+
Sbjct  331  EVQKALHVPPGLAPSKWDTCSNVVNGHWKDSSSSVLNIYHELIAAGLRIWVFSGDADAVV  390

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVTSTR+SIDAL L   S + PWY + QVGGW+Q+Y GL FV VRGAGHEV LH PK AL
Sbjct  391  PVTSTRHSIDALNLHPLSVYGPWYLDEQVGGWSQQYAGLNFVTVRGAGHEVPLHRPKQAL  450

Query  136  TXVESFLAGTSM  101
               ++F++GT +
Sbjct  451  ALFKAFISGTPL  462



>ref|XP_010505098.1| PREDICTED: serine carboxypeptidase-like 26 [Camelina sativa]
Length=453

 Score =   158 bits (399),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 91/133 (68%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKA+H + T  +  W TCSD V + W D P ++L +Y+ LI AGLRI VFSGDTD+V+
Sbjct  320  EVQKAMHANITGLAYPWKTCSDIVGEKWADSPLSMLPIYKELIAAGLRIWVFSGDTDSVV  379

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            P+T TRYSI ALKL   S W PW DNGQVGGW Q Y+GLT V + GAGHEV LH P+   
Sbjct  380  PITGTRYSIRALKLQPLSKWYPWNDNGQVGGWIQVYKGLTLVTIHGAGHEVPLHRPRRGF  439

Query  136  TXVESFLAGTSMP  98
               +SFL    +P
Sbjct  440  LLFQSFLDNKPLP  452



>gb|KJB76567.1| hypothetical protein B456_012G094900 [Gossypium raimondii]
Length=482

 Score =   158 bits (400),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 83/163 (51%), Positives = 97/163 (60%), Gaps = 30/163 (18%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTC------------------------------SDEVYDFWKD  407
            EVQKALH + T  S  W TC                              SD V ++W D
Sbjct  319  EVQKALHANVTALSYPWQTCRYDHFLNTSRIFKIFVSNIYFIRICKSLFYSDIVGNYWTD  378

Query  406  CPXTVLDVYQXLITAGLRIXVFSGDTDAVIPVTSTRYSIDALKLPTXSPWRPWYDNGQVG  227
             P ++L +Y+ LI AGLRI V+SGDTDAV+PVT+TRYSIDALKLPT   W PWYDNG+VG
Sbjct  379  APLSMLPIYKELIAAGLRIWVYSGDTDAVVPVTATRYSIDALKLPTVINWYPWYDNGKVG  438

Query  226  GWTQEYEGLTFVAVRGAGHEVALHXPKLALTXVESFLAGTSMP  98
            GW+Q Y+GLT V V GAGHEV LH P+ A     SFL    MP
Sbjct  439  GWSQAYKGLTLVTVTGAGHEVPLHRPRQAFILFRSFLENKLMP  481



>ref|XP_006294202.1| hypothetical protein CARUB_v10023198mg [Capsella rubella]
 gb|EOA27100.1| hypothetical protein CARUB_v10023198mg [Capsella rubella]
Length=451

 Score =   157 bits (398),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 91/133 (68%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKA+H + T  +  W  CSD V + W D P ++L +Y+ LI AGLRI VFSGDTD+V+
Sbjct  318  EVQKAMHANITGLAYSWKGCSDIVGEKWADSPLSMLPIYKELIAAGLRIWVFSGDTDSVV  377

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT TRYSI ALKL   S W PW DNGQVGGW+Q Y+GLT V + GAGHEV LH P+   
Sbjct  378  PVTGTRYSIRALKLQPVSKWYPWNDNGQVGGWSQVYQGLTLVTIHGAGHEVPLHRPRRGF  437

Query  136  TXVESFLAGTSMP  98
               +SFL    +P
Sbjct  438  LLFQSFLDNKPLP  450



>ref|XP_003549539.1| PREDICTED: serine carboxypeptidase 24-like [Glycine max]
 gb|KHN17498.1| Serine carboxypeptidase 24 [Glycine soja]
Length=460

 Score =   157 bits (398),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 92/133 (69%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKA+H + TN   +W  CSD +   WKD   +VL +Y+ LI AGL+I VFSGDTD+V+
Sbjct  326  EVQKAMHANVTNIPYKWTACSDVLLKNWKDSAISVLPIYKELIAAGLKIWVFSGDTDSVV  385

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TR+S++ L L   + W PWY  GQVGGWT+ Y+GLTF  VRGAGHEV L  PK A 
Sbjct  386  PVTATRFSLNHLNLSIRTRWYPWYSGGQVGGWTEVYDGLTFATVRGAGHEVPLFQPKRAY  445

Query  136  TXVESFLAGTSMP  98
               +SFLA   +P
Sbjct  446  ILFKSFLAAKELP  458



>ref|XP_010323187.1| PREDICTED: serine carboxypeptidase 24 isoform X3 [Solanum lycopersicum]
Length=400

 Score =   156 bits (395),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 93/133 (70%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            +VQ+A+H + T  S +W  CSD +   WKD   ++L +Y+ L+ AGLRI +FSGDTD+V+
Sbjct  267  DVQRAMHANLTKISYKWTACSDILLKNWKDSDDSMLPIYKKLMAAGLRIWMFSGDTDSVV  326

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TR+S+  L L   +PW PWY   QVGGWT+ Y+GLTF  +RGAGHEV L  PK AL
Sbjct  327  PVTATRFSLSHLNLKIKTPWYPWYSGTQVGGWTEVYDGLTFATIRGAGHEVPLFQPKRAL  386

Query  136  TXVESFLAGTSMP  98
               +SFLAG  +P
Sbjct  387  ILFQSFLAGKELP  399



>ref|XP_010656616.1| PREDICTED: serine carboxypeptidase 24 isoform X2 [Vitis vinifera]
Length=381

 Score =   156 bits (394),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 90/133 (68%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            +VQKA+H ++T    +W  CS  +  +W D   ++L +Y+ LI AGLRI VFSGDTDAV+
Sbjct  244  DVQKAMHANSTGIPYKWTACSGVLIKYWNDSEASMLPIYKELIEAGLRIWVFSGDTDAVV  303

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TR+S++ L L   +PW PWY  GQVGGWT+ YEGLTF  VRGAGHEV L  P  A 
Sbjct  304  PVTATRFSLNHLNLTVKTPWYPWYSGGQVGGWTEVYEGLTFATVRGAGHEVPLFQPMRAF  363

Query  136  TXVESFLAGTSMP  98
                SFL G  +P
Sbjct  364  LLFRSFLGGKQLP  376



>ref|XP_010509560.1| PREDICTED: serine carboxypeptidase-like 26 [Camelina sativa]
Length=451

 Score =   157 bits (397),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 91/133 (68%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKA+H + T  +  W  CSD V + W D P ++L +Y+ LI AGLRI VFSGDTD+V+
Sbjct  318  EVQKAMHANITGLAYSWKGCSDIVGEKWADSPLSMLPIYKELIAAGLRIWVFSGDTDSVV  377

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            P+T TRYSI ALKL   S W PW DNGQVGGW+Q Y+GLT V + GAGHEV LH P+   
Sbjct  378  PITGTRYSIRALKLQPLSKWYPWNDNGQVGGWSQVYKGLTLVTIHGAGHEVPLHRPRRGF  437

Query  136  TXVESFLAGTSMP  98
               +SFL    +P
Sbjct  438  LLFQSFLDNKPLP  450



>ref|XP_008645971.1| PREDICTED: serine carboxypeptidase-like 34 [Zea mays]
Length=158

 Score =   150 bits (378),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 87/133 (65%), Gaps = 1/133 (1%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            +VQ ALH + T     W  CSD +Y  W D   + L V + L+  GLR+ VFSGDTD  I
Sbjct  22   DVQAALHANVTKIGYNWTRCSDAIYT-WNDAAFSTLPVIRKLVAGGLRLWVFSGDTDGRI  80

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVTSTR ++  L L T   W PWYD+ QVGGWT  YEGLTFV +RGAGHEV LH P+ AL
Sbjct  81   PVTSTRLTLHKLGLKTVQEWTPWYDHLQVGGWTIVYEGLTFVTIRGAGHEVPLHAPRQAL  140

Query  136  TXVESFLAGTSMP  98
            T   +FLAGT MP
Sbjct  141  TLFSNFLAGTKMP  153



>emb|CAA70815.1| serine carboxypeptidase II, CP-MII [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86051.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=476

 Score =   157 bits (397),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 97/136 (71%), Gaps = 2/136 (1%)
 Frame = -3

Query  496  EVQKALHVHTTNS-SXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAV  320
            +VQ ALH + T + +  W TCSD +   W D P ++L +Y+ LI AGLRI VFSGDTDAV
Sbjct  333  DVQTALHANVTGAMNYTWATCSDTINTHWHDAPRSMLPIYRELIAAGLRIWVFSGDTDAV  392

Query  319  IPVTSTRYSIDALKLPTXSPWRPWYDNGQ-VGGWTQEYEGLTFVAVRGAGHEVALHXPKL  143
            +P+T+TRYSI AL L T + W PWYD+ Q VGGW+Q Y+GLT V+VRGAGHEV LH P+ 
Sbjct  393  VPLTATRYSIGALGLATTTSWYPWYDDLQEVGGWSQVYKGLTLVSVRGAGHEVPLHRPRQ  452

Query  142  ALTXVESFLAGTSMPG  95
            AL   + FL G  MPG
Sbjct  453  ALILFQQFLQGKPMPG  468



>emb|CDP02317.1| unnamed protein product [Coffea canephora]
Length=471

 Score =   157 bits (397),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 74/136 (54%), Positives = 95/136 (70%), Gaps = 0/136 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            +VQKALH +TT    +W  CS+ +   W D   +VL +Y+ LI AGLRI VFSGD D+V+
Sbjct  336  DVQKALHANTTRIPYKWTACSETLNRNWNDTDSSVLPIYRKLIAAGLRIWVFSGDVDSVV  395

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TRY++  LKL T +PW PWY   QVGGWT+ Y+GLTF  VRGAGHEV L  P+ AL
Sbjct  396  PVTATRYALAQLKLDTDAPWYPWYVKKQVGGWTEVYKGLTFATVRGAGHEVPLLKPRAAL  455

Query  136  TXVESFLAGTSMPGXQ  89
              ++SFLAG  +P  +
Sbjct  456  QLLKSFLAGQPLPSLK  471



>ref|XP_008649460.1| PREDICTED: serine carboxypeptidase 2-like isoform X1 [Zea mays]
Length=492

 Score =   157 bits (397),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 81/145 (56%), Positives = 95/145 (66%), Gaps = 12/145 (8%)
 Frame = -3

Query  496  EVQKALHVHTTNS-----SXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGD  332
            EVQ+ALH + T       +  W TCSD + + W D P +VL +Y+ LI AGLRI VFSGD
Sbjct  341  EVQRALHANVTAGAGGAMNYTWATCSDTINNNWGDSPKSVLHIYKELIAAGLRIWVFSGD  400

Query  331  TDAVIPVTSTRYSIDALKLPTXSPWRPWYD-------NGQVGGWTQEYEGLTFVAVRGAG  173
            TDAV+P+T+TRYSIDAL LPT   W PWYD         +VGGW+Q YEGLT V VRGAG
Sbjct  401  TDAVVPLTATRYSIDALNLPTVVSWYPWYDAKEQQKQQQEVGGWSQVYEGLTLVTVRGAG  460

Query  172  HEVALHXPKLALTXVESFLAGTSMP  98
            HEV LH P+ AL     FL G  MP
Sbjct  461  HEVPLHRPRQALILFRHFLRGKPMP  485



>ref|XP_010516783.1| PREDICTED: serine carboxypeptidase-like 26 [Camelina sativa]
Length=454

 Score =   156 bits (395),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 92/133 (69%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            EVQKA+H + T  +  W TCSD V + W D P ++L +Y+ LI AGLRI VFSGDTD+V+
Sbjct  321  EVQKAMHANITGLAYPWKTCSDIVGEKWADSPLSMLPIYKELIAAGLRIWVFSGDTDSVV  380

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            P+T TRYSI ALKL   S W PW D+GQVGGW+Q Y+GLT V + GAGHEV LH P+   
Sbjct  381  PITGTRYSIRALKLQPLSKWYPWNDSGQVGGWSQVYKGLTLVTIHGAGHEVPLHRPRRGF  440

Query  136  TXVESFLAGTSMP  98
               +SFL    +P
Sbjct  441  LLFQSFLDNKPLP  453



>emb|CDY39224.1| BnaA03g50360D [Brassica napus]
Length=463

 Score =   157 bits (396),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 91/133 (68%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            +VQ+A+H + T    +W  CSD +   WKD   T+L VY+ L  AGLRI VFSGDTD+V+
Sbjct  328  DVQRAMHANVTGIRYKWTACSDVLIKNWKDSDKTMLPVYKELAAAGLRIWVFSGDTDSVV  387

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TR+S+  L LP  + W PWY   QVGGWT+ Y+GLTF  VRGAGHEV L  PK AL
Sbjct  388  PVTATRFSLSHLNLPVKTRWYPWYSGNQVGGWTEVYKGLTFATVRGAGHEVPLFEPKRAL  447

Query  136  TXVESFLAGTSMP  98
               +SFLAG  +P
Sbjct  448  ILFKSFLAGKELP  460



>ref|XP_009631140.1| PREDICTED: serine carboxypeptidase 24-like [Nicotiana tomentosiformis]
Length=464

 Score =   156 bits (395),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 92/133 (69%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            +VQ+A+H +TT  S  W  CSD +   WKD   ++L +Y+ L+ AG+RI VFSGDTD+V+
Sbjct  330  DVQRAMHANTTGISYSWTACSDILLKNWKDSDDSMLPIYKKLMAAGIRIWVFSGDTDSVV  389

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TR+S+  L L   +PW PWY   QVGGWT+ Y+GLTF  VRGAGHEV L  P+ A 
Sbjct  390  PVTATRFSLSHLNLKIKTPWYPWYSGAQVGGWTEVYDGLTFATVRGAGHEVPLFQPRRAF  449

Query  136  TXVESFLAGTSMP  98
               +SFLAG  +P
Sbjct  450  ILFQSFLAGKELP  462



>ref|XP_010323186.1| PREDICTED: serine carboxypeptidase 24 isoform X2 [Solanum lycopersicum]
Length=478

 Score =   156 bits (395),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 93/133 (70%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            +VQ+A+H + T  S +W  CSD +   WKD   ++L +Y+ L+ AGLRI +FSGDTD+V+
Sbjct  345  DVQRAMHANLTKISYKWTACSDILLKNWKDSDDSMLPIYKKLMAAGLRIWMFSGDTDSVV  404

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TR+S+  L L   +PW PWY   QVGGWT+ Y+GLTF  +RGAGHEV L  PK AL
Sbjct  405  PVTATRFSLSHLNLKIKTPWYPWYSGTQVGGWTEVYDGLTFATIRGAGHEVPLFQPKRAL  464

Query  136  TXVESFLAGTSMP  98
               +SFLAG  +P
Sbjct  465  ILFQSFLAGKELP  477



>ref|XP_004242603.2| PREDICTED: serine carboxypeptidase 24 isoform X1 [Solanum lycopersicum]
Length=488

 Score =   156 bits (395),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 93/133 (70%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            +VQ+A+H + T  S +W  CSD +   WKD   ++L +Y+ L+ AGLRI +FSGDTD+V+
Sbjct  355  DVQRAMHANLTKISYKWTACSDILLKNWKDSDDSMLPIYKKLMAAGLRIWMFSGDTDSVV  414

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TR+S+  L L   +PW PWY   QVGGWT+ Y+GLTF  +RGAGHEV L  PK AL
Sbjct  415  PVTATRFSLSHLNLKIKTPWYPWYSGTQVGGWTEVYDGLTFATIRGAGHEVPLFQPKRAL  474

Query  136  TXVESFLAGTSMP  98
               +SFLAG  +P
Sbjct  475  ILFQSFLAGKELP  487



>ref|XP_002275684.1| PREDICTED: serine carboxypeptidase 24 isoform X1 [Vitis vinifera]
 ref|XP_010656614.1| PREDICTED: serine carboxypeptidase 24 isoform X1 [Vitis vinifera]
 emb|CBI36538.3| unnamed protein product [Vitis vinifera]
Length=469

 Score =   156 bits (394),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 90/133 (68%), Gaps = 0/133 (0%)
 Frame = -3

Query  496  EVQKALHVHTTNSSXEWVTCSDEVYDFWKDCPXTVLDVYQXLITAGLRIXVFSGDTDAVI  317
            +VQKA+H ++T    +W  CS  +  +W D   ++L +Y+ LI AGLRI VFSGDTDAV+
Sbjct  332  DVQKAMHANSTGIPYKWTACSGVLIKYWNDSEASMLPIYKELIEAGLRIWVFSGDTDAVV  391

Query  316  PVTSTRYSIDALKLPTXSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHXPKLAL  137
            PVT+TR+S++ L L   +PW PWY  GQVGGWT+ YEGLTF  VRGAGHEV L  P  A 
Sbjct  392  PVTATRFSLNHLNLTVKTPWYPWYSGGQVGGWTEVYEGLTFATVRGAGHEVPLFQPMRAF  451

Query  136  TXVESFLAGTSMP  98
                SFL G  +P
Sbjct  452  LLFRSFLGGKQLP  464



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 567283606695