BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF001C14

Length=525
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006364007.1|  PREDICTED: leucine-rich repeat receptor-like...    119   3e-27   Solanum tuberosum [potatoes]
ref|XP_004234641.1|  PREDICTED: leucine-rich repeat receptor-like...    118   5e-27   Solanum lycopersicum
ref|XP_009786199.1|  PREDICTED: leucine-rich repeat receptor-like...    116   2e-26   Nicotiana sylvestris
ref|XP_010547579.1|  PREDICTED: leucine-rich repeat receptor-like...    113   2e-25   Tarenaya hassleriana [spider flower]
ref|XP_009605676.1|  PREDICTED: leucine-rich repeat receptor-like...    113   3e-25   Nicotiana tomentosiformis
gb|KHN13035.1|  Leucine-rich repeat receptor-like serine/threonin...    112   4e-25   Glycine soja [wild soybean]
ref|XP_010518800.1|  PREDICTED: leucine-rich repeat receptor-like...    112   7e-25   Tarenaya hassleriana [spider flower]
ref|NP_001237715.1|  receptor-like protein kinase 2 precursor           112   8e-25   Glycine max [soybeans]
dbj|BAK52390.1|  leucine rich repeat receptor protein kinase CLAV...    112   8e-25   Solanum peruvianum [Peruvian tomato]
ref|XP_009771232.1|  PREDICTED: leucine-rich repeat receptor-like...    111   1e-24   Nicotiana sylvestris
dbj|BAK52389.1|  leucine rich repeat receptor protein kinase CLAV...    111   1e-24   Solanum pennellii
ref|NP_001274713.1|  leucine-rich repeat receptor-like serine/thr...    111   1e-24   Solanum lycopersicum
gb|KHN42601.1|  Leucine-rich repeat receptor-like serine/threonin...    110   2e-24   Glycine soja [wild soybean]
ref|NP_001235080.1|  receptor-like protein kinase 3 precursor           109   5e-24   
ref|XP_010105101.1|  Leucine-rich repeat receptor-like serine/thr...    109   5e-24   Morus notabilis
gb|KHG04200.1|  Leucine-rich repeat receptor-like serine/threonin...    108   7e-24   Gossypium arboreum [tree cotton]
ref|XP_009375880.1|  PREDICTED: leucine-rich repeat receptor-like...    108   9e-24   Pyrus x bretschneideri [bai li]
ref|XP_008393812.1|  PREDICTED: leucine-rich repeat receptor-like...    108   1e-23   
ref|XP_007156674.1|  hypothetical protein PHAVU_002G007600g             108   1e-23   Phaseolus vulgaris [French bean]
ref|XP_008344369.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    108   1e-23   
ref|XP_008354741.1|  PREDICTED: leucine-rich repeat receptor-like...    108   1e-23   
gb|KJB43996.1|  hypothetical protein B456_007G228700                    108   1e-23   Gossypium raimondii
ref|XP_009354585.1|  PREDICTED: leucine-rich repeat receptor-like...    108   1e-23   Pyrus x bretschneideri [bai li]
ref|XP_011099433.1|  PREDICTED: leucine-rich repeat receptor-like...    108   1e-23   Sesamum indicum [beniseed]
ref|XP_006357743.1|  PREDICTED: leucine-rich repeat receptor-like...    108   2e-23   Solanum tuberosum [potatoes]
ref|XP_009613990.1|  PREDICTED: leucine-rich repeat receptor-like...    107   2e-23   Nicotiana tomentosiformis
gb|KDP32143.1|  hypothetical protein JCGZ_12604                         107   3e-23   Jatropha curcas
ref|XP_011073654.1|  PREDICTED: leucine-rich repeat receptor-like...    107   4e-23   Sesamum indicum [beniseed]
ref|XP_002531999.1|  Receptor protein kinase CLAVATA1 precursor, ...    106   5e-23   Ricinus communis
ref|XP_007047661.1|  Leucine-rich receptor-like protein kinase fa...    105   8e-23   
ref|XP_010683073.1|  PREDICTED: leucine-rich repeat receptor-like...    105   9e-23   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB18115.1|  hypothetical protein B456_003G034500                    105   1e-22   Gossypium raimondii
ref|XP_004509039.1|  PREDICTED: leucine-rich repeat receptor-like...    105   2e-22   Cicer arietinum [garbanzo]
ref|XP_003635561.1|  PREDICTED: leucine-rich repeat receptor-like...    104   3e-22   Vitis vinifera
emb|CDP02660.1|  unnamed protein product                                104   3e-22   Coffea canephora [robusta coffee]
ref|XP_011021820.1|  PREDICTED: leucine-rich repeat receptor-like...    104   4e-22   Populus euphratica
gb|KDO78771.1|  hypothetical protein CISIN_1g001816mg                   103   4e-22   Citrus sinensis [apfelsine]
ref|XP_006466390.1|  PREDICTED: leucine-rich repeat receptor-like...    103   4e-22   Citrus sinensis [apfelsine]
ref|XP_006426178.1|  hypothetical protein CICLE_v10024796mg             103   4e-22   Citrus clementina [clementine]
ref|XP_002310320.2|  hypothetical protein POPTR_0007s14500g             103   4e-22   Populus trichocarpa [western balsam poplar]
ref|XP_007208421.1|  hypothetical protein PRUPE_ppa000739mg             103   6e-22   Prunus persica
ref|XP_004288299.1|  PREDICTED: leucine-rich repeat receptor-like...    103   7e-22   Fragaria vesca subsp. vesca
emb|CBI35733.3|  unnamed protein product                                103   7e-22   Vitis vinifera
gb|AIT56194.1|  leucine-rich repeat receptor-like serine/threonin...    103   8e-22   Dimocarpus longan [longan]
ref|XP_004511796.1|  PREDICTED: leucine-rich repeat receptor-like...    103   9e-22   
ref|XP_008237309.1|  PREDICTED: leucine-rich repeat receptor-like...    102   1e-21   
gb|KHG03710.1|  Leucine-rich repeat receptor-like serine/threonin...    102   1e-21   Gossypium arboreum [tree cotton]
ref|NP_001235065.1|  receptor-like protein kinase 1 precursor           102   1e-21   Glycine max [soybeans]
gb|KJB48795.1|  hypothetical protein B456_008G087500                    102   1e-21   Gossypium raimondii
gb|KHN47566.1|  Leucine-rich repeat receptor-like serine/threonin...    101   2e-21   Glycine soja [wild soybean]
ref|XP_010271550.1|  PREDICTED: leucine-rich repeat receptor-like...    101   4e-21   Nelumbo nucifera [Indian lotus]
ref|XP_007163887.1|  hypothetical protein PHAVU_L008000g              93.6    5e-21   Phaseolus vulgaris [French bean]
ref|XP_006279943.1|  hypothetical protein CARUB_v10025808mg             100   5e-21   Capsella rubella
ref|XP_006852730.1|  hypothetical protein AMTR_s00033p00083200          100   8e-21   
gb|AES94465.2|  LRR receptor-like kinase family protein                 100   9e-21   Medicago truncatula
ref|XP_010268646.1|  PREDICTED: leucine-rich repeat receptor-like...    100   1e-20   Nelumbo nucifera [Indian lotus]
ref|XP_006650665.1|  PREDICTED: leucine-rich repeat receptor-like...  99.8    1e-20   Oryza brachyantha
gb|KFK28239.1|  hypothetical protein AALP_AA8G490400                  99.8    1e-20   Arabis alpina [alpine rockcress]
dbj|BAJ84911.1|  predicted protein                                    99.4    2e-20   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008790445.1|  PREDICTED: leucine-rich repeat receptor-like...  99.4    2e-20   Phoenix dactylifera
ref|XP_010444585.1|  PREDICTED: leucine-rich repeat receptor-like...  99.4    2e-20   Camelina sativa [gold-of-pleasure]
ref|XP_004143422.1|  PREDICTED: leucine-rich repeat receptor-like...  99.4    2e-20   Cucumis sativus [cucumbers]
ref|XP_004955422.1|  PREDICTED: leucine-rich repeat receptor-like...  99.0    2e-20   
ref|XP_007155783.1|  hypothetical protein PHAVU_003G231400g           99.0    2e-20   Phaseolus vulgaris [French bean]
ref|NP_201371.1|  leucine-rich repeat receptor-like serine/threon...  99.0    2e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008441113.1|  PREDICTED: leucine-rich repeat receptor-like...  98.6    3e-20   Cucumis melo [Oriental melon]
ref|NP_001237688.1|  receptor-like protein kinase precursor           98.6    3e-20   Glycine max [soybeans]
ref|XP_006393995.1|  hypothetical protein EUTSA_v10003584mg           98.6    3e-20   
ref|XP_002864974.1|  hypothetical protein ARALYDRAFT_496807           98.2    4e-20   
gb|KJB18113.1|  hypothetical protein B456_003G034400                  98.2    4e-20   Gossypium raimondii
gb|KHN01704.1|  Leucine-rich repeat receptor-like serine/threonin...  97.8    5e-20   Glycine soja [wild soybean]
ref|XP_010463501.1|  PREDICTED: leucine-rich repeat receptor-like...  97.8    5e-20   Camelina sativa [gold-of-pleasure]
ref|XP_008787754.1|  PREDICTED: leucine-rich repeat receptor-like...  97.8    6e-20   Phoenix dactylifera
ref|XP_008785758.1|  PREDICTED: leucine-rich repeat receptor-like...  97.1    9e-20   
gb|AAO26313.1|  receptor-like protein kinase                          95.5    1e-19   Elaeis guineensis
gb|AAY32333.1|  RLK1                                                  96.7    1e-19   Phyllostachys praecox [zaozhu]
ref|XP_003608587.1|  Receptor-like protein kinase                     96.7    1e-19   Medicago truncatula
gb|EAY92008.1|  hypothetical protein OsI_13698                        96.7    1e-19   Oryza sativa Indica Group [Indian rice]
gb|AAP68887.1|  putative receptor-like protein kinase 1               96.7    1e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004981595.1|  PREDICTED: leucine-rich repeat receptor-like...  96.3    2e-19   Setaria italica
ref|XP_002461427.1|  hypothetical protein SORBIDRAFT_02g002450        96.3    2e-19   Sorghum bicolor [broomcorn]
gb|EYU41357.1|  hypothetical protein MIMGU_mgv1a000718mg              96.3    2e-19   Erythranthe guttata [common monkey flower]
ref|XP_010484412.1|  PREDICTED: leucine-rich repeat receptor-like...  96.3    2e-19   Camelina sativa [gold-of-pleasure]
ref|XP_003611507.1|  Receptor-like protein kinase                     96.3    2e-19   
ref|XP_010939309.1|  PREDICTED: leucine-rich repeat receptor-like...  95.9    2e-19   Elaeis guineensis
emb|CDY45620.1|  BnaCnng13280D                                        95.9    3e-19   Brassica napus [oilseed rape]
ref|NP_001051418.1|  Os03g0773700                                     95.9    3e-19   
gb|EEE60014.1|  hypothetical protein OsJ_12761                        95.9    3e-19   Oryza sativa Japonica Group [Japonica rice]
gb|EMT14290.1|  Receptor protein kinase CLAVATA1                      95.5    3e-19   
ref|XP_010023395.1|  PREDICTED: leucine-rich repeat receptor-like...  95.5    4e-19   
gb|EAZ02682.1|  hypothetical protein OsI_24796                        95.5    4e-19   Oryza sativa Indica Group [Indian rice]
dbj|BAF01968.1|  receptor protein kinase like protein                 91.7    4e-19   Arabidopsis thaliana [mouse-ear cress]
gb|EMS57320.1|  Leucine-rich repeat receptor-like serine/threonin...  95.1    4e-19   Triticum urartu
gb|KCW59634.1|  hypothetical protein EUGRSUZ_H023832                  95.1    4e-19   Eucalyptus grandis [rose gum]
emb|CDY08759.1|  BnaA06g24650D                                        95.1    4e-19   Brassica napus [oilseed rape]
ref|XP_009150662.1|  PREDICTED: leucine-rich repeat receptor-like...  95.1    4e-19   Brassica rapa
dbj|BAC82955.1|  putative OsLRK1(receptor-type protein kinase)        95.1    5e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010936307.1|  PREDICTED: leucine-rich repeat receptor-like...  94.7    6e-19   
ref|XP_009397330.1|  PREDICTED: leucine-rich repeat receptor-like...  93.6    1e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009399076.1|  PREDICTED: leucine-rich repeat receptor-like...  93.6    2e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006657429.1|  PREDICTED: leucine-rich repeat receptor-like...  93.2    2e-18   Oryza brachyantha
emb|CDY23037.1|  BnaC07g31500D                                        93.2    2e-18   Brassica napus [oilseed rape]
ref|XP_006290548.1|  hypothetical protein CARUB_v10016631mg           93.2    2e-18   Capsella rubella
gb|KFK34238.1|  hypothetical protein AALP_AA5G119100                  92.8    3e-18   Arabis alpina [alpine rockcress]
ref|NP_190536.1|  CLAVATA1-related receptor kinase-like protein       92.8    3e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009408581.1|  PREDICTED: leucine-rich repeat receptor-like...  92.8    3e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003557615.1|  PREDICTED: leucine-rich repeat receptor-like...  92.0    5e-18   Brachypodium distachyon [annual false brome]
ref|XP_010515326.1|  PREDICTED: leucine-rich repeat receptor-like...  92.0    5e-18   Camelina sativa [gold-of-pleasure]
gb|EMS67650.1|  Leucine-rich repeat receptor-like serine/threonin...  92.0    5e-18   Triticum urartu
emb|CDY02112.1|  BnaA03g40550D                                        92.0    6e-18   
emb|CDX91053.1|  BnaC02g05440D                                        85.1    7e-18   
emb|CDY68180.1|  BnaAnng26370D                                        85.1    7e-18   Brassica napus [oilseed rape]
ref|XP_003558681.1|  PREDICTED: leucine-rich repeat receptor-like...  91.7    7e-18   Brachypodium distachyon [annual false brome]
ref|XP_002466378.1|  hypothetical protein SORBIDRAFT_01g006690        91.7    8e-18   Sorghum bicolor [broomcorn]
ref|XP_009136515.1|  PREDICTED: leucine-rich repeat receptor-like...  91.7    8e-18   Brassica rapa
ref|XP_010943209.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...  91.3    9e-18   
ref|XP_010426489.1|  PREDICTED: leucine-rich repeat receptor-like...  91.3    1e-17   Camelina sativa [gold-of-pleasure]
ref|XP_009396449.1|  PREDICTED: leucine-rich repeat receptor-like...  91.3    1e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008665503.1|  PREDICTED: leucine-rich repeat receptor-like...  91.3    1e-17   Zea mays [maize]
dbj|BAJ89729.1|  predicted protein                                    90.9    1e-17   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010503631.1|  PREDICTED: leucine-rich repeat receptor-like...  90.9    1e-17   Camelina sativa [gold-of-pleasure]
ref|XP_002875982.1|  hypothetical protein ARALYDRAFT_906265           90.9    1e-17   Arabidopsis lyrata subsp. lyrata
gb|ADB85328.1|  putative receptor protein kinase                      90.5    1e-17   Phyllostachys edulis [kikko-chiku]
ref|XP_006404116.1|  hypothetical protein EUTSA_v10010092mg           90.9    1e-17   
gb|EMT20446.1|  Receptor protein kinase CLAVATA1                      90.1    2e-17   
ref|XP_010028033.1|  PREDICTED: leucine-rich repeat receptor-like...  89.7    3e-17   Eucalyptus grandis [rose gum]
ref|XP_009787949.1|  PREDICTED: leucine-rich repeat receptor-like...  89.7    3e-17   Nicotiana sylvestris
ref|XP_008787359.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...  89.7    3e-17   
gb|EPS74129.1|  hypothetical protein M569_00625                       89.4    5e-17   Genlisea aurea
ref|XP_006649672.1|  PREDICTED: leucine-rich repeat receptor-like...  87.8    1e-16   Oryza brachyantha
ref|XP_010941985.1|  PREDICTED: leucine-rich repeat receptor-like...  87.8    2e-16   Elaeis guineensis
gb|ABE79572.2|  Protein kinase                                        87.4    2e-16   Medicago truncatula
ref|XP_003592924.1|  Receptor-like protein kinase                     87.4    2e-16   Medicago truncatula
ref|XP_009394620.1|  PREDICTED: leucine-rich repeat receptor-like...  87.4    2e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001049453.1|  Os03g0228800                                     87.4    2e-16   
gb|AAM27467.1|AC099732_4  Putative receptor-like protein kinase       87.4    2e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009394785.1|  PREDICTED: leucine-rich repeat receptor-like...  86.7    3e-16   
gb|ACN35202.1|  unknown                                               83.6    4e-16   Zea mays [maize]
gb|EEC74807.1|  hypothetical protein OsI_10619                        85.9    6e-16   Oryza sativa Indica Group [Indian rice]
ref|XP_008356104.1|  PREDICTED: leucine-rich repeat receptor-like...  85.9    7e-16   
ref|XP_010228930.1|  PREDICTED: leucine-rich repeat receptor-like...  85.5    9e-16   
ref|XP_009395647.1|  PREDICTED: leucine-rich repeat receptor-like...  85.5    9e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001169902.1|  uncharacterized protein LOC100383797             84.3    9e-16   
ref|XP_009363288.1|  PREDICTED: leucine-rich repeat receptor-like...  85.1    1e-15   Pyrus x bretschneideri [bai li]
dbj|BAJ99137.1|  predicted protein                                    85.1    1e-15   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EYU33270.1|  hypothetical protein MIMGU_mgv1a0010742mg             79.7    1e-15   Erythranthe guttata [common monkey flower]
ref|XP_009603651.1|  PREDICTED: leucine-rich repeat receptor-like...  84.7    2e-15   Nicotiana tomentosiformis
ref|XP_006431638.1|  hypothetical protein CICLE_v10000148mg           84.3    2e-15   
tpg|DAA59489.1|  TPA: putative leucine-rich repeat receptor-like ...  84.3    2e-15   
ref|XP_011092305.1|  PREDICTED: leucine-rich repeat receptor-like...  84.3    2e-15   Sesamum indicum [beniseed]
ref|XP_007214567.1|  hypothetical protein PRUPE_ppa000837mg           84.3    2e-15   Prunus persica
ref|XP_004230451.1|  PREDICTED: leucine-rich repeat receptor-like...  84.0    3e-15   Solanum lycopersicum
gb|AAX94895.1|  Similar to receptor-like protein kinase               79.0    3e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007040964.1|  Leucine-rich receptor-like protein kinase fa...  83.6    3e-15   
ref|XP_008349109.1|  PREDICTED: leucine-rich repeat receptor-like...  83.6    4e-15   Malus domestica [apple tree]
ref|XP_009368577.1|  PREDICTED: leucine-rich repeat receptor-like...  83.6    4e-15   Pyrus x bretschneideri [bai li]
gb|EMT15500.1|  hypothetical protein F775_52402                       83.2    4e-15   
ref|XP_004295533.1|  PREDICTED: leucine-rich repeat receptor-like...  83.2    6e-15   Fragaria vesca subsp. vesca
ref|XP_011087678.1|  PREDICTED: leucine-rich repeat receptor-like...  83.2    6e-15   
gb|AHJ14779.1|  CLAVATA1                                              83.2    6e-15   Rhododendron ovatum
ref|XP_002304615.1|  leucine-rich repeat transmembrane protein ki...  82.8    6e-15   Populus trichocarpa [western balsam poplar]
ref|XP_007041221.1|  Leucine-rich receptor-like protein kinase fa...  82.8    7e-15   
gb|AAX96206.1|  Similar to receptor-like protein kinase 3             82.8    7e-15   Oryza sativa Japonica Group [Japonica rice]
emb|CBI29704.3|  unnamed protein product                              82.8    7e-15   Vitis vinifera
emb|CDP04113.1|  unnamed protein product                              82.8    7e-15   Coffea canephora [robusta coffee]
ref|XP_002263291.2|  PREDICTED: leucine-rich repeat receptor-like...  82.8    7e-15   Vitis vinifera
gb|KDP23869.1|  hypothetical protein JCGZ_27138                       82.4    8e-15   Jatropha curcas
ref|XP_006858565.1|  hypothetical protein AMTR_s00071p00176900        82.4    9e-15   
ref|XP_004485432.1|  PREDICTED: leucine-rich repeat receptor-like...  82.4    9e-15   Cicer arietinum [garbanzo]
ref|XP_009403711.1|  PREDICTED: leucine-rich repeat receptor-like...  82.4    1e-14   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACL54651.1|  unknown                                               81.3    1e-14   Zea mays [maize]
gb|KDO44093.1|  hypothetical protein CISIN_1g001922mg                 82.4    1e-14   Citrus sinensis [apfelsine]
ref|XP_006492589.1|  PREDICTED: leucine-rich repeat receptor-like...  82.4    1e-14   Citrus sinensis [apfelsine]
ref|XP_006349327.1|  PREDICTED: leucine-rich repeat receptor-like...  82.4    1e-14   Solanum tuberosum [potatoes]
ref|XP_010912647.1|  PREDICTED: leucine-rich repeat receptor-like...  82.4    1e-14   Elaeis guineensis
gb|KJB32855.1|  hypothetical protein B456_005G265400                  82.0    1e-14   Gossypium raimondii
gb|EEC67924.1|  hypothetical protein OsI_35629                        82.0    1e-14   Oryza sativa Indica Group [Indian rice]
ref|XP_004985112.1|  PREDICTED: leucine-rich repeat receptor-like...  82.0    1e-14   Setaria italica
ref|XP_010520784.1|  PREDICTED: leucine-rich repeat receptor-like...  81.6    2e-14   Tarenaya hassleriana [spider flower]
gb|EMT21762.1|  Receptor protein kinase CLAVATA1                      79.0    2e-14   
emb|CDO97616.1|  unnamed protein product                              81.6    2e-14   Coffea canephora [robusta coffee]
emb|CDY54567.1|  BnaA08g30460D                                        81.6    2e-14   Brassica napus [oilseed rape]
ref|XP_011022287.1|  PREDICTED: leucine-rich repeat receptor-like...  81.6    2e-14   Populus euphratica
ref|XP_009108464.1|  PREDICTED: leucine-rich repeat receptor-like...  81.6    2e-14   Brassica rapa
ref|XP_010520783.1|  PREDICTED: leucine-rich repeat receptor-like...  81.6    2e-14   Tarenaya hassleriana [spider flower]
emb|CAN71863.1|  hypothetical protein VITISV_023530                   81.6    2e-14   Vitis vinifera
ref|XP_006468612.1|  PREDICTED: leucine-rich repeat receptor-like...  81.6    2e-14   Citrus sinensis [apfelsine]
ref|NP_001145765.1|  uncharacterized protein LOC100279272             81.3    2e-14   
tpg|DAA44225.1|  TPA: putative leucine-rich repeat receptor-like ...  81.3    2e-14   
gb|KCW62729.1|  hypothetical protein EUGRSUZ_G00319                   80.9    3e-14   Eucalyptus grandis [rose gum]
ref|XP_010065309.1|  PREDICTED: leucine-rich repeat receptor-like...  80.9    3e-14   Eucalyptus grandis [rose gum]
ref|XP_002869943.1|  hypothetical protein ARALYDRAFT_492844           80.9    3e-14   
ref|XP_011004294.1|  PREDICTED: leucine-rich repeat receptor-like...  80.9    3e-14   Populus euphratica
ref|XP_008799579.1|  PREDICTED: leucine-rich repeat receptor-like...  80.9    3e-14   Phoenix dactylifera
ref|XP_010930574.1|  PREDICTED: leucine-rich repeat receptor-like...  80.9    3e-14   Elaeis guineensis
ref|XP_002297907.2|  leucine-rich repeat transmembrane protein ki...  80.9    3e-14   Populus trichocarpa [western balsam poplar]
emb|CDX93999.1|  BnaC07g36330D                                        80.5    3e-14   
emb|CDX98665.1|  BnaA03g44500D                                        80.5    3e-14   
gb|KHG14208.1|  Leucine-rich repeat receptor-like serine/threonin...  80.9    4e-14   Gossypium arboreum [tree cotton]
ref|XP_009137141.1|  PREDICTED: leucine-rich repeat receptor-like...  80.5    4e-14   Brassica rapa
dbj|BAJ90459.1|  predicted protein                                    80.5    4e-14   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006413888.1|  hypothetical protein EUTSA_v10024310mg           80.5    4e-14   Eutrema salsugineum [saltwater cress]
ref|XP_010439602.1|  PREDICTED: leucine-rich repeat receptor-like...  80.5    4e-14   Camelina sativa [gold-of-pleasure]
ref|XP_010449207.1|  PREDICTED: leucine-rich repeat receptor-like...  80.5    4e-14   Camelina sativa [gold-of-pleasure]
ref|XP_010243895.1|  PREDICTED: leucine-rich repeat receptor-like...  80.5    4e-14   Nelumbo nucifera [Indian lotus]
ref|XP_009355307.1|  PREDICTED: leucine-rich repeat receptor-like...  80.5    4e-14   Pyrus x bretschneideri [bai li]
emb|CDY31445.1|  BnaC03g63790D                                        80.5    4e-14   Brassica napus [oilseed rape]
ref|XP_009401113.1|  PREDICTED: leucine-rich repeat receptor-like...  80.5    4e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003576141.1|  PREDICTED: leucine-rich repeat receptor-like...  80.5    4e-14   Brachypodium distachyon [annual false brome]
gb|KDO77158.1|  hypothetical protein CISIN_1g012213mg                 79.3    5e-14   Citrus sinensis [apfelsine]
ref|XP_009133589.1|  PREDICTED: leucine-rich repeat receptor-like...  80.5    5e-14   Brassica rapa
ref|XP_006283067.1|  hypothetical protein CARUB_v10004060mg           80.5    5e-14   Capsella rubella
gb|ACN59341.1|  leucine-rich repeat receptor-like protein kinase      80.1    5e-14   Arabidopsis thaliana [mouse-ear cress]
gb|EEE51888.1|  hypothetical protein OsJ_33462                        80.1    5e-14   Oryza sativa Japonica Group [Japonica rice]
ref|NP_193760.1|  leucine-rich receptor-like protein kinase BAM3      80.1    5e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008225951.1|  PREDICTED: leucine-rich repeat receptor-like...  80.1    5e-14   Prunus mume [ume]
gb|KDP42443.1|  hypothetical protein JCGZ_00240                       80.1    5e-14   Jatropha curcas
ref|XP_006448558.1|  hypothetical protein CICLE_v10014145mg           80.1    6e-14   Citrus clementina [clementine]
ref|XP_004229499.1|  PREDICTED: leucine-rich repeat receptor-like...  80.1    6e-14   Solanum lycopersicum
ref|XP_010260843.1|  PREDICTED: leucine-rich repeat receptor-like...  79.7    7e-14   Nelumbo nucifera [Indian lotus]
ref|XP_007224667.1|  hypothetical protein PRUPE_ppa026134mg           79.3    9e-14   Prunus persica
gb|KHG23359.1|  Leucine-rich repeat receptor-like serine/threonin...  79.3    1e-13   Gossypium arboreum [tree cotton]
ref|XP_010687839.1|  PREDICTED: leucine-rich repeat receptor-like...  79.3    1e-13   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004491265.1|  PREDICTED: leucine-rich repeat receptor-like...  79.3    1e-13   Cicer arietinum [garbanzo]
ref|XP_009763204.1|  PREDICTED: leucine-rich repeat receptor-like...  79.0    1e-13   Nicotiana sylvestris
ref|XP_009600411.1|  PREDICTED: leucine-rich repeat receptor-like...  79.0    1e-13   Nicotiana tomentosiformis
gb|EYU26470.1|  hypothetical protein MIMGU_mgv1a019834mg              79.0    1e-13   Erythranthe guttata [common monkey flower]
ref|XP_010918071.1|  PREDICTED: leucine-rich repeat receptor-like...  79.0    1e-13   Elaeis guineensis
gb|KFK28659.1|  hypothetical protein AALP_AA7G028700                  79.0    1e-13   Arabis alpina [alpine rockcress]
gb|KJB32927.1|  hypothetical protein B456_005G268400                  79.0    2e-13   Gossypium raimondii
ref|XP_006859064.1|  hypothetical protein AMTR_s00068p00198250        78.6    2e-13   
ref|XP_010529317.1|  PREDICTED: leucine-rich repeat receptor-like...  78.6    2e-13   Tarenaya hassleriana [spider flower]
ref|XP_008793129.1|  PREDICTED: leucine-rich repeat receptor-like...  78.2    2e-13   
ref|XP_008218726.1|  PREDICTED: leucine-rich repeat receptor-like...  78.2    3e-13   Prunus mume [ume]
ref|XP_008793131.1|  PREDICTED: leucine-rich repeat receptor-like...  77.8    3e-13   
ref|XP_002264952.1|  PREDICTED: leucine-rich repeat receptor-like...  77.4    5e-13   Vitis vinifera
ref|XP_009415746.1|  PREDICTED: leucine-rich repeat receptor-like...  77.0    7e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008786484.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...  77.0    7e-13   
ref|XP_008347921.1|  PREDICTED: leucine-rich repeat receptor-like...  76.6    7e-13   
ref|XP_008339390.1|  PREDICTED: leucine-rich repeat receptor-like...  76.6    7e-13   
ref|XP_006356981.1|  PREDICTED: leucine-rich repeat receptor-like...  76.6    8e-13   Solanum tuberosum [potatoes]
ref|XP_009411355.1|  PREDICTED: leucine-rich repeat receptor-like...  76.6    8e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006385034.1|  hypothetical protein POPTR_0004s23260g           76.6    8e-13   Populus trichocarpa [western balsam poplar]
ref|XP_008781646.1|  PREDICTED: probable LRR receptor-like serine...  73.2    8e-13   Phoenix dactylifera
ref|XP_010924539.1|  PREDICTED: leucine-rich repeat receptor-like...  76.6    9e-13   Elaeis guineensis
ref|XP_011028346.1|  PREDICTED: leucine-rich repeat receptor-like...  76.6    9e-13   Populus euphratica
emb|CDY62258.1|  BnaCnng39750D                                        75.9    1e-12   Brassica napus [oilseed rape]
ref|XP_008795253.1|  PREDICTED: leucine-rich repeat receptor-like...  75.9    1e-12   Phoenix dactylifera
ref|XP_002526451.1|  Receptor protein kinase CLAVATA1 precursor, ...  75.9    2e-12   Ricinus communis
ref|XP_010030176.1|  PREDICTED: leucine-rich repeat receptor-like...  75.9    2e-12   Eucalyptus grandis [rose gum]
ref|XP_002532709.1|  Receptor protein kinase CLAVATA1 precursor, ...  75.5    2e-12   Ricinus communis
ref|XP_003617299.1|  Receptor-like protein kinase                     75.5    2e-12   Medicago truncatula
ref|XP_009392568.1|  PREDICTED: leucine-rich repeat receptor-like...  75.5    2e-12   Musa acuminata subsp. malaccensis [pisang utan]
gb|KCW57119.1|  hypothetical protein EUGRSUZ_I02765                   74.7    3e-12   Eucalyptus grandis [rose gum]
ref|XP_009353760.1|  PREDICTED: leucine-rich repeat receptor-like...  75.1    3e-12   Pyrus x bretschneideri [bai li]
ref|XP_010094628.1|  Leucine-rich repeat receptor-like serine/thr...  75.1    3e-12   Morus notabilis
gb|EPS62062.1|  protein kinase                                        73.9    6e-12   Genlisea aurea
gb|KHN28525.1|  Leucine-rich repeat receptor-like serine/threonin...  73.9    6e-12   Glycine soja [wild soybean]
ref|XP_006602289.1|  PREDICTED: leucine-rich repeat receptor-like...  73.9    6e-12   Glycine max [soybeans]
ref|XP_003530709.1|  PREDICTED: leucine-rich repeat receptor-like...  73.9    6e-12   Glycine max [soybeans]
ref|XP_009415213.1|  PREDICTED: leucine-rich repeat receptor-like...  73.9    7e-12   
ref|XP_009415217.1|  PREDICTED: leucine-rich repeat receptor-like...  73.9    7e-12   
gb|KJB16198.1|  hypothetical protein B456_002G217000                  73.6    8e-12   Gossypium raimondii
gb|KHG17337.1|  Leucine-rich repeat receptor-like serine/threonin...  73.6    9e-12   Gossypium arboreum [tree cotton]
gb|KJB16199.1|  hypothetical protein B456_002G217000                  73.6    9e-12   Gossypium raimondii
gb|KHM99687.1|  Leucine-rich repeat receptor-like serine/threonin...  72.8    1e-11   Glycine soja [wild soybean]
ref|XP_003545159.1|  PREDICTED: leucine-rich repeat receptor-like...  73.2    1e-11   Glycine max [soybeans]
gb|KHN12015.1|  Leucine-rich repeat receptor-like serine/threonin...  72.8    1e-11   Glycine soja [wild soybean]
ref|XP_009405747.1|  PREDICTED: leucine-rich repeat receptor-like...  72.8    1e-11   
ref|XP_004150938.1|  PREDICTED: leucine-rich repeat receptor-like...  72.8    2e-11   Cucumis sativus [cucumbers]
gb|KEH33614.1|  LRR receptor-like kinase family protein               71.6    4e-11   Medicago truncatula
ref|XP_007146301.1|  hypothetical protein PHAVU_006G029000g           71.6    4e-11   Phaseolus vulgaris [French bean]
ref|XP_010087435.1|  Leucine-rich repeat receptor-like serine/thr...  71.6    4e-11   Morus notabilis
ref|XP_006856744.1|  hypothetical protein AMTR_s00055p00012250        71.2    5e-11   
ref|XP_004155230.1|  PREDICTED: leucine-rich repeat receptor-like...  71.2    5e-11   
ref|XP_004301907.1|  PREDICTED: leucine-rich repeat receptor-like...  70.9    7e-11   Fragaria vesca subsp. vesca
gb|KHN15622.1|  Leucine-rich repeat receptor-like serine/threonin...  65.9    7e-11   Glycine soja [wild soybean]
gb|KHN07526.1|  Leucine-rich repeat receptor-like serine/threonin...  65.9    8e-11   Glycine soja [wild soybean]
ref|XP_004499483.1|  PREDICTED: leucine-rich repeat receptor-like...  70.5    9e-11   Cicer arietinum [garbanzo]
ref|NP_001170600.1|  uncharacterized protein LOC100384637             66.6    1e-10   
gb|EEC79804.1|  hypothetical protein OsI_21242                        69.7    2e-10   
ref|NP_001174552.1|  Os05g0595950                                     69.7    2e-10   
gb|KHN38370.1|  Leucine-rich repeat receptor-like serine/threonin...  69.3    2e-10   
ref|XP_008440463.1|  PREDICTED: leucine-rich repeat receptor-like...  68.9    2e-10   
gb|KJB47871.1|  hypothetical protein B456_008G045400                  68.9    2e-10   
ref|XP_003518489.2|  PREDICTED: leucine-rich repeat receptor-like...  68.9    2e-10   
gb|KHG13927.1|  Leucine-rich repeat receptor-like serine/threonin...  68.9    3e-10   
ref|XP_004143533.1|  PREDICTED: leucine-rich repeat receptor-like...  68.6    3e-10   
ref|XP_004160944.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...  68.6    4e-10   
ref|XP_006589895.1|  PREDICTED: leucine-rich repeat receptor-like...  64.7    4e-10   
ref|XP_008452253.1|  PREDICTED: leucine-rich repeat receptor-like...  68.2    5e-10   
tpg|DAA41870.1|  TPA: putative leucine-rich repeat receptor-like ...  67.8    7e-10   
ref|XP_002441645.1|  hypothetical protein SORBIDRAFT_09g030870        65.9    3e-09   
emb|CBI27382.3|  unnamed protein product                              65.1    3e-09   
ref|XP_008678021.1|  PREDICTED: leucine-rich repeat receptor-like...  65.1    4e-09   
ref|XP_004979026.1|  PREDICTED: leucine-rich repeat receptor-like...  65.1    6e-09   
ref|XP_006579172.1|  PREDICTED: leucine-rich repeat receptor-like...  61.6    9e-09   
ref|NP_001140626.1|  uncharacterized LOC100272700                     62.4    1e-08   
ref|XP_008647500.1|  PREDICTED: uncharacterized LOC100272700 isof...  63.9    1e-08   
ref|XP_008647502.1|  PREDICTED: uncharacterized LOC100272700 isof...  63.5    2e-08   
ref|XP_010416487.1|  PREDICTED: receptor protein kinase CLAVATA1-...  63.5    2e-08   
ref|XP_010471715.1|  PREDICTED: receptor protein kinase CLAVATA1 ...  63.5    2e-08   
ref|XP_006300675.1|  hypothetical protein CARUB_v10019714mg           63.5    2e-08   
ref|XP_006655663.1|  PREDICTED: leucine-rich repeat receptor-like...  63.2    2e-08   
gb|AAB58929.1|  CLV1 receptor kinase                                  63.2    2e-08   
gb|AAD02501.1|  receptor kinase                                       63.2    2e-08   
ref|XP_008466473.1|  PREDICTED: receptor protein kinase CLAVATA1      63.2    2e-08   
pir||E96787  protein T4O12.5 [imported] - Arabidopsis thaliana        62.8    2e-08
ref|NP_177710.1|  receptor protein kinase CLAVATA1                    62.8    2e-08   
ref|XP_004136488.1|  PREDICTED: receptor protein kinase CLAVATA1-...  62.8    3e-08   
gb|KJB58082.1|  hypothetical protein B456_009G193600                  62.4    4e-08   
ref|XP_010536408.1|  PREDICTED: receptor protein kinase CLAVATA1-...  62.4    4e-08   
emb|CDX73202.1|  BnaC06g36500D                                        62.0    4e-08   
gb|ADD64789.1|  CLAVATA1                                              62.0    5e-08   
ref|XP_009106236.1|  PREDICTED: receptor protein kinase CLAVATA1      62.0    5e-08   
ref|XP_006390268.1|  hypothetical protein EUTSA_v10018069mg           62.0    5e-08   
emb|CDX87661.1|  BnaA07g32120D                                        61.6    6e-08   
ref|XP_002450588.1|  hypothetical protein SORBIDRAFT_05g007480        61.6    7e-08   
ref|XP_006342066.1|  PREDICTED: receptor protein kinase CLAVATA1-...  61.2    7e-08   
ref|XP_002889046.1|  hypothetical protein ARALYDRAFT_476729           61.2    8e-08   
ref|XP_010539846.1|  PREDICTED: receptor protein kinase CLAVATA1      61.2    8e-08   
ref|XP_004291349.1|  PREDICTED: receptor protein kinase CLAVATA1      61.2    9e-08   
gb|KDP36903.1|  hypothetical protein JCGZ_08194                       60.8    1e-07   
ref|XP_004238370.1|  PREDICTED: receptor protein kinase CLAVATA1      60.5    1e-07   
ref|XP_010428620.1|  PREDICTED: receptor protein kinase CLAVATA1-...  60.1    2e-07   
gb|AAP49010.1|  CLV1-like receptor kinase                             60.1    2e-07   
ref|XP_008221401.1|  PREDICTED: receptor protein kinase CLAVATA1      59.7    2e-07   
ref|XP_002971751.1|  hypothetical protein SELMODRAFT_172284           59.7    3e-07   
ref|XP_002991545.1|  hypothetical protein SELMODRAFT_186143           59.7    3e-07   
ref|XP_011035001.1|  PREDICTED: receptor protein kinase CLAVATA1-...  59.7    3e-07   
ref|XP_007225356.1|  hypothetical protein PRUPE_ppa000916mg           59.3    3e-07   
gb|KJB29653.1|  hypothetical protein B456_005G112100                  59.3    3e-07   
gb|KHG24572.1|  Receptor protein kinase CLAVATA1                      59.3    3e-07   
ref|XP_004960969.1|  PREDICTED: leucine-rich repeat receptor-like...  59.3    3e-07   
gb|AFY06667.1|  receptor protein kinase CLAVATA1                      59.3    4e-07   
ref|XP_002307734.1|  receptor protein kinase                          59.3    4e-07   
ref|XP_009592786.1|  PREDICTED: receptor protein kinase CLAVATA1      59.3    4e-07   
ref|XP_011045060.1|  PREDICTED: receptor protein kinase CLAVATA1-...  59.3    4e-07   
ref|XP_006435205.1|  hypothetical protein CICLE_v10000156mg           58.9    5e-07   
gb|KDO84901.1|  hypothetical protein CISIN_1g002010mg                 58.9    5e-07   
ref|XP_002300697.2|  receptor protein kinase                          58.5    5e-07   
gb|EMT07441.1|  Receptor protein kinase CLAVATA1                      58.2    6e-07   
ref|XP_011074693.1|  PREDICTED: receptor protein kinase CLAVATA1-...  58.5    7e-07   
ref|XP_009766393.1|  PREDICTED: receptor protein kinase CLAVATA1      58.2    8e-07   
emb|CDP07378.1|  unnamed protein product                              53.5    9e-07   
ref|XP_009415664.1|  PREDICTED: leucine-rich repeat receptor-like...  57.8    1e-06   
gb|KHG26020.1|  Receptor protein kinase CLAVATA1                      57.8    1e-06   
emb|CAD42335.1|  hypernodulation aberrant root formation protein      57.8    1e-06   
ref|XP_002279563.1|  PREDICTED: receptor protein kinase CLAVATA1      57.8    1e-06   
ref|XP_007017845.1|  Leucine-rich receptor-like protein kinase fa...  57.8    1e-06   
emb|CBI19895.3|  unnamed protein product                              57.4    1e-06   
ref|XP_006853709.1|  hypothetical protein AMTR_s00056p00150470        57.4    1e-06   
gb|KCW58271.1|  hypothetical protein EUGRSUZ_H00963                   57.4    1e-06   
ref|XP_010069807.1|  PREDICTED: receptor protein kinase CLAVATA1-...  57.4    1e-06   
ref|XP_010935096.1|  PREDICTED: leucine-rich repeat receptor-like...  57.0    2e-06   
ref|XP_004507478.1|  PREDICTED: LOW QUALITY PROTEIN: receptor pro...  57.0    2e-06   
gb|EYU38789.1|  hypothetical protein MIMGU_mgv1a000850mg              57.0    2e-06   
ref|XP_001752668.1|  CLL1B clavata1-like receptor S/T protein kin...  56.6    3e-06   
ref|XP_008808401.1|  PREDICTED: leucine-rich repeat receptor-like...  56.6    3e-06   
ref|XP_002985227.1|  hypothetical protein SELMODRAFT_121783           56.2    3e-06   
ref|XP_002970036.1|  hypothetical protein SELMODRAFT_146738           56.2    3e-06   
ref|XP_010671767.1|  PREDICTED: receptor protein kinase CLAVATA1      56.2    3e-06   
gb|KCW58273.1|  hypothetical protein EUGRSUZ_H00964                   56.2    3e-06   
ref|XP_006473681.1|  PREDICTED: receptor protein kinase CLAVATA1-...  56.2    4e-06   
ref|XP_010026074.1|  PREDICTED: receptor protein kinase CLAVATA1      56.2    4e-06   
ref|XP_002965214.1|  hypothetical protein SELMODRAFT_83051            55.8    4e-06   
ref|XP_002962293.1|  hypothetical protein SELMODRAFT_77558            55.8    4e-06   
ref|XP_008357152.1|  PREDICTED: receptor protein kinase CLAVATA1-...  55.8    5e-06   
ref|XP_002510557.1|  Receptor protein kinase CLAVATA1 precursor, ...  55.8    5e-06   
gb|EMS49990.1|  Leucine-rich repeat receptor-like serine/threonin...  54.7    6e-06   
ref|XP_008364929.1|  PREDICTED: receptor protein kinase CLAVATA1-...  55.5    6e-06   
ref|XP_011461954.1|  PREDICTED: cysteine-rich receptor-like prote...  53.1    7e-06   
ref|NP_001238004.1|  receptor protein kinase-like protein precursor   55.1    9e-06   
dbj|BAC41332.1|  LRR receptor-like kinase                             55.1    9e-06   
ref|XP_010110004.1|  Receptor protein kinase CLAVATA1                 54.7    9e-06   
gb|KFK42020.1|  hypothetical protein AALP_AA2G201900                  54.7    9e-06   
ref|XP_009334873.1|  PREDICTED: receptor protein kinase CLAVATA1      54.7    1e-05   
gb|KHN25406.1|  Receptor protein kinase CLAVATA1                      54.7    1e-05   
gb|EYU36796.1|  hypothetical protein MIMGU_mgv1a020841mg              53.9    2e-05   
ref|XP_010249751.1|  PREDICTED: G-type lectin S-receptor-like ser...  53.5    2e-05   
ref|XP_010249750.1|  PREDICTED: G-type lectin S-receptor-like ser...  53.5    2e-05   
gb|KDP20845.1|  hypothetical protein JCGZ_21316                       53.5    2e-05   
ref|XP_011460134.1|  PREDICTED: G-type lectin S-receptor-like ser...  53.5    2e-05   
ref|XP_011460133.1|  PREDICTED: G-type lectin S-receptor-like ser...  53.5    2e-05   
dbj|BAI82122.1|  CLV1-like LRR receptor kinase                        53.5    3e-05   
emb|CAD42181.1|  serine-threonine protein kinase                      53.1    3e-05   
ref|XP_008808621.1|  PREDICTED: leucine-rich repeat receptor-like...  52.8    4e-05   
ref|XP_008233100.1|  PREDICTED: receptor protein kinase CLAVATA1-...  52.8    4e-05   
ref|XP_009418700.1|  PREDICTED: leucine-rich repeat receptor-like...  52.8    4e-05   
ref|XP_010941307.1|  PREDICTED: leucine-rich repeat receptor-like...  52.4    5e-05   
gb|AIT55304.1|  nodulation autoregulation receptor kinase             52.4    5e-05   
ref|XP_007131793.1|  hypothetical protein PHAVU_011G042000g           52.4    6e-05   
ref|XP_011083584.1|  PREDICTED: receptor protein kinase CLAVATA1      52.4    6e-05   
ref|NP_001238576.1|  receptor protein kinase-like protein precursor   52.0    7e-05   
gb|AAW71475.1|  CLV1-like receptor kinase                             52.0    8e-05   
gb|KHN39812.1|  Receptor protein kinase CLAVATA1                      51.6    8e-05   
ref|XP_003606988.1|  Receptor protein kinase CLAVATA1                 51.6    9e-05   
ref|XP_010266811.1|  PREDICTED: receptor protein kinase CLAVATA1      51.6    9e-05   
gb|KEH43634.1|  LRR receptor-like kinase                              50.4    3e-04   
ref|XP_011012341.1|  PREDICTED: G-type lectin S-receptor-like ser...  50.1    3e-04   
ref|XP_011012340.1|  PREDICTED: G-type lectin S-receptor-like ser...  50.1    3e-04   
ref|XP_011012339.1|  PREDICTED: G-type lectin S-receptor-like ser...  50.1    3e-04   
ref|XP_011012338.1|  PREDICTED: G-type lectin S-receptor-like ser...  50.1    3e-04   
ref|XP_011012337.1|  PREDICTED: G-type lectin S-receptor-like ser...  50.1    3e-04   
ref|XP_011012335.1|  PREDICTED: G-type lectin S-receptor-like ser...  50.1    3e-04   
ref|XP_011012334.1|  PREDICTED: G-type lectin S-receptor-like ser...  50.1    3e-04   
ref|XP_004306383.1|  PREDICTED: receptor-like serine/threonine-pr...  50.1    3e-04   
ref|XP_008345858.1|  PREDICTED: G-type lectin S-receptor-like ser...  49.7    4e-04   
ref|XP_007213482.1|  hypothetical protein PRUPE_ppa023389mg           49.7    4e-04   
gb|KHG02381.1|  Receptor-like serine/threonine-protein kinase SD1-8   49.7    5e-04   
ref|XP_006656496.1|  PREDICTED: leucine-rich repeat receptor-like...  49.3    5e-04   
ref|XP_009370405.1|  PREDICTED: G-type lectin S-receptor-like ser...  49.3    6e-04   
ref|XP_009352927.1|  PREDICTED: G-type lectin S-receptor-like ser...  49.3    6e-04   
ref|XP_008387933.1|  PREDICTED: receptor protein kinase CLAVATA1      48.9    7e-04   
gb|AIB04258.1|  S-locus receptor kinase s-haplotype 1                 48.9    8e-04   
ref|XP_008371231.1|  PREDICTED: receptor-like serine/threonine-pr...  47.4    9e-04   



>ref|XP_006364007.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Solanum tuberosum]
Length=1022

 Score =   119 bits (297),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 65/92 (71%), Positives = 70/92 (76%), Gaps = 8/92 (9%)
 Frame = -1

Query  525   GKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGT  346
             GKKEGV+KILD RLSTVP+HE MH+FYVA+LCVEEQAVERPKMREVVQMLTELPK P G 
Sbjct  916   GKKEGVLKILDPRLSTVPLHEVMHVFYVAMLCVEEQAVERPKMREVVQMLTELPK-PSGP  974

Query  345   KPEGTTACES-----SALEPPPSTGTSDDAKD  265
             K E +T  ES      ALE P  T T  D KD
Sbjct  975   KTEDSTITESPPSSGPALESP--TSTPGDTKD  1004



>ref|XP_004234641.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Solanum lycopersicum]
Length=1022

 Score =   118 bits (295),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 57/85 (67%), Positives = 69/85 (81%), Gaps = 6/85 (7%)
 Frame = -1

Query  525  GKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGT  346
            GKKEGV+KILD+RLSTVP+HE MH+FYVA+LCVEEQAVERPKMREVVQMLTELP      
Sbjct  916  GKKEGVLKILDARLSTVPLHEVMHVFYVAMLCVEEQAVERPKMREVVQMLTELP------  969

Query  345  KPEGTTACESSALEPPPSTGTSDDA  271
            KP G  + +S+  E PPS+G + ++
Sbjct  970  KPSGPKSGDSTITESPPSSGPASES  994



>ref|XP_009786199.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nicotiana sylvestris]
Length=1015

 Score =   116 bits (290),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 66/109 (61%), Positives = 75/109 (69%), Gaps = 17/109 (16%)
 Frame = -1

Query  525   GKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGT  346
             GKKEGV+KILD RLSTVP+HE MH+FYVA+LCVEEQAVERPKMREVVQ+LTELP      
Sbjct  913   GKKEGVLKILDPRLSTVPLHEVMHVFYVAMLCVEEQAVERPKMREVVQILTELP------  966

Query  345   KPEGTTACESSALEPPPST-----------GTSDDAKDqqqppPDLLSI  232
              P GT + ES+  E PPS+           G + D      PPPDLLSI
Sbjct  967   NPSGTKSGESTITESPPSSAPASELPTSAPGNTKDNHQPPSPPPDLLSI  1015



>ref|XP_010547579.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Tarenaya hassleriana]
Length=1015

 Score =   113 bits (283),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 59/96 (61%), Positives = 70/96 (73%), Gaps = 1/96 (1%)
 Frame = -1

Query  519   KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
             KE VVK++D RLS+VPI E  H+FYVA+LCVEEQAVERP MREVVQ+L E+PK PP +KP
Sbjct  921   KESVVKVIDPRLSSVPIQEVTHVFYVAMLCVEEQAVERPTMREVVQILAEIPKMPP-SKP  979

Query  339   EGTTACESSALEPPPSTGTSDDAKDqqqppPDLLSI  232
             + T   +S A E  P  G  DD  D  + PPDLLSI
Sbjct  980   DPTAGEKSPAHESSPKGGRGDDGNDPGRVPPDLLSI  1015



>ref|XP_009605676.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nicotiana tomentosiformis]
Length=1017

 Score =   113 bits (282),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 70/108 (65%), Positives = 79/108 (73%), Gaps = 13/108 (12%)
 Frame = -1

Query  525   GKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGT  346
             GKK+GV+KILD RLSTVP++E MH+FYVA+LCVEEQAVERP MREVVQ+LTELPK PPG+
Sbjct  913   GKKDGVLKILDPRLSTVPLNEVMHVFYVAMLCVEEQAVERPTMREVVQILTELPK-PPGS  971

Query  345   KPEGTTACES-----SALEPPPSTGTSDDAKD-----qqqppPDLLSI  232
             K   +T  ES     SALE P  T    D KD      Q PPPDLLSI
Sbjct  972   KSGDSTVTESPSPSASALESP--TSAPGDTKDHHQPTPQSPPPDLLSI  1017



>gb|KHN13035.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Glycine soja]
Length=724

 Score =   112 bits (279),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 65/101 (64%), Positives = 76/101 (75%), Gaps = 7/101 (7%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
            KEGV+K+LD RL +VP+HE MH+FYVA+LCVEEQAVERP MREVVQ+LTELPK PPG+K 
Sbjct  626  KEGVLKVLDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQILTELPK-PPGSKE  684

Query  339  EGTTACESS-----ALEPPPSTGTSDDAKDqqqppPDLLSI  232
               T  ESS     ALE  PS+ + +D    Q PPPDLLSI
Sbjct  685  GDLTITESSLSSSNALE-SPSSASKEDQNPPQSPPPDLLSI  724



>ref|XP_010518800.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Tarenaya hassleriana]
Length=1011

 Score =   112 bits (279),  Expect = 7e-25, Method: Composition-based stats.
 Identities = 59/96 (61%), Positives = 70/96 (73%), Gaps = 1/96 (1%)
 Frame = -1

Query  519   KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
             KE VVK+LD RLS+VPI+E MH+FYVA+LCVEE AVERP MREVVQ+LTE+PK  P  KP
Sbjct  917   KESVVKVLDPRLSSVPINEVMHVFYVAMLCVEELAVERPTMREVVQILTEIPKMRP-PKP  975

Query  339   EGTTACESSALEPPPSTGTSDDAKDqqqppPDLLSI  232
             E   A +S A +  P  G+  D  D  + PPDLLSI
Sbjct  976   EPNAAEDSPAYQSSPMAGSGKDGNDVSRDPPDLLSI  1011



>ref|NP_001237715.1| receptor-like protein kinase 2 precursor [Glycine max]
 gb|AAF91323.1|AF244889_1 receptor-like protein kinase 2 [Glycine max]
Length=1012

 Score =   112 bits (279),  Expect = 8e-25, Method: Composition-based stats.
 Identities = 65/101 (64%), Positives = 76/101 (75%), Gaps = 7/101 (7%)
 Frame = -1

Query  519   KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
             KEGV+K+LD RL +VP+HE MH+FYVA+LCVEEQAVERP MREVVQ+LTELPK PPG+K 
Sbjct  914   KEGVLKVLDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQILTELPK-PPGSKE  972

Query  339   EGTTACESS-----ALEPPPSTGTSDDAKDqqqppPDLLSI  232
                T  ESS     ALE  PS+ + +D    Q PPPDLLSI
Sbjct  973   GDLTITESSLSSSNALE-SPSSASKEDQNPPQSPPPDLLSI  1012



>dbj|BAK52390.1| leucine rich repeat receptor protein kinase CLAVATA1 [Solanum 
peruvianum]
Length=1015

 Score =   112 bits (279),  Expect = 8e-25, Method: Composition-based stats.
 Identities = 69/108 (64%), Positives = 79/108 (73%), Gaps = 13/108 (12%)
 Frame = -1

Query  525   GKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGT  346
             GKK+GV+KILD RLSTVP++E MH+FYVALLCVEEQAVERP MREVVQ+LTELPK PPG 
Sbjct  911   GKKDGVLKILDPRLSTVPLNEVMHVFYVALLCVEEQAVERPTMREVVQILTELPK-PPGA  969

Query  345   KPEGTTACE-----SSALEPPPSTGTSDDAKD-----qqqppPDLLSI  232
             K + +T  +     +SALE P  T    D KD      Q PPPDLLSI
Sbjct  970   KSDDSTGTDHSPPSASALESP--TSIPGDTKDHHQPTPQSPPPDLLSI  1015



>ref|XP_009771232.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nicotiana sylvestris]
Length=1019

 Score =   111 bits (277),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 65/107 (61%), Positives = 78/107 (73%), Gaps = 10/107 (9%)
 Frame = -1

Query  525   GKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGT  346
             GKK+GV+KILD RLSTVP++E MH+FYVA+LCVEEQAVERP MREVVQ+LTELPK PPG+
Sbjct  914   GKKDGVLKILDPRLSTVPLNEVMHVFYVAMLCVEEQAVERPTMREVVQILTELPK-PPGS  972

Query  345   KPEGTTACE------SSALEPPPS-TGTSDDAKDqqqpp--PDLLSI  232
             K   +T  E      +SALE P S +G ++D          PDLLSI
Sbjct  973   KSGDSTVTELPPPSVASALESPASASGDTNDHHQPTPQSPPPDLLSI  1019



>dbj|BAK52389.1| leucine rich repeat receptor protein kinase CLAVATA1 [Solanum 
pennellii]
Length=1016

 Score =   111 bits (277),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 69/108 (64%), Positives = 79/108 (73%), Gaps = 13/108 (12%)
 Frame = -1

Query  525   GKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGT  346
             GKK+GV+KILD RLSTVP++E MH+FYVALLCVEEQAVERP MREVVQ+LTELPK PPG 
Sbjct  912   GKKDGVLKILDPRLSTVPLNEVMHVFYVALLCVEEQAVERPTMREVVQILTELPK-PPGA  970

Query  345   KPEGTTACE-----SSALEPPPSTGTSDDAKD-----qqqppPDLLSI  232
             K + +T  +     +SALE P  T    D KD      Q PPPDLLSI
Sbjct  971   KSDDSTVTDQSPPSASALESP--TSIPGDTKDHHQPTPQSPPPDLLSI  1016



>ref|NP_001274713.1| leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1-like precursor [Solanum lycopersicum]
 dbj|BAK52388.1| leucine rich repeat receptor protein kinase CLAVATA1 [Solanum 
lycopersicum]
 dbj|BAK52391.1| leucine rich repeat receptor protein kinase CLAVATA1 [Solanum 
lycopersicum]
Length=1016

 Score =   111 bits (277),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 69/108 (64%), Positives = 79/108 (73%), Gaps = 13/108 (12%)
 Frame = -1

Query  525   GKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGT  346
             GKK+GV+KILD RLSTVP++E MH+FYVALLCVEEQAVERP MREVVQ+LTELPK PPG 
Sbjct  912   GKKDGVLKILDPRLSTVPLNEVMHVFYVALLCVEEQAVERPTMREVVQILTELPK-PPGA  970

Query  345   KPEGTTACE-----SSALEPPPSTGTSDDAKD-----qqqppPDLLSI  232
             K + +T  +     +SALE P  T    D KD      Q PPPDLLSI
Sbjct  971   KSDDSTVTDQSPPSASALESP--TSIPGDTKDHHQPTPQSPPPDLLSI  1016



>gb|KHN42601.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Glycine soja]
Length=724

 Score =   110 bits (274),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 64/101 (63%), Positives = 75/101 (74%), Gaps = 7/101 (7%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
            KEGV+K+LD RL +VP+HE MH+FYVA+LCVEEQAVERP MREVVQ+LTELPK PP +K 
Sbjct  626  KEGVLKVLDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQILTELPK-PPDSKE  684

Query  339  EGTTACESS-----ALEPPPSTGTSDDAKDqqqppPDLLSI  232
               T  ESS     ALE  PS+ + +D    Q PPPDLLSI
Sbjct  685  GNLTITESSLSSSNALE-SPSSASKEDQNPPQSPPPDLLSI  724



>ref|NP_001235080.1| receptor-like protein kinase 3 precursor [Glycine max]
 gb|AAF91324.1|AF244890_1 receptor-like protein kinase 3 [Glycine max]
Length=1012

 Score =   109 bits (273),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 64/101 (63%), Positives = 75/101 (74%), Gaps = 7/101 (7%)
 Frame = -1

Query  519   KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
             KEGV+K+LD RL +VP+HE MH+FYVA+LCVEEQAVERP MREVVQ+LTELPK PP +K 
Sbjct  914   KEGVLKVLDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQILTELPK-PPDSKE  972

Query  339   EGTTACESS-----ALEPPPSTGTSDDAKDqqqppPDLLSI  232
                T  ESS     ALE  PS+ + +D    Q PPPDLLSI
Sbjct  973   GNLTITESSLSSSNALE-SPSSASKEDQNPPQSPPPDLLSI  1012



>ref|XP_010105101.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Morus notabilis]
 gb|EXC03886.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Morus notabilis]
Length=1021

 Score =   109 bits (273),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 54/78 (69%), Positives = 61/78 (78%), Gaps = 3/78 (4%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
            KEGV+KILD RL +VPIHE MH+FYVA+LCVEEQAVERP MREVVQ+LTELPK P   + 
Sbjct  917  KEGVLKILDPRLPSVPIHEVMHVFYVAMLCVEEQAVERPTMREVVQILTELPKPPGSKQG  976

Query  339  EGTTACESSALEPPPSTG  286
            + TT  ESS   PPP  G
Sbjct  977  DSTTITESS---PPPVGG  991



>gb|KHG04200.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Gossypium arboreum]
Length=1014

 Score =   108 bits (271),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 56/98 (57%), Positives = 67/98 (68%), Gaps = 4/98 (4%)
 Frame = -1

Query  519   KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
             KEGV+K+LD RL +VP+HE MH+FYVA+LCVEEQAVERP MREVVQ+LTELPK P    P
Sbjct  919   KEGVLKVLDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQILTELPKPPNSESP  978

Query  339   EGTTACESSALEPPPSTGTSDDAKDqqqppP--DLLSI  232
                  C  + L+PP +T T D  +         DLLSI
Sbjct  979   TSPAPC--TTLDPPTTTITKDQQQPPAPKSTPPDLLSI  1014



>ref|XP_009375880.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Pyrus x bretschneideri]
Length=1015

 Score =   108 bits (271),  Expect = 9e-24, Method: Composition-based stats.
 Identities = 66/106 (62%), Positives = 74/106 (70%), Gaps = 13/106 (12%)
 Frame = -1

Query  519   KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
             KEGV+KILD RL +VP+HE MH+FYVA+LCVEEQAVERP MREVVQ+LTELPK P     
Sbjct  913   KEGVLKILDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQILTELPKAPGSKLV  972

Query  339   EGTTACESSALEPPPST-------GTSDDAKDq---qqppPDLLSI  232
             E +   ESS   PPP+T        TS D KDQ   Q P PDLLSI
Sbjct  973   EDSAITESS---PPPATTASESPGTTSKDTKDQPPLQSPQPDLLSI  1015



>ref|XP_008393812.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Malus domestica]
Length=1014

 Score =   108 bits (270),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 64/106 (60%), Positives = 72/106 (68%), Gaps = 13/106 (12%)
 Frame = -1

Query  519   KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
             KEGV+KILD RL +VP+HE MH+FYVA+LCVEEQAVERP MREVVQ+LTELPK P     
Sbjct  912   KEGVLKILDPRLXSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQILTELPKGPGSKLV  971

Query  339   EGTTACESSALEPPPSTG-------TSDDAKDqqqppP---DLLSI  232
             E +   ESS   PPP+T        TS D KDQ  P     DLLSI
Sbjct  972   EESAITESS---PPPATXASESPGTTSKDTKDQPPPQSLPPDLLSI  1014



>ref|XP_007156674.1| hypothetical protein PHAVU_002G007600g [Phaseolus vulgaris]
 gb|ESW28668.1| hypothetical protein PHAVU_002G007600g [Phaseolus vulgaris]
Length=1005

 Score =   108 bits (270),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 63/99 (64%), Positives = 75/99 (76%), Gaps = 5/99 (5%)
 Frame = -1

Query  519   KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
             KE V+K+LD RLS+VP+H+ MH+FYVA+LCVEEQAVERP MREVVQ+LTELP+ PPG+K 
Sbjct  909   KEEVLKVLDPRLSSVPLHDVMHVFYVAMLCVEEQAVERPTMREVVQILTELPR-PPGSKQ  967

Query  339   EGTTA---CESSALEPPPSTGTSDDAKDqqqppPDLLSI  232
             E  T      S+ALE  PST + D     Q PPPDLLSI
Sbjct  968   EDLTESSLSSSNALE-SPSTASKDRQNPSQSPPPDLLSI  1005



>ref|XP_008344369.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat receptor-like 
serine/threonine-protein kinase BAM1 [Malus domestica]
Length=1015

 Score =   108 bits (270),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 67/106 (63%), Positives = 75/106 (71%), Gaps = 13/106 (12%)
 Frame = -1

Query  519   KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
             KEGV+KILD RL +VP+HE MH+FYVA+LCVEEQAVERP MREVVQ+LTELPK P     
Sbjct  913   KEGVLKILDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQILTELPKAPGSKLV  972

Query  339   EGTTACESSALEPPPST-------GTSDDAKDq---qqppPDLLSI  232
             E +   ESS   PPP+T        TS D KDQ   Q PPPDLLSI
Sbjct  973   EDSAITESS---PPPATTASESPGTTSKDTKDQPPLQSPPPDLLSI  1015



>ref|XP_008354741.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Malus domestica]
Length=1015

 Score =   108 bits (270),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 67/106 (63%), Positives = 75/106 (71%), Gaps = 13/106 (12%)
 Frame = -1

Query  519   KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
             KEGV+KILD RL +VP+HE MH+FYVA+LCVEEQAVERP MREVVQ+LTELPK P     
Sbjct  913   KEGVLKILDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQILTELPKAPGSKLV  972

Query  339   EGTTACESSALEPPPST-------GTSDDAKDq---qqppPDLLSI  232
             E +   ESS   PPP+T        TS D KDQ   Q PPPDLLSI
Sbjct  973   EDSAITESS---PPPATTASESPGTTSKDTKDQPPLQSPPPDLLSI  1015



>gb|KJB43996.1| hypothetical protein B456_007G228700 [Gossypium raimondii]
Length=866

 Score =   108 bits (269),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 61/102 (60%), Positives = 75/102 (74%), Gaps = 6/102 (6%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
            KEGV+KILD RLS+VP++E MH+FYVA+LCVEEQAVERP MREVVQ+LTE+PK P   + 
Sbjct  765  KEGVLKILDPRLSSVPLYEVMHVFYVAMLCVEEQAVERPTMREVVQILTEVPKPPSSKQQ  824

Query  339  EG-TTACESSALEPP-----PSTGTSDDAKDqqqppPDLLSI  232
            +G +T  ESS +  P     P    + + KDQ  PPPDLLSI
Sbjct  825  QGDSTITESSPISQPTTLESPRDARTKEPKDQHTPPPDLLSI  866



>ref|XP_009354585.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Pyrus x bretschneideri]
Length=1014

 Score =   108 bits (270),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 66/106 (62%), Positives = 74/106 (70%), Gaps = 13/106 (12%)
 Frame = -1

Query  519   KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
             KEGV+KILD RL +VP+HE MH+FYVA+LCVEEQAVERP MREVVQ+LTELPK P     
Sbjct  912   KEGVLKILDPRLPSVPLHEVMHLFYVAMLCVEEQAVERPTMREVVQILTELPKGPGSKLV  971

Query  339   EGTTACESSALEPPPST-------GTSDDAKD---qqqppPDLLSI  232
             E +   ESS   PPP+T        TS D KD    Q PPPDLLSI
Sbjct  972   EESAITESS---PPPATTASESQGTTSKDMKDQPPPQSPPPDLLSI  1014



>ref|XP_011099433.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Sesamum indicum]
Length=1008

 Score =   108 bits (270),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 61/98 (62%), Positives = 72/98 (73%), Gaps = 2/98 (2%)
 Frame = -1

Query  525   GKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGT  346
             G KEGV+K+LD RL TVP+HE MH+FYVA+LCVEEQAVERP MREV+Q+LTELPK P   
Sbjct  913   GNKEGVLKVLDPRLPTVPLHEVMHVFYVAMLCVEEQAVERPTMREVIQILTELPK-PTAA  971

Query  345   KPEGTTACESSALEPPPSTGTSDDAKDqqqppPDLLSI  232
             KP  +T  +SS   P   T T  + +  Q PPPDLLSI
Sbjct  972   KPGDSTITDSSVDSPATETKTH-NRQASQSPPPDLLSI  1008



>ref|XP_006357743.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Solanum tuberosum]
Length=1017

 Score =   108 bits (269),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 67/110 (61%), Positives = 78/110 (71%), Gaps = 16/110 (15%)
 Frame = -1

Query  525   GKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGT  346
             GKK+GV+KILD RLSTVP++E MH+FYVALLCVEEQAVERP MREVVQ+LTELPK  PG 
Sbjct  912   GKKDGVLKILDPRLSTVPLNEVMHVFYVALLCVEEQAVERPTMREVVQILTELPKS-PGA  970

Query  345   KPEGTTACESSALEPPPS-------TGTSDDAKD-----qqqppPDLLSI  232
             K + +T  + S   PPPS       T   ++ KD      Q PPPDLLSI
Sbjct  971   KSDDSTVTDQS---PPPSDSALESPTSIPEETKDHHQPTPQSPPPDLLSI  1017



>ref|XP_009613990.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nicotiana tomentosiformis]
Length=1019

 Score =   107 bits (268),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 65/106 (61%), Positives = 73/106 (69%), Gaps = 9/106 (8%)
 Frame = -1

Query  525   GKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGT  346
             GKKEGV+KILD RLSTVP+HE +H+FYVA+LCVEEQAVERPKMREVVQ+LTELP  P  T
Sbjct  915   GKKEGVLKILDPRLSTVPLHEVIHVFYVAMLCVEEQAVERPKMREVVQILTELP-TPSNT  973

Query  345   KPEGTTACESSALEPPPS---TGTSDDAKD-----qqqppPDLLSI  232
             K   +T  ES     P S   T    + KD      Q P PDLLSI
Sbjct  974   KSGDSTITESLPSSAPASESPTSAPGNTKDNHQPPPQSPQPDLLSI  1019



>gb|KDP32143.1| hypothetical protein JCGZ_12604 [Jatropha curcas]
Length=1013

 Score =   107 bits (267),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 62/102 (61%), Positives = 73/102 (72%), Gaps = 7/102 (7%)
 Frame = -1

Query  519   KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
             KEGV+K+LD RL +VP+HE MH+FYVA+LCVEEQA+ERP MREVVQ+LTELPK PP +K 
Sbjct  913   KEGVLKVLDPRLPSVPLHEVMHVFYVAMLCVEEQAIERPTMREVVQILTELPK-PPNSKQ  971

Query  339   EGTTACESS----ALEPPPSTGTSDDAKD--qqqppPDLLSI  232
                T  ESS    A    P+  T+ D KD    Q PPDLLSI
Sbjct  972   GDLTVTESSPQSAATLDSPNAATTRDQKDHQSPQSPPDLLSI  1013



>ref|XP_011073654.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Sesamum indicum]
Length=1015

 Score =   107 bits (266),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 63/102 (62%), Positives = 71/102 (70%), Gaps = 5/102 (5%)
 Frame = -1

Query  525   GKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGT  346
             G KEGV+K+LD RL TVP+HE MH+FYVA+LCVEEQAVERP MREVVQ+L+ELPK P G 
Sbjct  915   GNKEGVLKVLDPRLPTVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQILSELPK-PHGA  973

Query  345   KPEGTTACES----SALEPPPSTGTSDDAKDqqqppPDLLSI  232
             KP      ES    S LE P +   S      Q PPPDLLSI
Sbjct  974   KPGDPAPTESPPPASILESPATDPESHHPNPPQSPPPDLLSI  1015



>ref|XP_002531999.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
 gb|EEF30398.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
Length=1021

 Score =   106 bits (265),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 64/107 (60%), Positives = 77/107 (72%), Gaps = 14/107 (13%)
 Frame = -1

Query  519   KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
             KEGV+K+LD RL +VP+HE MH+FYVA+LCVEEQA+ERP MREVVQ+LTELPK PP +K 
Sbjct  918   KEGVLKVLDPRLPSVPLHEVMHVFYVAMLCVEEQAIERPTMREVVQILTELPK-PPNSKQ  976

Query  339   EGTTACESS-----ALEPPPSTGTSDDAKD------qqqppPDLLSI  232
               +T  ESS     +L+ P +  TS D KD       Q PPPDLLSI
Sbjct  977   GDSTVTESSPQSATSLDSPKA--TSKDPKDNQQPALPQSPPPDLLSI  1021



>ref|XP_007047661.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
 gb|EOX91818.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
Length=1018

 Score =   105 bits (263),  Expect = 8e-23, Method: Composition-based stats.
 Identities = 55/85 (65%), Positives = 65/85 (76%), Gaps = 6/85 (7%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
            KEGV+KILD RL +VP+HE MH+FYVA+LCVEEQAVERP MREVVQ+LTELPK PP +K 
Sbjct  915  KEGVLKILDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQILTELPK-PPNSKQ  973

Query  339  EGTTACESSALEPPPSTGTSDDAKD  265
              +T  ES      PS GTS D+ +
Sbjct  974  GDSTVTESL-----PSPGTSLDSPN  993



>ref|XP_010683073.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Beta vulgaris subsp. vulgaris]
Length=1009

 Score =   105 bits (263),  Expect = 9e-23, Method: Composition-based stats.
 Identities = 59/98 (60%), Positives = 70/98 (71%), Gaps = 4/98 (4%)
 Frame = -1

Query  525   GKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGT  346
             G KEGV+K+LD RL +VP+HE MH+FYVA+LCVEEQAVERP MREVVQ+L E+PK PPGT
Sbjct  916   GNKEGVLKVLDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQILLEIPK-PPGT  974

Query  345   KPEGTTACESSALEPPPSTGTSDDAKDqqqppPDLLSI  232
              P+   A   S LE P     +      + PPPDLLSI
Sbjct  975   TPKQGDA---SPLESPQRPTDAIVGSPTKSPPPDLLSI  1009



>gb|KJB18115.1| hypothetical protein B456_003G034500 [Gossypium raimondii]
Length=1014

 Score =   105 bits (262),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 55/98 (56%), Positives = 66/98 (67%), Gaps = 4/98 (4%)
 Frame = -1

Query  519   KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
             KEGV+K+LD RL +VP+HE MH+FYVA+LCVEEQAVERP MREVVQ+LTELPK P     
Sbjct  919   KEGVLKVLDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQILTELPKPPNSEST  978

Query  339   EGTTACESSALEPPPSTGTSDDAKDqqqppP--DLLSI  232
                  C  + L+PP +T T D  +         DLLSI
Sbjct  979   TSPAPC--TTLDPPTTTITKDQQQPPAPKSTPPDLLSI  1014



>ref|XP_004509039.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Cicer arietinum]
Length=1005

 Score =   105 bits (261),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 55/96 (57%), Positives = 66/96 (69%), Gaps = 4/96 (4%)
 Frame = -1

Query  519   KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
             KEGV+K+LD RL +VP+HE MH+FYVA+LCVEEQAVERP MREVVQMLTELPK P     
Sbjct  914   KEGVLKVLDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQMLTELPKPPTSKHV  973

Query  339   EGTTACESSALEPPPSTGTSDDAKDqqqppPDLLSI  232
             E  T      +   PS  +S+  +   + P DLLSI
Sbjct  974   EDLTL----TITESPSLASSNSLESPSKEPKDLLSI  1005



>ref|XP_003635561.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Vitis vinifera]
Length=1017

 Score =   104 bits (259),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 54/81 (67%), Positives = 63/81 (78%), Gaps = 5/81 (6%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
            KEGV+KILD+RL TVP+HE MH+FYVA+LCVEEQAVERP MREVVQ+LTELPK PP +K 
Sbjct  916  KEGVLKILDTRLPTVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQILTELPK-PPSSKQ  974

Query  339  EGTTACESS----ALEPPPST  289
              +   ESS     LE P +T
Sbjct  975  GDSIVTESSPPSCTLESPTTT  995



>emb|CDP02660.1| unnamed protein product [Coffea canephora]
Length=1017

 Score =   104 bits (259),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 53/79 (67%), Positives = 61/79 (77%), Gaps = 5/79 (6%)
 Frame = -1

Query  525  GKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGT  346
            G KEGV+KILD RL TVP+HE MH+FYVA+LCVEEQAVERP MREVVQ+LTELPK P   
Sbjct  913  GNKEGVLKILDPRLPTVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQILTELPK-PANG  971

Query  345  KPEGTTACESSALEPPPST  289
            K   +T  ES    PPP++
Sbjct  972  KQGDSTDTES----PPPAS  986



>ref|XP_011021820.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Populus euphratica]
Length=1020

 Score =   104 bits (259),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 60/103 (58%), Positives = 72/103 (70%), Gaps = 8/103 (8%)
 Frame = -1

Query  519   KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPG---  349
             KEGV+K+LD RL +VP+HE MH+FYVA+LCVEEQAVERP MREVVQ+LTELPK P     
Sbjct  919   KEGVLKVLDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQILTELPKSPSSKQG  978

Query  348   ----TKPEGTTACESSALEPPPSTGTSDDAKDqqqppPDLLSI  232
                 T+P   +A  ++AL+ P ST        QQ PP DLLSI
Sbjct  979   DSIITEPSPHSAA-TAALDSPSSTAKDVPKDHQQPPPADLLSI  1020



>gb|KDO78771.1| hypothetical protein CISIN_1g001816mg [Citrus sinensis]
Length=1010

 Score =   103 bits (258),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 52/76 (68%), Positives = 61/76 (80%), Gaps = 8/76 (11%)
 Frame = -1

Query  522  KKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTK  343
            KKEGV+KILD RL +VP+HE MH+FYVA+LCVEEQAVERP MREVVQ+LTELPK PP +K
Sbjct  909  KKEGVLKILDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQILTELPK-PPTSK  967

Query  342  -------PEGTTACES  316
                   P GTT+ +S
Sbjct  968  QGEESLPPSGTTSLDS  983



>ref|XP_006466390.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Citrus sinensis]
Length=1010

 Score =   103 bits (258),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 52/76 (68%), Positives = 61/76 (80%), Gaps = 8/76 (11%)
 Frame = -1

Query  522  KKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTK  343
            KKEGV+KILD RL +VP+HE MH+FYVA+LCVEEQAVERP MREVVQ+LTELPK PP +K
Sbjct  909  KKEGVLKILDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQILTELPK-PPTSK  967

Query  342  -------PEGTTACES  316
                   P GTT+ +S
Sbjct  968  QGEESLPPSGTTSLDS  983



>ref|XP_006426178.1| hypothetical protein CICLE_v10024796mg [Citrus clementina]
 gb|ESR39418.1| hypothetical protein CICLE_v10024796mg [Citrus clementina]
Length=1012

 Score =   103 bits (258),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 52/76 (68%), Positives = 61/76 (80%), Gaps = 8/76 (11%)
 Frame = -1

Query  522  KKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTK  343
            KKEGV+KILD RL +VP+HE MH+FYVA+LCVEEQAVERP MREVVQ+LTELPK PP +K
Sbjct  911  KKEGVLKILDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQILTELPK-PPTSK  969

Query  342  -------PEGTTACES  316
                   P GTT+ +S
Sbjct  970  QGEESLPPSGTTSLDS  985



>ref|XP_002310320.2| hypothetical protein POPTR_0007s14500g [Populus trichocarpa]
 gb|EEE90770.2| hypothetical protein POPTR_0007s14500g [Populus trichocarpa]
Length=1020

 Score =   103 bits (258),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 60/103 (58%), Positives = 72/103 (70%), Gaps = 8/103 (8%)
 Frame = -1

Query  519   KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPG---  349
             KEGV+K+LD RL +VP+HE MH+FYVA+LCVEEQAVERP MREVVQ+LTELPK P     
Sbjct  919   KEGVLKVLDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQILTELPKSPSSKQG  978

Query  348   ----TKPEGTTACESSALEPPPSTGTSDDAKDqqqppPDLLSI  232
                 T+P   +A  ++AL+ P ST        QQ PP DLLSI
Sbjct  979   DSVITEPSPHSAA-TAALDSPSSTAKDVPKDHQQPPPADLLSI  1020



>ref|XP_007208421.1| hypothetical protein PRUPE_ppa000739mg [Prunus persica]
 gb|EMJ09620.1| hypothetical protein PRUPE_ppa000739mg [Prunus persica]
Length=1017

 Score =   103 bits (257),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 51/81 (63%), Positives = 60/81 (74%), Gaps = 2/81 (2%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
            KEGV+KILD RL +VP+HE MH+FYVA+LCVEEQAVERP MREVVQ+LTELPK P   + 
Sbjct  912  KEGVLKILDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQILTELPKAPGSKQG  971

Query  339  EGTTACESSALEPPPSTGTSD  277
             G +A   S   PP  T  S+
Sbjct  972  GGDSAITESF--PPSGTSASE  990



>ref|XP_004288299.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Fragaria vesca subsp. vesca]
Length=1023

 Score =   103 bits (257),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 55/85 (65%), Positives = 66/85 (78%), Gaps = 9/85 (11%)
 Frame = -1

Query  519   KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
             KEGV+KILDSRL +VP+HE MH+FYVA+LCVEEQAVERP MREVVQ+LTELP  PPG+K 
Sbjct  922   KEGVLKILDSRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQILTELPI-PPGSKQ  980

Query  339   --EGTTACES------SALEPPPST  289
               E TT  +S      +A+E P +T
Sbjct  981   VGETTTVTDSPQQSAITAIESPTTT  1005



>emb|CBI35733.3| unnamed protein product [Vitis vinifera]
Length=948

 Score =   103 bits (256),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 54/81 (67%), Positives = 63/81 (78%), Gaps = 5/81 (6%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
            KEGV+KILD+RL TVP+HE MH+FYVA+LCVEEQAVERP MREVVQ+LTELPK PP +K 
Sbjct  847  KEGVLKILDTRLPTVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQILTELPK-PPSSKQ  905

Query  339  EGTTACESS----ALEPPPST  289
              +   ESS     LE P +T
Sbjct  906  GDSIVTESSPPSCTLESPTTT  926



>gb|AIT56194.1| leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Dimocarpus longan]
Length=1015

 Score =   103 bits (256),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 53/78 (68%), Positives = 62/78 (79%), Gaps = 4/78 (5%)
 Frame = -1

Query  516  EGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKPE  337
            +GV+KILD RL TVP++E MH+FYVALLCVEEQAVERP MREVVQ+LTELPK PP +KP 
Sbjct  912  DGVLKILDPRLPTVPLNEVMHVFYVALLCVEEQAVERPTMREVVQILTELPK-PPSSKPA  970

Query  336  GTTACESSALEPPPSTGT  283
             +   ESS   P P+T T
Sbjct  971  DSAIPESS---PSPATTT  985



>ref|XP_004511796.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Cicer arietinum]
Length=1009

 Score =   103 bits (256),  Expect = 9e-22, Method: Composition-based stats.
 Identities = 58/98 (59%), Positives = 69/98 (70%), Gaps = 3/98 (3%)
 Frame = -1

Query  519   KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
             KEGV+K+LD RLS+VP+HE  H+FYVA+LCVEEQAVERP MREVVQ+LTELP  PP +K 
Sbjct  913   KEGVLKVLDPRLSSVPLHEVTHVFYVAILCVEEQAVERPTMREVVQILTELP-MPPESKQ  971

Query  339   EGTTACESSALEPPPS--TGTSDDAKDqqqppPDLLSI  232
               +T  ESS      S    + D+      PPPDLLSI
Sbjct  972   GDSTITESSLSNASESLTAASKDNQHPPPSPPPDLLSI  1009



>ref|XP_008237309.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Prunus mume]
Length=968

 Score =   102 bits (254),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 51/81 (63%), Positives = 60/81 (74%), Gaps = 2/81 (2%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
            KEGV+KILD RL +VP+HE MH+FYVA+LCVEEQAVERP MREVVQ+LTELPK P   + 
Sbjct  863  KEGVLKILDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQILTELPKAPGSKQG  922

Query  339  EGTTACESSALEPPPSTGTSD  277
             G +A   S   PP  T  S+
Sbjct  923  GGDSAITESF--PPSGTSASE  941



>gb|KHG03710.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Gossypium arboreum]
 gb|KHG03906.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Gossypium arboreum]
Length=1013

 Score =   102 bits (254),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 60/101 (59%), Positives = 69/101 (68%), Gaps = 6/101 (6%)
 Frame = -1

Query  522   KKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTK  343
             KKEGV+KILD RL +VP+HE MH+FYVA+LCVEEQAVERP MREVVQ+LTELPK     +
Sbjct  915   KKEGVLKILDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQILTELPKASDSKQ  974

Query  342   PEGTTACES----SALEPPPSTGTSDDAKDqqqppPDLLSI  232
              + T    S    S LE P +  T D     Q P PDLLSI
Sbjct  975   GDPTVTESSHSPTSTLESPNNATTKDPM--PQSPTPDLLSI  1013



>ref|NP_001235065.1| receptor-like protein kinase 1 precursor [Glycine max]
 gb|AAF91322.1|AF244888_1 receptor-like protein kinase 1 [Glycine max]
Length=1008

 Score =   102 bits (254),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 62/100 (62%), Positives = 73/100 (73%), Gaps = 5/100 (5%)
 Frame = -1

Query  519   KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
             KEGV+K+LDSRL +VP+HE MH+FYVA+LCVEEQAVERP MREVVQ+LTELPK PP +K 
Sbjct  910   KEGVLKVLDSRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQILTELPK-PPSSKH  968

Query  339   EGTTACESSALEPPPSTGTSDDAKD----qqqppPDLLSI  232
               T +  SS+      T  S + KD     Q PPPDLLSI
Sbjct  969   AITESSLSSSNSLGSPTTASKEPKDNQHPPQSPPPDLLSI  1008



>gb|KJB48795.1| hypothetical protein B456_008G087500 [Gossypium raimondii]
Length=1013

 Score =   102 bits (254),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 62/102 (61%), Positives = 70/102 (69%), Gaps = 8/102 (8%)
 Frame = -1

Query  522   KKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTK  343
             KKEGV+KILD RL +VP+HE MH+FYVA+LCVEEQAVERP MREVVQ+LTELPK    +K
Sbjct  915   KKEGVLKILDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQILTELPK-ASDSK  973

Query  342   PEGTTACES-----SALEPPPSTGTSDDAKDqqqppPDLLSI  232
                 T  ES     S LE P +  T D     Q P PDLLSI
Sbjct  974   QRDPTVTESSHSPTSTLESPNNATTKDPM--PQSPTPDLLSI  1013



>gb|KHN47566.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Glycine soja]
Length=725

 Score =   101 bits (252),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 62/100 (62%), Positives = 73/100 (73%), Gaps = 5/100 (5%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
            KEGV+K+LDSRL +VP+HE MH+FYVA+LCVEEQAVERP MREVVQ+LTELPK PP +K 
Sbjct  627  KEGVLKVLDSRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQILTELPK-PPSSKH  685

Query  339  EGTTACESSALEPPPSTGTSDDAKD----qqqppPDLLSI  232
              T +  SS+      T  S + KD     Q PPPDLLSI
Sbjct  686  AITESSLSSSNSLGSPTTASKEPKDNQHPPQSPPPDLLSI  725



>ref|XP_010271550.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nelumbo nucifera]
Length=1032

 Score =   101 bits (251),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 50/76 (66%), Positives = 60/76 (79%), Gaps = 4/76 (5%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
            KEGV+KILD RL +VP+HE MH+FYVA+LCVEEQAVERP MREVVQ+LTELPK PP +K 
Sbjct  919  KEGVLKILDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQILTELPK-PPNSKQ  977

Query  339  EGTTACESSALEPPPS  292
              +T    + +E  PS
Sbjct  978  GDSTI---TTMESSPS  990



>ref|XP_007163887.1| hypothetical protein PHAVU_L008000g [Phaseolus vulgaris]
 gb|ESW35881.1| hypothetical protein PHAVU_L008000g [Phaseolus vulgaris]
Length=106

 Score = 93.6 bits (231),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -1

Query  525  GKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPK  361
              KEGV+K+LD RL +VP+HE MH+FYVA+LCVEEQAVERP MREVVQ+LTELPK
Sbjct  4    SNKEGVLKVLDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQILTELPK  58



>ref|XP_006279943.1| hypothetical protein CARUB_v10025808mg [Capsella rubella]
 gb|EOA12841.1| hypothetical protein CARUB_v10025808mg [Capsella rubella]
Length=1004

 Score =   100 bits (250),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 46/73 (63%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
            KE V+K+LD RLS++PIHE  H+FYVA+LCVEEQAVERP MREVVQ+LTE+PK PP    
Sbjct  919  KESVLKVLDPRLSSIPIHEVTHVFYVAMLCVEEQAVERPTMREVVQILTEIPKLPPSKDQ  978

Query  339  EGTTACESSALEP  301
              T +   S L P
Sbjct  979  TTTESTPESELSP  991



>ref|XP_006852730.1| hypothetical protein AMTR_s00033p00083200 [Amborella trichopoda]
 gb|ERN14197.1| hypothetical protein AMTR_s00033p00083200 [Amborella trichopoda]
Length=1017

 Score =   100 bits (249),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 60/104 (58%), Positives = 72/104 (69%), Gaps = 7/104 (7%)
 Frame = -1

Query  522   KKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQP----  355
             KKEGV+ ILD RL TVP+HEAMH+FYVA+LCVEEQ+VERP MREVVQ+LT+LPK P    
Sbjct  914   KKEGVLNILDPRLPTVPLHEAMHVFYVAMLCVEEQSVERPTMREVVQILTDLPKPPEQPS  973

Query  354   PGTKPEGTTACESSALEPP-PSTGTSDDAKD--qqqppPDLLSI  232
             P T+  G      ++ EP  P+ G  +       Q PPPDLLSI
Sbjct  974   PTTQKHGGIGGGDASPEPNGPNVGVKEQQGQLPPQSPPPDLLSI  1017



>gb|AES94465.2| LRR receptor-like kinase family protein [Medicago truncatula]
Length=1014

 Score =   100 bits (248),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 61/101 (60%), Positives = 72/101 (71%), Gaps = 7/101 (7%)
 Frame = -1

Query  519   KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
             KEGV+K+LD RLS+VP+ E MH+FYVA+LCVEEQAVERP MREVVQ+LTELPK    +K 
Sbjct  916   KEGVLKVLDPRLSSVPLQEVMHVFYVAILCVEEQAVERPTMREVVQILTELPKSTE-SKL  974

Query  339   EGTTACESS-----ALEPPPSTGTSDDAKDqqqppPDLLSI  232
               +T  ESS     ALE  P+  + D     Q PPPDLLSI
Sbjct  975   GDSTITESSLSSSNALE-SPTAASKDHQHPPQSPPPDLLSI  1014



>ref|XP_010268646.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nelumbo nucifera]
Length=1034

 Score =   100 bits (248),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 48/80 (60%), Positives = 60/80 (75%), Gaps = 2/80 (3%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
            KEGV+KILD RL +VP+HE MH+FYVA+LCVEEQAVERP MREVVQ+LTELPK P     
Sbjct  916  KEGVLKILDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQILTELPKAP--ISK  973

Query  339  EGTTACESSALEPPPSTGTS  280
            +G++A   S+     + G +
Sbjct  974  QGSSAMTESSPSAAATAGET  993



>ref|XP_006650665.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Oryza brachyantha]
Length=1021

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 52/91 (57%), Positives = 64/91 (70%), Gaps = 6/91 (7%)
 Frame = -1

Query  519   KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
             KE V+K+LD RLSTVP+HE MH+FYVALLC+EEQ+V+RP MREVVQ+L+ELPK  P    
Sbjct  912   KEQVMKVLDPRLSTVPLHEVMHIFYVALLCIEEQSVQRPTMREVVQILSELPKLAPRQGE  971

Query  339   EGTTACESSALEPP---PS---TGTSDDAKD  265
               + A + SA  PP   PS      + DAKD
Sbjct  972   VLSHAVDGSASNPPAPVPSGSAKAPTGDAKD  1002



>gb|KFK28239.1| hypothetical protein AALP_AA8G490400 [Arabis alpina]
Length=1002

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 47/81 (58%), Positives = 59/81 (73%), Gaps = 1/81 (1%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
            KE V+K+LD R+S++PIHE  H+FYVA+LCVEEQAVERP MREVVQ+LTE+PK PP +K 
Sbjct  919  KESVLKVLDPRMSSIPIHEVTHVFYVAMLCVEEQAVERPTMREVVQILTEIPKMPP-SKE  977

Query  339  EGTTACESSALEPPPSTGTSD  277
            + TT         P + G  D
Sbjct  978  QSTTELTGVEKSTPENEGPPD  998



>dbj|BAJ84911.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96166.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1020

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 48/81 (59%), Positives = 61/81 (75%), Gaps = 3/81 (4%)
 Frame = -1

Query  522  KKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPK---QPP  352
            KKE V+KI+D RLSTVP+HE MH+FYVALLCVEEQ+V+RP MREVVQ+L+ELPK   +  
Sbjct  913  KKEQVIKIMDPRLSTVPVHEVMHVFYVALLCVEEQSVQRPTMREVVQILSELPKPIAKQG  972

Query  351  GTKPEGTTACESSALEPPPST  289
            G +  G++  +   L  PP T
Sbjct  973  GEQLTGSSDGDEPGLSGPPET  993



>ref|XP_008790445.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Phoenix dactylifera]
Length=1019

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 59/97 (61%), Positives = 73/97 (75%), Gaps = 5/97 (5%)
 Frame = -1

Query  522   KKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTK  343
             KKEGVV +LD RL +VP+HEAMH+FYVA+LCVEEQ++ERP MREVVQ+LTELP+ PP  +
Sbjct  928   KKEGVVIVLDPRLPSVPLHEAMHVFYVAMLCVEEQSIERPTMREVVQILTELPRPPP-NQ  986

Query  342   PEGTTACESSALEPPPSTGTSDDAKDqqqppPDLLSI  232
              EG    E S   PPP+ G +   + + QP PDLLSI
Sbjct  987   GEG----EDSPPPPPPAGGETPMKESKPQPQPDLLSI  1019



>ref|XP_010444585.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Camelina sativa]
Length=1006

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 45/73 (62%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
            KE V+K+LD RLS++PIHE  H+FYVA+LCVEEQAVERP MREVVQ+LTE+PK PP    
Sbjct  919  KESVLKVLDPRLSSIPIHEVTHVFYVAMLCVEEQAVERPTMREVVQILTEIPKLPPSKDQ  978

Query  339  EGTTACESSALEP  301
              T +   + L P
Sbjct  979  PTTESTPENELSP  991



>ref|XP_004143422.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Cucumis sativus]
 ref|XP_004163335.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Cucumis sativus]
 gb|KGN48657.1| hypothetical protein Csa_6G497080 [Cucumis sativus]
Length=1019

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 61/105 (58%), Positives = 76/105 (72%), Gaps = 10/105 (10%)
 Frame = -1

Query  519   KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
             KE VVKILD RLS+VP+HE MH+FYVA+LCVEEQAVERP MREV+Q+L+E+P QPP +K 
Sbjct  916   KEEVVKILDPRLSSVPLHEVMHVFYVAMLCVEEQAVERPTMREVIQILSEIP-QPPSSKQ  974

Query  339   EGTTAC--------ESSALEPPPSTGTSDDAK-DqqqppPDLLSI  232
              G +           ++A    P+TGT +  +  QQQPPPDLLSI
Sbjct  975   GGDSTLPNSSPPPPPTAADLDLPTTGTKNKKEHQQQQPPPDLLSI  1019



>ref|XP_004955422.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Setaria italica]
Length=1030

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 50/89 (56%), Positives = 64/89 (72%), Gaps = 4/89 (4%)
 Frame = -1

Query  519   KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
             KE V+KI+D RLSTVP+HE MH+FYVALLCVEEQ+V+RP MREVVQML+ELPK       
Sbjct  921   KEQVIKIMDPRLSTVPVHEVMHIFYVALLCVEEQSVQRPTMREVVQMLSELPKPTSRQGD  980

Query  339   EGTTACESSALEPPPSTGT----SDDAKD  265
             E  +  + +A  PP S  +    +D+AK+
Sbjct  981   ELPSGDDGAAPNPPVSADSVEALNDEAKE  1009



>ref|XP_007155783.1| hypothetical protein PHAVU_003G231400g [Phaseolus vulgaris]
 gb|ESW27777.1| hypothetical protein PHAVU_003G231400g [Phaseolus vulgaris]
Length=1018

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 59/103 (57%), Positives = 70/103 (68%), Gaps = 8/103 (8%)
 Frame = -1

Query  519   KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
             KEGV+K+LD RL +VP+HE MH+FYVA+LCVEEQAVERP MREVVQ+LTELPK    +K 
Sbjct  917   KEGVLKVLDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQILTELPKS-ASSKQ  975

Query  339   EGTTACESS-----ALEPPPSTGTS--DDAKDqqqppPDLLSI  232
                T  ESS     +LE P +      D+    Q  PPDLLSI
Sbjct  976   GDLTITESSLPSSNSLESPTTASMEPKDNQHLPQSSPPDLLSI  1018



>ref|NP_201371.1| leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Arabidopsis thaliana]
 ref|NP_001190624.1| leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Arabidopsis thaliana]
 sp|O49545.1|BAME1_ARATH RecName: Full=Leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1; AltName: Full=Protein BARELY ANY MERISTEM 
1; Flags: Precursor [Arabidopsis thaliana]
 emb|CAA16688.1| receptor protein kinase - like protein [Arabidopsis thaliana]
 dbj|BAB10677.1| receptor protein kinase-like protein [Arabidopsis thaliana]
 gb|AAM20665.1| receptor protein kinase-like protein [Arabidopsis thaliana]
 gb|AAP68249.1| At5g65700 [Arabidopsis thaliana]
 dbj|BAE98627.1| receptor protein kinase like protein [Arabidopsis thaliana]
 gb|ACN59407.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED98091.1| CLAVATA1-related receptor kinase-like protein [Arabidopsis thaliana]
 gb|AED98092.1| CLAVATA1-related receptor kinase-like protein [Arabidopsis thaliana]
Length=1003

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 46/82 (56%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
            K+ V+K+LD RLS++PIHE  H+FYVA+LCVEEQAVERP MREVVQ+LTE+PK PP    
Sbjct  918  KDSVLKVLDPRLSSIPIHEVTHVFYVAMLCVEEQAVERPTMREVVQILTEIPKLPPSKDQ  977

Query  339  EGTTACESSALEPPPSTGTSDD  274
              T +   S L P     +  D
Sbjct  978  PMTESAPESELSPKSGVQSPPD  999



>ref|XP_008441113.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1, partial [Cucumis melo]
Length=977

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 61/105 (58%), Positives = 76/105 (72%), Gaps = 10/105 (10%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
            KE VVKILD RLS+VP+HE MH+FYVA+LCVEEQAVERP MREV+Q+L+E+P QPP +K 
Sbjct  874  KEEVVKILDPRLSSVPLHEVMHVFYVAMLCVEEQAVERPTMREVIQILSEIP-QPPSSKQ  932

Query  339  EGTTAC--------ESSALEPPPSTGTSDDAK-DqqqppPDLLSI  232
             G +           ++A    P+TGT +  +  QQQPPPDLLSI
Sbjct  933  GGDSTLPNSSPPPPPTAADLDLPTTGTKNKKEHQQQQPPPDLLSI  977



>ref|NP_001237688.1| receptor-like protein kinase precursor [Glycine max]
 gb|ACM89563.1| receptor-like protein kinase [Glycine max]
Length=1010

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 57/102 (56%), Positives = 68/102 (67%), Gaps = 7/102 (7%)
 Frame = -1

Query  519   KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
             KEGV+K+LD RL +VP+HE MH+FYVA+LCVEEQAVERP MREVVQ+LTELPK PP +K 
Sbjct  910   KEGVLKVLDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQILTELPK-PPSSKQ  968

Query  339   EGTTAC------ESSALEPPPSTGTSDDAKDqqqppPDLLSI  232
                T         +S   P  ++    D    Q PP DLLSI
Sbjct  969   GDLTITESSLSSSNSLESPTTASKEPKDQHPPQSPPTDLLSI  1010



>ref|XP_006393995.1| hypothetical protein EUTSA_v10003584mg [Eutrema salsugineum]
 gb|ESQ31281.1| hypothetical protein EUTSA_v10003584mg [Eutrema salsugineum]
Length=1007

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 51/86 (59%), Positives = 59/86 (69%), Gaps = 5/86 (6%)
 Frame = -1

Query  519   KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
             KE V+K+LD RLS++PIHE  H+FYVA+LCVEEQAVERP MREVVQ+LTE+PK PP    
Sbjct  918   KESVLKVLDPRLSSIPIHEVTHVFYVAMLCVEEQAVERPTMREVVQILTEIPKMPPLKDQ  977

Query  339   EGT--TACESSALE---PPPSTGTSD  277
               T  T  E S  E    P S G  D
Sbjct  978   PATELTGVEKSTAENELSPKSGGPPD  1003



>ref|XP_002864974.1| hypothetical protein ARALYDRAFT_496807 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41233.1| hypothetical protein ARALYDRAFT_496807 [Arabidopsis lyrata subsp. 
lyrata]
Length=1003

 Score = 98.2 bits (243),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 45/73 (62%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
            KE V+K+LD RLS++PIHE  H+FYVA+LCVEEQAVERP MREVVQ+LTE+PK PP    
Sbjct  918  KESVLKVLDPRLSSIPIHEVTHVFYVAMLCVEEQAVERPTMREVVQILTEIPKLPPPKDQ  977

Query  339  EGTTACESSALEP  301
              T +   + L P
Sbjct  978  PTTESTPENELSP  990



>gb|KJB18113.1| hypothetical protein B456_003G034400 [Gossypium raimondii]
 gb|KJB18114.1| hypothetical protein B456_003G034400 [Gossypium raimondii]
Length=1026

 Score = 98.2 bits (243),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 61/109 (56%), Positives = 71/109 (65%), Gaps = 14/109 (13%)
 Frame = -1

Query  519   KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
             KE V+K+LD RL +VP+ E MH+FYVA+LCVEEQAVERP MREVVQ+LTELPK PP +K 
Sbjct  919   KESVLKVLDPRLPSVPLQEVMHVFYVAMLCVEEQAVERPTMREVVQILTELPK-PPNSKE  977

Query  339   EGTTACESSALEPP------PSTGTSDDAKDqq-------qppPDLLSI  232
               TT  E      P      P+T  + D KDQQ         PPDLLSI
Sbjct  978   GDTTINEPPTSPSPDTTLDSPTTTITKDPKDQQQQPPAPKSTPPDLLSI  1026



>gb|KHN01704.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Glycine soja]
Length=854

 Score = 97.8 bits (242),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 57/102 (56%), Positives = 68/102 (67%), Gaps = 7/102 (7%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
            KEGV+K+LD RL +VP+HE MH+FYVA+LCVEEQAVERP MREVVQ+LTELPK PP +K 
Sbjct  754  KEGVLKVLDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQILTELPK-PPSSKQ  812

Query  339  EGTTAC------ESSALEPPPSTGTSDDAKDqqqppPDLLSI  232
               T         +S   P  ++    D    Q PP DLLSI
Sbjct  813  GDLTITESSLSSSNSLESPTTASKEPKDQHPPQSPPTDLLSI  854



>ref|XP_010463501.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Camelina sativa]
Length=1006

 Score = 97.8 bits (242),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 44/73 (60%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
            KE V+K+LD RLS++PIHE  H+FYVA+LCVEEQAVERP MREVVQ+LTE+PK PP    
Sbjct  919  KESVLKVLDPRLSSIPIHEVTHVFYVAMLCVEEQAVERPTMREVVQILTEIPKLPPSKDQ  978

Query  339  EGTTACESSALEP  301
              T +   + + P
Sbjct  979  PTTESTPENEVSP  991



>ref|XP_008787754.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Phoenix dactylifera]
Length=990

 Score = 97.8 bits (242),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 54/99 (55%), Positives = 65/99 (66%), Gaps = 3/99 (3%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
            KE V  ILD RLSTVP+H+ MH+FYVA+LCVEEQ+VERP MREVVQ+L+ELP+  P    
Sbjct  892  KEAVTNILDPRLSTVPLHDVMHVFYVAMLCVEEQSVERPTMREVVQILSELPRPTPKPGE  951

Query  339  EGTTACESSALEPPPSTGTSDDAKDqqqppP---DLLSI  232
            + +   ES A  P PS  T    + Q  P     DLLSI
Sbjct  952  DSSNDEESEAPAPVPSAETPSKEQQQPAPRSPPPDLLSI  990



>ref|XP_008785758.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1, partial [Phoenix dactylifera]
Length=782

 Score = 97.1 bits (240),  Expect = 9e-20, Method: Composition-based stats.
 Identities = 44/56 (79%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPP  352
            KEGV+KILD RLS+VP+HEAMH+FYVA+LCVEEQ+VERP  REVVQ+LTELP  PP
Sbjct  690  KEGVLKILDPRLSSVPLHEAMHVFYVAMLCVEEQSVERPTTREVVQILTELPGPPP  745



>gb|AAO26313.1| receptor-like protein kinase, partial [Elaeis guineensis]
Length=481

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = -1

Query  522  KKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQP  355
             KEG++KI+D RLS+VP+HEAMH+FYVA+LCVEEQ+VERP MREVVQ+LTELP  P
Sbjct  388  NKEGILKIIDPRLSSVPLHEAMHVFYVAMLCVEEQSVERPTMREVVQILTELPGTP  443



>gb|AAY32333.1| RLK1 [Phyllostachys praecox]
Length=804

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 45/76 (59%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
            KE V+KILD RLSTVP+HE MH+FYVALLCVEEQ+V+RP MREVVQ+L+ELP        
Sbjct  698  KEQVIKILDPRLSTVPVHEVMHVFYVALLCVEEQSVQRPTMREVVQILSELPSPTSKQGE  757

Query  339  EGTTACESSALEPPPS  292
            E  +  + +A +PP +
Sbjct  758  EFPSGGDGAASDPPAA  773



>ref|XP_003608587.1| Receptor-like protein kinase [Medicago truncatula]
 gb|AES90784.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=1005

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 45/59 (76%), Positives = 53/59 (90%), Gaps = 1/59 (2%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTK  343
            KEGV+K+LD RL +VP++E MH+FYVA+LCVEEQAVERP MREVVQMLTELPK PP +K
Sbjct  913  KEGVLKVLDPRLPSVPLNEVMHVFYVAMLCVEEQAVERPTMREVVQMLTELPK-PPSSK  970



>gb|EAY92008.1| hypothetical protein OsI_13698 [Oryza sativa Indica Group]
Length=1029

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 51/91 (56%), Positives = 63/91 (69%), Gaps = 6/91 (7%)
 Frame = -1

Query  519   KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
             KE V+K+LD RLSTVP+HE MH+FYVALLC+EEQ+V+RP MREVVQ+L+ELPK  P    
Sbjct  920   KEQVMKVLDPRLSTVPLHEVMHVFYVALLCIEEQSVQRPTMREVVQILSELPKLAPRQGE  979

Query  339   EGTTACESSALEPP---PS---TGTSDDAKD  265
               + A +  A  PP   PS      + DAKD
Sbjct  980   VLSHAVDGFASNPPAPVPSGSAEALTGDAKD  1010



>gb|AAP68887.1| putative receptor-like protein kinase 1 [Oryza sativa Japonica 
Group]
 gb|ABF99107.1| Receptor protein kinase CLAVATA1 precursor, putative, expressed 
[Oryza sativa Japonica Group]
Length=1029

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 51/91 (56%), Positives = 63/91 (69%), Gaps = 6/91 (7%)
 Frame = -1

Query  519   KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
             KE V+K+LD RLSTVP+HE MH+FYVALLC+EEQ+V+RP MREVVQ+L+ELPK  P    
Sbjct  920   KEQVMKVLDPRLSTVPLHEVMHVFYVALLCIEEQSVQRPTMREVVQILSELPKLAPRQGE  979

Query  339   EGTTACESSALEPP---PS---TGTSDDAKD  265
               + A +  A  PP   PS      + DAKD
Sbjct  980   VLSHAVDGFASNPPAPVPSGSAEALTGDAKD  1010



>ref|XP_004981595.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Setaria italica]
Length=1029

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 50/84 (60%), Positives = 61/84 (73%), Gaps = 1/84 (1%)
 Frame = -1

Query  519   KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
             KE V+KILD RLSTVP+HE MH+FYVALLC EEQ+V+RP MREVVQ+L+ELPK       
Sbjct  920   KEQVMKILDPRLSTVPLHEIMHVFYVALLCTEEQSVQRPTMREVVQILSELPKPSTKQGE  979

Query  339   EGTTACESSALEP-PPSTGTSDDA  271
             E   AC+ SA  P  P+   S++A
Sbjct  980   EVPNACDGSASGPLHPAPAGSNEA  1003



>ref|XP_002461427.1| hypothetical protein SORBIDRAFT_02g002450 [Sorghum bicolor]
 gb|EER97948.1| hypothetical protein SORBIDRAFT_02g002450 [Sorghum bicolor]
Length=1031

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 46/72 (64%), Positives = 56/72 (78%), Gaps = 7/72 (10%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPK-------  361
            KE V+KI+D RLSTVP+HE MH+FYVALLCVEEQ+V+RP MREVVQML+ELPK       
Sbjct  921  KEQVIKIMDPRLSTVPVHEVMHVFYVALLCVEEQSVQRPTMREVVQMLSELPKPAARQGD  980

Query  360  QPPGTKPEGTTA  325
            +PP    +G+ A
Sbjct  981  EPPSVDDDGSAA  992



>gb|EYU41357.1| hypothetical protein MIMGU_mgv1a000718mg [Erythranthe guttata]
Length=1006

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 46/77 (60%), Positives = 51/77 (66%), Gaps = 0/77 (0%)
 Frame = -1

Query  525  GKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGT  346
            G K+G VK+LD RL  VP+HE  H+FYVA+LCVEEQAVERP MREVVQMLTELP      
Sbjct  924  GNKQGAVKVLDPRLERVPLHEVTHVFYVAMLCVEEQAVERPTMREVVQMLTELPGDSGSE  983

Query  345  KPEGTTACESSALEPPP  295
               G    E     PPP
Sbjct  984  VKLGHQEQEMPISSPPP  1000



>ref|XP_010484412.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Camelina sativa]
Length=1005

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 44/73 (60%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
            KE V+K+LD RLS++PIHE  H+FYVA+LCVEEQAVERP MREVVQ+LTE+PK  P    
Sbjct  919  KESVLKVLDPRLSSIPIHEVTHVFYVAMLCVEEQAVERPTMREVVQILTEIPKSLPSKDQ  978

Query  339  EGTTACESSALEP  301
              T +   + L P
Sbjct  979  PTTESTPENELSP  991



>ref|XP_003611507.1| Receptor-like protein kinase [Medicago truncatula]
Length=1109

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 54/87 (62%), Positives = 63/87 (72%), Gaps = 8/87 (9%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
            KEGV+K+LD RLS+VP+ E MH+FYVA+LCVEEQAVERP MREVVQ+LTELPK    +K 
Sbjct  916  KEGVLKVLDPRLSSVPLQEVMHVFYVAILCVEEQAVERPTMREVVQILTELPKSTE-SKL  974

Query  339  EGTTACESS-----ALEPPPSTGTSDD  274
              +T  ESS     ALE P  T  S D
Sbjct  975  GDSTITESSLSSSNALESP--TAASKD  999



>ref|XP_010939309.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Elaeis guineensis]
Length=1020

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 42/55 (76%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQP  355
            KEG++KI+D RLS+VP+HEAMH+FYVA+LCVEEQ+VERP MREVVQ+LTELP  P
Sbjct  928  KEGILKIIDPRLSSVPLHEAMHVFYVAMLCVEEQSVERPTMREVVQILTELPGTP  982



>emb|CDY45620.1| BnaCnng13280D [Brassica napus]
Length=973

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 42/63 (67%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
            K+ V+K+LD RLS++PIHE  H+FYVA+LCVEEQAVERP MREVVQ+LTE+PK PP    
Sbjct  889  KDSVLKVLDPRLSSIPIHEVTHVFYVAMLCVEEQAVERPTMREVVQILTEVPKMPPSKDQ  948

Query  339  EGT  331
              T
Sbjct  949  PAT  951



>ref|NP_001051418.1| Os03g0773700 [Oryza sativa Japonica Group]
 dbj|BAF13332.1| Os03g0773700, partial [Oryza sativa Japonica Group]
Length=885

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 51/91 (56%), Positives = 63/91 (69%), Gaps = 6/91 (7%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
            KE V+K+LD RLSTVP+HE MH+FYVALLC+EEQ+V+RP MREVVQ+L+ELPK  P    
Sbjct  776  KEQVMKVLDPRLSTVPLHEVMHVFYVALLCIEEQSVQRPTMREVVQILSELPKLAPRQGE  835

Query  339  EGTTACESSALEPP---PS---TGTSDDAKD  265
              + A +  A  PP   PS      + DAKD
Sbjct  836  VLSHAVDGFASNPPAPVPSGSAEALTGDAKD  866



>gb|EEE60014.1| hypothetical protein OsJ_12761 [Oryza sativa Japonica Group]
Length=979

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 51/91 (56%), Positives = 63/91 (69%), Gaps = 6/91 (7%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
            KE V+K+LD RLSTVP+HE MH+FYVALLC+EEQ+V+RP MREVVQ+L+ELPK  P    
Sbjct  870  KEQVMKVLDPRLSTVPLHEVMHVFYVALLCIEEQSVQRPTMREVVQILSELPKLAPRQGE  929

Query  339  EGTTACESSALEPP---PS---TGTSDDAKD  265
              + A +  A  PP   PS      + DAKD
Sbjct  930  VLSHAVDGFASNPPAPVPSGSAEALTGDAKD  960



>gb|EMT14290.1| Receptor protein kinase CLAVATA1 [Aegilops tauschii]
Length=895

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 50/91 (55%), Positives = 64/91 (70%), Gaps = 5/91 (5%)
 Frame = -1

Query  522  KKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTK  343
            K+E V+KI+D RLSTVP+HE MH+FYVALLCVEEQ+V+RP MREVVQ+L+ELPK      
Sbjct  785  KREQVIKIMDPRLSTVPVHEVMHVFYVALLCVEEQSVQRPTMREVVQILSELPKPTTKHG  844

Query  342  PEGTTAC----ESSALEPPPSTG-TSDDAKD  265
             E  T      ES  + PP +    +D+AK+
Sbjct  845  EEQLTGSGDGDESGPVGPPETVEPATDEAKE  875



>ref|XP_010023395.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1, partial [Eucalyptus grandis]
Length=875

 Score = 95.5 bits (236),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 50/89 (56%), Positives = 61/89 (69%), Gaps = 5/89 (6%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
            KE V KILD RL  VP+HEAMH+FYVA+LCVEEQAVERP MREVVQ+LTE P+ PPG+  
Sbjct  770  KEEVQKILDPRLPAVPLHEAMHVFYVAMLCVEEQAVERPTMREVVQILTERPR-PPGSAK  828

Query  339  EGTTACESSALEPP----PSTGTSDDAKD  265
              +    + +L P      S  T+ D K+
Sbjct  829  GDSVVVVAQSLPPQGLALESLATTKDGKE  857



>gb|EAZ02682.1| hypothetical protein OsI_24796 [Oryza sativa Indica Group]
Length=1023

 Score = 95.5 bits (236),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 52/90 (58%), Positives = 65/90 (72%), Gaps = 9/90 (10%)
 Frame = -1

Query  519   KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTK-  343
             KE V+KILD RLSTVP+HE MH+FYVALLCVEEQ+V+RP MREVVQ+L+ELPK  P +K 
Sbjct  919   KEHVIKILDPRLSTVPVHEVMHVFYVALLCVEEQSVQRPTMREVVQILSELPK--PTSKQ  976

Query  342   ----PEGTTACESSALEPPPSTGTSDDAKD  265
                 P G  A   S L  P  +  +++AK+
Sbjct  977   GEEPPSGEGAV--SDLVVPAESAEANEAKE  1004



>dbj|BAF01968.1| receptor protein kinase like protein [Arabidopsis thaliana]
Length=243

 Score = 91.7 bits (226),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 57/81 (70%), Gaps = 4/81 (5%)
 Frame = -1

Query  522  KKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTK  343
             K+ V+K++D RLS+VP+HE  H+FYVALLCVEEQAVERP MREVVQ+LTE+PK P   +
Sbjct  154  NKDCVLKVIDLRLSSVPVHEVTHVFYVALLCVEEQAVERPTMREVVQILTEIPKIPLSKQ  213

Query  342  PEGTTACESSALEPPPSTGTS  280
                 A ES   E  P+   S
Sbjct  214  ----QAAESDVTEKAPAINES  230



>gb|EMS57320.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Triticum urartu]
Length=788

 Score = 95.1 bits (235),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 50/91 (55%), Positives = 64/91 (70%), Gaps = 5/91 (5%)
 Frame = -1

Query  522  KKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTK  343
            K+E V+KI+D RLSTVP+HE MH+FYVALLCVEEQ+V+RP MREVVQ+L+ELPK      
Sbjct  678  KREQVIKIMDPRLSTVPVHEVMHVFYVALLCVEEQSVQRPTMREVVQILSELPKPTTKHG  737

Query  342  PEGTTAC----ESSALEPPPSTG-TSDDAKD  265
             E  T      ES  + PP +    +D+AK+
Sbjct  738  EEQLTGSGDGDESGPVGPPETVEPATDEAKE  768



>gb|KCW59634.1| hypothetical protein EUGRSUZ_H023832 [Eucalyptus grandis]
Length=871

 Score = 95.1 bits (235),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 50/89 (56%), Positives = 61/89 (69%), Gaps = 5/89 (6%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
            KE V KILD RL  VP+HEAMH+FYVA+LCVEEQAVERP MREVVQ+LTE P+ PPG+  
Sbjct  766  KEEVQKILDPRLPAVPLHEAMHVFYVAMLCVEEQAVERPTMREVVQILTERPR-PPGSAK  824

Query  339  EGTTACESSALEPP----PSTGTSDDAKD  265
              +    + +L P      S  T+ D K+
Sbjct  825  GDSVVVVAQSLPPQGLALESLATTKDGKE  853



>emb|CDY08759.1| BnaA06g24650D [Brassica napus]
Length=971

 Score = 95.1 bits (235),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 42/63 (67%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
            K+ V+K+LD RLS++PIHE  H+FYVA+LCVEEQAVERP MREVVQ+LTE+PK PP    
Sbjct  887  KDSVLKVLDPRLSSIPIHEVTHVFYVAMLCVEEQAVERPTMREVVQILTEVPKMPPSKDQ  946

Query  339  EGT  331
              T
Sbjct  947  PAT  949



>ref|XP_009150662.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Brassica rapa]
Length=997

 Score = 95.1 bits (235),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 42/63 (67%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
            K+ V+K+LD RLS++PIHE  H+FYVA+LCVEEQAVERP MREVVQ+LTE+PK PP    
Sbjct  913  KDSVLKVLDPRLSSIPIHEVTHVFYVAMLCVEEQAVERPTMREVVQILTEVPKMPPSKDQ  972

Query  339  EGT  331
              T
Sbjct  973  AAT  975



>dbj|BAC82955.1| putative OsLRK1(receptor-type protein kinase) [Oryza sativa Japonica 
Group]
 dbj|BAD30615.1| putative OsLRK1(receptor-type protein kinase) [Oryza sativa Japonica 
Group]
 gb|EAZ38608.1| hypothetical protein OsJ_22997 [Oryza sativa Japonica Group]
 dbj|BAH01666.1| unnamed protein product [Oryza sativa Japonica Group]
Length=1023

 Score = 95.1 bits (235),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 48/87 (55%), Positives = 64/87 (74%), Gaps = 3/87 (3%)
 Frame = -1

Query  519   KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
             KE V+KILD RLSTVP+HE MH+FYVALLCVEEQ+V+RP MREVVQ+L+ELPK P   + 
Sbjct  919   KEHVIKILDPRLSTVPVHEVMHVFYVALLCVEEQSVQRPTMREVVQILSELPK-PTSKQG  977

Query  339   EGTTACESSALE--PPPSTGTSDDAKD  265
             E   + E +  +   P  +  +++AK+
Sbjct  978   EEPPSGEGAVFDLVVPAESAEANEAKE  1004



>ref|XP_010936307.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Elaeis guineensis]
Length=1007

 Score = 94.7 bits (234),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 41/56 (73%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = -1

Query  522  KKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQP  355
            KKEGV+ +LD RL +VP+HEAMH+FYVA+LCVEEQ++ERP MREVVQ+LTELP+ P
Sbjct  926  KKEGVLSVLDPRLPSVPLHEAMHVFYVAMLCVEEQSIERPTMREVVQILTELPRPP  981



>ref|XP_009397330.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1023

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 43/55 (78%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQP  355
            KE V KILD RL T+P+HEAMH+FYVA+LCVEEQ+VERP MREVVQ+LTELPK P
Sbjct  919  KEEVTKILDPRLPTLPVHEAMHVFYVAMLCVEEQSVERPTMREVVQILTELPKPP  973



>ref|XP_009399076.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1021

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 48/81 (59%), Positives = 57/81 (70%), Gaps = 1/81 (1%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
            KE V KILD RL T PIHE MH+FYVA+LCVEEQ+V RP MREVVQMLTELP  P   + 
Sbjct  917  KENVAKILDPRLPTAPIHEVMHVFYVAMLCVEEQSVGRPTMREVVQMLTELPI-PSLKQG  975

Query  339  EGTTACESSALEPPPSTGTSD  277
            E +++   +A  PPP   + D
Sbjct  976  EDSSSGNVTAQPPPPIVASVD  996



>ref|XP_006657429.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Oryza brachyantha]
Length=864

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 48/87 (55%), Positives = 64/87 (74%), Gaps = 3/87 (3%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
            KE V+KILD RLSTVP+HE MH+FYVALLCVEEQ+++RP MREVVQ+L+ELPK P   + 
Sbjct  755  KEQVIKILDPRLSTVPVHEVMHVFYVALLCVEEQSMQRPTMREVVQILSELPK-PASKQG  813

Query  339  EGTTACESSA--LEPPPSTGTSDDAKD  265
            E   + E +   L  P  +  +++AK+
Sbjct  814  EEPPSGEGAVPDLVVPAESAEANEAKE  840



>emb|CDY23037.1| BnaC07g31500D [Brassica napus]
Length=967

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 46/76 (61%), Positives = 55/76 (72%), Gaps = 4/76 (5%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
            KE V+K++D RLS+VP+HE  H+FYVALLCVEEQAV RP MREVVQ+LTELPK P   + 
Sbjct  888  KECVLKVIDHRLSSVPVHEVTHVFYVALLCVEEQAVARPTMREVVQILTELPKIPLSKQ-  946

Query  339  EGTTACESSALEPPPS  292
                A ES   E  P+
Sbjct  947  ---LAVESDVTEKSPA  959



>ref|XP_006290548.1| hypothetical protein CARUB_v10016631mg [Capsella rubella]
 gb|EOA23446.1| hypothetical protein CARUB_v10016631mg [Capsella rubella]
Length=997

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 46/85 (54%), Positives = 59/85 (69%), Gaps = 3/85 (4%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
            K+ V+K++D RLS+VP+HE  H+FYVALLCVEEQAVERP MREVVQ+LTE+PK P   + 
Sbjct  909  KDCVLKVIDLRLSSVPVHEVTHVFYVALLCVEEQAVERPTMREVVQILTEIPKLPLSKQQ  968

Query  339  EGTTACESSAL---EPPPSTGTSDD  274
            E  +     A    E  P +G+  D
Sbjct  969  ETESDVTEKAPRMNESSPDSGSPPD  993



>gb|KFK34238.1| hypothetical protein AALP_AA5G119100 [Arabis alpina]
Length=998

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 47/76 (62%), Positives = 56/76 (74%), Gaps = 4/76 (5%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
            KE V+K++D RLS+VPIHE  H+FYVALLCVEEQAVERP MREVVQ+LTE+PK      P
Sbjct  910  KECVLKVIDLRLSSVPIHEVTHVFYVALLCVEEQAVERPTMREVVQILTEIPK----ILP  965

Query  339  EGTTACESSALEPPPS  292
                A ES+  E  P+
Sbjct  966  TKQHAAESNVTEISPA  981



>ref|NP_190536.1| CLAVATA1-related receptor kinase-like protein [Arabidopsis thaliana]
 sp|Q9M2Z1.1|BAME2_ARATH RecName: Full=Leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2; AltName: Full=Protein BARELY ANY MERISTEM 
2; Flags: Precursor [Arabidopsis thaliana]
 emb|CAB66905.1| receptor protein kinase-like protein [Arabidopsis thaliana]
 gb|AAO64138.1| putative leucine-rich repeat transmembrane protein kinase [Arabidopsis 
thaliana]
 gb|AAP04098.1| putative leucine-rich repeat transmembrane protein kinase [Arabidopsis 
thaliana]
 dbj|BAF00510.1| receptor protein kinase like protein [Arabidopsis thaliana]
 gb|ACN59331.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE78574.1| CLAVATA1-related receptor kinase-like protein [Arabidopsis thaliana]
Length=1002

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 46/80 (58%), Positives = 57/80 (71%), Gaps = 4/80 (5%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
            K+ V+K++D RLS+VP+HE  H+FYVALLCVEEQAVERP MREVVQ+LTE+PK P   + 
Sbjct  914  KDCVLKVIDLRLSSVPVHEVTHVFYVALLCVEEQAVERPTMREVVQILTEIPKIPLSKQ-  972

Query  339  EGTTACESSALEPPPSTGTS  280
                A ES   E  P+   S
Sbjct  973  ---QAAESDVTEKAPAINES  989



>ref|XP_009408581.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1016

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 54/101 (53%), Positives = 61/101 (60%), Gaps = 6/101 (6%)
 Frame = -1

Query  522   KKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTK  343
             KK  V KILD RL TVP+HE MH+F VA+LCVEEQ+VERP MREVVQ+LTELPK PP  K
Sbjct  918   KKGEVTKILDPRLPTVPLHEVMHVFCVAMLCVEEQSVERPTMREVVQILTELPKPPP--K  975

Query  342   PEGTTACESSALEPP----PSTGTSDDAKDqqqppPDLLSI  232
               G T      +  P    P T            P DLLS+
Sbjct  976   QGGDTPTPRGDVSAPRYIIPETREQQQQPASDSLPSDLLSM  1016



>ref|XP_003557615.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Brachypodium distachyon]
Length=1019

 Score = 92.0 bits (227),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 45/73 (62%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
            KE V+KI+D RLSTVP+HE MH+FYVALLCVEEQ+V+RP MREVVQ+L+E PK  P    
Sbjct  914  KERVIKIMDPRLSTVPVHEVMHVFYVALLCVEEQSVQRPTMREVVQILSEPPKLIPKQGE  973

Query  339  EGTTACESSALEP  301
            E   + E   L+P
Sbjct  974  ELPGSGEGDELDP  986



>ref|XP_010515326.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2 [Camelina sativa]
Length=1000

 Score = 92.0 bits (227),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 45/83 (54%), Positives = 58/83 (70%), Gaps = 3/83 (4%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
            K+ V+K++D RLS+VP+HE  H+FYVALLCVEEQAVERP MREVVQ+L E+PK P   + 
Sbjct  912  KDCVLKVIDLRLSSVPVHEVTHVFYVALLCVEEQAVERPTMREVVQILAEIPKMPLTKQL  971

Query  339  EGTTACESSALEPPPSTGTSDDA  271
            E  +     A   PP   +S D+
Sbjct  972  ETESDVTEKA---PPMNDSSPDS  991



>gb|EMS67650.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Triticum urartu]
Length=868

 Score = 92.0 bits (227),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 50/97 (52%), Positives = 61/97 (63%), Gaps = 17/97 (18%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQP-----  355
            KE V+KILD RLSTVP+HE MH+FYVALLC EE +V+RP MREVVQ+L+ELPK       
Sbjct  755  KEQVMKILDPRLSTVPVHEVMHVFYVALLCTEEHSVQRPTMREVVQILSELPKPAANQGD  814

Query  354  -------PGTKPEGTTACESSALEPPPSTGTSDDAKD  265
                    G  PE  T   +S+ + P     + DAKD
Sbjct  815  GEEELPLSGEGPESNTPAPTSSTDAP-----TGDAKD  846



>emb|CDY02112.1| BnaA03g40550D [Brassica napus]
Length=969

 Score = 92.0 bits (227),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 45/81 (56%), Positives = 56/81 (69%), Gaps = 4/81 (5%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
            KE V+K++D RLS+VP+HE  H+FYVA+LCVEEQAV RP MREVVQ+LTE+PK P   + 
Sbjct  889  KECVLKVIDHRLSSVPVHEVTHVFYVAMLCVEEQAVARPTMREVVQILTEVPKIPLSEQ-  947

Query  339  EGTTACESSALEPPPSTGTSD  277
                A ES   E  P+    D
Sbjct  948  ---LAVESDVTEKSPAVDEED  965



>emb|CDX91053.1| BnaC02g05440D [Brassica napus]
Length=99

 Score = 85.1 bits (209),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -1

Query  525  GKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQP  355
              KE VVK+LD RLS+ P+HE  H+FYVA+LCVEEQAVERP +RE VQ+LTE+PK P
Sbjct  22   SNKESVVKVLDPRLSSFPLHEVTHVFYVAMLCVEEQAVERPTIREDVQILTEVPKMP  78



>emb|CDY68180.1| BnaAnng26370D [Brassica napus]
Length=99

 Score = 85.1 bits (209),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -1

Query  525  GKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQP  355
              KE VVK+LD RLS+  +HE  H+FYVA+LCVEEQAVERP +REVVQ+LTE+PK P
Sbjct  22   SNKESVVKVLDPRLSSFALHEVTHVFYVAMLCVEEQAVERPTIREVVQILTEVPKMP  78



>ref|XP_003558681.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Brachypodium distachyon]
Length=1027

 Score = 91.7 bits (226),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 41/53 (77%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPK  361
            KE V+KILD RLSTVP+HE MH+FYVALLC+EEQ+V+RP MREVVQ+L+ELPK
Sbjct  919  KEQVMKILDPRLSTVPLHEVMHVFYVALLCIEEQSVQRPTMREVVQILSELPK  971



>ref|XP_002466378.1| hypothetical protein SORBIDRAFT_01g006690 [Sorghum bicolor]
 gb|EER93376.1| hypothetical protein SORBIDRAFT_01g006690 [Sorghum bicolor]
Length=1030

 Score = 91.7 bits (226),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 48/80 (60%), Positives = 55/80 (69%), Gaps = 7/80 (9%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTK-  343
            KE V+KILD RLSTVP+ E MH+FYVALLC EEQ+V+RP MREVVQ+L+ELPK  P  K 
Sbjct  922  KEQVMKILDPRLSTVPLQEVMHVFYVALLCTEEQSVQRPTMREVVQILSELPK--PANKQ  979

Query  342  ----PEGTTACESSALEPPP  295
                P       SS L P P
Sbjct  980  GEDVPNSGDGSASSPLHPAP  999



>ref|XP_009136515.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2 [Brassica rapa]
Length=993

 Score = 91.7 bits (226),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 45/81 (56%), Positives = 56/81 (69%), Gaps = 4/81 (5%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
            KE V+K++D RLS+VP+HE  H+FYVA+LCVEEQAV RP MREVVQ+LTE+PK P   + 
Sbjct  913  KECVLKVIDHRLSSVPVHEVTHVFYVAMLCVEEQAVARPMMREVVQILTEVPKIPLSEQ-  971

Query  339  EGTTACESSALEPPPSTGTSD  277
                A ES   E  P+    D
Sbjct  972  ---LAVESDVTEKSPAVDEED  989



>ref|XP_010943209.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat receptor-like 
serine/threonine-protein kinase BAM1 [Elaeis guineensis]
Length=995

 Score = 91.3 bits (225),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 57/104 (55%), Positives = 71/104 (68%), Gaps = 8/104 (8%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
            K+ V  ILD RLS+VP+H+ MH+FYVA+LCVEEQ+VERP MREVVQ+L+ELP+  P    
Sbjct  892  KQAVTNILDPRLSSVPLHDVMHVFYVAMLCVEEQSVERPTMREVVQILSELPRPTPKPGE  951

Query  339  EGTTACESS-ALEPPPSTGT-SDDAKDqqqppP------DLLSI  232
            E ++  E S A  P PS  T S + K+QQQ P       DLLSI
Sbjct  952  EDSSNNEESGAPAPVPSAETPSKETKEQQQQPARQSPPPDLLSI  995



>ref|XP_010426489.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2 [Camelina sativa]
Length=1000

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 51/95 (54%), Positives = 64/95 (67%), Gaps = 7/95 (7%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
            K+ V+K++D RLS+VP+HE  H+FYVALLCVEEQAVERP MREVVQ+L E+PK P   + 
Sbjct  912  KDCVLKVIDLRLSSVPVHEVTHVFYVALLCVEEQAVERPTMREVVQILAEIPKMPLTKQL  971

Query  339  EGTTACESSALEPPPSTGTSDDAKDqqqppPDLLS  235
            E     ES   E  P   T +++      PPDLLS
Sbjct  972  E----TESDVTEKAP---TMNESSPDSGSPPDLLS  999



>ref|XP_009396449.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1006

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 45/77 (58%), Positives = 56/77 (73%), Gaps = 2/77 (3%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPK--QPPGT  346
            KEGV++I+D RL TVP+ E MH+FYVA+LCVEEQ+VERP MREVVQ+LT+LP   +  G 
Sbjct  923  KEGVLEIVDPRLPTVPLDEVMHVFYVAMLCVEEQSVERPTMREVVQILTDLPNPARKQGE  982

Query  345  KPEGTTACESSALEPPP  295
              E  T  +  A E PP
Sbjct  983  DREAATKEQQQAAEKPP  999



>ref|XP_008665503.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Zea mays]
 tpg|DAA51666.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=1034

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 43/59 (73%), Positives = 51/59 (86%), Gaps = 1/59 (2%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTK  343
            KE V+K+LD RLSTVP+HE  H+FYVALLC EEQ+V+RP MREVVQ+L+ELPK PP TK
Sbjct  916  KEQVMKVLDPRLSTVPLHEVTHVFYVALLCTEEQSVQRPTMREVVQILSELPK-PPSTK  973



>dbj|BAJ89729.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1030

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 48/87 (55%), Positives = 60/87 (69%), Gaps = 5/87 (6%)
 Frame = -1

Query  519   KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
             KE V+KILD RLSTVP+HE MH+FYVALLC EE +V+RP MREVVQ+L+ELPK P  ++ 
Sbjct  919   KEQVMKILDPRLSTVPVHEVMHVFYVALLCTEEHSVQRPTMREVVQILSELPK-PAASQG  977

Query  339   EGTTACESSA----LEPPPSTGTSDDA  271
             +G      S       PP  T +S +A
Sbjct  978   DGEEELPLSGDGPESNPPAPTSSSTEA  1004



>ref|XP_010503631.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2 [Camelina sativa]
Length=999

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 45/80 (56%), Positives = 56/80 (70%), Gaps = 4/80 (5%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
            K+ V+K++D RLS+VP+HE  H+FYVALLCVEEQAVERP MREVVQ+L E+PK P   + 
Sbjct  911  KDCVLKVIDLRLSSVPVHEVTHVFYVALLCVEEQAVERPTMREVVQILAEIPKMPLTKQL  970

Query  339  EGTTACESSALEPPPSTGTS  280
            E     ES   E  P+   S
Sbjct  971  E----TESDVTEKAPAMNES  986



>ref|XP_002875982.1| hypothetical protein ARALYDRAFT_906265 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52241.1| hypothetical protein ARALYDRAFT_906265 [Arabidopsis lyrata subsp. 
lyrata]
Length=1001

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 46/80 (58%), Positives = 57/80 (71%), Gaps = 4/80 (5%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
            K+ V+K++D RLS+VP+HE  H+FYVALLCVEEQAVERP MREVVQ+LTE+PK P   + 
Sbjct  913  KDCVLKVIDLRLSSVPVHEVTHVFYVALLCVEEQAVERPTMREVVQILTEIPKIPLLKQ-  971

Query  339  EGTTACESSALEPPPSTGTS  280
                A ES   E  P+   S
Sbjct  972  ---QAAESDVSEKAPAMNES  988



>gb|ADB85328.1| putative receptor protein kinase [Phyllostachys edulis]
Length=743

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 46/84 (55%), Positives = 60/84 (71%), Gaps = 1/84 (1%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
            KE V+ I D RLSTVP+HE MH+FYVALLCVEEQ+V+RP MREVVQ+L++LPK  P    
Sbjct  635  KEQVMMIRDPRLSTVPLHEVMHVFYVALLCVEEQSVQRPTMREVVQILSDLPKPAPKQGE  694

Query  339  EGTTACESSAL-EPPPSTGTSDDA  271
            + + + + SA   P P+   S +A
Sbjct  695  DLSLSGDGSASNSPAPAPSGSAEA  718



>ref|XP_006404116.1| hypothetical protein EUTSA_v10010092mg [Eutrema salsugineum]
 gb|ESQ45569.1| hypothetical protein EUTSA_v10010092mg [Eutrema salsugineum]
Length=1009

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 45/80 (56%), Positives = 57/80 (71%), Gaps = 3/80 (4%)
 Frame = -1

Query  519   KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
             K+ V+K++D RLS+VPIHE  H+FYVA+LCVEE+AVERP MREVVQ+LTE+PK P   + 
Sbjct  926   KDCVLKVIDLRLSSVPIHEVTHVFYVAMLCVEERAVERPTMREVVQILTEIPKIPISKQ-  984

Query  339   EGTTACESSALEPPPSTGTS  280
                 A ES   E  P+   S
Sbjct  985   --KAAAESDVTEKSPAMNES  1002



>gb|EMT20446.1| Receptor protein kinase CLAVATA1 [Aegilops tauschii]
Length=866

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 46/83 (55%), Positives = 58/83 (70%), Gaps = 2/83 (2%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPP--GT  346
            KE V+KILD RLSTVP+HE MH+FYVALLC EE +V+RP MREVVQ+L+ELPK     G 
Sbjct  755  KEQVMKILDPRLSTVPVHEVMHVFYVALLCTEEHSVQRPTMREVVQILSELPKPAANQGD  814

Query  345  KPEGTTACESSALEPPPSTGTSD  277
            + E   + E     PP  T +++
Sbjct  815  EEELPLSGEGPESNPPAPTSSTE  837



>ref|XP_010028033.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Eucalyptus grandis]
 gb|KCW54695.1| hypothetical protein EUGRSUZ_I00635 [Eucalyptus grandis]
Length=1023

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 48/74 (65%), Positives = 54/74 (73%), Gaps = 4/74 (5%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
            KE V  ILD RL+TVP+HEAMH+FYVA+LCVEEQAVERP MREVVQ+LTE PK     + 
Sbjct  928  KEEVQLILDPRLNTVPLHEAMHLFYVAMLCVEEQAVERPTMREVVQILTEFPKPCNVKQD  987

Query  339  EGTTACESSALEPP  298
            E  T    S LE P
Sbjct  988  EPLT----SPLESP  997



>ref|XP_009787949.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Nicotiana sylvestris]
Length=1000

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 36/65 (55%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = -1

Query  522  KKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTK  343
            K+E V  I+D RL+TVP  EAMH+F+VA+LC++E +VERP MREV+QML+E P+Q P  +
Sbjct  912  KREQVTHIVDPRLTTVPEDEAMHLFFVAMLCIQENSVERPTMREVIQMLSEFPRQSPEYQ  971

Query  342  PEGTT  328
            P  ++
Sbjct  972  PSSSS  976



>ref|XP_008787359.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat receptor-like 
serine/threonine-protein kinase BAM1, partial [Phoenix 
dactylifera]
Length=1004

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 39/57 (68%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPG  349
            +E V +ILD RLSTVP+HE +H+F+VA+LCVEEQ+VERP MREVVQ+L E PK  PG
Sbjct  919  REAVTEILDPRLSTVPLHEVLHVFHVAMLCVEEQSVERPTMREVVQILAEFPKPKPG  975



>gb|EPS74129.1| hypothetical protein M569_00625, partial [Genlisea aurea]
Length=970

 Score = 89.4 bits (220),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 42/54 (78%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = -1

Query  525  GKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELP  364
            G KE V+KI+DSRLST PI E  H+FYVA+LCVEEQAVERP MREVVQ+LTELP
Sbjct  917  GNKEEVMKIVDSRLSTPPIEEVTHVFYVAMLCVEEQAVERPTMREVVQILTELP  970



>ref|XP_006649672.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Oryza brachyantha]
Length=1001

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 53/107 (50%), Positives = 61/107 (57%), Gaps = 20/107 (19%)
 Frame = -1

Query  519   KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELP--------  364
             KEGV KI D RLSTVP+HE  H+FYVA+LCV EQ+VERP MREVVQ+LT+LP        
Sbjct  904   KEGVTKIADPRLSTVPLHELTHVFYVAMLCVAEQSVERPTMREVVQILTDLPGTAATPMD  963

Query  363   ---KQPPGTKPEGTTACESSALEPPPSTGTSDDAKDqqqppPDLLSI  232
                   PG K +GTT          P      D   +  P  DLLSI
Sbjct  964   DAASHGPG-KDQGTTT--------SPEKPQQQDGSRESPPQQDLLSI  1001



>ref|XP_010941985.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Elaeis guineensis]
Length=1024

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 45/85 (53%), Positives = 57/85 (67%), Gaps = 3/85 (4%)
 Frame = -1

Query  519   KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPG---  349
             KE V +ILD RLSTVP+ E +H+F+VA+LCVEEQ+VERP MREVVQ+L E PK  PG   
Sbjct  919   KEAVSEILDPRLSTVPLQEVIHVFHVAMLCVEEQSVERPTMREVVQILAEFPKPKPGEDS  978

Query  348   TKPEGTTACESSALEPPPSTGTSDD  274
             +  EG+       +E   S  T +D
Sbjct  979   SANEGSVPPPPVPVEETSSKETKED  1003



>gb|ABE79572.2| Protein kinase [Medicago truncatula]
Length=989

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 36/56 (64%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = -1

Query  525  GKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  358
            G++E VV I+DSRL  VP  EAMHMF++A+LC+EE +V+RP MREVVQML+E P+Q
Sbjct  891  GRREEVVNIIDSRLMVVPKEEAMHMFFIAMLCLEENSVQRPTMREVVQMLSEFPRQ  946



>ref|XP_003592924.1| Receptor-like protein kinase [Medicago truncatula]
 gb|AES63175.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=1007

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 36/56 (64%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = -1

Query  525  GKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  358
            G++E VV I+DSRL  VP  EAMHMF++A+LC+EE +V+RP MREVVQML+E P+Q
Sbjct  909  GRREEVVNIIDSRLMVVPKEEAMHMFFIAMLCLEENSVQRPTMREVVQMLSEFPRQ  964



>ref|XP_009394620.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1003

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 47/82 (57%), Positives = 57/82 (70%), Gaps = 9/82 (11%)
 Frame = -1

Query  522  KKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTK  343
            KKEGV++ILD RL TVP+ EAMH+FYVA+LCVEEQ+VERP MREVVQ+L + PK      
Sbjct  920  KKEGVLQILDRRLPTVPLDEAMHVFYVAMLCVEEQSVERPTMREVVQILMDRPKGHGCDA  979

Query  342  P------EGTTACESSALEPPP  295
            P      +   A E+S   PPP
Sbjct  980  PIKEVKEQQQRAAENS---PPP  998



>ref|NP_001049453.1| Os03g0228800 [Oryza sativa Japonica Group]
 gb|ABF94768.1| Receptor protein kinase CLAVATA1 precursor, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF11367.1| Os03g0228800 [Oryza sativa Japonica Group]
 gb|EEE58640.1| hypothetical protein OsJ_10012 [Oryza sativa Japonica Group]
Length=1007

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 47/96 (49%), Positives = 59/96 (61%), Gaps = 1/96 (1%)
 Frame = -1

Query  519   KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
             KEGV KI D RLSTVP+HE  H+FYVA+LCV EQ+VERP MREVVQ+LT+LP     T  
Sbjct  913   KEGVTKIADPRLSTVPLHELTHVFYVAMLCVAEQSVERPTMREVVQILTDLPGTAAATAM  972

Query  339   EGTTACESSALEPPPSTGTSDDAKDqqqppPDLLSI  232
             +  +       +        D +++   P  DLLSI
Sbjct  973   DAPSHGSGKEQDRSAEMQQQDGSRE-SPPQQDLLSI  1007



>gb|AAM27467.1|AC099732_4 Putative receptor-like protein kinase [Oryza sativa Japonica 
Group]
Length=1001

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 47/96 (49%), Positives = 59/96 (61%), Gaps = 1/96 (1%)
 Frame = -1

Query  519   KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
             KEGV KI D RLSTVP+HE  H+FYVA+LCV EQ+VERP MREVVQ+LT+LP     T  
Sbjct  907   KEGVTKIADPRLSTVPLHELTHVFYVAMLCVAEQSVERPTMREVVQILTDLPGTAAATAM  966

Query  339   EGTTACESSALEPPPSTGTSDDAKDqqqppPDLLSI  232
             +  +       +        D +++   P  DLLSI
Sbjct  967   DAPSHGSGKEQDRSAEMQQQDGSRE-SPPQQDLLSI  1001



>ref|XP_009394785.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1006

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 42/65 (65%), Positives = 52/65 (80%), Gaps = 1/65 (2%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
            KEGV+KILD RL TVP+ E MH+FYVA+LCVEEQ+V RP MREVVQ+LT+LP+ P  T+ 
Sbjct  924  KEGVLKILDHRLPTVPLDEVMHVFYVAMLCVEEQSVGRPTMREVVQILTDLPR-PATTQA  982

Query  339  EGTTA  325
            +   A
Sbjct  983  DDCEA  987



>gb|ACN35202.1| unknown [Zea mays]
Length=320

 Score = 83.6 bits (205),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPK  361
            KE VVK++D RLS+VP+HE  H+F VALLCVEEQ+V+RP MREVVQML ELPK
Sbjct  207  KEQVVKVMDPRLSSVPVHEVAHVFCVALLCVEEQSVQRPTMREVVQMLGELPK  259



>gb|EEC74807.1| hypothetical protein OsI_10619 [Oryza sativa Indica Group]
Length=1010

 Score = 85.9 bits (211),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 39/52 (75%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELP  364
            KEGV KI D RLSTVP+HE  H+FYVA+LCV EQ+VERP MREVVQ+LT+LP
Sbjct  911  KEGVTKIADPRLSTVPLHELTHVFYVAMLCVAEQSVERPTMREVVQILTDLP  962



>ref|XP_008356104.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Malus domestica]
Length=987

 Score = 85.9 bits (211),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 39/56 (70%), Positives = 48/56 (86%), Gaps = 1/56 (2%)
 Frame = -1

Query  522  KKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQP  355
            +KEGV+KILD RL TVP+ EAM +F+VA+LCV+EQ+VERP MREVVQML +  KQP
Sbjct  927  QKEGVIKILDKRLDTVPMDEAMQVFFVAVLCVQEQSVERPTMREVVQMLAQ-AKQP  981



>ref|XP_010228930.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Brachypodium distachyon]
Length=1008

 Score = 85.5 bits (210),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 46/74 (62%), Positives = 53/74 (72%), Gaps = 11/74 (15%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
            KEGV+KI D RLSTVPI E  H+FYVA+LCV EQ+VERP MREVVQ+LT+LP        
Sbjct  915  KEGVMKIADPRLSTVPIQELTHVFYVAMLCVAEQSVERPTMREVVQILTDLP--------  966

Query  339  EGTTACESSALEPP  298
             GTT   S +L PP
Sbjct  967  -GTTT--SMSLPPP  977



>ref|XP_009395647.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1004

 Score = 85.5 bits (210),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 46/80 (58%), Positives = 55/80 (69%), Gaps = 8/80 (10%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ-----P  355
            KEG +KILD RL T P  EAMH+FYVA LCV+EQ+VERP MREVVQ+LT+ PKQ      
Sbjct  923  KEGALKILDPRLPTAPPDEAMHVFYVATLCVQEQSVERPTMREVVQILTDPPKQGEDRET  982

Query  354  PGTKPEGTTACESSALEPPP  295
            P  + E   A +S+   PPP
Sbjct  983  PIKEAEQQQAAQST---PPP  999



>ref|NP_001169902.1| uncharacterized protein LOC100383797 [Zea mays]
 gb|ACN27138.1| unknown [Zea mays]
Length=459

 Score = 84.3 bits (207),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPK  361
            KE VVK++D RLS+VP+HE  H+F VALLCVEEQ+V+RP MREVVQML ELPK
Sbjct  346  KEQVVKVMDPRLSSVPVHEVAHVFCVALLCVEEQSVQRPTMREVVQMLGELPK  398



>ref|XP_009363288.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Pyrus x bretschneideri]
Length=987

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 39/56 (70%), Positives = 47/56 (84%), Gaps = 1/56 (2%)
 Frame = -1

Query  522  KKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQP  355
            +KEGV+KILD RL  VP+ EAM +F+VA+LCVEEQ+VERP MREVVQML +  KQP
Sbjct  927  QKEGVIKILDKRLDAVPMDEAMQVFFVAVLCVEEQSVERPTMREVVQMLAQ-AKQP  981



>dbj|BAJ99137.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1004

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 50/99 (51%), Positives = 59/99 (60%), Gaps = 13/99 (13%)
 Frame = -1

Query  519   KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELP---KQPPG  349
             KEGV+KI D RLSTVPI E  H+FYVA+LCV EQ+VERP MREVVQ+L ++P       G
Sbjct  916   KEGVMKIADPRLSTVPIQELTHVFYVAMLCVAEQSVERPTMREVVQILADMPGATSMTVG  975

Query  348   TKPEGTTACESSALEPPPSTGTSDDAKDqqqppPDLLSI  232
             T+ E T   E    +     GT D          DLLSI
Sbjct  976   TRSEATVEVEEEHQD-----GTQDSP-----AQQDLLSI  1004



>gb|EYU33270.1| hypothetical protein MIMGU_mgv1a0010742mg, partial [Erythranthe 
guttata]
Length=138

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = -1

Query  522  KKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTK  343
            ++E V +I+D RL+ VP  EAMH+F+VA+LCV+E +VERP MREVVQML+E P++ P   
Sbjct  51   RREEVTRIIDPRLTVVPKDEAMHLFFVAMLCVQENSVERPTMREVVQMLSEFPRRSPEFH  110

Query  342  P  340
            P
Sbjct  111  P  111



>ref|XP_009603651.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Nicotiana tomentosiformis]
Length=1000

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/65 (54%), Positives = 50/65 (77%), Gaps = 0/65 (0%)
 Frame = -1

Query  522  KKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTK  343
            K+E V  I+D RL+TVP  EAMH+F+VA+L ++E +VERP MREV+QML+E P+Q P  +
Sbjct  912  KREQVRHIVDPRLTTVPEDEAMHLFFVAMLSIQENSVERPTMREVIQMLSEFPRQSPEYQ  971

Query  342  PEGTT  328
            P  ++
Sbjct  972  PSSSS  976



>ref|XP_006431638.1| hypothetical protein CICLE_v10000148mg [Citrus clementina]
 gb|ESR44878.1| hypothetical protein CICLE_v10000148mg [Citrus clementina]
Length=997

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/56 (61%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = -1

Query  525  GKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  358
            G+KE  + ILD RLSTVP  EAMH+ +VA+LC++E ++ERP+MREVVQML+E P+ 
Sbjct  911  GRKEEFLSILDPRLSTVPKEEAMHLLFVAMLCIQENSIERPRMREVVQMLSEFPRH  966



>tpg|DAA59489.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=1037

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 39/53 (74%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPK  361
            KE VVK++D RLS+VP+HE  H+F VALLCVEEQ+V+RP MREVVQML ELPK
Sbjct  924  KEQVVKVMDPRLSSVPVHEVAHVFCVALLCVEEQSVQRPTMREVVQMLGELPK  976



>ref|XP_011092305.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Sesamum indicum]
Length=1004

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/57 (60%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -1

Query  522  KKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPP  352
            ++E V +ILD RL+ VP  EAMH+F+VA+LC++E +VERP MREVVQML+E P++ P
Sbjct  920  RREEVSRILDPRLAVVPKDEAMHLFFVAMLCIQENSVERPTMREVVQMLSEFPRRSP  976



>ref|XP_007214567.1| hypothetical protein PRUPE_ppa000837mg [Prunus persica]
 gb|EMJ15766.1| hypothetical protein PRUPE_ppa000837mg [Prunus persica]
Length=986

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 38/55 (69%), Positives = 47/55 (85%), Gaps = 1/55 (2%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQP  355
            KEGV+KILD RL +VP+ EAM +F+VA+LCV+EQ+VERP MREVVQML +  KQP
Sbjct  927  KEGVIKILDKRLDSVPLDEAMQVFFVAVLCVQEQSVERPTMREVVQMLAQ-AKQP  980



>ref|XP_004230451.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Solanum lycopersicum]
Length=995

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 32/57 (56%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -1

Query  522  KKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPP  352
            K+E V  I+D RL++VP  EAMH+F++++LC++E +VERP MREV+QML+E P+Q P
Sbjct  905  KREQVTHIVDPRLTSVPQDEAMHLFFISMLCIQENSVERPTMREVIQMLSEFPRQSP  961



>gb|AAX94895.1| Similar to receptor-like protein kinase [Oryza sativa Japonica 
Group]
Length=139

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 54/77 (70%), Gaps = 8/77 (10%)
 Frame = -1

Query  525  GKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ----  358
            G++E V +I+D R+STVP+ E  H+F+V++LCV+E +VERP MREVVQML+E P+     
Sbjct  49   GRRESVHRIIDRRISTVPMDEVAHIFFVSMLCVQENSVERPTMREVVQMLSEFPRHGSDQ  108

Query  357  --PPGTKPEGTTACESS  313
              P  + PE  T  ESS
Sbjct  109  PSPSSSAPE--TGEESS  123



>ref|XP_007040964.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
 gb|EOX96795.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
Length=986

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 38/55 (69%), Positives = 45/55 (82%), Gaps = 1/55 (2%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQP  355
            KEGVVKILD R S +P+ EAM +F+VA+LCVEE +VERP MREVVQML +  KQP
Sbjct  927  KEGVVKILDQRASNIPVEEAMQVFFVAMLCVEEHSVERPTMREVVQMLAQ-AKQP  980



>ref|XP_008349109.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Malus domestica]
Length=987

 Score = 83.6 bits (205),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 38/56 (68%), Positives = 47/56 (84%), Gaps = 1/56 (2%)
 Frame = -1

Query  522  KKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQP  355
            +KEGV+KILD RL TVP+ EAM +F+VA+LCV+E +VERP MREVVQML +  KQP
Sbjct  927  QKEGVIKILDKRLDTVPMDEAMQVFFVAVLCVQEHSVERPTMREVVQMLAQ-AKQP  981



>ref|XP_009368577.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Pyrus x bretschneideri]
Length=987

 Score = 83.6 bits (205),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 38/56 (68%), Positives = 47/56 (84%), Gaps = 1/56 (2%)
 Frame = -1

Query  522  KKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQP  355
            +KEGV+KILD RL TVP+ EAM +F+VA+LCV+E +VERP MREVVQML +  KQP
Sbjct  927  QKEGVIKILDKRLDTVPMDEAMQVFFVAVLCVQEHSVERPTMREVVQMLAQ-AKQP  981



>gb|EMT15500.1| hypothetical protein F775_52402 [Aegilops tauschii]
Length=811

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 48/96 (50%), Positives = 58/96 (60%), Gaps = 5/96 (5%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
            KEGV+KI D RLSTVPI E  H+FYVA+LCV EQ+VERP MREVVQ+L ++P     T  
Sbjct  721  KEGVMKIADPRLSTVPIQELTHVFYVAMLCVAEQSVERPTMREVVQILADMPGATSMTA-  779

Query  339  EGTTACESSALEPPPSTGTSDDAKDqqqppPDLLSI  232
             GTT  E++            D   +     DLLSI
Sbjct  780  -GTTRVEATV---EGEDEEHQDGPQESPAQQDLLSI  811



>ref|XP_004295533.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Fragaria vesca subsp. vesca]
Length=982

 Score = 83.2 bits (204),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 37/56 (66%), Positives = 47/56 (84%), Gaps = 1/56 (2%)
 Frame = -1

Query  522  KKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQP  355
            +KEGV+KILD RL +VP+ EAM +F+VA+LCV+E +VERP MREVVQML +  KQP
Sbjct  922  RKEGVIKILDQRLGSVPLDEAMQVFFVAVLCVQEHSVERPTMREVVQMLAQ-AKQP  976



>ref|XP_011087678.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Sesamum indicum]
Length=992

 Score = 83.2 bits (204),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 34/56 (61%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPP  352
            +E V +I+D RL+ VP  EAMH+F+VA+LCV+E  VERP MREVVQML+E P++ P
Sbjct  908  REEVTRIIDPRLTVVPKDEAMHLFFVAMLCVQENCVERPTMREVVQMLSEFPRRSP  963



>gb|AHJ14779.1| CLAVATA1 [Rhododendron ovatum]
Length=992

 Score = 83.2 bits (204),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 38/55 (69%), Positives = 45/55 (82%), Gaps = 1/55 (2%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQP  355
            KEGVVKILD RL  VP+ EAM +F+VA+LCV+E +VERP MREVVQML +  KQP
Sbjct  933  KEGVVKILDERLKNVPVDEAMQVFFVAMLCVQEHSVERPTMREVVQMLAQ-AKQP  986



>ref|XP_002304615.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE79594.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=988

 Score = 82.8 bits (203),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 38/55 (69%), Positives = 47/55 (85%), Gaps = 1/55 (2%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQP  355
            KEGVVKILD RL+ +P+ EAM +F+VA+LCV+EQ+VERP MREVVQML +  KQP
Sbjct  929  KEGVVKILDQRLTDIPLIEAMQVFFVAMLCVQEQSVERPTMREVVQMLAQ-AKQP  982



>ref|XP_007041221.1| Leucine-rich receptor-like protein kinase family protein, putative 
[Theobroma cacao]
 gb|EOX97052.1| Leucine-rich receptor-like protein kinase family protein, putative 
[Theobroma cacao]
Length=988

 Score = 82.8 bits (203),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 32/57 (56%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -1

Query  522  KKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPP  352
            ++E V++I+D RL+TVP  EAMH+ ++A+LCV+E ++ERP MREVVQML+E P+  P
Sbjct  906  RREEVMRIVDPRLTTVPKDEAMHLLFIAMLCVQENSIERPTMREVVQMLSEFPRHSP  962



>gb|AAX96206.1| Similar to receptor-like protein kinase 3 [Oryza sativa Japonica 
Group]
 gb|ABA92267.1| Leucine Rich Repeat family protein, expressed [Oryza sativa Japonica 
Group]
Length=1061

 Score = 82.8 bits (203),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 39/80 (49%), Positives = 55/80 (69%), Gaps = 4/80 (5%)
 Frame = -1

Query  525   GKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPK----Q  358
             G++E V +I+D R+STVP+ E  H+F+V++LCV+E +VERP MREVVQML+E P+    Q
Sbjct  971   GRRESVHRIIDRRISTVPMDEVAHIFFVSMLCVQENSVERPTMREVVQMLSEFPRHGSDQ  1030

Query  357   PPGTKPEGTTACESSALEPP  298
             P  +     T  ESS  + P
Sbjct  1031  PSPSSSAPETGEESSPEKEP  1050



>emb|CBI29704.3| unnamed protein product [Vitis vinifera]
Length=895

 Score = 82.8 bits (203),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 34/64 (53%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
            KE V++I+D RL+T+P +EA H+F++ALLC+EE +VERP MREVVQML+E  +  P  K 
Sbjct  829  KENVIRIVDPRLATIPRNEATHLFFIALLCIEENSVERPTMREVVQMLSESHRNSPDNKT  888

Query  339  EGTT  328
              ++
Sbjct  889  SSSS  892



>emb|CDP04113.1| unnamed protein product [Coffea canephora]
Length=987

 Score = 82.8 bits (203),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 37/55 (67%), Positives = 46/55 (84%), Gaps = 1/55 (2%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQP  355
            KEGVVKILD RL  VP++EAM +F+VA+LCV+E ++ERP MREVVQML +  KQP
Sbjct  928  KEGVVKILDERLKNVPLNEAMQVFFVAMLCVQEHSIERPTMREVVQMLAQ-AKQP  981



>ref|XP_002263291.2| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Vitis vinifera]
Length=976

 Score = 82.8 bits (203),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 34/64 (53%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
            KE V++I+D RL+T+P +EA H+F++ALLC+EE +VERP MREVVQML+E  +  P  K 
Sbjct  910  KENVIRIVDPRLATIPRNEATHLFFIALLCIEENSVERPTMREVVQMLSESHRNSPDNKT  969

Query  339  EGTT  328
              ++
Sbjct  970  SSSS  973



>gb|KDP23869.1| hypothetical protein JCGZ_27138 [Jatropha curcas]
Length=989

 Score = 82.4 bits (202),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 39/55 (71%), Positives = 46/55 (84%), Gaps = 1/55 (2%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQP  355
            KE VVKILD RLS +P+ EAM +F+VA+LCV+EQ+VERP MREVVQML E  KQP
Sbjct  930  KERVVKILDQRLSEIPLIEAMQVFFVAMLCVQEQSVERPTMREVVQMLAE-AKQP  983



>ref|XP_006858565.1| hypothetical protein AMTR_s00071p00176900 [Amborella trichopoda]
 gb|ERN20032.1| hypothetical protein AMTR_s00071p00176900 [Amborella trichopoda]
Length=803

 Score = 82.4 bits (202),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 36/64 (56%), Positives = 48/64 (75%), Gaps = 2/64 (3%)
 Frame = -1

Query  525  GKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTEL--PKQPP  352
            G +  V  ILDSRL+ VP+ E+MH+F++A+LCV+E ++ERP MREVVQML+E   PK P 
Sbjct  688  GDRRKVTLILDSRLNQVPLEESMHLFFIAMLCVQENSIERPTMREVVQMLSEFPNPKPPS  747

Query  351  GTKP  340
             T P
Sbjct  748  QTSP  751



>ref|XP_004485432.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3-like [Cicer arietinum]
Length=987

 Score = 82.4 bits (202),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 34/56 (61%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = -1

Query  525  GKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  358
            G++E V  I+DSRL  VP  E MHMF++A+LC+EE +V+RP MREVVQML+E P Q
Sbjct  912  GRREDVFNIVDSRLVVVPKEEVMHMFFIAMLCLEENSVQRPTMREVVQMLSEFPPQ  967



>ref|XP_009403711.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2 [Musa acuminata subsp. malaccensis]
 ref|XP_009403712.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2 [Musa acuminata subsp. malaccensis]
 ref|XP_009403713.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2 [Musa acuminata subsp. malaccensis]
Length=995

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 39/73 (53%), Positives = 51/73 (70%), Gaps = 3/73 (4%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
            ++ V  I D RLSTVPI E MH+F+VA+LCV+E +VERP MREVVQML+E P   P +  
Sbjct  907  RDNVAAIADPRLSTVPIAEVMHVFFVAMLCVQENSVERPTMREVVQMLSEFPHHVPESHS  966

Query  339  EGTTAC---ESSA  310
              ++A    ESS+
Sbjct  967  PSSSATALKESSS  979



>gb|ACL54651.1| unknown [Zea mays]
Length=441

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
            KEGV+KI D RLSTVP++E  H+FYVA+LCV EQ+VERP MREVVQ+L ++P     T  
Sbjct  344  KEGVMKIADPRLSTVPLYELTHVFYVAMLCVAEQSVERPTMREVVQILADMPGSTSTTSI  403

Query  339  E  337
            +
Sbjct  404  D  404



>gb|KDO44093.1| hypothetical protein CISIN_1g001922mg [Citrus sinensis]
Length=995

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/56 (59%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = -1

Query  525  GKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  358
            G+KE  + ILD RLS VP  EAMH+ +VA+LC++E ++ERP+MREVVQML+E P+ 
Sbjct  909  GRKEEFLSILDPRLSMVPKEEAMHLLFVAMLCIQENSIERPRMREVVQMLSEFPRH  964



>ref|XP_006492589.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Citrus sinensis]
Length=995

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/56 (59%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = -1

Query  525  GKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  358
            G+KE  + ILD RLS VP  EAMH+ +VA+LC++E ++ERP+MREVVQML+E P+ 
Sbjct  909  GRKEEFLSILDPRLSMVPKEEAMHLLFVAMLCIQENSIERPRMREVVQMLSEFPRH  964



>ref|XP_006349327.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3-like [Solanum tuberosum]
Length=999

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 32/55 (58%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -1

Query  522  KKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  358
            K+E V  I+D RL+TVP  EAMH+F++++LC++E +VERP MREV+QML+E P+Q
Sbjct  909  KREQVTHIVDPRLTTVPEDEAMHLFFISMLCIQENSVERPTMREVIQMLSEFPRQ  963



>ref|XP_010912647.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Elaeis guineensis]
Length=992

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 34/65 (52%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
            K  V KI+DSRLSTVPI+E MH+F++ +LC+ E ++ERP MREVVQML+E P      + 
Sbjct  906  KNNVAKIVDSRLSTVPINEVMHVFFITMLCIHENSIERPTMREVVQMLSEFPHHASEDQS  965

Query  339  EGTTA  325
              ++A
Sbjct  966  PSSSA  970



>gb|KJB32855.1| hypothetical protein B456_005G265400 [Gossypium raimondii]
Length=992

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/57 (58%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -1

Query  522  KKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPP  352
            +K  V  I+D RL+TVP  EAMH+ ++A+LCV+E ++ERP MREVVQML+E P+Q P
Sbjct  910  RKAEVTSIVDPRLTTVPKDEAMHLLFIAMLCVQENSIERPTMREVVQMLSEFPRQSP  966



>gb|EEC67924.1| hypothetical protein OsI_35629 [Oryza sativa Indica Group]
Length=1035

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 39/80 (49%), Positives = 55/80 (69%), Gaps = 4/80 (5%)
 Frame = -1

Query  525   GKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPK----Q  358
             G++E V +I+D R+STVP+ E  H+F+V++LCV+E +VERP MREVVQML+E P+    Q
Sbjct  945   GRRESVHRIVDRRISTVPMDEVAHIFFVSMLCVQENSVERPTMREVVQMLSEFPRHGSDQ  1004

Query  357   PPGTKPEGTTACESSALEPP  298
             P  +     T  ESS  + P
Sbjct  1005  PSPSSSAPETGEESSPEKEP  1024



>ref|XP_004985112.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2-like [Setaria italica]
Length=998

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 47/98 (48%), Positives = 60/98 (61%), Gaps = 5/98 (5%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGT--  346
            KEGV+KI D RLSTVP++E  H+FYVA+LCV EQ+VERP MREVVQ+L ++P     +  
Sbjct  904  KEGVMKIADPRLSTVPLYELTHVFYVAMLCVAEQSVERPTMREVVQILADMPGSTSTSID  963

Query  345  KPEGTTACESSALEPPPSTGTSDDAKDqqqppPDLLSI  232
             P      E ++ E PP      +      P  DLLSI
Sbjct  964  APLVIEPKEDASSEKPPR---QQEGPHDSPPQQDLLSI  998



>ref|XP_010520784.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 isoform X2 [Tarenaya hassleriana]
Length=958

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 42/90 (47%), Positives = 55/90 (61%), Gaps = 18/90 (20%)
 Frame = -1

Query  522  KKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTK  343
            +KE V+ ++D RLS VP  EA H+ +VA+LCVEE +VERP MREVVQML E P      +
Sbjct  874  RKEEVMLVVDHRLSNVPRQEAAHLLFVAMLCVEENSVERPSMREVVQMLLEFP------R  927

Query  342  PEGTTACESSALEPPPST-----GTSDDAK  268
            PE       +   PPP+      G ++DAK
Sbjct  928  PE-------TPFSPPPAVHSPCKGVTNDAK  950



>gb|EMT21762.1| Receptor protein kinase CLAVATA1 [Aegilops tauschii]
Length=313

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = -1

Query  525  GKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  358
            G++E V K++D RLSTVP+ E  H+F+V++LCV+E +VERP MREVVQML+E P+ 
Sbjct  230  GRRESVPKVVDRRLSTVPMDEVSHLFFVSMLCVQENSVERPTMREVVQMLSEFPRH  285



>emb|CDO97616.1| unnamed protein product [Coffea canephora]
Length=1001

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 38/66 (58%), Positives = 50/66 (76%), Gaps = 1/66 (2%)
 Frame = -1

Query  522  KKEGVVKILDSRLST-VPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGT  346
            ++E V  I+D RLST VP  EAMH+F++A+LCV+E +VERP MREVVQML+E P+Q   T
Sbjct  907  RREEVDGIVDPRLSTAVPKDEAMHLFFIAMLCVQENSVERPTMREVVQMLSEFPRQFSST  966

Query  345  KPEGTT  328
             P+  T
Sbjct  967  PPDYRT  972



>emb|CDY54567.1| BnaA08g30460D [Brassica napus]
Length=844

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 36/55 (65%), Positives = 47/55 (85%), Gaps = 1/55 (2%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQP  355
            K+GVVKI+D RLS VP+ EAM +F+VA+LCV+E +VERP MREVVQM+++  KQP
Sbjct  788  KQGVVKIIDQRLSNVPLGEAMELFFVAMLCVQEHSVERPTMREVVQMISQ-AKQP  841



>ref|XP_011022287.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Populus euphratica]
Length=988

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 38/55 (69%), Positives = 46/55 (84%), Gaps = 1/55 (2%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQP  355
            KEGVVKILD RL  +P+ EAM +F+VA+LCV+EQ+VERP MREVVQML +  KQP
Sbjct  929  KEGVVKILDQRLIDIPLIEAMQVFFVAMLCVQEQSVERPTMREVVQMLAQ-AKQP  982



>ref|XP_009108464.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Brassica rapa]
Length=995

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 36/55 (65%), Positives = 47/55 (85%), Gaps = 1/55 (2%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQP  355
            K+GVVKI+D RLS VP+ EAM +F+VA+LCV+E +VERP MREVVQM+++  KQP
Sbjct  939  KQGVVKIIDQRLSNVPLGEAMELFFVAMLCVQEHSVERPTMREVVQMISQ-AKQP  992



>ref|XP_010520783.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 isoform X1 [Tarenaya hassleriana]
Length=994

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 42/90 (47%), Positives = 55/90 (61%), Gaps = 18/90 (20%)
 Frame = -1

Query  522  KKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTK  343
            +KE V+ ++D RLS VP  EA H+ +VA+LCVEE +VERP MREVVQML E P      +
Sbjct  910  RKEEVMLVVDHRLSNVPRQEAAHLLFVAMLCVEENSVERPSMREVVQMLLEFP------R  963

Query  342  PEGTTACESSALEPPPST-----GTSDDAK  268
            PE       +   PPP+      G ++DAK
Sbjct  964  PE-------TPFSPPPAVHSPCKGVTNDAK  986



>emb|CAN71863.1| hypothetical protein VITISV_023530 [Vitis vinifera]
Length=954

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 34/64 (53%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
            KE V+ I+D RL+T+P +EA H+F++ALLC+EE +VERP MREVVQML+E  +  P  K 
Sbjct  888  KENVIXIVDPRLATIPRNEATHLFFIALLCIEENSVERPTMREVVQMLSESHRNSPDNKT  947

Query  339  EGTT  328
              ++
Sbjct  948  SSSS  951



>ref|XP_006468612.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3-like isoform X1 [Citrus sinensis]
Length=987

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 38/58 (66%), Positives = 44/58 (76%), Gaps = 2/58 (3%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGT  346
            KEGVVKILD RLS  P+ EAM +F+VA+LCV+E  VERP MREVVQML +   Q P T
Sbjct  928  KEGVVKILDQRLSNTPLSEAMQVFFVAMLCVQEHGVERPTMREVVQMLAQ--AQKPNT  983



>ref|NP_001145765.1| uncharacterized protein LOC100279272 [Zea mays]
 gb|ACL52548.1| unknown [Zea mays]
Length=771

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 36/52 (69%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELP  364
            KEGV+KI D RLSTVP++E  H+FYVA+LCV EQ+VERP MREVVQ+L ++P
Sbjct  674  KEGVMKIADPRLSTVPLYELTHVFYVAMLCVAEQSVERPTMREVVQILADMP  725



>tpg|DAA44225.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=1002

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 36/52 (69%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELP  364
            KEGV+KI D RLSTVP++E  H+FYVA+LCV EQ+VERP MREVVQ+L ++P
Sbjct  905  KEGVMKIADPRLSTVPLYELTHVFYVAMLCVAEQSVERPTMREVVQILADMP  956



>gb|KCW62729.1| hypothetical protein EUGRSUZ_G00319 [Eucalyptus grandis]
Length=958

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 32/57 (56%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -1

Query  522  KKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPP  352
            ++E   +++D RLS VP  EA H+F+VA+LCV+E + ERP MREVVQML+E P+ PP
Sbjct  878  RREEATRVVDPRLSLVPKDEATHVFFVAMLCVQENSTERPTMREVVQMLSEFPRHPP  934



>ref|XP_010065309.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Eucalyptus grandis]
Length=990

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 32/57 (56%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -1

Query  522  KKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPP  352
            ++E   +++D RLS VP  EA H+F+VA+LCV+E + ERP MREVVQML+E P+ PP
Sbjct  910  RREEATRVVDPRLSLVPKDEATHVFFVAMLCVQENSTERPTMREVVQMLSEFPRHPP  966



>ref|XP_002869943.1| hypothetical protein ARALYDRAFT_492844 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46202.1| hypothetical protein ARALYDRAFT_492844 [Arabidopsis lyrata subsp. 
lyrata]
Length=992

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 34/55 (62%), Positives = 47/55 (85%), Gaps = 1/55 (2%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQP  355
            ++GVVKI+D RLS +P+ EAM +F+VA+LCV+E +VERP MREVVQM+++  KQP
Sbjct  936  RQGVVKIIDQRLSNIPLEEAMELFFVAMLCVQEHSVERPTMREVVQMISQ-AKQP  989



>ref|XP_011004294.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 isoform X1 [Populus euphratica]
Length=988

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 38/55 (69%), Positives = 46/55 (84%), Gaps = 1/55 (2%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQP  355
            KEGVVKILD  L+ +P+ EAM +F+VA+LCV+EQ+VERP MREVVQML E  KQP
Sbjct  929  KEGVVKILDQGLTDIPLIEAMQVFFVAMLCVQEQSVERPTMREVVQMLAE-AKQP  982



>ref|XP_008799579.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Phoenix dactylifera]
Length=984

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 39/57 (68%), Positives = 45/57 (79%), Gaps = 1/57 (2%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPG  349
            KEGVVKILD RL   P+ EAM +F+V +LCV+EQ+VERP MREVVQML E  KQP G
Sbjct  925  KEGVVKILDPRLINFPLEEAMQVFFVGMLCVQEQSVERPTMREVVQML-EQTKQPFG  980



>ref|XP_010930574.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Elaeis guineensis]
Length=994

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 34/51 (67%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTEL  367
            ++ V  I+DSRLSTVPI+E MH+F+VA+LCV+E +VERP MREVVQML+E 
Sbjct  907  RDNVATIIDSRLSTVPINEVMHVFFVAMLCVQENSVERPTMREVVQMLSEF  957



>ref|XP_002297907.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE82712.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=988

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 38/55 (69%), Positives = 46/55 (84%), Gaps = 1/55 (2%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQP  355
            KEGVVKILD  L+ +P+ EAM +F+VA+LCV+EQ+VERP MREVVQML E  KQP
Sbjct  929  KEGVVKILDQGLTDIPLIEAMQVFFVAMLCVQEQSVERPTMREVVQMLAE-AKQP  982



>emb|CDX93999.1| BnaC07g36330D [Brassica napus]
Length=844

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 35/55 (64%), Positives = 47/55 (85%), Gaps = 1/55 (2%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQP  355
            ++GVVKI+D RLS VP+ EAM +F+VA+LCV+E +VERP MREVVQM+++  KQP
Sbjct  788  RQGVVKIIDQRLSNVPLGEAMELFFVAMLCVQEHSVERPTMREVVQMISQ-AKQP  841



>emb|CDX98665.1| BnaA03g44500D [Brassica napus]
Length=844

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 35/55 (64%), Positives = 47/55 (85%), Gaps = 1/55 (2%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQP  355
            ++GVVKI+D RLS VP+ EAM +F+VA+LCV+E +VERP MREVVQM+++  KQP
Sbjct  788  RQGVVKIIDQRLSNVPLGEAMELFFVAMLCVQEHSVERPTMREVVQMISQ-AKQP  841



>gb|KHG14208.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Gossypium arboreum]
Length=992

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 32/53 (60%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -1

Query  510  VVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPP  352
            V  I+D RL+TVP  EAMH+ ++A+LCV+E ++ERP MREVVQML+E P+Q P
Sbjct  914  VTNIVDPRLTTVPKDEAMHLLFIAMLCVQENSIERPTMREVVQMLSEFPRQSP  966



>ref|XP_009137141.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Brassica rapa]
Length=967

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 35/55 (64%), Positives = 47/55 (85%), Gaps = 1/55 (2%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQP  355
            ++GVVKI+D RLS VP+ EAM +F+VA+LCV+E +VERP MREVVQM+++  KQP
Sbjct  911  RQGVVKIIDQRLSNVPLGEAMELFFVAMLCVQEHSVERPTMREVVQMISQ-AKQP  964



>dbj|BAJ90459.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ98621.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1024

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 33/56 (59%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = -1

Query  525  GKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  358
            G++E V K++D RLSTVP+ E  H+F+V++LCV+E +VERP MREVVQML+E P+ 
Sbjct  936  GRRESVPKVVDRRLSTVPMDEVSHLFFVSMLCVQENSVERPTMREVVQMLSEFPRH  991



>ref|XP_006413888.1| hypothetical protein EUTSA_v10024310mg [Eutrema salsugineum]
 gb|ESQ55341.1| hypothetical protein EUTSA_v10024310mg [Eutrema salsugineum]
Length=996

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 35/55 (64%), Positives = 47/55 (85%), Gaps = 1/55 (2%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQP  355
            ++GVVKI+D RLS VP+ EAM +F+VA+LCV+E +VERP MREVVQM+++  KQP
Sbjct  940  RQGVVKIIDQRLSNVPLGEAMELFFVAMLCVQEHSVERPTMREVVQMISQ-AKQP  993



>ref|XP_010439602.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Camelina sativa]
Length=997

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 35/55 (64%), Positives = 47/55 (85%), Gaps = 1/55 (2%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQP  355
            ++GVVKI+D RLS VP+ EAM +F+VA+LCV+E +VERP MREVVQM+++  KQP
Sbjct  941  RQGVVKIIDQRLSNVPLGEAMELFFVAMLCVQEHSVERPTMREVVQMISQ-AKQP  994



>ref|XP_010449207.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Camelina sativa]
Length=998

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 35/55 (64%), Positives = 47/55 (85%), Gaps = 1/55 (2%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQP  355
            ++GVVKI+D RLS VP+ EAM +F+VA+LCV+E +VERP MREVVQM+++  KQP
Sbjct  942  RQGVVKIIDQRLSNVPLGEAMELFFVAMLCVQEHSVERPTMREVVQMISQ-AKQP  995



>ref|XP_010243895.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 isoform X1 [Nelumbo nucifera]
 ref|XP_010243896.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 isoform X2 [Nelumbo nucifera]
 ref|XP_010243898.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 isoform X3 [Nelumbo nucifera]
Length=991

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 33/52 (63%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -1

Query  522  KKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTEL  367
            +KE V++I+D RL+ VPI EAMH+F++A+LCV+E +VERP MREVVQML+E 
Sbjct  905  RKEEVIRIIDPRLTGVPIDEAMHVFFIAMLCVQENSVERPTMREVVQMLSEF  956



>ref|XP_009355307.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Pyrus x bretschneideri]
Length=999

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 34/58 (59%), Positives = 46/58 (79%), Gaps = 1/58 (2%)
 Frame = -1

Query  522  KKEGVVKILDSRLS-TVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPP  352
            +KE V  I+D RL+ +VP  EAMHMF++A+LC++E +VERP MREVVQML+E P+  P
Sbjct  909  RKEDVANIVDHRLTISVPKDEAMHMFFIAMLCIQENSVERPTMREVVQMLSEFPRHTP  966



>emb|CDY31445.1| BnaC03g63790D [Brassica napus]
Length=844

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 35/55 (64%), Positives = 47/55 (85%), Gaps = 1/55 (2%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQP  355
            K+GVVKI+D RLS VP+ EAM +F++A+LCV+E +VERP MREVVQM+++  KQP
Sbjct  788  KQGVVKIIDQRLSNVPLGEAMELFFLAMLCVQEHSVERPTMREVVQMISQ-AKQP  841



>ref|XP_009401113.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=987

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 38/84 (45%), Positives = 51/84 (61%), Gaps = 13/84 (15%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
            ++    I+D RLSTVP+ E MH+F+VA+LCV+E +VERP MREVVQML+E P   P    
Sbjct  904  RDNAAAIVDPRLSTVPVDELMHVFFVAMLCVQENSVERPTMREVVQMLSEFPHHVPEN--  961

Query  339  EGTTACESSALEPPPSTGTSDDAK  268
                       + P S+ T+ D K
Sbjct  962  -----------QSPSSSSTARDKK  974



>ref|XP_003576141.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Brachypodium distachyon]
Length=1043

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 33/56 (59%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = -1

Query  525   GKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  358
             G++EGV K++D RLSTV + E  H+F+V++LCV+E +VERP MREVVQML+E P+ 
Sbjct  955   GRREGVPKVVDRRLSTVAMDEVAHLFFVSMLCVQENSVERPTMREVVQMLSEFPRH  1010



>gb|KDO77158.1| hypothetical protein CISIN_1g012213mg [Citrus sinensis]
Length=468

 Score = 79.3 bits (194),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 44/58 (76%), Gaps = 2/58 (3%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGT  346
            KEGVVKILD RLS  P+ EAM +F+VA+LCV+E  VERP MREVVQML +   Q P T
Sbjct  409  KEGVVKILDQRLSNTPLSEAMQVFFVAMLCVQEHGVERPTMREVVQMLAQ--AQKPNT  464



>ref|XP_009133589.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Brassica rapa]
Length=966

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 35/55 (64%), Positives = 47/55 (85%), Gaps = 1/55 (2%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQP  355
            ++GVVKI+D RLS VP+ EAM +F+VA+LCV+E +VERP MREVVQM+++  KQP
Sbjct  910  RQGVVKIVDQRLSNVPLGEAMELFFVAMLCVQEHSVERPTMREVVQMISQ-AKQP  963



>ref|XP_006283067.1| hypothetical protein CARUB_v10004060mg [Capsella rubella]
 gb|EOA15965.1| hypothetical protein CARUB_v10004060mg [Capsella rubella]
Length=996

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 35/55 (64%), Positives = 47/55 (85%), Gaps = 1/55 (2%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQP  355
            ++GVVKI+D RLS VP+ EAM +F+VA+LCV+E +VERP MREVVQM+++  KQP
Sbjct  940  RQGVVKIIDQRLSNVPLGEAMELFFVAMLCVQEHSVERPTMREVVQMVSQ-AKQP  993



>gb|ACN59341.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
Length=963

 Score = 80.1 bits (196),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 34/55 (62%), Positives = 47/55 (85%), Gaps = 1/55 (2%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQP  355
            ++GVVKI+D RLS +P+ EAM +F+VA+LCV+E +VERP MREVVQM+++  KQP
Sbjct  907  RQGVVKIIDQRLSNIPLAEAMELFFVAMLCVQEHSVERPTMREVVQMISQ-AKQP  960



>gb|EEE51888.1| hypothetical protein OsJ_33462 [Oryza sativa Japonica Group]
Length=881

 Score = 80.1 bits (196),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 39/80 (49%), Positives = 55/80 (69%), Gaps = 4/80 (5%)
 Frame = -1

Query  525  GKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPK----Q  358
            G++E V +I+D R+STVP+ E  H+F+V++LCV+E +VERP MREVVQML+E P+    Q
Sbjct  791  GRRESVHRIIDRRISTVPMDEVAHIFFVSMLCVQENSVERPTMREVVQMLSEFPRHGSDQ  850

Query  357  PPGTKPEGTTACESSALEPP  298
            P  +     T  ESS  + P
Sbjct  851  PSPSSSAPETGEESSPEKEP  870



>ref|NP_193760.1| leucine-rich receptor-like protein kinase BAM3 [Arabidopsis thaliana]
 sp|O65440.3|BAME3_ARATH RecName: Full=Leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3; AltName: Full=Protein BARELY ANY MERISTEM 
3; Flags: Precursor [Arabidopsis thaliana]
 emb|CAA18252.1| CLV1 receptor kinase like protein [Arabidopsis thaliana]
 emb|CAB79027.1| CLV1 receptor kinase like protein [Arabidopsis thaliana]
 gb|AEE84297.1| leucine-rich receptor-like protein kinase BAM3 [Arabidopsis thaliana]
Length=992

 Score = 80.1 bits (196),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 34/55 (62%), Positives = 47/55 (85%), Gaps = 1/55 (2%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQP  355
            ++GVVKI+D RLS +P+ EAM +F+VA+LCV+E +VERP MREVVQM+++  KQP
Sbjct  936  RQGVVKIIDQRLSNIPLAEAMELFFVAMLCVQEHSVERPTMREVVQMISQ-AKQP  989



>ref|XP_008225951.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Prunus mume]
Length=986

 Score = 80.1 bits (196),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 34/50 (68%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTE  370
            KEGV+KILD RL +VP+ EAM +F+VA+LC +EQ+VERP MREVVQML +
Sbjct  927  KEGVIKILDKRLDSVPLDEAMQVFFVAVLCAQEQSVERPTMREVVQMLAQ  976



>gb|KDP42443.1| hypothetical protein JCGZ_00240 [Jatropha curcas]
Length=995

 Score = 80.1 bits (196),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 30/57 (53%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -1

Query  522  KKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPP  352
            ++E V++++D RL+ VP  EAMH+F++A+LC +E ++ERP MREVVQML+E P+  P
Sbjct  907  RREDVMQVVDRRLTMVPKDEAMHLFFIAMLCSQENSIERPTMREVVQMLSEFPRHSP  963



>ref|XP_006448558.1| hypothetical protein CICLE_v10014145mg [Citrus clementina]
 gb|ESR61798.1| hypothetical protein CICLE_v10014145mg [Citrus clementina]
Length=987

 Score = 80.1 bits (196),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 38/58 (66%), Positives = 43/58 (74%), Gaps = 2/58 (3%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGT  346
            KEGVVKILD RLS  P+ EAM +F+VA LCV+E  VERP MREVVQML +   Q P T
Sbjct  928  KEGVVKILDQRLSNTPLSEAMQVFFVATLCVQEHGVERPTMREVVQMLAQ--AQKPNT  983



>ref|XP_004229499.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Solanum lycopersicum]
Length=960

 Score = 80.1 bits (196),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 38/55 (69%), Positives = 45/55 (82%), Gaps = 1/55 (2%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQP  355
            KEGVVKILD RL  V I EAM +F+VA+LCVEE ++ERP MREVVQML++  KQP
Sbjct  901  KEGVVKILDERLKNVAIVEAMQVFFVAMLCVEEYSIERPTMREVVQMLSQ-AKQP  954



>ref|XP_010260843.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Nelumbo nucifera]
 ref|XP_010260847.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Nelumbo nucifera]
Length=1006

 Score = 79.7 bits (195),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 36/55 (65%), Positives = 45/55 (82%), Gaps = 1/55 (2%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQP  355
            KEGV+KILD RL+ VP+ EAM +F+V +LCV+E +VERP MREVVQML +  KQP
Sbjct  947  KEGVMKILDERLTNVPLDEAMQVFFVGMLCVQEHSVERPTMREVVQMLVQ-AKQP  1000



>ref|XP_007224667.1| hypothetical protein PRUPE_ppa026134mg [Prunus persica]
 gb|EMJ25866.1| hypothetical protein PRUPE_ppa026134mg [Prunus persica]
Length=998

 Score = 79.3 bits (194),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 33/58 (57%), Positives = 46/58 (79%), Gaps = 1/58 (2%)
 Frame = -1

Query  522  KKEGVVKILDSRLS-TVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPP  352
            +KE V  I+D RL+ +VP  EAMH+F++A+LC++E +VERP MREVVQML+E P+  P
Sbjct  908  RKEDVTSIVDPRLAISVPKDEAMHLFFIAMLCIQEHSVERPTMREVVQMLSEFPRHSP  965



>gb|KHG23359.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM3 [Gossypium arboreum]
Length=995

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 39/57 (68%), Positives = 46/57 (81%), Gaps = 2/57 (4%)
 Frame = -1

Query  522  KKEGVVKILDSRLS-TVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQP  355
            KKEGVVKILD R+S T+P  E M +F+VA+LCVEE +VERP MREVVQML +  KQP
Sbjct  934  KKEGVVKILDHRVSNTIPKEEVMQVFFVAMLCVEEHSVERPTMREVVQMLAQ-AKQP  989



>ref|XP_010687839.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Beta vulgaris subsp. vulgaris]
Length=1010

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 35/58 (60%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = -1

Query  522  KKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPG  349
            +KE V  ILDSRL+ VP  EAMH+F+VA+LC +E ++ERP MREVVQML+E P    G
Sbjct  921  RKETVPIILDSRLTAVPQDEAMHLFFVAMLCTQENSIERPTMREVVQMLSEYPYHAMG  978



>ref|XP_004491265.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3-like [Cicer arietinum]
Length=976

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 36/55 (65%), Positives = 45/55 (82%), Gaps = 1/55 (2%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQP  355
            KE VVKILD RL  +P+ EAM +F+VA+LCV+EQ+VERP MREVV+ML +  KQP
Sbjct  918  KEKVVKILDGRLHHIPLDEAMQLFFVAMLCVQEQSVERPTMREVVEMLAQ-AKQP  971



>ref|XP_009763204.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Nicotiana sylvestris]
Length=958

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 38/55 (69%), Positives = 44/55 (80%), Gaps = 1/55 (2%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQP  355
            KEGVVKILD RL  V   EAM +F+VA+LCVEE +VERP MREVVQML++  KQP
Sbjct  899  KEGVVKILDERLKNVATAEAMQVFFVAMLCVEEYSVERPTMREVVQMLSQ-AKQP  952



>ref|XP_009600411.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Nicotiana tomentosiformis]
Length=964

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 38/55 (69%), Positives = 44/55 (80%), Gaps = 1/55 (2%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQP  355
            KEGVVKILD RL  V   EAM +F+VA+LCVEE +VERP MREVVQML++  KQP
Sbjct  905  KEGVVKILDERLKNVATAEAMQVFFVAMLCVEEYSVERPTMREVVQMLSQ-AKQP  958



>gb|EYU26470.1| hypothetical protein MIMGU_mgv1a019834mg [Erythranthe guttata]
Length=1001

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 31/54 (57%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -1

Query  522  KKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPK  361
            ++E V +I+D R++  P  EAMH+F+VA+LCV+E +VERP MREVVQML+E P+
Sbjct  911  RREDVTRIIDPRITVAPKDEAMHLFFVAMLCVQENSVERPTMREVVQMLSEFPR  964



>ref|XP_010918071.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Elaeis guineensis]
Length=984

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 34/50 (68%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTE  370
            KEGVVKILD RL  VP+ EAM +F+V +LC++EQ+VERP MREVVQML +
Sbjct  925  KEGVVKILDPRLINVPLEEAMQVFFVGMLCIQEQSVERPTMREVVQMLEQ  974



>gb|KFK28659.1| hypothetical protein AALP_AA7G028700 [Arabis alpina]
Length=965

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 34/55 (62%), Positives = 46/55 (84%), Gaps = 1/55 (2%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQP  355
            ++GVVKI+D RLS VP+ E M +F+VA+LCV+E +VERP MREVVQM+++  KQP
Sbjct  909  RQGVVKIIDQRLSNVPLGEVMELFFVAMLCVQEHSVERPTMREVVQMISQ-AKQP  962



>gb|KJB32927.1| hypothetical protein B456_005G268400 [Gossypium raimondii]
Length=995

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 39/57 (68%), Positives = 46/57 (81%), Gaps = 2/57 (4%)
 Frame = -1

Query  522  KKEGVVKILDSRLS-TVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQP  355
            KKEGVVKILD R+S T+P  E M +F+VA+LCVEE +VERP MREVVQML +  KQP
Sbjct  934  KKEGVVKILDHRVSNTIPEEEVMQVFFVAMLCVEEHSVERPTMREVVQMLAQ-AKQP  989



>ref|XP_006859064.1| hypothetical protein AMTR_s00068p00198250 [Amborella trichopoda]
 gb|ERN20531.1| hypothetical protein AMTR_s00068p00198250 [Amborella trichopoda]
Length=737

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 34/50 (68%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTE  370
            KEGV +ILDSRL  +PI EA H+F+VA+LCV+EQ+VERP MREVV ML +
Sbjct  669  KEGVFEILDSRLKDIPIEEAKHVFFVAMLCVQEQSVERPTMREVVHMLQQ  718



>ref|XP_010529317.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Tarenaya hassleriana]
Length=999

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 35/55 (64%), Positives = 46/55 (84%), Gaps = 1/55 (2%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQP  355
            K+GVVKILD RLS  P+ EA  +F+VA+LCV+EQ+VERP MREVVQM+++  +QP
Sbjct  940  KQGVVKILDQRLSNPPLEEATQVFFVAMLCVQEQSVERPTMREVVQMISQ-ARQP  993



>ref|XP_008793129.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 isoform X1 [Phoenix dactylifera]
Length=988

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 35/50 (70%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTE  370
            KEGVVKILD RL  VP+ EAM +F+V +LCV+EQ+VERP MREVVQML +
Sbjct  929  KEGVVKILDPRLINVPLEEAMQVFFVGMLCVQEQSVERPTMREVVQMLEQ  978



>ref|XP_008218726.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Prunus mume]
Length=982

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 33/58 (57%), Positives = 45/58 (78%), Gaps = 1/58 (2%)
 Frame = -1

Query  522  KKEGVVKILDSRLS-TVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPP  352
            +KE V  I+D RL+ +VP  EAMH+F++A LC++E +VERP MREVVQML+E P+  P
Sbjct  892  RKEDVTSIVDPRLAISVPKDEAMHLFFIATLCIQEHSVERPTMREVVQMLSEFPRHSP  949



>ref|XP_008793131.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 isoform X2 [Phoenix dactylifera]
Length=813

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 35/50 (70%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTE  370
            KEGVVKILD RL  VP+ EAM +F+V +LCV+EQ+VERP MREVVQML +
Sbjct  754  KEGVVKILDPRLINVPLEEAMQVFFVGMLCVQEQSVERPTMREVVQMLEQ  803



>ref|XP_002264952.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Vitis vinifera]
Length=988

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 36/55 (65%), Positives = 43/55 (78%), Gaps = 1/55 (2%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQP  355
            KEGVVKILD RL  VP  EA+  F+VA+LCV+E +VERP MREV+QML +  KQP
Sbjct  929  KEGVVKILDERLRNVPEDEAIQTFFVAMLCVQEHSVERPTMREVIQMLAQ-AKQP  982



>ref|XP_009415746.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Musa acuminata subsp. malaccensis]
Length=978

 Score = 77.0 bits (188),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 34/50 (68%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTE  370
            KEGVV I+D RL  VP+ EAM +F+VA+LCV+E +VERPKMREVVQML +
Sbjct  919  KEGVVNIMDRRLIDVPMEEAMQVFFVAMLCVQEHSVERPKMREVVQMLEQ  968



>ref|XP_008786484.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat receptor-like 
serine/threonine-protein kinase BAM1 [Phoenix dactylifera]
Length=995

 Score = 77.0 bits (188),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 31/52 (60%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELP  364
            ++ V  I+DSRLST+PI+E MH+F++A+LC+ E +VERP MREVV ML+E P
Sbjct  907  RDNVATIVDSRLSTMPINEVMHVFFIAMLCIXENSVERPTMREVVLMLSEFP  958



>ref|XP_008347921.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Malus domestica]
Length=999

 Score = 76.6 bits (187),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 33/54 (61%), Positives = 44/54 (81%), Gaps = 1/54 (2%)
 Frame = -1

Query  522  KKEGVVKILDSRLS-TVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELP  364
            +KE V  I+D RL+ +VP  EAMHMF++A+LC++E +VERP MREVVQML+E P
Sbjct  909  RKEXVANIVDHRLTISVPKDEAMHMFFIAMLCIQENSVERPTMREVVQMLSEFP  962



>ref|XP_008339390.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Malus domestica]
Length=999

 Score = 76.6 bits (187),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 32/56 (57%), Positives = 45/56 (80%), Gaps = 1/56 (2%)
 Frame = -1

Query  522  KKEGVVKILDSRLS-TVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  358
            +KE V  I+D RL+ ++P  EAMHMF++A+LC++E +VERP MREVVQML+E P+ 
Sbjct  909  RKEDVTNIVDHRLTVSLPKDEAMHMFFIAMLCIQENSVERPTMREVVQMLSEFPRH  964



>ref|XP_006356981.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3-like [Solanum tuberosum]
Length=960

 Score = 76.6 bits (187),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 37/55 (67%), Positives = 44/55 (80%), Gaps = 1/55 (2%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQP  355
            KE VVKILD RL  V I EAM +F+VA+LCVEE ++ERP MREVVQML++  KQP
Sbjct  901  KEEVVKILDERLKNVAIVEAMQVFFVAMLCVEEYSIERPTMREVVQMLSQ-AKQP  954



>ref|XP_009411355.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1009

 Score = 76.6 bits (187),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 42/84 (50%), Positives = 53/84 (63%), Gaps = 15/84 (18%)
 Frame = -1

Query  513   GVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKPEG  334
             GV +I+D RL TVP+ EA+H+F+VA+LCVEEQ+VERP MREVVQ+L + PK      PE 
Sbjct  925   GVPQIVDPRLPTVPMDEAVHVFHVAMLCVEEQSVERPTMREVVQILMDAPK----AAPEQ  980

Query  333   TTACESSALE-----------PPP  295
                CE+   E           PPP
Sbjct  981   GDDCEAPTKEAKEHQQPAQTSPPP  1004



>ref|XP_006385034.1| hypothetical protein POPTR_0004s23260g [Populus trichocarpa]
 gb|ERP62831.1| hypothetical protein POPTR_0004s23260g [Populus trichocarpa]
Length=1001

 Score = 76.6 bits (187),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 32/62 (52%), Positives = 46/62 (74%), Gaps = 3/62 (5%)
 Frame = -1

Query  522  KKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTK  343
            +KE  + I+D RL+ VP  EAMH+F++A+LC +E ++ERP MREVVQML+E P+    T 
Sbjct  907  RKEDAMHIVDPRLTMVPKDEAMHLFFIAMLCSQENSIERPTMREVVQMLSEFPRH---TS  963

Query  342  PE  337
            P+
Sbjct  964  PD  965



>ref|XP_008781646.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g34110 [Phoenix dactylifera]
Length=215

 Score = 73.2 bits (178),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 43/57 (75%), Gaps = 1/57 (2%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPG  349
            KEGV KILD R   VP+ EAM +F+  +LCV+EQ+VERP MREVVQML +  KQP G
Sbjct  156  KEGVAKILDPRQINVPLEEAMQVFFGGMLCVQEQSVERPTMREVVQMLKQ-TKQPSG  211



>ref|XP_010924539.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Elaeis guineensis]
Length=986

 Score = 76.6 bits (187),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 34/50 (68%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTE  370
            KEGVVKILD RL  VP+ EAM +F+V +LCV+E +VERP MREVVQML +
Sbjct  927  KEGVVKILDPRLIDVPLEEAMQVFFVGMLCVQEHSVERPTMREVVQMLEQ  976



>ref|XP_011028346.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Populus euphratica]
Length=1001

 Score = 76.6 bits (187),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 32/62 (52%), Positives = 46/62 (74%), Gaps = 3/62 (5%)
 Frame = -1

Query  522  KKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTK  343
            +KE  + I+D RL+ VP  EAMH+F++A+LC +E ++ERP MREVVQML+E P+    T 
Sbjct  907  RKEDAMHIVDPRLTMVPKAEAMHLFFIAMLCSQENSIERPTMREVVQMLSEFPRH---TS  963

Query  342  PE  337
            P+
Sbjct  964  PD  965



>emb|CDY62258.1| BnaCnng39750D [Brassica napus]
Length=871

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 33/55 (60%), Positives = 45/55 (82%), Gaps = 1/55 (2%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQP  355
            ++GVVKI+D RLS VP+ EAM +F+VA+ CV+E +VERP MREVVQM+++  K P
Sbjct  815  RQGVVKIIDQRLSNVPLGEAMELFFVAMSCVQEHSVERPTMREVVQMISQ-AKHP  868



>ref|XP_008795253.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Phoenix dactylifera]
Length=992

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 31/65 (48%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = -1

Query  519  KEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPPGTKP  340
            K    +I+DSRL  VPI+E MH+F++A+LC  E ++ERP MREVVQML+E P      + 
Sbjct  906  KNNASRIVDSRLGAVPINEVMHIFFIAMLCTHENSIERPTMREVVQMLSEFPHHASEDQS  965

Query  339  EGTTA  325
              ++A
Sbjct  966  PSSSA  970



>ref|XP_002526451.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
 gb|EEF35946.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
Length=996

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 31/55 (56%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = -1

Query  522  KKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  358
            +KE V+ I+DSRL+ VP  E MH+F++ALLC +E ++ERP MREVVQML+E  + 
Sbjct  908  RKEDVLNIIDSRLTMVPKDEVMHLFFIALLCSQENSIERPTMREVVQMLSEFHRH  962



>ref|XP_010030176.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Eucalyptus grandis]
Length=994

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 31/57 (54%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = -1

Query  522  KKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQPP  352
            +KE V  I+D +L  VP  EA H+F++A+LCV++ +VERP MREVVQML+E P+  P
Sbjct  905  RKEEVTCIVDPKLKAVPKDEATHLFFIAMLCVQDNSVERPTMREVVQMLSEYPRHSP  961



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 561572122600