BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF001C11

Length=552
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009791268.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    290   5e-92   Nicotiana sylvestris
ref|XP_009598884.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    290   9e-92   Nicotiana tomentosiformis
ref|XP_010277273.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    285   5e-90   Nelumbo nucifera [Indian lotus]
ref|XP_011075752.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     285   7e-90   Sesamum indicum [beniseed]
emb|CDP04847.1|  unnamed protein product                                280   1e-89   Coffea canephora [robusta coffee]
gb|EYU29160.1|  hypothetical protein MIMGU_mgv1a004174mg                283   2e-89   Erythranthe guttata [common monkey flower]
ref|XP_004239653.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     283   2e-89   Solanum lycopersicum
ref|XP_006345989.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    283   3e-89   Solanum tuberosum [potatoes]
ref|XP_008466345.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     283   3e-89   Cucumis melo [Oriental melon]
ref|XP_004136326.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    283   4e-89   Cucumis sativus [cucumbers]
ref|XP_009377365.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    281   1e-88   Pyrus x bretschneideri [bai li]
ref|XP_006422161.1|  hypothetical protein CICLE_v10004669mg             281   1e-88   Citrus clementina [clementine]
ref|XP_006290941.1|  hypothetical protein CARUB_v10017054mg             280   2e-88   Capsella rubella
ref|XP_006412618.1|  hypothetical protein EUTSA_v100249451mg            271   2e-88   
ref|XP_008219827.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     280   3e-88   Prunus mume [ume]
ref|XP_007222302.1|  hypothetical protein PRUPE_ppa003911mg             280   3e-88   Prunus persica
ref|XP_008809075.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    280   3e-88   
ref|XP_010431338.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    278   5e-88   Camelina sativa [gold-of-pleasure]
gb|KFK29697.1|  hypothetical protein AALP_AA7G167100                    280   6e-88   Arabis alpina [alpine rockcress]
gb|EPS57914.1|  hypothetical protein M569_16902                         279   6e-88   Genlisea aurea
ref|XP_002523450.1|  aspartyl-tRNA synthetase, putative                 280   6e-88   Ricinus communis
ref|XP_004162485.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    279   8e-88   
ref|XP_010095486.1|  Aspartate--tRNA ligase                             279   1e-87   Morus notabilis
gb|KJB06559.1|  hypothetical protein B456_001G001300                    277   1e-87   Gossypium raimondii
ref|XP_007011472.1|  Class II aminoacyl-tRNA and biotin synthetas...    277   2e-87   
ref|XP_008347712.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    278   2e-87   
emb|CBI20816.3|  unnamed protein product                                274   2e-87   Vitis vinifera
gb|KDP45573.1|  hypothetical protein JCGZ_17180                         266   2e-87   Jatropha curcas
ref|XP_007011470.1|  Class II aminoacyl-tRNA and biotin synthetas...    277   4e-87   
gb|KHN37081.1|  Aspartate--tRNA ligase, cytoplasmic                     273   8e-87   Glycine soja [wild soybean]
gb|KJB06558.1|  hypothetical protein B456_001G001300                    276   8e-87   Gossypium raimondii
ref|XP_008378275.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    276   1e-86   
ref|XP_004512467.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    276   1e-86   Cicer arietinum [garbanzo]
gb|KHN15295.1|  Aspartate--tRNA ligase, cytoplasmic                     273   1e-86   Glycine soja [wild soybean]
ref|XP_010927161.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    276   2e-86   Elaeis guineensis
gb|KHG15734.1|  Aspartate--tRNA ligase, cytoplasmic                     276   2e-86   Gossypium arboreum [tree cotton]
ref|XP_011019869.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     276   2e-86   Populus euphratica
ref|XP_008352039.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    276   2e-86   
ref|XP_002308157.2|  aspartyl-tRNA synthetase family protein            276   2e-86   Populus trichocarpa [western balsam poplar]
gb|AAL61938.1|  aspartate--tRNA ligase - like protein                   271   2e-86   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010526284.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     276   3e-86   Tarenaya hassleriana [spider flower]
ref|XP_006283471.1|  hypothetical protein CARUB_v10004519mg             275   3e-86   Capsella rubella
ref|XP_002283440.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     275   4e-86   Vitis vinifera
ref|XP_006381194.1|  hypothetical protein POPTR_0006s08550g             275   7e-86   
ref|XP_010447608.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    274   9e-86   Camelina sativa [gold-of-pleasure]
ref|XP_003544559.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    274   9e-86   Glycine max [soybeans]
ref|XP_003550250.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    274   1e-85   Glycine max [soybeans]
ref|NP_849558.1|  Asx tRNA synthetase (AspRS/AsnRS) class II core...    274   1e-85   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010036668.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    273   2e-85   Eucalyptus grandis [rose gum]
ref|XP_010438070.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    273   3e-85   Camelina sativa [gold-of-pleasure]
ref|XP_007160941.1|  hypothetical protein PHAVU_001G030000g             273   3e-85   Phaseolus vulgaris [French bean]
ref|XP_009390472.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    273   3e-85   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010929419.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     273   3e-85   Elaeis guineensis
ref|XP_002869341.1|  hypothetical protein ARALYDRAFT_491623             273   4e-85   Arabidopsis lyrata subsp. lyrata
ref|XP_008801441.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    272   4e-85   Phoenix dactylifera
gb|EEC73805.1|  hypothetical protein OsI_08509                          272   5e-85   Oryza sativa Indica Group [Indian rice]
ref|XP_010432896.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    272   6e-85   Camelina sativa [gold-of-pleasure]
ref|NP_001047770.1|  Os02g0686400                                       272   6e-85   
ref|XP_004498802.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    271   1e-84   Cicer arietinum [garbanzo]
ref|XP_004303438.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     271   1e-84   Fragaria vesca subsp. vesca
ref|XP_006660416.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    270   2e-84   Oryza brachyantha
ref|XP_003588866.1|  Aspartyl-tRNA synthetase                           270   2e-84   Medicago truncatula
ref|XP_009129024.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     270   2e-84   Brassica rapa
ref|XP_002876233.1|  predicted protein                                  270   2e-84   
emb|CDY14727.1|  BnaC05g19840D                                          270   3e-84   Brassica napus [oilseed rape]
gb|KFK40259.1|  hypothetical protein AALP_AA3G351000                    269   7e-84   Arabis alpina [alpine rockcress]
ref|XP_006657639.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    269   8e-84   Oryza brachyantha
emb|CDY35247.1|  BnaA01g07840D                                          268   1e-83   Brassica napus [oilseed rape]
gb|KDP45577.1|  hypothetical protein JCGZ_17184                         270   2e-83   Jatropha curcas
ref|XP_004967463.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    268   2e-83   Setaria italica
ref|XP_006838453.1|  hypothetical protein AMTR_s00002p00135270          263   3e-83   
ref|XP_003578963.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    268   4e-83   Brachypodium distachyon [annual false brome]
ref|XP_010049784.1|  PREDICTED: LOW QUALITY PROTEIN: aspartate--t...    267   5e-83   
dbj|BAJ99106.1|  predicted protein                                      267   5e-83   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001145746.1|  hypothetical protein                               266   8e-83   Zea mays [maize]
emb|CAB36533.1|  putative aspartate-tRNA ligase                         263   5e-82   Arabidopsis thaliana [mouse-ear cress]
gb|ACN28001.1|  unknown                                                 264   7e-82   Zea mays [maize]
ref|NP_001149817.1|  LOC100283444                                       264   7e-82   
ref|NP_194417.2|  Asx tRNA synthetase (AspRS/AsnRS) class II core...    263   8e-82   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006850989.1|  hypothetical protein AMTR_s00025p00212870          264   1e-81   Amborella trichopoda
ref|XP_002868911.1|  hypothetical protein ARALYDRAFT_490730             262   1e-81   
ref|XP_006401257.1|  hypothetical protein EUTSA_v10015942mg             264   5e-81   Eutrema salsugineum [saltwater cress]
ref|XP_001778245.1|  predicted protein                                  261   7e-81   
gb|ABK25168.1|  unknown                                                 262   8e-81   Picea sitchensis
gb|EYU28247.1|  hypothetical protein MIMGU_mgv1a004064mg                259   5e-80   Erythranthe guttata [common monkey flower]
ref|XP_009137996.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    259   6e-80   Brassica rapa
emb|CDX68726.1|  BnaC01g07270D                                          258   1e-79   
emb|CDY28248.1|  BnaA01g06010D                                          258   1e-79   Brassica napus [oilseed rape]
ref|XP_009127185.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     258   1e-79   Brassica rapa
ref|XP_010672510.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    256   6e-79   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007041300.1|  Class II aminoacyl-tRNA and biotin synthetas...    254   6e-79   
gb|EMT03438.1|  Aspartyl-tRNA synthetase, cytoplasmic                   256   2e-78   
ref|XP_006283432.1|  hypothetical protein CARUB_v10004480mg             255   2e-78   
emb|CDX72297.1|  BnaC07g43190D                                          254   5e-78   
ref|XP_010436322.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    256   7e-78   Camelina sativa [gold-of-pleasure]
ref|XP_010238758.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    254   1e-77   Brachypodium distachyon [annual false brome]
gb|EMT21796.1|  Aspartyl-tRNA synthetase, cytoplasmic                   245   2e-76   
ref|XP_006409074.1|  hypothetical protein EUTSA_v10023162mg             240   1e-75   
ref|NP_001172794.1|  Os02g0139600                                       235   2e-75   
ref|XP_004951929.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    246   2e-75   Setaria italica
ref|XP_003575513.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    244   3e-74   
ref|XP_002451520.1|  hypothetical protein SORBIDRAFT_04g003180          234   4e-73   
gb|EEC72451.1|  hypothetical protein OsI_05793                          238   2e-72   Oryza sativa Indica Group [Indian rice]
dbj|BAD10253.1|  putative Aspartyl-tRNA synthetase                      238   2e-72   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001695300.1|  aspartyl-tRNA synthetase                           239   4e-72   Chlamydomonas reinhardtii
dbj|BAJ97188.1|  predicted protein                                      238   4e-72   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007011471.1|  Class II aminoacyl-tRNA and biotin synthetas...    237   9e-72   
ref|XP_003612738.1|  Aspartyl-tRNA synthetase                           238   2e-71   
ref|XP_005851895.1|  hypothetical protein CHLNCDRAFT_33640              229   4e-70   Chlorella variabilis
ref|XP_002945972.1|  hypothetical protein VOLCADRAFT_72624              232   2e-69   Volvox carteri f. nagariensis
gb|KDD76372.1|  class II (D, K and N) tRNA synthetase                   222   3e-69   Helicosporidium sp. ATCC 50920
ref|XP_011401383.1|  Aspartate-tRNA ligase, cytoplasmic                 226   4e-68   Auxenochlorella protothecoides
ref|XP_002983062.1|  hypothetical protein SELMODRAFT_117697             226   9e-68   
ref|XP_002965575.1|  hypothetical protein SELMODRAFT_84215              226   1e-67   
ref|XP_006409458.1|  hypothetical protein EUTSA_v10023019mg             225   4e-67   
ref|XP_003082076.1|  OJ1717_A09.34 gene product (ISS)                   223   2e-66   Ostreococcus tauri
ref|XP_002509202.1|  predicted protein                                  219   4e-66   Micromonas commoda
ref|XP_003061556.1|  predicted protein                                  220   7e-66   Micromonas pusilla CCMP1545
ref|XP_001420524.1|  predicted protein                                  219   4e-65   Ostreococcus lucimarinus CCE9901
gb|EYU29913.1|  hypothetical protein MIMGU_mgv1a018492mg                217   1e-64   Erythranthe guttata [common monkey flower]
ref|XP_005648554.1|  aspartyl-tRNA synthetase                           218   1e-64   Coccomyxa subellipsoidea C-169
ref|XP_006848204.1|  hypothetical protein AMTR_s00029p00241780          220   3e-64   
gb|EYU31296.1|  hypothetical protein MIMGU_mgv1a019826mg                215   2e-62   Erythranthe guttata [common monkey flower]
ref|XP_007213075.1|  hypothetical protein PRUPE_ppa021187mg             207   7e-62   
emb|CDS30263.1|  aspartyl tRNA synthetase, cytoplasmic                  208   1e-60   Hymenolepis microstoma
emb|CBJ31343.1|  Aspartyl-tRNA Synthetase                               209   2e-60   Ectocarpus siliculosus
gb|EJK74501.1|  hypothetical protein THAOC_03817                        209   3e-60   Thalassiosira oceanica
gb|EUB65062.1|  Aspartyl-tRNA synthetase, cytoplasmic                   206   3e-60   Echinococcus granulosus
ref|XP_003384922.2|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    206   6e-60   Amphimedon queenslandica
emb|CDJ02923.1|  aspartyl tRNA synthetase, cytoplasmic                  206   8e-60   
ref|XP_003740658.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    205   2e-59   Galendromus occidentalis
ref|XP_006727730.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    200   3e-59   Leptonychotes weddellii
ref|XP_008141705.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    200   9e-59   
ref|XP_007509366.1|  aspartyl-tRNA synthetase                           203   1e-58   Bathycoccus prasinos
ref|XP_007570419.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     202   1e-58   Poecilia formosa
ref|XP_008401396.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     202   1e-58   Poecilia reticulata
ref|XP_006773157.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     202   2e-58   Myotis davidii
ref|XP_006100496.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     202   2e-58   Myotis lucifugus
ref|XP_008141704.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    202   2e-58   Eptesicus fuscus
ref|XP_005862923.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     201   2e-58   Myotis brandtii
gb|AAY15029.1|  unknown                                                 196   2e-58   Homo sapiens [man]
ref|XP_004616570.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    199   3e-58   Sorex araneus [Eurasian shrew]
ref|XP_005095117.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    202   3e-58   Aplysia californica
ref|NP_001080336.1|  aspartyl-tRNA synthetase                           202   3e-58   Xenopus laevis [clawed frog]
ref|NP_001085490.1|  aspartyl-tRNA synthetase                           202   3e-58   Xenopus laevis [clawed frog]
ref|NP_001279392.1|  aspartyl-tRNA synthetase                           201   3e-58   Callorhinchus milii [Australian ghost shark]
gb|EPQ05648.1|  Aspartyl-tRNA synthetase, cytoplasmic                   201   3e-58   Myotis brandtii
ref|XP_009945209.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     200   4e-58   Leptosomus discolor
ref|XP_003962102.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    201   4e-58   Takifugu rubripes [tiger puffer]
gb|KFV00090.1|  Aspartate--tRNA ligase, cytoplasmic                     200   4e-58   Pterocles gutturalis
ref|XP_010078250.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     200   4e-58   Pterocles gutturalis
ref|XP_009565947.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     200   4e-58   Cuculus canorus
gb|KFQ06975.1|  Aspartate--tRNA ligase, cytoplasmic                     200   4e-58   Leptosomus discolor
gb|KFO81148.1|  Aspartate--tRNA ligase, cytoplasmic                     200   4e-58   Cuculus canorus
dbj|BAE88209.1|  unnamed protein product                                194   4e-58   Macaca fascicularis [crab eating macaque]
ref|XP_006249746.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    200   4e-58   Rattus norvegicus [brown rat]
ref|XP_009874320.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     196   4e-58   Apaloderma vittatum
gb|KFP79070.1|  Aspartate--tRNA ligase, cytoplasmic                     196   5e-58   Apaloderma vittatum
gb|ELK04585.1|  Aspartyl-tRNA synthetase, cytoplasmic                   200   5e-58   Pteropus alecto
gb|KFO22727.1|  Aspartyl-tRNA synthetase, cytoplasmic                   199   5e-58   Fukomys damarensis [Damara mole rat]
emb|CDQ57315.1|  unnamed protein product                                195   6e-58   Oncorhynchus mykiss
ref|XP_010604451.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     200   6e-58   Fukomys damarensis [Damara mole rat]
ref|XP_009970796.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     195   6e-58   Tyto alba [Schleiereule]
gb|AAH08638.1|  Aspartyl-tRNA synthetase                                200   6e-58   Mus musculus [mouse]
ref|NP_446251.1|  aspartate--tRNA ligase, cytoplasmic                   200   7e-58   Rattus norvegicus [brown rat]
dbj|BAC36851.1|  unnamed protein product                                200   7e-58   Mus musculus [mouse]
ref|NP_803228.2|  aspartate--tRNA ligase, cytoplasmic isoform 1         200   7e-58   Mus musculus [mouse]
dbj|BAE41011.1|  unnamed protein product                                200   7e-58   Mus musculus [mouse]
dbj|BAE27102.1|  unnamed protein product                                200   7e-58   Mus musculus [mouse]
dbj|BAE38517.1|  unnamed protein product                                200   7e-58   Mus musculus [mouse]
ref|XP_004616569.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    200   8e-58   Sorex araneus [Eurasian shrew]
ref|XP_006921100.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    200   8e-58   Pteropus alecto
ref|XP_006618426.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    197   8e-58   Apis dorsata [rock honeybee]
gb|ELK23193.1|  Aspartyl-tRNA synthetase, cytoplasmic                   201   9e-58   Myotis davidii
gb|EWM24309.1|  aspartyl-trna synthetase                                202   9e-58   Nannochloropsis gaditana
emb|CDH50826.1|  aspartyl-trna synthetase                               201   9e-58   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_006894506.1|  PREDICTED: LOW QUALITY PROTEIN: aspartate--t...    200   9e-58   Elephantulus edwardii [Cape long-eared elephant shrew]
emb|CDS12969.1|  hypothetical protein LRAMOSA05153                      201   1e-57   Lichtheimia ramosa
ref|XP_008582944.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    197   1e-57   Galeopterus variegatus [Malayan flying lemur]
ref|NP_001280241.1|  aspartate--tRNA ligase, cytoplasmic isoform 2      197   1e-57   Homo sapiens [man]
ref|XP_005977057.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    197   1e-57   Pantholops hodgsonii [Tibetan antelope]
ref|XP_006196190.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    197   1e-57   
ref|XP_005899557.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    197   1e-57   Bos mutus
ref|XP_005807733.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    200   1e-57   Xiphophorus maculatus
ref|XP_004375153.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    197   1e-57   
ref|XP_003922054.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    197   1e-57   Saimiri boliviensis boliviensis
ref|XP_006748245.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    197   1e-57   Leptonychotes weddellii
ref|XP_008058975.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    199   1e-57   Carlito syrichta
ref|XP_007525079.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    198   1e-57   Erinaceus europaeus [common hedgehog]
gb|EMP34755.1|  Aspartyl-tRNA synthetase, cytoplasmic                   198   1e-57   Chelonia mydas [green seaturtle]
ref|XP_006834638.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    197   1e-57   Chrysochloris asiatica
ref|XP_004423920.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    197   1e-57   
ref|XP_003267656.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    197   1e-57   Nomascus leucogenys [White-cheeked Gibbon]
ref|XP_007452083.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    197   1e-57   Lipotes vexillifer [baiji]
ref|XP_002607648.1|  hypothetical protein BRAFLDRAFT_123951             198   1e-57   Branchiostoma floridae
ref|XP_004589424.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    197   1e-57   Ochotona princeps [southern American pika]
ref|XP_010304864.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     194   1e-57   Balearica regulorum gibbericeps
ref|XP_011352781.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     199   2e-57   Pteropus vampyrus
ref|XP_010208384.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     194   2e-57   Colius striatus
ref|XP_004086973.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     200   2e-57   Oryzias latipes [Japanese rice fish]
ref|XP_002286873.1|  aspartate-trna ligase                              198   2e-57   Thalassiosira pseudonana CCMP1335
ref|XP_968957.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic        200   2e-57   Tribolium castaneum [rust-red flour beetle]
ref|XP_006275951.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     199   2e-57   Alligator mississippiensis
ref|XP_007525078.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    199   2e-57   Erinaceus europaeus [common hedgehog]
ref|XP_003794431.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    197   2e-57   
ref|XP_005315894.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     199   2e-57   Ictidomys tridecemlineatus
ref|XP_004674747.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    196   2e-57   
ref|XP_009937033.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     198   2e-57   Opisthocomus hoazin [hoatzin]
ref|XP_006992782.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     198   2e-57   
gb|EHJ74756.1|  aspartyl-tRNA synthetase                                194   2e-57   
ref|XP_007060951.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     199   2e-57   
gb|EAX11618.1|  aspartyl-tRNA synthetase, isoform CRA_b                 198   2e-57   Homo sapiens [man]
gb|KFR14034.1|  Aspartate--tRNA ligase, cytoplasmic                     198   2e-57   Opisthocomus hoazin [hoatzin]
ref|XP_002737659.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    199   2e-57   Saccoglossus kowalevskii
ref|XP_006636375.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    199   3e-57   
ref|XP_010851973.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     198   3e-57   Bison bison bison
ref|XP_008058974.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    199   3e-57   Carlito syrichta
ref|XP_006018449.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     199   3e-57   Alligator sinensis
ref|XP_003405905.1|  PREDICTED: LOW QUALITY PROTEIN: aspartate--t...    199   3e-57   
ref|XP_010125958.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     196   3e-57   Chlamydotis macqueenii
ref|XP_011494872.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     199   3e-57   Ceratosolen solmsi marchali
ref|XP_008582943.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    199   3e-57   Galeopterus variegatus [Malayan flying lemur]
ref|XP_005573101.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    198   3e-57   Macaca fascicularis [crab eating macaque]
ref|XP_011283514.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    198   3e-57   
ref|XP_004403601.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    196   3e-57   Odobenus rosmarus divergens
ref|XP_005899556.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    198   3e-57   Bos mutus
ref|XP_008515152.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     198   3e-57   Equus przewalskii [Przewalski horse]
ref|XP_005676244.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     198   3e-57   
gb|EFX84904.1|  hypothetical protein DAPPUDRAFT_99304                   197   3e-57   Daphnia pulex
ref|XP_004774308.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     198   3e-57   Mustela putorius furo [black ferret]
ref|XP_001490073.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    198   3e-57   Equus caballus [domestic horse]
ref|XP_004668210.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    196   3e-57   Jaculus jaculus
ref|XP_005977056.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    198   3e-57   Pantholops hodgsonii [Tibetan antelope]
ref|XP_315584.3|  AGAP005576-PA                                         199   3e-57   Anopheles gambiae str. PEST
gb|AAP36306.1|  Homo sapiens aspartyl-tRNA synthetase                   198   3e-57   synthetic construct
tpg|DAA32651.1|  TPA: aspartyl-tRNA synthetase, cytoplasmic             198   3e-57   Bos taurus [bovine]
ref|XP_003497764.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    198   3e-57   Cricetulus griseus [Chinese hamsters]
gb|AAI07750.1|  Aspartyl-tRNA synthetase                                198   3e-57   Homo sapiens [man]
ref|XP_006049208.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    198   3e-57   Bubalus bubalis [domestic water buffalo]
ref|NP_001340.2|  aspartate--tRNA ligase, cytoplasmic isoform 1         198   3e-57   Homo sapiens [man]
gb|KFV43662.1|  Aspartate--tRNA ligase, cytoplasmic                     197   3e-57   Gavia stellata
ref|XP_009812359.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     197   3e-57   Gavia stellata
ref|XP_004375152.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    198   3e-57   Trichechus manatus latirostris
ref|XP_848666.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic ...    198   3e-57   Canis lupus familiaris [dogs]
gb|AAX07827.1|  cell proliferation-inducing protein 40                  198   3e-57   Homo sapiens [man]
ref|XP_006196189.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    198   3e-57   Vicugna pacos
dbj|BAD96196.1|  aspartyl-tRNA synthetase variant                       198   3e-57   Homo sapiens [man]
ref|XP_003215139.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     198   4e-57   Anolis carolinensis [Carolina anole]
ref|XP_010739294.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     199   4e-57   
ref|XP_004563182.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    199   4e-57   
ref|XP_007098910.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     198   4e-57   Panthera tigris altaica
ref|XP_006799171.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    199   4e-57   Neolamprologus brichardi [lyretail cichlid]
ref|XP_005745749.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    199   4e-57   Pundamilia nyererei
ref|XP_010190646.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     196   4e-57   Mesitornis unicolor
ref|XP_002749521.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     198   4e-57   Callithrix jacchus [common marmoset]
ref|XP_003922053.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    198   4e-57   Saimiri boliviensis boliviensis
ref|XP_003133314.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    198   4e-57   Sus scrofa [pigs]
ref|XP_006748244.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    198   4e-57   Leptonychotes weddellii
ref|XP_003445448.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    199   4e-57   Oreochromis niloticus
ref|XP_007950689.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     198   4e-57   Orycteropus afer afer
ref|NP_001155359.1|  aspartyl-tRNA synthetase, cytoplasmic              198   4e-57   Ovis aries [domestic sheep]
gb|KFZ65811.1|  Aspartate--tRNA ligase, cytoplasmic                     196   4e-57   Podiceps cristatus
ref|XP_004423919.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    198   4e-57   Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_001155169.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     198   4e-57   Pan troglodytes
ref|XP_011283512.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    198   4e-57   Felis catus [cat]
ref|XP_003267655.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    198   4e-57   Nomascus leucogenys [White-cheeked Gibbon]
ref|XP_004589423.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    198   4e-57   Ochotona princeps [southern American pika]
gb|KFO62612.1|  Aspartate--tRNA ligase, cytoplasmic                     197   4e-57   Corvus brachyrhynchos
ref|XP_003909218.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    198   4e-57   Papio anubis [baboon]
ref|XP_010982259.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     198   4e-57   Camelus dromedarius [camel]
ref|XP_006834637.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    198   4e-57   Chrysochloris asiatica
gb|KFP45448.1|  Aspartate--tRNA ligase, cytoplasmic                     196   4e-57   Chlamydotis macqueenii
gb|KFP19056.1|  Aspartate--tRNA ligase, cytoplasmic                     197   4e-57   Egretta garzetta
ref|XP_004265496.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     198   4e-57   Orcinus orca [Orca]
ref|XP_008694082.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     198   4e-57   Ursus maritimus [white bear]
ref|XP_007452082.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    198   4e-57   Lipotes vexillifer [baiji]
ref|XP_009086036.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     197   4e-57   
ref|XP_005020359.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     197   4e-57   
ref|XP_010971513.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     198   5e-57   Camelus bactrianus [camel]
ref|XP_006175778.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     198   5e-57   
gb|KGL86649.1|  Aspartate--tRNA ligase, cytoplasmic                     197   5e-57   
ref|XP_009884978.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     197   5e-57   
ref|XP_007192114.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     198   5e-57   
ref|XP_007894403.1|  PREDICTED: LOW QUALITY PROTEIN: aspartate--t...    199   5e-57   
ref|XP_008636434.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     197   5e-57   
ref|XP_011215338.1|  PREDICTED: LOW QUALITY PROTEIN: aspartate--t...    197   5e-57   
ref|XP_009640780.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     197   5e-57   
ref|XP_010014135.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     197   5e-57   
gb|KFQ50746.1|  Aspartate--tRNA ligase, cytoplasmic                     197   5e-57   
ref|XP_005390823.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     198   5e-57   
ref|XP_003478767.2|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    197   5e-57   
ref|XP_010405462.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     197   5e-57   
ref|XP_009705402.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     197   5e-57   
ref|XP_009487670.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     197   5e-57   
ref|XP_008935669.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     197   5e-57   
ref|XP_009575956.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     197   5e-57   
pdb|4J15|A  Chain A, Crystal Structure Of Human Cytosolic Asparty...    198   5e-57   
ref|XP_004674746.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    198   5e-57   
ref|XP_002194194.2|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     197   5e-57   
ref|XP_011283513.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    197   5e-57   
ref|XP_009910301.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     197   5e-57   
ref|XP_002712168.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     198   6e-57   
ref|XP_003794430.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    197   6e-57   
ref|XP_004885153.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     197   6e-57   
ref|XP_009183258.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    196   6e-57   
gb|KFQ17990.1|  Aspartate--tRNA ligase, cytoplasmic                     197   6e-57   
ref|XP_005007764.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    197   6e-57   
gb|KFQ54646.1|  Aspartate--tRNA ligase, cytoplasmic                     197   6e-57   
ref|XP_010290541.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     197   6e-57   
ref|XP_009460053.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     197   6e-57   
ref|XP_002125902.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     198   6e-57   
ref|XP_004403600.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    197   6e-57   
ref|NP_001125925.1|  aspartate--tRNA ligase, cytoplasmic                197   6e-57   
gb|KFZ46086.1|  Aspartate--tRNA ligase, cytoplasmic                     197   6e-57   
gb|KFQ94447.1|  Aspartate--tRNA ligase, cytoplasmic                     197   6e-57   
ref|XP_008492572.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     197   6e-57   
ref|XP_005519661.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     197   7e-57   
ref|XP_001095858.1|  PREDICTED: aspartyl-tRNA synthetase, cytopla...    197   7e-57   
ref|XP_010157948.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     197   7e-57   
ref|XP_009317210.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     197   7e-57   
gb|EDL39749.1|  aspartyl-tRNA synthetase                                199   7e-57   
gb|KFW63602.1|  Aspartate--tRNA ligase, cytoplasmic                     197   7e-57   
gb|KFQ88629.1|  Aspartate--tRNA ligase, cytoplasmic                     197   7e-57   
gb|KFV92225.1|  Aspartate--tRNA ligase, cytoplasmic                     197   7e-57   
gb|KFP98763.1|  Aspartate--tRNA ligase, cytoplasmic                     197   7e-57   
gb|KFP68443.1|  Aspartate--tRNA ligase, cytoplasmic                     197   7e-57   
ref|XP_009278011.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     197   7e-57   
ref|NP_989306.1|  aspartate--tRNA ligase, cytoplasmic                   198   7e-57   
gb|KFV96538.1|  Aspartate--tRNA ligase, cytoplasmic                     196   7e-57   
gb|KFM01083.1|  Aspartate--tRNA ligase, cytoplasmic                     196   7e-57   
ref|XP_003767085.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    195   7e-57   
ref|XP_007129547.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     197   7e-57   
ref|XP_009979954.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     197   7e-57   
ref|NP_001134011.1|  Aspartyl-tRNA synthetase, cytoplasmic              198   7e-57   
ref|XP_005153817.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    197   7e-57   
ref|XP_003702833.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    198   7e-57   
gb|KFQ68263.1|  Aspartate--tRNA ligase, cytoplasmic                     196   7e-57   
gb|AAH75373.1|  aspartyl-tRNA synthetase                                198   7e-57   
ref|XP_005049720.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     197   7e-57   
ref|XP_010160988.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     197   7e-57   
gb|KFV00637.1|  Aspartate--tRNA ligase, cytoplasmic                     196   8e-57   
ref|XP_005153816.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    197   8e-57   
ref|XP_009895089.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     197   8e-57   
ref|XP_005416057.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     197   8e-57   
ref|XP_007667671.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     194   8e-57   
ref|XP_010712327.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     196   8e-57   
ref|XP_006006252.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     198   8e-57   
gb|EFN75459.1|  Aspartyl-tRNA synthetase, cytoplasmic                   198   9e-57   
ref|XP_011152966.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     198   9e-57   
gb|KFQ25741.1|  Aspartate--tRNA ligase, cytoplasmic                     196   9e-57   
gb|KFV64522.1|  Aspartate--tRNA ligase, cytoplasmic                     196   9e-57   
gb|KFP01245.1|  Aspartate--tRNA ligase, cytoplasmic                     197   9e-57   
gb|ACI33786.1|  Aspartyl-tRNA synthetase, cytoplasmic                   198   9e-57   
ref|XP_005242442.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     197   9e-57   
ref|XP_009508359.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     196   9e-57   
ref|XP_006682759.1|  hypothetical protein BATDEDRAFT_14798              198   9e-57   
ref|NP_001006528.1|  aspartyl-tRNA synthetase, cytoplasmic              197   1e-56   
emb|CAG32037.1|  hypothetical protein RCJMB04_16g4                      197   1e-56   
ref|XP_005286826.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    197   1e-56   
emb|CAG01849.1|  unnamed protein product                                197   1e-56   
ref|XP_007636149.1|  PREDICTED: LOW QUALITY PROTEIN: aspartate--t...    198   1e-56   
emb|CDQ57836.1|  unnamed protein product                                197   1e-56   
gb|KFW93918.1|  Aspartate--tRNA ligase, cytoplasmic                     196   1e-56   
gb|KFU91688.1|  Aspartate--tRNA ligase, cytoplasmic                     196   1e-56   
emb|CEJ04778.1|  Putative Aspartyl-tRNA synthetase                      198   1e-56   
ref|XP_009998676.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    196   1e-56   
ref|XP_008831879.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     197   1e-56   
ref|XP_008920246.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     196   1e-56   
ref|NP_001030257.1|  aspartate--tRNA ligase, cytoplasmic                197   1e-56   
ref|XP_006169785.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    197   1e-56   
ref|XP_001606085.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     197   1e-56   
ref|XP_004668209.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    197   1e-56   
emb|CEI91695.1|  Putative Aspartyl-tRNA synthetase                      197   1e-56   
gb|KFW79362.1|  Aspartate--tRNA ligase, cytoplasmic                     196   1e-56   
emb|CEG68415.1|  Putative Aspartyl-tRNA synthetase                      197   2e-56   
gb|ERE73730.1|  aspartyl-tRNA synthetase, cytoplasmic                   198   2e-56   
ref|XP_008327117.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     197   2e-56   
gb|ETE73729.1|  Aspartyl-tRNA synthetase, cytoplasmic                   197   2e-56   
gb|KIO33847.1|  hypothetical protein M407DRAFT_240953                   197   2e-56   
ref|XP_007494170.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     196   2e-56   
ref|XP_009675663.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    194   2e-56   
ref|XP_002185644.1|  predicted protein                                  197   2e-56   
ref|XP_005488013.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     197   2e-56   
ref|XP_008275411.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     197   2e-56   
ref|XP_001361642.1|  GA17710                                            197   2e-56   
ref|XP_011263373.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     196   2e-56   
ref|XP_393437.2|  PREDICTED: aspartate--tRNA ligase, cytoplasmic        197   2e-56   
ref|XP_011174729.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    196   3e-56   
ref|XP_011301459.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     197   3e-56   
gb|KFB50781.1|  AGAP005576-PA-like protein                              197   3e-56   
ref|XP_002006462.1|  GI18555                                            196   3e-56   
ref|XP_011174735.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    196   4e-56   
gb|KFV82611.1|  Aspartate--tRNA ligase, cytoplasmic                     194   4e-56   
ref|XP_005509007.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     195   4e-56   
gb|KDR12536.1|  Aspartyl-tRNA synthetase, cytoplasmic                   196   4e-56   
ref|XP_009675662.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    194   4e-56   
gb|EMC84113.1|  Aspartyl-tRNA synthetase, cytoplasmic                   194   5e-56   
ref|XP_002404413.1|  aspartyl-tRNA synthetase, putative                 195   5e-56   
ref|XP_001655895.1|  AAEL002748-PA                                      196   5e-56   
ref|XP_010142010.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     190   5e-56   
ref|XP_011068846.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    196   6e-56   
ref|XP_011068862.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    196   6e-56   
ref|XP_001661717.1|  AAEL011518-PA                                      196   6e-56   
gb|EGI70962.1|  Aspartyl-tRNA synthetase, cytoplasmic                   196   6e-56   
ref|NP_001071079.1|  aspartate--tRNA ligase, cytoplasmic                196   7e-56   
ref|XP_005187396.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     196   8e-56   
ref|XP_002033628.1|  GM21429                                            195   8e-56   
emb|CEF64568.1|  Aspartyl-tRNA synthetase                               195   8e-56   
ref|NP_476609.1|  Aspartyl-tRNA synthetase, isoform A                   195   9e-56   
ref|XP_002090983.1|  Aats-asp                                           195   9e-56   
ref|XP_010889072.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     195   9e-56   
ref|XP_002081265.1|  GD10925                                            195   9e-56   
gb|ERL92973.1|  hypothetical protein D910_10276                         195   1e-55   
ref|XP_001959541.1|  GF12925                                            195   1e-55   
ref|XP_009492590.1|  aspartyl-tRNA synthetase                           194   1e-55   
gb|KJE94927.1|  aspartyl-tRNA synthetase, variant 1                     194   1e-55   
ref|XP_004346141.2|  aspartyl-tRNA synthetase                           195   1e-55   
ref|XP_011413947.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    194   1e-55   
ref|XP_002900771.1|  aspartyl-tRNA synthetase, putative                 194   1e-55   
ref|XP_001865617.1|  aspartyl-tRNA synthetase                           194   1e-55   
ref|XP_008557938.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     194   1e-55   
ref|XP_003694862.1|  PREDICTED: LOW QUALITY PROTEIN: aspartate--t...    194   1e-55   
ref|XP_004537437.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    195   2e-55   
ref|XP_001869733.1|  aspartyl-tRNA synthetase                           194   2e-55   
ref|XP_006117110.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     194   2e-55   
gb|KJE94928.1|  aspartyl-tRNA synthetase, variant 2                     194   2e-55   
emb|CBK21654.2|  unnamed protein product                                197   2e-55   
gb|EPZ32107.1|  Aminoacyl-tRNA synthetase, class II (D/K/N)-like ...    194   2e-55   
gb|ETN59224.1|  aspartyl-tRNA synthetase                                194   2e-55   
ref|XP_011413945.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    194   2e-55   
ref|XP_003493969.1|  PREDICTED: aspartyl-tRNA synthetase, cytopla...    194   2e-55   
ref|XP_011413946.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    194   2e-55   
ref|XP_003400609.1|  PREDICTED: aspartyl-tRNA synthetase, cytopla...    194   2e-55   
ref|XP_003400610.1|  PREDICTED: aspartyl-tRNA synthetase, cytopla...    194   2e-55   
gb|AAA35567.1|  aspartyl-tRNA synthetase                                193   3e-55   
gb|AAI52078.1|  Zgc:154056 protein                                      184   3e-55   
ref|XP_002546002.1|  aspartyl-tRNA synthetase                           194   3e-55   
gb|EFO17462.2|  aspartyl-tRNA synthetase                                193   4e-55   
gb|ETL83259.1|  aspartate-tRNA(Asn) ligase                              193   4e-55   
gb|AAD21582.1|  aspartyl tRNA synthetase                                193   4e-55   
gb|ETK76592.1|  aspartate-tRNA(Asn) ligase                              193   4e-55   
ref|XP_002050154.1|  GJ20350                                            193   5e-55   
gb|ETO65082.1|  aspartate-tRNA(Asn) ligase                              193   5e-55   
ref|XP_008895961.1|  aspartate-tRNA(Asn) ligase                         193   5e-55   
gb|ETI36380.1|  aspartate-tRNA(Asn) ligase                              193   5e-55   
gb|EAS04430.2|  aspartyl-tRNA synthetase protein                        194   5e-55   
ref|XP_001024675.1|  aspartyl-tRNA synthetase family protein            194   6e-55   
ref|XP_008865791.1|  aspartate-tRNA(Asn) ligase                         194   6e-55   
gb|ELT90819.1|  hypothetical protein CAPTEDRAFT_148058                  193   6e-55   
gb|EPY26141.1|  aspartyl-tRNA synthetase                                188   9e-55   
ref|XP_003146606.1|  aspartyl-tRNA synthetase                           193   9e-55   
emb|CDW55668.1|  asparaginyl tRNA synthetase, cytoplasmic               192   1e-54   
gb|EIE80753.1|  hypothetical protein RO3G_05458                         192   1e-54   
ref|XP_001634294.1|  predicted protein                                  192   1e-54   
ref|XP_001975841.1|  GG20342                                            192   1e-54   
ref|XP_002421880.1|  aspartyl-tRNA synthetase, cytoplasmic, putative    193   1e-54   
ref|XP_010795271.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     187   1e-54   
ref|XP_009055134.1|  hypothetical protein LOTGIDRAFT_118845             191   2e-54   
gb|EPB81701.1|  aspartyl-tRNA synthetase                                192   2e-54   
ref|XP_010365553.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    187   2e-54   
dbj|GAN06365.1|  aspartyl-tRNA synthetase                               190   2e-54   
gb|KDN49617.1|  aspartyl-tRNA synthetase                                192   3e-54   
ref|XP_002061362.1|  GK20765                                            191   3e-54   
emb|CDX73541.1|  BnaC08g24620D                                          182   3e-54   
ref|XP_001986463.1|  GH21379                                            191   4e-54   
gb|ESL10311.1|  hypothetical protein TRSC58_01959                       186   4e-54   
gb|KFM63678.1|  Aspartate--tRNA ligase, cytoplasmic                     191   5e-54   
ref|XP_004032648.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     188   5e-54   
emb|CEP11967.1|  hypothetical protein                                   191   6e-54   
ref|XP_011208424.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     190   7e-54   
ref|XP_011182222.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     190   7e-54   
ref|XP_845309.1|  aspartyl-tRNA synthetase                              191   8e-54   
gb|ERG82190.1|  aspartate--trna cytoplasmic                             190   8e-54   
ref|XP_009072672.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     189   9e-54   
gb|EPY34111.1|  aspartyl-tRNA synthetase                                190   9e-54   
gb|KFD53173.1|  hypothetical protein M513_05883                         190   1e-53   
gb|KHJ48459.1|  aspartate--tRNA ligase                                  190   1e-53   
gb|KFP80008.1|  Aspartate--tRNA ligase, cytoplasmic                     189   1e-53   
dbj|BAH72272.1|  ACYPI007430                                            183   1e-53   
gb|EIE79914.1|  hypothetical protein RO3G_04619                         189   1e-53   
emb|CCD79412.1|  putative aspartyl-tRNA synthetase                      189   1e-53   
ref|XP_011129737.1|  aspartyl-tRNA synthetase                           189   2e-53   
ref|XP_009169334.1|  hypothetical protein T265_13902                    189   2e-53   
ref|XP_009029804.1|  hypothetical protein HELRODRAFT_186165             189   2e-53   
gb|EJW82942.1|  aspartyl-tRNA synthetase                                188   2e-53   
ref|XP_007201590.1|  hypothetical protein PRUPE_ppa020801mg             182   3e-53   
gb|EFO63904.1|  Aspartyl-tRNA synthetase                                189   3e-53   
gb|KHC29683.1|  aspartyl-tRNA synthetase, cytoplasmic                   189   3e-53   
gb|KGQ82915.1|  aspartyl-tRNA synthetase, cytoplasmic                   189   3e-53   
gb|KHC78258.1|  aspartyl-tRNA synthetase, cytoplasmic                   189   3e-53   
gb|KGU21895.1|  aspartyl-tRNA synthetase, cytoplasmic                   189   3e-53   
gb|KGU19639.1|  aspartyl-tRNA synthetase, cytoplasmic                   189   3e-53   
gb|KGQ81649.1|  aspartyl-tRNA synthetase, cytoplasmic                   189   3e-53   
ref|XP_713293.1|  probable aspartate-tRNA synthetase                    189   3e-53   
gb|KHJ82932.1|  tRNA ligase class II                                    181   3e-53   
ref|XP_003113118.1|  CRE-DARS-1 protein                                 188   3e-53   
gb|EEQ43416.1|  aspartyl-tRNA synthetase                                189   4e-53   
gb|EET01155.1|  Aspartyl-tRNA synthetase                                189   4e-53   
ref|XP_004480213.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     187   4e-53   
gb|EMG48614.1|  Aspartyl-tRNA synthetase, cytoplasmic, putative         189   4e-53   



>ref|XP_009791268.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Nicotiana 
sylvestris]
Length=541

 Score =   290 bits (742),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 137/146 (94%), Positives = 140/146 (96%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KEAGI+VDP GDLNTESERKLGQLV +KYGTEFYIL +YPLAVRPFYTMPCYDN AYSNS
Sbjct  396  KEAGIEVDPFGDLNTESERKLGQLVAKKYGTEFYILHKYPLAVRPFYTMPCYDNPAYSNS  455

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQRVHVPE L KRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER
Sbjct  456  FDVFIRGEEIISGAQRVHVPEFLAKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  515

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFCALNNIRKTSLFPRDPQRIAP
Sbjct  516  VVMLFCALNNIRKTSLFPRDPQRIAP  541



>ref|XP_009598884.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Nicotiana 
tomentosiformis]
Length=552

 Score =   290 bits (741),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 137/146 (94%), Positives = 140/146 (96%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KEAGI+VDP GDLNTESERKLGQLV +KYGTEFYIL +YPLAVRPFYTMPCYDN AYSNS
Sbjct  407  KEAGIEVDPFGDLNTESERKLGQLVAKKYGTEFYILHKYPLAVRPFYTMPCYDNPAYSNS  466

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQRVHVPE L KRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER
Sbjct  467  FDVFIRGEEIISGAQRVHVPEFLAKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  526

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFCALNNIRKTSLFPRDPQRIAP
Sbjct  527  VVMLFCALNNIRKTSLFPRDPQRIAP  552



>ref|XP_010277273.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Nelumbo 
nucifera]
Length=550

 Score =   285 bits (730),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 135/146 (92%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KEAGI+VDPLGDLNTE+ERKLGQLVLEKYGTEFYIL RYPLAVRPFYTMPCYD+ AYSNS
Sbjct  405  KEAGIEVDPLGDLNTETERKLGQLVLEKYGTEFYILHRYPLAVRPFYTMPCYDDLAYSNS  464

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQR+HVPE L  RAE CGIDVKTISTYIDSFRYGAPPHGGFGVGLER
Sbjct  465  FDVFIRGEEIISGAQRIHVPEFLATRAEACGIDVKTISTYIDSFRYGAPPHGGFGVGLER  524

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFCALNNIRKTSLFPRDP RIAP
Sbjct  525  VVMLFCALNNIRKTSLFPRDPLRIAP  550



>ref|XP_011075752.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic [Sesamum indicum]
Length=542

 Score =   285 bits (728),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 133/146 (91%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KEAG+++DPLGDLNTESERKLGQLVLEKYGTEFYIL RYPLAVRPFYTMPC+DN  YSNS
Sbjct  397  KEAGVEIDPLGDLNTESERKLGQLVLEKYGTEFYILHRYPLAVRPFYTMPCHDNPKYSNS  456

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQRVHVPE LT+RA+  GIDVKTISTYIDSFRYGAPPHGGFGVGLER
Sbjct  457  FDVFIRGEEIISGAQRVHVPEFLTERAQSLGIDVKTISTYIDSFRYGAPPHGGFGVGLER  516

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFCALNNIRKTSLFPRDPQRI P
Sbjct  517  VVMLFCALNNIRKTSLFPRDPQRITP  542



>emb|CDP04847.1| unnamed protein product [Coffea canephora]
Length=405

 Score =   280 bits (715),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 131/146 (90%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KEAG++VDPLGDLNTE+ERKLGQLV EKYGTEFYIL RYPLAVRPFYTMPCYDN AYSNS
Sbjct  260  KEAGVEVDPLGDLNTETERKLGQLVFEKYGTEFYILHRYPLAVRPFYTMPCYDNPAYSNS  319

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQRVHVPELL +RAE CGIDV+TISTYIDSFR GAP HGGFGVGLER
Sbjct  320  FDVFIRGEEIISGAQRVHVPELLAQRAESCGIDVRTISTYIDSFRCGAPTHGGFGVGLER  379

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVML+CALNN+RKTSLFPRDPQR+AP
Sbjct  380  VVMLYCALNNVRKTSLFPRDPQRLAP  405



>gb|EYU29160.1| hypothetical protein MIMGU_mgv1a004174mg [Erythranthe guttata]
Length=541

 Score =   283 bits (725),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 132/146 (90%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KE+G+DVDPLGDLNTESERKLGQLVLEKYGTEFYIL RYPL VRPFYTMPC+D+  YSNS
Sbjct  396  KESGVDVDPLGDLNTESERKLGQLVLEKYGTEFYILHRYPLGVRPFYTMPCHDDMKYSNS  455

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQRVHVPE LT+RA+ CGIDV TISTYIDSFRYGAPPHGGFGVGLER
Sbjct  456  FDVFIRGEEIISGAQRVHVPEFLTERAQACGIDVNTISTYIDSFRYGAPPHGGFGVGLER  515

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFCALNNIRKTSLFPRDPQRI P
Sbjct  516  VVMLFCALNNIRKTSLFPRDPQRITP  541



>ref|XP_004239653.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic [Solanum lycopersicum]
Length=544

 Score =   283 bits (725),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 134/146 (92%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KEAG++VDPLGDLNTESERKLGQLV EKYGTEFYIL +YP AVRPFYTMPC+DN +YSNS
Sbjct  399  KEAGVEVDPLGDLNTESERKLGQLVAEKYGTEFYILHKYPQAVRPFYTMPCHDNPSYSNS  458

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQRVHVPELL KRA ECGIDVKTISTYIDSFRYGAPPHGGFGVGLER
Sbjct  459  FDVFIRGEEIISGAQRVHVPELLEKRAGECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  518

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFCALNNIRKTSLFPRDPQRI P
Sbjct  519  VVMLFCALNNIRKTSLFPRDPQRIVP  544



>ref|XP_006345989.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Solanum 
tuberosum]
Length=539

 Score =   283 bits (724),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 133/146 (91%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KEAG++VDPLGDLNTESERKLGQLV +KYGTEFYIL +YP AVRPFYTMPC+DN +YSNS
Sbjct  394  KEAGVEVDPLGDLNTESERKLGQLVADKYGTEFYILHKYPQAVRPFYTMPCHDNPSYSNS  453

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQRVHVPE L KRA ECGIDVKTISTYIDSFRYGAPPHGGFGVGLER
Sbjct  454  FDVFIRGEEIISGAQRVHVPEFLEKRAGECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  513

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFCALNNIRKTSLFPRDPQRIAP
Sbjct  514  VVMLFCALNNIRKTSLFPRDPQRIAP  539



>ref|XP_008466345.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic [Cucumis melo]
Length=545

 Score =   283 bits (724),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 131/146 (90%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            K+AG+++DPLGDLNTE+ERKLGQLVLEKYGTEFYIL RYPLAVRPFYTMPCYDN  YSNS
Sbjct  400  KDAGVEIDPLGDLNTEAERKLGQLVLEKYGTEFYILHRYPLAVRPFYTMPCYDNPTYSNS  459

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQRVHVPE L +RA+ CGIDVKTI TYIDSFRYGAPPHGGFGVGLER
Sbjct  460  FDVFIRGEEIISGAQRVHVPEFLAERAQACGIDVKTIETYIDSFRYGAPPHGGFGVGLER  519

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFC LNNIRKTSLFPRDPQRIAP
Sbjct  520  VVMLFCGLNNIRKTSLFPRDPQRIAP  545



>ref|XP_004136326.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Cucumis 
sativus]
 gb|KGN60145.1| hypothetical protein Csa_3G881580 [Cucumis sativus]
Length=545

 Score =   283 bits (723),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 131/146 (90%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            K+AG+++DPLGDLNTE+ERKLGQLVLEKYGTEFYIL RYPLAVRPFYTMPCYDN  YSNS
Sbjct  400  KDAGVEIDPLGDLNTEAERKLGQLVLEKYGTEFYILHRYPLAVRPFYTMPCYDNPTYSNS  459

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQRVHVPE L +RA+ CGIDVKTI TYIDSFRYGAPPHGGFGVGLER
Sbjct  460  FDVFIRGEEIISGAQRVHVPEFLAERAQACGIDVKTIETYIDSFRYGAPPHGGFGVGLER  519

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFC LNNIRKTSLFPRDPQRIAP
Sbjct  520  VVMLFCGLNNIRKTSLFPRDPQRIAP  545



>ref|XP_009377365.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Pyrus x 
bretschneideri]
Length=542

 Score =   281 bits (719),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 132/146 (90%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KEAG++VDP GDLNTE+ERKLGQLVLEKYGTEFYIL RYPLAVRPFYTMPC+DN AYSNS
Sbjct  397  KEAGVEVDPFGDLNTENERKLGQLVLEKYGTEFYILHRYPLAVRPFYTMPCHDNPAYSNS  456

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQRVHVPELLT+RA+  GIDVKTISTYIDSFRYGAPPHGGFGVGLER
Sbjct  457  FDVFIRGEEIISGAQRVHVPELLTERAQALGIDVKTISTYIDSFRYGAPPHGGFGVGLER  516

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFC LNNIRKTSLFPRDP R+AP
Sbjct  517  VVMLFCGLNNIRKTSLFPRDPLRLAP  542



>ref|XP_006422161.1| hypothetical protein CICLE_v10004669mg [Citrus clementina]
 ref|XP_006490529.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Citrus sinensis]
 gb|ESR35401.1| hypothetical protein CICLE_v10004669mg [Citrus clementina]
 gb|KDO46758.1| hypothetical protein CISIN_1g008808mg [Citrus sinensis]
Length=553

 Score =   281 bits (720),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 129/146 (88%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            K+AG+++DPLGDLNTESERKLGQLVLEKYGTEFYIL RYPLAVRPFYTMPC+DNS YSNS
Sbjct  408  KDAGVEIDPLGDLNTESERKLGQLVLEKYGTEFYILHRYPLAVRPFYTMPCHDNSLYSNS  467

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQR+H+PE L +RA+ CGIDVKTISTYIDSFRYGAPPHGGFGVGLER
Sbjct  468  FDVFIRGEEIISGAQRIHIPEFLAERAQACGIDVKTISTYIDSFRYGAPPHGGFGVGLER  527

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFC LNNIRKTSL+PRDP RIAP
Sbjct  528  VVMLFCGLNNIRKTSLYPRDPLRIAP  553



>ref|XP_006290941.1| hypothetical protein CARUB_v10017054mg [Capsella rubella]
 gb|EOA23839.1| hypothetical protein CARUB_v10017054mg [Capsella rubella]
Length=506

 Score =   280 bits (716),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 132/146 (90%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KEAG++VDPLGDLNTESERKLGQLVLEKY TEFYIL RYP AVRPFYTMPC DN  YSNS
Sbjct  361  KEAGVEVDPLGDLNTESERKLGQLVLEKYNTEFYILHRYPAAVRPFYTMPCADNPLYSNS  420

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQRVH+PE+L KRA ECGIDVKTISTYIDSFRYGAPPHGGFGVGLER
Sbjct  421  FDVFIRGEEIISGAQRVHIPEVLEKRAGECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  480

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFCALNNIRKTSLFPRDPQR+ P
Sbjct  481  VVMLFCALNNIRKTSLFPRDPQRLTP  506



>ref|XP_006412618.1| hypothetical protein EUTSA_v100249451mg, partial [Eutrema salsugineum]
 gb|ESQ54071.1| hypothetical protein EUTSA_v100249451mg, partial [Eutrema salsugineum]
Length=257

 Score =   271 bits (694),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            K+AG++V+PLGDLNTESERKLGQLVLEKY TEFY+L RYP AVRPFYTMPC D+S YSNS
Sbjct  112  KDAGVEVNPLGDLNTESERKLGQLVLEKYNTEFYMLHRYPAAVRPFYTMPCADDSRYSNS  171

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQRVH+PE+L +RA ECGIDVKTI TYIDSFRYGAPPHGGFGVGLER
Sbjct  172  FDVFIRGEEIISGAQRVHIPEVLEQRAGECGIDVKTIKTYIDSFRYGAPPHGGFGVGLER  231

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFCALNNIRKTSLFPRDPQR+AP
Sbjct  232  VVMLFCALNNIRKTSLFPRDPQRLAP  257



>ref|XP_008219827.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic [Prunus mume]
Length=533

 Score =   280 bits (717),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 130/146 (89%), Positives = 140/146 (96%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            K+AGI+VDP+GDLNTE+ERKLGQLVLEKYGTEFYIL RYPLAVRPFYTMPC+DN AYSNS
Sbjct  388  KDAGIEVDPMGDLNTEAERKLGQLVLEKYGTEFYILHRYPLAVRPFYTMPCHDNPAYSNS  447

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQRVHVPELL +RA+ CGI++KTISTYID+FRYGAPPHGGFGVGLER
Sbjct  448  FDVFIRGEEIISGAQRVHVPELLAERAQACGIELKTISTYIDAFRYGAPPHGGFGVGLER  507

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFC LNNIRKTSLFPRDP RIAP
Sbjct  508  VVMLFCGLNNIRKTSLFPRDPLRIAP  533



>ref|XP_007222302.1| hypothetical protein PRUPE_ppa003911mg [Prunus persica]
 gb|EMJ23501.1| hypothetical protein PRUPE_ppa003911mg [Prunus persica]
Length=540

 Score =   280 bits (717),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 130/146 (89%), Positives = 140/146 (96%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            K+AGI+VDP+GDLNTE+ERKLGQLVLEKYGTEFYIL RYPLAVRPFYTMPC+DN AYSNS
Sbjct  395  KDAGIEVDPMGDLNTEAERKLGQLVLEKYGTEFYILHRYPLAVRPFYTMPCHDNLAYSNS  454

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQRVHVPELL +RA+ CGI++KTISTYID+FRYGAPPHGGFGVGLER
Sbjct  455  FDVFIRGEEIISGAQRVHVPELLAERAQACGIELKTISTYIDAFRYGAPPHGGFGVGLER  514

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFC LNNIRKTSLFPRDP RIAP
Sbjct  515  VVMLFCGLNNIRKTSLFPRDPLRIAP  540



>ref|XP_008809075.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Phoenix 
dactylifera]
 ref|XP_008809076.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Phoenix 
dactylifera]
Length=546

 Score =   280 bits (717),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 132/146 (90%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KEAGI+VDP GDLNTE+E+KLGQLV EKY TEFYIL RYPLAVRPFYTMPCYD+ AYSNS
Sbjct  401  KEAGIEVDPFGDLNTEAEKKLGQLVREKYDTEFYILYRYPLAVRPFYTMPCYDDLAYSNS  460

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQR+H+PELLTKRAE CGIDVKTISTYIDSFRYGAPPHGGFGVGLER
Sbjct  461  FDVFIRGEEIISGAQRIHLPELLTKRAEACGIDVKTISTYIDSFRYGAPPHGGFGVGLER  520

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFCALNNIRKTSLFPRDPQR+ P
Sbjct  521  VVMLFCALNNIRKTSLFPRDPQRLVP  546



>ref|XP_010431338.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Camelina 
sativa]
Length=497

 Score =   278 bits (712),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 130/146 (89%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KEAG++VDP GDLNTESERKLGQLVLEKY TEFYIL RYP AVRPFYTMPC DN  YSNS
Sbjct  352  KEAGVEVDPFGDLNTESERKLGQLVLEKYNTEFYILHRYPTAVRPFYTMPCADNPLYSNS  411

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQRVH+PE+L KRA ECGIDVKTISTYIDSFRYGAPPHGGFGVGLER
Sbjct  412  FDVFIRGEEIISGAQRVHIPEVLEKRAGECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  471

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V+MLFCALNNIRKTSLFPRDPQR+ P
Sbjct  472  VIMLFCALNNIRKTSLFPRDPQRLTP  497



>gb|KFK29697.1| hypothetical protein AALP_AA7G167100 [Arabis alpina]
Length=556

 Score =   280 bits (716),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 131/146 (90%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KEAG++VDPLGDLNTESERKLGQLVLEKY TEFYIL RYP AVRPFYTMPC D++ YSNS
Sbjct  411  KEAGVEVDPLGDLNTESERKLGQLVLEKYNTEFYILHRYPSAVRPFYTMPCADDARYSNS  470

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQRVH+PE+L KRA ECGIDVKTISTYIDSFRYGAPPHGG GVGLER
Sbjct  471  FDVFIRGEEIISGAQRVHIPEVLEKRAGECGIDVKTISTYIDSFRYGAPPHGGLGVGLER  530

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFCALNNIRKTSLFPRDPQR+AP
Sbjct  531  VVMLFCALNNIRKTSLFPRDPQRLAP  556



>gb|EPS57914.1| hypothetical protein M569_16902, partial [Genlisea aurea]
Length=534

 Score =   279 bits (714),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 131/146 (90%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            K  G+++DP GDLNTE+ERKLGQLVLEKYGTEFYIL RYPLAVRPFYTMPCYDN  YSNS
Sbjct  389  KATGVEMDPFGDLNTEAERKLGQLVLEKYGTEFYILHRYPLAVRPFYTMPCYDNPNYSNS  448

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQRVHV ELLT+RA+ CGIDVKTISTYIDSFRYGA PHGGFGVGLER
Sbjct  449  FDVFIRGEEIISGAQRVHVAELLTERAQSCGIDVKTISTYIDSFRYGASPHGGFGVGLER  508

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFCALNNIRKTSLFPRDPQRIAP
Sbjct  509  VVMLFCALNNIRKTSLFPRDPQRIAP  534



>ref|XP_002523450.1| aspartyl-tRNA synthetase, putative [Ricinus communis]
 gb|EEF38909.1| aspartyl-tRNA synthetase, putative [Ricinus communis]
Length=540

 Score =   280 bits (715),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 130/146 (89%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KEAG++VDP GDLNTE+ERKLGQLVLEKYGTEFYIL RYPLAVRPFYTMPCYD++ YSNS
Sbjct  395  KEAGVEVDPYGDLNTEAERKLGQLVLEKYGTEFYILHRYPLAVRPFYTMPCYDDAKYSNS  454

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQRVHVPELL +RA+ CGIDV TISTYIDSFRYGAPPHGGFGVGLER
Sbjct  455  FDVFIRGEEIISGAQRVHVPELLEERAKACGIDVSTISTYIDSFRYGAPPHGGFGVGLER  514

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V+MLFC LNNIRKTSLFPRDP RIAP
Sbjct  515  VIMLFCGLNNIRKTSLFPRDPMRIAP  540



>ref|XP_004162485.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Cucumis 
sativus]
Length=545

 Score =   279 bits (714),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 130/146 (89%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            K+AG+++DPLGDLNTE+ERKLGQLVLEKYGTEFYIL RYPLAVRPFYTMPCYDN  YSNS
Sbjct  400  KDAGVEIDPLGDLNTEAERKLGQLVLEKYGTEFYILHRYPLAVRPFYTMPCYDNPTYSNS  459

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQRVHVPE L + A+ CGIDVKTI TYIDSFRYGAPPHGGFGVGLER
Sbjct  460  FDVFIRGEEIISGAQRVHVPEFLAECAQACGIDVKTIETYIDSFRYGAPPHGGFGVGLER  519

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFC LNNIRKTSLFPRDPQRIAP
Sbjct  520  VVMLFCGLNNIRKTSLFPRDPQRIAP  545



>ref|XP_010095486.1| Aspartate--tRNA ligase [Morus notabilis]
 gb|EXB60460.1| Aspartate--tRNA ligase [Morus notabilis]
Length=541

 Score =   279 bits (713),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 131/146 (90%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            K+AG++VDPLGDLNTESERKLGQLVLEKYGTEFYIL RYPL VRPFYTMPCYDN AYSNS
Sbjct  396  KDAGVEVDPLGDLNTESERKLGQLVLEKYGTEFYILHRYPLVVRPFYTMPCYDNPAYSNS  455

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQRVHVPE L +RA+ CGIDVKTIS YIDSFRYGAPPHGGFGVGLER
Sbjct  456  FDVFIRGEEIISGAQRVHVPEFLAERAQACGIDVKTISPYIDSFRYGAPPHGGFGVGLER  515

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFC LNNIRKTSLFPRDP R+AP
Sbjct  516  VVMLFCGLNNIRKTSLFPRDPLRLAP  541



>gb|KJB06559.1| hypothetical protein B456_001G001300 [Gossypium raimondii]
Length=485

 Score =   277 bits (709),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            K+AG++VDPLGDLNTE+ERKLGQLVLEKY TEFYIL RYPLAVRPFYTMPCYDN+ YSNS
Sbjct  340  KDAGVEVDPLGDLNTEAERKLGQLVLEKYDTEFYILHRYPLAVRPFYTMPCYDNALYSNS  399

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQRVHVPE L +RA+ CGIDV TISTY+DSFRYG PPHGGFGVGLER
Sbjct  400  FDVFIRGEEIISGAQRVHVPEFLAERAQACGIDVNTISTYVDSFRYGVPPHGGFGVGLER  459

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFCAL NIRKTSL+PRDPQRIAP
Sbjct  460  VVMLFCALGNIRKTSLYPRDPQRIAP  485



>ref|XP_007011472.1| Class II aminoacyl-tRNA and biotin synthetases superfamily protein 
isoform 3 [Theobroma cacao]
 gb|EOY29091.1| Class II aminoacyl-tRNA and biotin synthetases superfamily protein 
isoform 3 [Theobroma cacao]
Length=506

 Score =   277 bits (709),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 129/146 (88%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            K+AG++VDPLGDLNTE+ERKLGQLVLEKYGTEFYIL RYPLAVRPFYTMPCYD+S YSNS
Sbjct  361  KDAGVEVDPLGDLNTEAERKLGQLVLEKYGTEFYILHRYPLAVRPFYTMPCYDDSLYSNS  420

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQR+HVP  L +RA+ CGIDV TISTYIDSFRYGAPPHGGFGVGLER
Sbjct  421  FDVFIRGEEIISGAQRIHVPAFLAERAQACGIDVNTISTYIDSFRYGAPPHGGFGVGLER  480

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFC L NIRKTSLFPRDPQRIAP
Sbjct  481  VVMLFCGLGNIRKTSLFPRDPQRIAP  506



>ref|XP_008347712.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Malus domestica]
Length=542

 Score =   278 bits (711),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 130/146 (89%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KEAG++VDP GDLNTE+ERKLGQLVLEKYGTEFYIL RYPLAVRPFYTMPC+DN AYSNS
Sbjct  397  KEAGVEVDPFGDLNTETERKLGQLVLEKYGTEFYILHRYPLAVRPFYTMPCHDNPAYSNS  456

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISG QRVHVPELLT+RA+  GIDVKTISTY+DSFRYGAPPHGGFGVGLER
Sbjct  457  FDVFIRGEEIISGGQRVHVPELLTERAQALGIDVKTISTYMDSFRYGAPPHGGFGVGLER  516

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFC LNNIRKTSLFPRDP R+AP
Sbjct  517  VVMLFCGLNNIRKTSLFPRDPLRLAP  542



>emb|CBI20816.3| unnamed protein product [Vitis vinifera]
Length=404

 Score =   274 bits (700),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 131/146 (90%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KE G++VDP GDLNTE+ERKLGQLVLEKYGTEFYIL RYPLAVRPFYTMP YD+  YSNS
Sbjct  259  KEVGMEVDPYGDLNTEAERKLGQLVLEKYGTEFYILHRYPLAVRPFYTMPSYDDPLYSNS  318

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQRVHVP+ L KRAE CGIDVKTISTYIDSFRYGAPPHGGFGVGLER
Sbjct  319  FDVFIRGEEIISGAQRVHVPDFLEKRAEACGIDVKTISTYIDSFRYGAPPHGGFGVGLER  378

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFCALNNIRKTSLFPRDP RIAP
Sbjct  379  VVMLFCALNNIRKTSLFPRDPTRIAP  404



>gb|KDP45573.1| hypothetical protein JCGZ_17180 [Jatropha curcas]
Length=188

 Score =   266 bits (681),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAG++VDP GDLNTE+ERKLGQLVLEKYGTEFYIL RYPLAVRPFYTMPCYD++ YSNS
Sbjct  43   QEAGVEVDPFGDLNTEAERKLGQLVLEKYGTEFYILHRYPLAVRPFYTMPCYDDAKYSNS  102

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIIS AQR+HVPELL  RA+ CGIDV TISTYID+FRYGAPPHGGFGVGLER
Sbjct  103  FDVFIRGEEIISVAQRIHVPELLEARAKACGIDVNTISTYIDAFRYGAPPHGGFGVGLER  162

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
             VMLFC LNNIRKTSLFPRDP R+AP
Sbjct  163  EVMLFCGLNNIRKTSLFPRDPLRLAP  188



>ref|XP_007011470.1| Class II aminoacyl-tRNA and biotin synthetases superfamily protein 
isoform 1 [Theobroma cacao]
 gb|EOY29089.1| Class II aminoacyl-tRNA and biotin synthetases superfamily protein 
isoform 1 [Theobroma cacao]
Length=543

 Score =   277 bits (709),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 129/146 (88%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            K+AG++VDPLGDLNTE+ERKLGQLVLEKYGTEFYIL RYPLAVRPFYTMPCYD+S YSNS
Sbjct  398  KDAGVEVDPLGDLNTEAERKLGQLVLEKYGTEFYILHRYPLAVRPFYTMPCYDDSLYSNS  457

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQR+HVP  L +RA+ CGIDV TISTYIDSFRYGAPPHGGFGVGLER
Sbjct  458  FDVFIRGEEIISGAQRIHVPAFLAERAQACGIDVNTISTYIDSFRYGAPPHGGFGVGLER  517

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFC L NIRKTSLFPRDPQRIAP
Sbjct  518  VVMLFCGLGNIRKTSLFPRDPQRIAP  543



>gb|KHN37081.1| Aspartate--tRNA ligase, cytoplasmic [Glycine soja]
Length=432

 Score =   273 bits (699),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            K+ G++++P GDLNTE+ERKLGQLVLEKYGTEFYIL RYPLA+RPFYTMPCYDN AYSNS
Sbjct  287  KDVGVEIEPYGDLNTEAERKLGQLVLEKYGTEFYILHRYPLAIRPFYTMPCYDNPAYSNS  346

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQRVHVPE L +RA  CGIDVKTIS+YIDSFRYGAPPHGGFGVGLER
Sbjct  347  FDVFIRGEEIISGAQRVHVPEFLEQRAAACGIDVKTISSYIDSFRYGAPPHGGFGVGLER  406

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFC LNNIRKTSLFPRDP RIAP
Sbjct  407  VVMLFCGLNNIRKTSLFPRDPLRIAP  432



>gb|KJB06558.1| hypothetical protein B456_001G001300 [Gossypium raimondii]
Length=543

 Score =   276 bits (707),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            K+AG++VDPLGDLNTE+ERKLGQLVLEKY TEFYIL RYPLAVRPFYTMPCYDN+ YSNS
Sbjct  398  KDAGVEVDPLGDLNTEAERKLGQLVLEKYDTEFYILHRYPLAVRPFYTMPCYDNALYSNS  457

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQRVHVPE L +RA+ CGIDV TISTY+DSFRYG PPHGGFGVGLER
Sbjct  458  FDVFIRGEEIISGAQRVHVPEFLAERAQACGIDVNTISTYVDSFRYGVPPHGGFGVGLER  517

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFCAL NIRKTSL+PRDPQRIAP
Sbjct  518  VVMLFCALGNIRKTSLYPRDPQRIAP  543



>ref|XP_008378275.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Malus domestica]
Length=542

 Score =   276 bits (706),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 130/146 (89%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KEAG++VDP GDLNTE ERKLGQLVLEKYGTEFYIL RYPLAVRPFYTMPC+DN AYSNS
Sbjct  397  KEAGVEVDPFGDLNTEXERKLGQLVLEKYGTEFYILHRYPLAVRPFYTMPCHDNPAYSNS  456

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISG QRVHVPELLT+RA+  GIDVKTISTY DSFRYGAPPHGGFGVGLER
Sbjct  457  FDVFIRGEEIISGXQRVHVPELLTERAQALGIDVKTISTYXDSFRYGAPPHGGFGVGLER  516

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFC LNNIRKTSLFPRDP R+AP
Sbjct  517  VVMLFCGLNNIRKTSLFPRDPLRLAP  542



>ref|XP_004512467.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Cicer arietinum]
Length=538

 Score =   276 bits (706),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KE G++++P GDLNTE+ERKLGQLVLEKYGTEFYIL RYPLA+RPFYTMPCYDN  YSNS
Sbjct  393  KEVGVEIEPFGDLNTEAERKLGQLVLEKYGTEFYILHRYPLAIRPFYTMPCYDNPEYSNS  452

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQRVH+PE L +RA+ CGI+VKTISTYIDSFRYGAPPHGGFGVGLER
Sbjct  453  FDVFIRGEEIISGAQRVHIPEFLEQRAQACGIEVKTISTYIDSFRYGAPPHGGFGVGLER  512

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFC LNNIRKTSL+PRDPQRIAP
Sbjct  513  VVMLFCGLNNIRKTSLYPRDPQRIAP  538



>gb|KHN15295.1| Aspartate--tRNA ligase, cytoplasmic [Glycine soja]
Length=432

 Score =   273 bits (697),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            K+ G++++P GDLNTE+ERKLGQLV EKYGTEFYIL RYPLAVRPFYTMPCYDN AYSNS
Sbjct  287  KDVGVEIEPYGDLNTEAERKLGQLVSEKYGTEFYILHRYPLAVRPFYTMPCYDNPAYSNS  346

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQRVHVPE L +RA  CGIDVKTISTYIDSFRYGAPPHGGFGVGLER
Sbjct  347  FDVFIRGEEIISGAQRVHVPEFLEQRAAACGIDVKTISTYIDSFRYGAPPHGGFGVGLER  406

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFC LNNIRKTSLFPRDP RIAP
Sbjct  407  VVMLFCGLNNIRKTSLFPRDPLRIAP  432



>ref|XP_010927161.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Elaeis guineensis]
 ref|XP_010927162.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Elaeis guineensis]
Length=543

 Score =   276 bits (705),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/146 (88%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KEAGI+V+P GDL+TE+E+KLGQLV EKY T+FYIL RYPLAVRPFYTMPCYD+ AYSNS
Sbjct  398  KEAGIEVNPFGDLSTEAEKKLGQLVREKYDTDFYILYRYPLAVRPFYTMPCYDDPAYSNS  457

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQR+H+PELLTKRAE CGIDVKTISTYIDSFRYGAPPHGGFGVGLER
Sbjct  458  FDVFIRGEEIISGAQRIHLPELLTKRAEACGIDVKTISTYIDSFRYGAPPHGGFGVGLER  517

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFCALNNIRKTSLFPRDPQR+ P
Sbjct  518  VVMLFCALNNIRKTSLFPRDPQRLVP  543



>gb|KHG15734.1| Aspartate--tRNA ligase, cytoplasmic [Gossypium arboreum]
Length=543

 Score =   276 bits (705),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            K+AG++VDPLGDLNTE+ERKLGQLVLEKY TEFY+L RYPLAVRPFYTMPCYDN+ YSNS
Sbjct  398  KDAGVEVDPLGDLNTEAERKLGQLVLEKYDTEFYLLHRYPLAVRPFYTMPCYDNALYSNS  457

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQRVHVPE L +RA+ CGIDV TISTYIDSFRYGAPPHGGFGVGLER
Sbjct  458  FDVFIRGEEIISGAQRVHVPEFLAERAQACGIDVNTISTYIDSFRYGAPPHGGFGVGLER  517

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFCAL NIRKTSL+PRDPQRI P
Sbjct  518  VVMLFCALGNIRKTSLYPRDPQRITP  543



>ref|XP_011019869.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic [Populus euphratica]
Length=546

 Score =   276 bits (705),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/146 (88%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KEAG+++DP GDLNTESERKLGQLVLEKYGTEFYIL RYPLAVRPFYTMPCYD+  YSNS
Sbjct  401  KEAGVEIDPYGDLNTESERKLGQLVLEKYGTEFYILHRYPLAVRPFYTMPCYDDPKYSNS  460

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQRVHVPE L +RA+ CGIDV TISTYIDSFRYGAPPHGGFG GLER
Sbjct  461  FDVFIRGEEIISGAQRVHVPEFLVERAQACGIDVSTISTYIDSFRYGAPPHGGFGAGLER  520

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFC LNNIRKTSLFPRDP RIAP
Sbjct  521  VVMLFCGLNNIRKTSLFPRDPLRIAP  546



>ref|XP_008352039.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Malus domestica]
Length=545

 Score =   276 bits (705),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KE+G++VDP GDLNTE+ERKLG LVLEKYGTEFYIL RYPLAVRPFYTMPC+DN AYSNS
Sbjct  400  KESGVEVDPFGDLNTENERKLGLLVLEKYGTEFYILHRYPLAVRPFYTMPCHDNPAYSNS  459

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQRVHVPE LT+RA+ CGIDVKTI TYID+FRYGAPPHGGFGVGLER
Sbjct  460  FDVFIRGEEIISGAQRVHVPEFLTERAQACGIDVKTIQTYIDAFRYGAPPHGGFGVGLER  519

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFC LNNIRKTSLFPRDP R+AP
Sbjct  520  VVMLFCGLNNIRKTSLFPRDPLRLAP  545



>ref|XP_002308157.2| aspartyl-tRNA synthetase family protein [Populus trichocarpa]
 gb|EEE91680.2| aspartyl-tRNA synthetase family protein [Populus trichocarpa]
Length=545

 Score =   276 bits (705),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/146 (88%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KEAG+++DP GDLNTESERKLGQLVLEKYGTEFYIL RYPLAVRPFYTMPCYD+  YSNS
Sbjct  400  KEAGVEIDPYGDLNTESERKLGQLVLEKYGTEFYILHRYPLAVRPFYTMPCYDDPKYSNS  459

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQRVHVPE L +RA+ CGIDV TISTYIDSFRYGAPPHGGFG GLER
Sbjct  460  FDVFIRGEEIISGAQRVHVPEFLVERAQACGIDVSTISTYIDSFRYGAPPHGGFGAGLER  519

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFC LNNIRKTSLFPRDP RIAP
Sbjct  520  VVMLFCGLNNIRKTSLFPRDPLRIAP  545



>gb|AAL61938.1| aspartate--tRNA ligase - like protein [Arabidopsis thaliana]
 gb|AAO00927.1| aspartate--tRNA ligase - like protein [Arabidopsis thaliana]
Length=405

 Score =   271 bits (693),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/146 (88%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KEAG++VDPLGDLNTESERKLGQLVLEKY TEFYIL RYP AVRPFYTM C DN  YSNS
Sbjct  260  KEAGVEVDPLGDLNTESERKLGQLVLEKYNTEFYILHRYPKAVRPFYTMTCADNPLYSNS  319

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQRVH+PE+L +RA ECGIDVKTISTYIDSFRYGAP HGGFGVGLER
Sbjct  320  FDVFIRGEEIISGAQRVHIPEVLEQRAGECGIDVKTISTYIDSFRYGAPLHGGFGVGLER  379

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFCALNNIRKTSLFPRDPQR++P
Sbjct  380  VVMLFCALNNIRKTSLFPRDPQRLSP  405



>ref|XP_010526284.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic [Tarenaya hassleriana]
Length=566

 Score =   276 bits (705),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 129/146 (88%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KEAG+++DPLGDLNTESERKLGQLVLEKYGTEFYIL RYP +VRPFYTMPC DN  YSNS
Sbjct  421  KEAGVEIDPLGDLNTESERKLGQLVLEKYGTEFYILHRYPQSVRPFYTMPCADNPLYSNS  480

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQR+HVPELL +RA+ CGIDVKTISTYIDSFRYGAPPHGGFGVGLER
Sbjct  481  FDVFIRGEEIISGAQRIHVPELLEERAQACGIDVKTISTYIDSFRYGAPPHGGFGVGLER  540

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFCAL NIRKTSL+PRDP RIAP
Sbjct  541  VVMLFCALKNIRKTSLYPRDPVRIAP  566



>ref|XP_006283471.1| hypothetical protein CARUB_v10004519mg [Capsella rubella]
 gb|EOA16369.1| hypothetical protein CARUB_v10004519mg [Capsella rubella]
Length=550

 Score =   275 bits (704),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 129/146 (88%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KE G++VDPLGDLNTE+ERKLGQLVLEKY TEFYIL RYP AVRPFYTM C DN  YSNS
Sbjct  405  KEDGVEVDPLGDLNTETERKLGQLVLEKYNTEFYILHRYPKAVRPFYTMACADNPLYSNS  464

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQRVH+PE+L +RA ECGIDVKTISTYIDSFRYGAPPHGGFGVGLER
Sbjct  465  FDVFIRGEEIISGAQRVHIPEVLEERAGECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  524

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFCALNNIRKTSLFPRDPQR+AP
Sbjct  525  VVMLFCALNNIRKTSLFPRDPQRLAP  550



>ref|XP_002283440.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic [Vitis vinifera]
Length=544

 Score =   275 bits (703),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 131/146 (90%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KE G++VDP GDLNTE+ERKLGQLVLEKYGTEFYIL RYPLAVRPFYTMP YD+  YSNS
Sbjct  399  KEVGMEVDPYGDLNTEAERKLGQLVLEKYGTEFYILHRYPLAVRPFYTMPSYDDPLYSNS  458

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQRVHVP+ L KRAE CGIDVKTISTYIDSFRYGAPPHGGFGVGLER
Sbjct  459  FDVFIRGEEIISGAQRVHVPDFLEKRAEACGIDVKTISTYIDSFRYGAPPHGGFGVGLER  518

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFCALNNIRKTSLFPRDP RIAP
Sbjct  519  VVMLFCALNNIRKTSLFPRDPTRIAP  544



>ref|XP_006381194.1| hypothetical protein POPTR_0006s08550g [Populus trichocarpa]
 gb|ERP58991.1| hypothetical protein POPTR_0006s08550g [Populus trichocarpa]
Length=564

 Score =   275 bits (703),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAG+++DP GDLNTESERKLGQLVLEKYGTEFYIL RYPLAVRPFYTMPCYD+  YSNS
Sbjct  419  REAGVEIDPYGDLNTESERKLGQLVLEKYGTEFYILHRYPLAVRPFYTMPCYDDPKYSNS  478

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQRVHVPE L +RA+ CGIDV TISTYIDSFRYGAPPHGGFG GLER
Sbjct  479  FDVFIRGEEIISGAQRVHVPEFLVERAQACGIDVSTISTYIDSFRYGAPPHGGFGAGLER  538

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFC LNNIRKTSLFPRDP RIAP
Sbjct  539  VVMLFCGLNNIRKTSLFPRDPLRIAP  564



>ref|XP_010447608.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Camelina 
sativa]
Length=551

 Score =   274 bits (701),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 129/146 (88%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KEAG+++DPLGDLNTESERKLGQLVLEKY TEFYIL RYP AVRPFYTM C DN  YSNS
Sbjct  406  KEAGVEIDPLGDLNTESERKLGQLVLEKYNTEFYILHRYPKAVRPFYTMTCADNPLYSNS  465

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQRVH+PE+L +RA E GIDVKTISTYIDSFRYGAPPHGGFGVGLER
Sbjct  466  FDVFIRGEEIISGAQRVHIPEVLEQRAGEYGIDVKTISTYIDSFRYGAPPHGGFGVGLER  525

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFCALNNIRKTSLFPRDPQR+AP
Sbjct  526  VVMLFCALNNIRKTSLFPRDPQRLAP  551



>ref|XP_003544559.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Glycine 
max]
Length=543

 Score =   274 bits (700),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            K+ G++++P GDLNTE+ERKLGQLV EKYGTEFYIL RYPLAVRPFYTMPCYDN AYSNS
Sbjct  398  KDVGVEIEPYGDLNTEAERKLGQLVSEKYGTEFYILHRYPLAVRPFYTMPCYDNPAYSNS  457

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQRVHVPE L +RA  CGIDVKTISTYIDSFRYGAPPHGGFGVGLER
Sbjct  458  FDVFIRGEEIISGAQRVHVPEFLEQRAAACGIDVKTISTYIDSFRYGAPPHGGFGVGLER  517

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFC LNNIRKTSLFPRDP RIAP
Sbjct  518  VVMLFCGLNNIRKTSLFPRDPLRIAP  543



>ref|XP_003550250.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Glycine 
max]
Length=544

 Score =   274 bits (700),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            K+ G++++P GDLNTE+ERKLGQLVLEKYGTEFYIL RYPLA+RPFYTMPCYDN AYSNS
Sbjct  399  KDVGVEIEPYGDLNTEAERKLGQLVLEKYGTEFYILHRYPLAIRPFYTMPCYDNPAYSNS  458

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQRVHVPE L +RA  CGIDVKTIS+YIDSFRYGAPPHGGFGVGLER
Sbjct  459  FDVFIRGEEIISGAQRVHVPEFLEQRAAACGIDVKTISSYIDSFRYGAPPHGGFGVGLER  518

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFC LNNIRKTSLFPRDP RIAP
Sbjct  519  VVMLFCGLNNIRKTSLFPRDPLRIAP  544



>ref|NP_849558.1| Asx tRNA synthetase (AspRS/AsnRS) class II core domain-contating 
protein [Arabidopsis thaliana]
 ref|NP_194847.3| Asx tRNA synthetase (AspRS/AsnRS) class II core domain-contating 
protein [Arabidopsis thaliana]
 emb|CAB79836.1| aspartate--tRNA ligase-like protein [Arabidopsis thaliana]
 dbj|BAH20270.1| AT4G31180 [Arabidopsis thaliana]
 gb|AEE85872.1| Asx tRNA synthetase (AspRS/AsnRS) class II core domain-contating 
protein [Arabidopsis thaliana]
 gb|AEE85873.1| Asx tRNA synthetase (AspRS/AsnRS) class II core domain-contating 
protein [Arabidopsis thaliana]
Length=558

 Score =   274 bits (701),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 129/146 (88%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KEAG++VDPLGDLNTESERKLGQLVLEKY TEFYIL RYP AVRPFYTM C DN  YSNS
Sbjct  413  KEAGVEVDPLGDLNTESERKLGQLVLEKYNTEFYILHRYPKAVRPFYTMTCADNPLYSNS  472

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQRVH+PE+L +RA ECGIDVKTISTYIDSFRYGAP HGGFGVGLER
Sbjct  473  FDVFIRGEEIISGAQRVHIPEVLEQRAGECGIDVKTISTYIDSFRYGAPLHGGFGVGLER  532

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFCALNNIRKTSLFPRDPQR++P
Sbjct  533  VVMLFCALNNIRKTSLFPRDPQRLSP  558



>ref|XP_010036668.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Eucalyptus 
grandis]
 gb|KCW48296.1| hypothetical protein EUGRSUZ_K02027 [Eucalyptus grandis]
Length=535

 Score =   273 bits (698),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/146 (88%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            K+AGI++DP GDL+TE ERKLGQLVLEKYGTEFYIL RYP AVRPFYTMPCYD+ AYSNS
Sbjct  390  KDAGIEIDPFGDLSTEVERKLGQLVLEKYGTEFYILHRYPFAVRPFYTMPCYDDPAYSNS  449

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQRVHVPELLTK+AE  GIDVKTI TYIDSFRYGAPPHGGFGVGLER
Sbjct  450  FDVFIRGEEIISGAQRVHVPELLTKQAEAKGIDVKTIETYIDSFRYGAPPHGGFGVGLER  509

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFC LNNIRKTSLFPRDP RI+P
Sbjct  510  VVMLFCGLNNIRKTSLFPRDPLRISP  535



>ref|XP_010438070.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Camelina 
sativa]
Length=551

 Score =   273 bits (698),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            K+AG+++DPLGDLNTESERKLGQLVLEKY TEFYIL RYP AVRPFYTM C DN  YSNS
Sbjct  406  KDAGVEIDPLGDLNTESERKLGQLVLEKYNTEFYILHRYPKAVRPFYTMTCADNPLYSNS  465

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQRVH+PE+L +RA E GIDVKTISTYIDSFRYGAPPHGGFGVGLER
Sbjct  466  FDVFIRGEEIISGAQRVHIPEVLEQRAGEYGIDVKTISTYIDSFRYGAPPHGGFGVGLER  525

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFCALNNIRKTSLFPRDPQR+AP
Sbjct  526  VVMLFCALNNIRKTSLFPRDPQRLAP  551



>ref|XP_007160941.1| hypothetical protein PHAVU_001G030000g [Phaseolus vulgaris]
 gb|ESW32935.1| hypothetical protein PHAVU_001G030000g [Phaseolus vulgaris]
Length=541

 Score =   273 bits (697),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            K+ G++++P GDLNTE+ERKLGQLVLEKYGTEFY+L RYPLAVRPFYTMPCYDN AYSNS
Sbjct  396  KDVGVEIEPFGDLNTEAERKLGQLVLEKYGTEFYMLHRYPLAVRPFYTMPCYDNPAYSNS  455

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQRVHVPELL +RA  CGIDVKTISTYID+FRYGAP HGGFGVGLER
Sbjct  456  FDVFIRGEEIISGAQRVHVPELLEQRAAACGIDVKTISTYIDAFRYGAPLHGGFGVGLER  515

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFC LNNIRKTSLFPRDP RIAP
Sbjct  516  VVMLFCGLNNIRKTSLFPRDPLRIAP  541



>ref|XP_009390472.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Musa acuminata 
subsp. malaccensis]
Length=560

 Score =   273 bits (698),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAG++VDPLGDLNTE+E+KLG+LV EKY T+FYIL RYPLAVRPFYTMPCYD+ AYSNS
Sbjct  415  QEAGVEVDPLGDLNTEAEKKLGRLVHEKYDTDFYILCRYPLAVRPFYTMPCYDDPAYSNS  474

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQRVH+PELLT RAE CGIDVKTI++YIDSFRYGAPPHGGFG+GLER
Sbjct  475  FDVFIRGEEIISGAQRVHLPELLTTRAEACGIDVKTIASYIDSFRYGAPPHGGFGIGLER  534

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFCALNNIRKTSLFPRDPQR+ P
Sbjct  535  VVMLFCALNNIRKTSLFPRDPQRLVP  560



>ref|XP_010929419.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic [Elaeis guineensis]
Length=547

 Score =   273 bits (697),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KEAG +VDP GDLNTE+E+ LG+LV EKY T+FYIL RYPLAVRPFYTMPCYD+  YSNS
Sbjct  402  KEAGTEVDPFGDLNTEAEKTLGRLVREKYDTDFYILHRYPLAVRPFYTMPCYDDPTYSNS  461

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQRVH+PELLTKRAE CGIDVKTISTYIDSFRYGAPPHGGFGVGLER
Sbjct  462  FDVFIRGEEIISGAQRVHLPELLTKRAEACGIDVKTISTYIDSFRYGAPPHGGFGVGLER  521

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFCALNNIRKTSLFPRDPQR+ P
Sbjct  522  VVMLFCALNNIRKTSLFPRDPQRLVP  547



>ref|XP_002869341.1| hypothetical protein ARALYDRAFT_491623 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45600.1| hypothetical protein ARALYDRAFT_491623 [Arabidopsis lyrata subsp. 
lyrata]
Length=557

 Score =   273 bits (697),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 129/146 (88%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KEAG++VDPLGDLNTESERKLGQLVLEKY TEFYIL RYP AVRPFYTM C DN  YSNS
Sbjct  412  KEAGVEVDPLGDLNTESERKLGQLVLEKYNTEFYILHRYPKAVRPFYTMTCADNPLYSNS  471

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQRVH+PE+L +RA E GIDVKTISTYIDSFRYGAPPHGGFGVGLER
Sbjct  472  FDVFIRGEEIISGAQRVHIPEILEQRAGEFGIDVKTISTYIDSFRYGAPPHGGFGVGLER  531

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFC LNNIRKTSLFPRDPQR+AP
Sbjct  532  VVMLFCGLNNIRKTSLFPRDPQRLAP  557



>ref|XP_008801441.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Phoenix 
dactylifera]
Length=543

 Score =   272 bits (696),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KEAGI+VDP GDLNTE+E+ LG+LV EK+ T+FYIL RYPLAVRPFYTMPCYD+ AYSNS
Sbjct  398  KEAGIEVDPFGDLNTEAEKTLGRLVREKFDTDFYILYRYPLAVRPFYTMPCYDDPAYSNS  457

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQRVH+PELLTKRAE CGIDVKTISTYIDSFRYGAPPHGGFGVGLER
Sbjct  458  FDVFIRGEEIISGAQRVHLPELLTKRAEACGIDVKTISTYIDSFRYGAPPHGGFGVGLER  517

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFCALNNIRK SLFPRDPQR+ P
Sbjct  518  VVMLFCALNNIRKASLFPRDPQRLVP  543



>gb|EEC73805.1| hypothetical protein OsI_08509 [Oryza sativa Indica Group]
Length=549

 Score =   272 bits (696),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KEAG +++P+GDLNTE+E+KLG+LV EKYGTEF+IL RYPLAVRPFYTMPCYDN AYSNS
Sbjct  404  KEAGTEIEPMGDLNTEAEKKLGRLVKEKYGTEFFILYRYPLAVRPFYTMPCYDNPAYSNS  463

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQR+H+PELLTKRA ECGID  TIS+YI+SF YGAPPHGGFGVGLER
Sbjct  464  FDVFIRGEEIISGAQRIHLPELLTKRATECGIDASTISSYIESFSYGAPPHGGFGVGLER  523

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFCALNNIRKTSLFPRDPQR+ P
Sbjct  524  VVMLFCALNNIRKTSLFPRDPQRLVP  549



>ref|XP_010432896.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Camelina 
sativa]
Length=551

 Score =   272 bits (695),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KEAG+++DPLGDLNTESERKLGQLVLEKY TEFYIL RYP AVRPFYTM C DN  YSNS
Sbjct  406  KEAGVEIDPLGDLNTESERKLGQLVLEKYNTEFYILHRYPKAVRPFYTMTCADNPLYSNS  465

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQRVH+PE+L +RA E GIDVKTISTYIDSFRYGAPPHGGFGVGLER
Sbjct  466  FDVFIRGEEIISGAQRVHIPEVLEQRAGEYGIDVKTISTYIDSFRYGAPPHGGFGVGLER  525

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFCALNNIRKTSLFPRDPQR+ P
Sbjct  526  VVMLFCALNNIRKTSLFPRDPQRLVP  551



>ref|NP_001047770.1| Os02g0686400 [Oryza sativa Japonica Group]
 dbj|BAD07576.1| putative aspartate-tRNA ligase [Oryza sativa Japonica Group]
 dbj|BAF09684.1| Os02g0686400 [Oryza sativa Japonica Group]
 dbj|BAG93847.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57599.1| hypothetical protein OsJ_07966 [Oryza sativa Japonica Group]
Length=549

 Score =   272 bits (695),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KEAG +++P+GDLNTE+E+KLG+LV EKYGTEF+IL RYPLAVRPFYTMPCYDN AYSNS
Sbjct  404  KEAGTEIEPMGDLNTEAEKKLGRLVKEKYGTEFFILYRYPLAVRPFYTMPCYDNPAYSNS  463

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQR+H+PELLTKRA ECGID  TIS+YI+SF YGAPPHGGFGVGLER
Sbjct  464  FDVFIRGEEIISGAQRIHLPELLTKRATECGIDASTISSYIESFSYGAPPHGGFGVGLER  523

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFCALNNIRKTSLFPRDPQR+ P
Sbjct  524  VVMLFCALNNIRKTSLFPRDPQRLVP  549



>ref|XP_004498802.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Cicer arietinum]
Length=539

 Score =   271 bits (693),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KE G++++P GDLNTE+ERKLGQLVLEKYGTEFYIL RYPLAVRPFYTMPCYDN  YSNS
Sbjct  394  KEVGVEIEPFGDLNTEAERKLGQLVLEKYGTEFYILHRYPLAVRPFYTMPCYDNPEYSNS  453

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQRVHVPE L +RAE C I+VKTIS YIDSFRYGAPPHGGFGVGLER
Sbjct  454  FDVFIRGEEIISGAQRVHVPEFLEQRAEACDIEVKTISAYIDSFRYGAPPHGGFGVGLER  513

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFC LNNIRKTSL+PRDP RIAP
Sbjct  514  VVMLFCGLNNIRKTSLYPRDPLRIAP  539



>ref|XP_004303438.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic [Fragaria vesca 
subsp. vesca]
Length=551

 Score =   271 bits (694),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            K+AG++VDP+GDLNTE+ERKLGQLVLEKY TEFYIL RYPLAVRPFYTMPC+DN  YSNS
Sbjct  406  KDAGVEVDPMGDLNTEAERKLGQLVLEKYNTEFYILHRYPLAVRPFYTMPCHDNKEYSNS  465

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQRVHVP+ L +RAE  GIDVKTISTYIDSFRYGAPPHGGFGVGLER
Sbjct  466  FDVFIRGEEIISGAQRVHVPDFLAERAEARGIDVKTISTYIDSFRYGAPPHGGFGVGLER  525

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFC LNNIRKTSLFPRDP R+AP
Sbjct  526  VVMLFCGLNNIRKTSLFPRDPLRLAP  551



>ref|XP_006660416.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Oryza brachyantha]
Length=543

 Score =   270 bits (691),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KEAG +++P+GDLNTE+E+KLG+LV EKYGTEF+IL RYPLAVRPFYTMPCYDN AYSNS
Sbjct  398  KEAGTEIEPMGDLNTEAEKKLGRLVKEKYGTEFFILYRYPLAVRPFYTMPCYDNPAYSNS  457

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQR+H PELLTKRA ECGID  TI++YI+SF YGAPPHGGFGVGLER
Sbjct  458  FDVFIRGEEIISGAQRIHTPELLTKRATECGIDASTIASYIESFSYGAPPHGGFGVGLER  517

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFCALNNIRKTSLFPRDPQR+ P
Sbjct  518  VVMLFCALNNIRKTSLFPRDPQRLVP  543



>ref|XP_003588866.1| Aspartyl-tRNA synthetase [Medicago truncatula]
 gb|AES59117.1| aspartate-tRNA ligase [Medicago truncatula]
Length=541

 Score =   270 bits (691),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KE G++++P GDLNTE+ERKLGQLVLEKYGTEFYIL RYPLAVRPFYTMPCYDN  YSNS
Sbjct  396  KEVGVEIEPFGDLNTEAERKLGQLVLEKYGTEFYILHRYPLAVRPFYTMPCYDNPNYSNS  455

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQR+HVPE L +RA+ CGI+VKTIS YIDSFRYG PPHGGFGVGLER
Sbjct  456  FDVFIRGEEIISGAQRIHVPEFLEERAQACGIEVKTISAYIDSFRYGVPPHGGFGVGLER  515

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFC LNNIRKTSL+PRDP RIAP
Sbjct  516  VVMLFCGLNNIRKTSLYPRDPLRIAP  541



>ref|XP_009129024.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic [Brassica rapa]
Length=534

 Score =   270 bits (690),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KEAG +VDPLGDLNTESERKLGQLVLEKY TEFY+L RYP AVRPFYTMPC D+S YSNS
Sbjct  389  KEAGEEVDPLGDLNTESERKLGQLVLEKYKTEFYMLHRYPSAVRPFYTMPCEDDSNYSNS  448

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEI+SGAQR+H PELL KRA ECGIDVKTISTYID+FRYGAPPHGGFGVGLER
Sbjct  449  FDVFIRGEEIMSGAQRIHDPELLEKRARECGIDVKTISTYIDAFRYGAPPHGGFGVGLER  508

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVML CAL+NIRKTSLFPRDP+R+AP
Sbjct  509  VVMLLCALDNIRKTSLFPRDPKRLAP  534



>ref|XP_002876233.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52492.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=550

 Score =   270 bits (691),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KEAG+++DPLGDLNTESERKLGQLVLEKY TEFYIL R+P AVRPFYTM C DN  YSNS
Sbjct  405  KEAGVEIDPLGDLNTESERKLGQLVLEKYNTEFYILHRFPTAVRPFYTMTCVDNPLYSNS  464

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQR+H PELL +RA E GIDVKTISTYIDSFRYGAPPHGGFG GLER
Sbjct  465  FDVFIRGEEIISGAQRIHTPELLEQRAREHGIDVKTISTYIDSFRYGAPPHGGFGAGLER  524

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFC LNNIRKTSLFPRDPQR+AP
Sbjct  525  VVMLFCGLNNIRKTSLFPRDPQRLAP  550



>emb|CDY14727.1| BnaC05g19840D [Brassica napus]
Length=537

 Score =   270 bits (690),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KEAG +VDPLGDLNTESE+KLGQLVLEKY TEFY+L RYP AVRPFYTMPC D+S YSNS
Sbjct  392  KEAGEEVDPLGDLNTESEKKLGQLVLEKYKTEFYMLHRYPSAVRPFYTMPCEDDSNYSNS  451

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQR+H PELL KRA ECGIDVKTISTYID+FRYGAPPHGGFG GLER
Sbjct  452  FDVFIRGEEIISGAQRIHDPELLEKRARECGIDVKTISTYIDAFRYGAPPHGGFGAGLER  511

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVML CALNNIRKTSLFPRDP+R+AP
Sbjct  512  VVMLLCALNNIRKTSLFPRDPKRLAP  537



>gb|KFK40259.1| hypothetical protein AALP_AA3G351000 [Arabis alpina]
Length=549

 Score =   269 bits (688),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KEAG +VDPL DLNTESERKLGQLVLEKY TEFYIL RYPLA RPFYTMPC DN+ YSNS
Sbjct  404  KEAGEEVDPLKDLNTESERKLGQLVLEKYNTEFYILHRYPLAARPFYTMPCADNADYSNS  463

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQRVH+PELL +RA+E GIDV  ISTYI+SFRYGAPPHGGFGVGLER
Sbjct  464  FDVFIRGEEIISGAQRVHIPELLEERAKEIGIDVTAISTYINSFRYGAPPHGGFGVGLER  523

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFCAL+NIRKTSLFPRDPQR+AP
Sbjct  524  VVMLFCALDNIRKTSLFPRDPQRLAP  549



>ref|XP_006657639.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Oryza brachyantha]
Length=545

 Score =   269 bits (687),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KEAG +++P+GDLNTE+E+KLG+LV EKYGTEF+IL RYPLAVRPFYTMPCYD+ AYSNS
Sbjct  400  KEAGTEIEPMGDLNTEAEKKLGRLVKEKYGTEFFILYRYPLAVRPFYTMPCYDDPAYSNS  459

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQR+H PELLTKRA ECGID  TI++YI+SF YGAPPHGGFGVGLER
Sbjct  460  FDVFIRGEEIISGAQRIHTPELLTKRATECGIDASTIASYIESFSYGAPPHGGFGVGLER  519

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFCALNNIRKTSLFPRDPQR+ P
Sbjct  520  VVMLFCALNNIRKTSLFPRDPQRLVP  545



>emb|CDY35247.1| BnaA01g07840D [Brassica napus]
Length=529

 Score =   268 bits (685),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KEAG +VDPLGDLNTESERKLGQLVLEKY TEFY+L RYP AVRPFYTMPC D+S YSNS
Sbjct  384  KEAGEEVDPLGDLNTESERKLGQLVLEKYKTEFYMLHRYPSAVRPFYTMPCEDDSNYSNS  443

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEI+SGAQR+H PELL KRA ECGIDV TISTYID+FRYGAPPHGGFGVGLER
Sbjct  444  FDVFIRGEEIMSGAQRIHDPELLEKRARECGIDVMTISTYIDAFRYGAPPHGGFGVGLER  503

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVML CAL+NIRKTSLFPRDP+R+AP
Sbjct  504  VVMLLCALDNIRKTSLFPRDPKRLAP  529



>gb|KDP45577.1| hypothetical protein JCGZ_17184 [Jatropha curcas]
Length=594

 Score =   270 bits (689),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAG++VDP GDLNTE+ERKLGQLVLEKYGTEFYIL RYPLAVRPFY  PCY+++ YSNS
Sbjct  449  QEAGVEVDPFGDLNTEAERKLGQLVLEKYGTEFYILHRYPLAVRPFYPKPCYEDAKYSNS  508

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQR+HVPELL +RA+ CGIDV TISTYID+FRYGAPPHGGFGVGLER
Sbjct  509  FDVFIRGEEIISGAQRIHVPELLEERAKACGIDVNTISTYIDAFRYGAPPHGGFGVGLER  568

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFC LNNIRKTSLFPRDP R+AP
Sbjct  569  VVMLFCGLNNIRKTSLFPRDPLRLAP  594



>ref|XP_004967463.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Setaria 
italica]
Length=547

 Score =   268 bits (685),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KEAG +++P+GDLNTE+E+KLG+LV EKYGT+F+IL RYPLAVRPFYTMPCYDN AY+NS
Sbjct  402  KEAGTEIEPMGDLNTEAEKKLGRLVKEKYGTDFFILYRYPLAVRPFYTMPCYDNPAYTNS  461

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQR+H PELL KRA ECGIDV TIS YI+SF YGAPPHGGFGVGLER
Sbjct  462  FDVFIRGEEIISGAQRIHTPELLAKRATECGIDVSTISAYIESFSYGAPPHGGFGVGLER  521

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFCALNNIRKTS+FPRDPQR+ P
Sbjct  522  VVMLFCALNNIRKTSMFPRDPQRLVP  547



>ref|XP_006838453.1| hypothetical protein AMTR_s00002p00135270 [Amborella trichopoda]
 gb|ERN01022.1| hypothetical protein AMTR_s00002p00135270 [Amborella trichopoda]
Length=380

 Score =   263 bits (671),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KEAG + DPLGDLNTE+ER LGQLV EKY T+FYIL RYPLAVRPFYTMPC+D+  YSNS
Sbjct  235  KEAGFEADPLGDLNTETERNLGQLVREKYDTDFYILHRYPLAVRPFYTMPCFDDDLYSNS  294

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQRVH  + LT RA+ECGIDVKTISTYIDSFR GAPPHGGFGVGLER
Sbjct  295  FDVFIRGEEIISGAQRVHDADFLTSRAQECGIDVKTISTYIDSFRCGAPPHGGFGVGLER  354

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFC LNNIRKTSLFPRDPQR+AP
Sbjct  355  VVMLFCGLNNIRKTSLFPRDPQRLAP  380



>ref|XP_003578963.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like isoform X2 
[Brachypodium distachyon]
Length=558

 Score =   268 bits (684),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            K+AG ++DP+GDLNTESE+KLG+LV EKYGTEF+IL RYPLAVRPFYTMPCYD+ +YSNS
Sbjct  413  KDAGTEIDPMGDLNTESEKKLGRLVKEKYGTEFFILYRYPLAVRPFYTMPCYDDPSYSNS  472

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQRVH PELL KRA ECGID  TI++YI+SF YGAPPHGGFGVGLER
Sbjct  473  FDVFIRGEEIISGAQRVHTPELLRKRAIECGIDASTIASYIESFSYGAPPHGGFGVGLER  532

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFCALNNIRKTSLFPRDPQR+AP
Sbjct  533  VVMLFCALNNIRKTSLFPRDPQRLAP  558



>ref|XP_010049784.1| PREDICTED: LOW QUALITY PROTEIN: aspartate--tRNA ligase, cytoplasmic 
[Eucalyptus grandis]
Length=546

 Score =   267 bits (682),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 135/153 (88%), Gaps = 7/153 (5%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            K+A +++DPLGDLNTE ERKLGQLVLEKYGTEFYIL RYPLAVRPFYTMPCYDN AYSNS
Sbjct  394  KDASVEIDPLGDLNTEVERKLGQLVLEKYGTEFYILHRYPLAVRPFYTMPCYDNPAYSNS  453

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYG-------APPHGG  213
            FDVFIRGEEIISGAQRVHVPE LTKRAE CGID+KTI TYIDSFR         APPHGG
Sbjct  454  FDVFIRGEEIISGAQRVHVPEFLTKRAEACGIDMKTIETYIDSFRLFSLHNWXLAPPHGG  513

Query  212  FGVGLERVVMLFCALNNIRKTSLFPRDPQRIAP  114
            FGVGLERVVMLFC LNNIRKTSLFPRDP RI+P
Sbjct  514  FGVGLERVVMLFCGLNNIRKTSLFPRDPLRISP  546



>dbj|BAJ99106.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=544

 Score =   267 bits (682),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KEAG +++P+GDLNTE+E+KLG+LV EKYGTEF+IL RYPLAVRPFYTMPCYD+ AYSNS
Sbjct  399  KEAGTEIEPMGDLNTEAEKKLGRLVKEKYGTEFFILYRYPLAVRPFYTMPCYDDPAYSNS  458

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQR+H PELL KRA ECGID  TI++YI+SF YGAPPHGGFGVGLER
Sbjct  459  FDVFIRGEEIISGAQRIHTPELLRKRAIECGIDASTIASYIESFSYGAPPHGGFGVGLER  518

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFCALNNIRKTSLFPRDPQR+AP
Sbjct  519  VVMLFCALNNIRKTSLFPRDPQRLAP  544



>ref|NP_001145746.1| hypothetical protein [Zea mays]
 gb|ACL52520.1| unknown [Zea mays]
 gb|AFW80451.1| hypothetical protein ZEAMMB73_076937 [Zea mays]
Length=545

 Score =   266 bits (680),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KEAG +++P+GDLNTE+E+KLG+LV EKY T+F+I+ RYPLAVRPFYTMPCYDN AYSNS
Sbjct  400  KEAGTEIEPMGDLNTEAEKKLGRLVREKYDTDFFIMYRYPLAVRPFYTMPCYDNPAYSNS  459

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQR+H PELLTKRA ECGIDV TISTYI+ F YGAPPHGGFGVGLER
Sbjct  460  FDVFIRGEEIISGAQRIHTPELLTKRATECGIDVSTISTYIEVFSYGAPPHGGFGVGLER  519

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFCALNNIRKTS+FPRDPQR+ P
Sbjct  520  VVMLFCALNNIRKTSMFPRDPQRLVP  545



>emb|CAB36533.1| putative aspartate-tRNA ligase [Arabidopsis thaliana]
 emb|CAB79542.1| putative aspartate-tRNA ligase [Arabidopsis thaliana]
Length=504

 Score =   263 bits (672),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KEAG +VDPLGDLNTESERKLGQLVLEKY TEFY+L RYP AVRPFYTMP  ++S YSNS
Sbjct  359  KEAGEEVDPLGDLNTESERKLGQLVLEKYKTEFYMLHRYPSAVRPFYTMPYENDSNYSNS  418

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEI+SGAQR+H PELL KRA ECGIDVKTISTYID+FRYGAPPHGGFGVGLER
Sbjct  419  FDVFIRGEEIMSGAQRIHDPELLEKRARECGIDVKTISTYIDAFRYGAPPHGGFGVGLER  478

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVML CALNNIRKTSLFPRD QR+ P
Sbjct  479  VVMLLCALNNIRKTSLFPRDSQRLTP  504



>gb|ACN28001.1| unknown [Zea mays]
 gb|AFW70024.1| aspartyl-tRNA synthetase [Zea mays]
Length=546

 Score =   264 bits (675),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KEAG +++P+GDLNTE+E+KLG+LV EKY T+F+IL RYPLAVRPFYTMPCYDN AY+NS
Sbjct  401  KEAGTEIEPMGDLNTEAEKKLGRLVREKYDTDFFILYRYPLAVRPFYTMPCYDNPAYTNS  460

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQR+H PELL KRA ECGIDV TIS YI+SF YG PPHGGFGVGLER
Sbjct  461  FDVFIRGEEIISGAQRIHTPELLAKRATECGIDVSTISAYIESFSYGVPPHGGFGVGLER  520

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFCALNNIRKTSLFPRDPQR+ P
Sbjct  521  VVMLFCALNNIRKTSLFPRDPQRLVP  546



>ref|NP_001149817.1| LOC100283444 [Zea mays]
 gb|ACG36897.1| aspartyl-tRNA synthetase [Zea mays]
Length=546

 Score =   264 bits (675),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KEAG +++P+GDLNTE+E+KLG+LV EKY T+F+IL RYPLAVRPFYTMPCYDN AY+NS
Sbjct  401  KEAGTEIEPMGDLNTEAEKKLGRLVREKYDTDFFILYRYPLAVRPFYTMPCYDNPAYTNS  460

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQR+H PELL KRA ECGIDV TIS YI+SF YG PPHGGFGVGLER
Sbjct  461  FDVFIRGEEIISGAQRIHTPELLAKRATECGIDVSTISAYIESFSYGVPPHGGFGVGLER  520

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFCALNNIRKTSLFPRDPQR+ P
Sbjct  521  VVMLFCALNNIRKTSLFPRDPQRLVP  546



>ref|NP_194417.2| Asx tRNA synthetase (AspRS/AsnRS) class II core domain-contating 
protein [Arabidopsis thaliana]
 gb|AAN41339.1| putative aspartate-tRNA ligase [Arabidopsis thaliana]
 gb|AEE85263.1| Asx tRNA synthetase (AspRS/AsnRS) class II core domain-contating 
protein [Arabidopsis thaliana]
Length=532

 Score =   263 bits (673),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KEAG +VDPLGDLNTESERKLGQLVLEKY TEFY+L RYP AVRPFYTMP  ++S YSNS
Sbjct  387  KEAGEEVDPLGDLNTESERKLGQLVLEKYKTEFYMLHRYPSAVRPFYTMPYENDSNYSNS  446

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEI+SGAQR+H PELL KRA ECGIDVKTISTYID+FRYGAPPHGGFGVGLER
Sbjct  447  FDVFIRGEEIMSGAQRIHDPELLEKRARECGIDVKTISTYIDAFRYGAPPHGGFGVGLER  506

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVML CALNNIRKTSLFPRD QR+ P
Sbjct  507  VVMLLCALNNIRKTSLFPRDSQRLTP  532



>ref|XP_006850989.1| hypothetical protein AMTR_s00025p00212870 [Amborella trichopoda]
 gb|ERN12570.1| hypothetical protein AMTR_s00025p00212870 [Amborella trichopoda]
Length=559

 Score =   264 bits (674),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KEAGID DPLGDLNTE+ERKLGQLV EKY T+FYIL RYPLAVRPFYTMPCYD+  YSNS
Sbjct  414  KEAGIDADPLGDLNTETERKLGQLVREKYDTDFYILHRYPLAVRPFYTMPCYDDDLYSNS  473

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQRVH  E L+ RA+  GID+KTISTY+DSFRYGAP HGGFGVGLER
Sbjct  474  FDVFIRGEEIISGAQRVHDAEFLSNRAQALGIDLKTISTYVDSFRYGAPTHGGFGVGLER  533

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFC LNNIRKTSLFPRDPQR+AP
Sbjct  534  VVMLFCGLNNIRKTSLFPRDPQRLAP  559



>ref|XP_002868911.1| hypothetical protein ARALYDRAFT_490730 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45170.1| hypothetical protein ARALYDRAFT_490730 [Arabidopsis lyrata subsp. 
lyrata]
Length=504

 Score =   262 bits (670),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KEAG +VDPLGDLNTESERKLGQLVLEKY TEFY+L RYPLAVRPFYTMP  ++S YSNS
Sbjct  359  KEAGEEVDPLGDLNTESERKLGQLVLEKYKTEFYMLHRYPLAVRPFYTMPYENDSNYSNS  418

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEI+SGAQR+H PELL KRA EC IDVKTISTYID+FRYGAPPHGGFGVGLER
Sbjct  419  FDVFIRGEEIMSGAQRIHDPELLEKRARECCIDVKTISTYIDAFRYGAPPHGGFGVGLER  478

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVML CALNNIRKTSLFPRD QR+ P
Sbjct  479  VVMLLCALNNIRKTSLFPRDSQRLTP  504



>ref|XP_006401257.1| hypothetical protein EUTSA_v10015942mg [Eutrema salsugineum]
 gb|ESQ42710.1| hypothetical protein EUTSA_v10015942mg [Eutrema salsugineum]
Length=628

 Score =   264 bits (674),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            K+AG++VDPLGDLNTE+ERKLGQLVLEKY TEFY+L R+P AVRPFYTMPC D+  YSNS
Sbjct  483  KDAGVEVDPLGDLNTETERKLGQLVLEKYNTEFYMLHRFPAAVRPFYTMPCGDDPRYSNS  542

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVF+RGEEIISGAQR+H+ E L +RA ECGID+KT+ TYID+FRYGAPPHGGFGVGLER
Sbjct  543  FDVFLRGEEIISGAQRIHILEFLEERAGECGIDLKTLETYIDAFRYGAPPHGGFGVGLER  602

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFCALNNIRKTSLFPRDPQR+AP
Sbjct  603  VVMLFCALNNIRKTSLFPRDPQRLAP  628



>ref|XP_001778245.1| predicted protein [Physcomitrella patens]
 gb|EDQ56912.1| predicted protein [Physcomitrella patens]
Length=525

 Score =   261 bits (666),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KEAGI+VDP+ D NTE+E+ LG+LV E+Y T+FY+L RYP  +RPFYTMPC+D+ +YSNS
Sbjct  380  KEAGIEVDPMADFNTETEKTLGKLVKERYKTDFYVLHRYPSGIRPFYTMPCWDDKSYSNS  439

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQR+H PELLTKRA ECGIDVK+++TYIDSFRYGAPPHGG GVGLER
Sbjct  440  FDVFIRGEEIISGAQRIHDPELLTKRATECGIDVKSLTTYIDSFRYGAPPHGGAGVGLER  499

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFCALNNIRKTSLFPRDPQR+AP
Sbjct  500  VVMLFCALNNIRKTSLFPRDPQRLAP  525



>gb|ABK25168.1| unknown [Picea sitchensis]
Length=566

 Score =   262 bits (669),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KEAGI+VDPLGD NTE+ERKLG LV EKY T+FYIL RYPLAVRPFYTMPC D+  YSNS
Sbjct  421  KEAGIEVDPLGDFNTETERKLGGLVREKYDTDFYILHRYPLAVRPFYTMPCIDDPLYSNS  480

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQRVH PE LTKRA+E GIDV TISTYIDSFR+GA PHGG GVGLER
Sbjct  481  FDVFIRGEEIISGAQRVHEPEFLTKRAKELGIDVNTISTYIDSFRWGAVPHGGLGVGLER  540

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFCALNNIRKTSLFPRDPQR+AP
Sbjct  541  VVMLFCALNNIRKTSLFPRDPQRLAP  566



>gb|EYU28247.1| hypothetical protein MIMGU_mgv1a004064mg [Erythranthe guttata]
Length=546

 Score =   259 bits (662),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 124/148 (84%), Positives = 134/148 (91%), Gaps = 2/148 (1%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KEAG++VDPLGDL+TE+ERKLGQLVLEKY TEFYIL RYPL+VRPFYTMP +D + YSNS
Sbjct  399  KEAGVEVDPLGDLSTETERKLGQLVLEKYDTEFYILYRYPLSVRPFYTMPSHDGTEYSNS  458

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDV--KTISTYIDSFRYGAPPHGGFGVGL  198
            FDVFIRGEEIISG QRVHV +LL +RA+ CGIDV  KTISTYIDSFRYG  PHGGFGVGL
Sbjct  459  FDVFIRGEEIISGGQRVHVADLLRERAQACGIDVTSKTISTYIDSFRYGTAPHGGFGVGL  518

Query  197  ERVVMLFCALNNIRKTSLFPRDPQRIAP  114
            ERVVMLFCALNNIRKTSLFPRDPQRI P
Sbjct  519  ERVVMLFCALNNIRKTSLFPRDPQRIVP  546



>ref|XP_009137996.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Brassica 
rapa]
 emb|CDY13418.1| BnaA03g51360D [Brassica napus]
Length=552

 Score =   259 bits (662),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KEAG++ DPLGDLNTE+ERKLG LVLEKY TEFYIL RYP AVRPFYTMPC D+  YSNS
Sbjct  407  KEAGVEADPLGDLNTETERKLGLLVLEKYNTEFYILHRYPSAVRPFYTMPCADDPNYSNS  466

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQRVH PELLT++A+  GIDV+TI TYIDSFRYGAPPHGGFGVGLER
Sbjct  467  FDVFIRGEEIISGAQRVHDPELLTEQAKRFGIDVETIKTYIDSFRYGAPPHGGFGVGLER  526

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFC LNNIRKTSLFPRDP R+AP
Sbjct  527  VVMLFCGLNNIRKTSLFPRDPLRLAP  552



>emb|CDX68726.1| BnaC01g07270D [Brassica napus]
Length=549

 Score =   258 bits (660),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KEAG++ DPLGDLNTE ERKLGQLVLEKY TEFYIL RYP AVRPFYTMPC D+S YSNS
Sbjct  404  KEAGVEADPLGDLNTEVERKLGQLVLEKYNTEFYILHRYPSAVRPFYTMPCADDSNYSNS  463

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQRVH PELL ++A   GIDV TI TYIDSFRYGAPPHGGFGVGLER
Sbjct  464  FDVFIRGEEIISGAQRVHDPELLKEQAIRFGIDVDTIKTYIDSFRYGAPPHGGFGVGLER  523

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFC LNNIRKTSLFPRDP R+AP
Sbjct  524  VVMLFCGLNNIRKTSLFPRDPLRLAP  549



>emb|CDY28248.1| BnaA01g06010D [Brassica napus]
Length=549

 Score =   258 bits (660),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KEAG++ DPLGDLNTE ERKLGQLVLEKY TEFYIL RYP AVRPFYTMPC D+S YSNS
Sbjct  404  KEAGVEADPLGDLNTEVERKLGQLVLEKYNTEFYILHRYPSAVRPFYTMPCADDSNYSNS  463

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQRVH PELL ++A   GIDV TI TYIDSFRYGAPPHGGFGVGLER
Sbjct  464  FDVFIRGEEIISGAQRVHDPELLKEQAIRFGIDVDTIKTYIDSFRYGAPPHGGFGVGLER  523

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFC LNNIRKTSLFPRDP R+AP
Sbjct  524  VVMLFCGLNNIRKTSLFPRDPLRLAP  549



>ref|XP_009127185.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic [Brassica rapa]
Length=549

 Score =   258 bits (659),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KEAG++ DPLGDLNTE ERKLGQLVLEKY TEFYIL RYP AVRPFYTMPC D+S YSNS
Sbjct  404  KEAGVEADPLGDLNTEVERKLGQLVLEKYNTEFYILHRYPSAVRPFYTMPCADDSNYSNS  463

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQRVH PELL ++A   GIDV TI TYIDSFRYGAPPHGGFGVGLER
Sbjct  464  FDVFIRGEEIISGAQRVHDPELLKEQAIRFGIDVDTIKTYIDSFRYGAPPHGGFGVGLER  523

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFC LNNIRKTSLFPRDP R+AP
Sbjct  524  VVMLFCGLNNIRKTSLFPRDPLRLAP  549



>ref|XP_010672510.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Beta vulgaris 
subsp. vulgaris]
Length=544

 Score =   256 bits (655),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KEAGI+VDP GD NTE+ERKLG+LV +KY TEFYIL RYPLAVRPFYTMPC+D+ +YSNS
Sbjct  399  KEAGIEVDPHGDFNTETERKLGELVRDKYDTEFYILHRYPLAVRPFYTMPCHDDPSYSNS  458

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQRVH P+ L KRAE C IDV +I+TY+DSF+YGA PHGGFGVGLER
Sbjct  459  FDVFIRGEEIISGAQRVHDPDFLVKRAEACKIDVNSIATYLDSFKYGAWPHGGFGVGLER  518

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFC LNNIR+TSLFPRDPQR+AP
Sbjct  519  VVMLFCNLNNIRRTSLFPRDPQRLAP  544



>ref|XP_007041300.1| Class II aminoacyl-tRNA and biotin synthetases superfamily protein 
[Theobroma cacao]
 gb|EOX97131.1| Class II aminoacyl-tRNA and biotin synthetases superfamily protein 
[Theobroma cacao]
Length=451

 Score =   254 bits (648),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 121/149 (81%), Positives = 135/149 (91%), Gaps = 3/149 (2%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            K+AG++VDPLGDLNT++ERKLGQLVLEKYGTEFYIL RYPLAVRPFYTMPC+DNS YS S
Sbjct  299  KDAGMEVDPLGDLNTDAERKLGQLVLEKYGTEFYILHRYPLAVRPFYTMPCFDNSLYSKS  358

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKT--ISTYIDSFRYG-APPHGGFGVG  201
            FDVFIRGEEIISGAQR+HVPE+L +RA+ CGIDV T  ISTYIDS RYG A PHGGFG G
Sbjct  359  FDVFIRGEEIISGAQRIHVPEMLEERAQACGIDVNTISISTYIDSIRYGPAGPHGGFGAG  418

Query  200  LERVVMLFCALNNIRKTSLFPRDPQRIAP  114
            LER+VMLFC L+NIRKT LFPRDP+R+AP
Sbjct  419  LERIVMLFCGLDNIRKTPLFPRDPRRLAP  447



>gb|EMT03438.1| Aspartyl-tRNA synthetase, cytoplasmic [Aegilops tauschii]
Length=563

 Score =   256 bits (653),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 136/165 (82%), Gaps = 19/165 (12%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KEAG +++P+GDLNTE+E+KLG+LV EKYGTEF+IL RYPLAVRPFYTMPCYD+ AYSNS
Sbjct  399  KEAGTEIEPMGDLNTEAEKKLGRLVKEKYGTEFFILYRYPLAVRPFYTMPCYDDPAYSNS  458

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSF----------------  240
            FDVFIRGEEIISGAQR+H PELL KRA ECGID  TI++YI+SF                
Sbjct  459  FDVFIRGEEIISGAQRIHTPELLRKRAIECGIDASTIASYIESFSNTYIFFTSVLNSSHA  518

Query  239  ---RYGAPPHGGFGVGLERVVMLFCALNNIRKTSLFPRDPQRIAP  114
                YGAPPHGGFGVGLERVVMLFCALNNIRKTSLFPRDPQR+AP
Sbjct  519  DNHSYGAPPHGGFGVGLERVVMLFCALNNIRKTSLFPRDPQRLAP  563



>ref|XP_006283432.1| hypothetical protein CARUB_v10004480mg [Capsella rubella]
 gb|EOA16330.1| hypothetical protein CARUB_v10004480mg [Capsella rubella]
Length=565

 Score =   255 bits (652),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KEAG +VDP GDLN +SERKLGQL+ EKY T+FYIL R+PLAVRPFYTMPC D+  YS S
Sbjct  420  KEAGKEVDPFGDLNADSERKLGQLIREKYNTDFYILHRFPLAVRPFYTMPCEDDPRYSKS  479

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVF+RGEEIISG QR+H PELL KRA ECGIDVKT+STYIDSFRYGAPPHGGFG+GLER
Sbjct  480  FDVFLRGEEIISGGQRIHDPELLEKRARECGIDVKTLSTYIDSFRYGAPPHGGFGMGLER  539

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFC L+NIRKTSLFPRDP R+AP
Sbjct  540  VVMLFCGLDNIRKTSLFPRDPHRLAP  565



>emb|CDX72297.1| BnaC07g43190D [Brassica napus]
Length=554

 Score =   254 bits (649),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KEAG+  DPLGDLNTE+ERKLG+LV EKY TEFYIL RYP AVRPFYTMPC D+  YSNS
Sbjct  409  KEAGVQADPLGDLNTETERKLGELVREKYDTEFYILHRYPSAVRPFYTMPCADDPNYSNS  468

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQRVH PELLT++A+  GIDV+TI TYIDSFRYGAPPHGGFGVGLER
Sbjct  469  FDVFIRGEEIISGAQRVHDPELLTEQAKRFGIDVETIKTYIDSFRYGAPPHGGFGVGLER  528

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFC LNNIRKTSLF RDP R+AP
Sbjct  529  VVMLFCGLNNIRKTSLFSRDPLRLAP  554



>ref|XP_010436322.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Camelina 
sativa]
Length=657

 Score =   256 bits (654),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KEAG+++DP GDLNTESER+LGQL+ EKY T+FYIL R+PLAVRPFYTMPC D+  YS S
Sbjct  478  KEAGVEIDPFGDLNTESERRLGQLIREKYNTDFYILYRFPLAVRPFYTMPCEDDPRYSKS  537

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVF+RGEEIISG QR+H PE+L KRA ECGI+V+TISTYIDSFRYGAPPHGGFG+GLER
Sbjct  538  FDVFLRGEEIISGGQRIHDPEMLEKRARECGINVETISTYIDSFRYGAPPHGGFGMGLER  597

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFC L+NIRKTSLFPRDP R+AP
Sbjct  598  VVMLFCGLDNIRKTSLFPRDPHRLAP  623



>ref|XP_010238758.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like isoform X1 
[Brachypodium distachyon]
Length=588

 Score =   254 bits (648),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 124/176 (70%), Positives = 137/176 (78%), Gaps = 30/176 (17%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            K+AG ++DP+GDLNTESE+KLG+LV EKYGTEF+IL RYPLAVRPFYTMPCYD+ +YSNS
Sbjct  413  KDAGTEIDPMGDLNTESEKKLGRLVKEKYGTEFFILYRYPLAVRPFYTMPCYDDPSYSNS  472

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFR---------------  237
            FDVFIRGEEIISGAQRVH PELL KRA ECGID  TI++YI+SFR               
Sbjct  473  FDVFIRGEEIISGAQRVHTPELLRKRAIECGIDASTIASYIESFRYVVSFYYICMHWTAC  532

Query  236  ---------------YGAPPHGGFGVGLERVVMLFCALNNIRKTSLFPRDPQRIAP  114
                           YGAPPHGGFGVGLERVVMLFCALNNIRKTSLFPRDPQR+AP
Sbjct  533  ICYFSLVLMVVDNYSYGAPPHGGFGVGLERVVMLFCALNNIRKTSLFPRDPQRLAP  588



>gb|EMT21796.1| Aspartyl-tRNA synthetase, cytoplasmic [Aegilops tauschii]
Length=375

 Score =   245 bits (626),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KEAG +++P+GDLNTE+E+KLGQLV EKY TEF+IL RYPLA RPFYTMPCY+N AYSNS
Sbjct  230  KEAGTEIEPMGDLNTEAEKKLGQLVREKYDTEFFILYRYPLAARPFYTMPCYENPAYSNS  289

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVF+RGEEIISGAQR+H PELL KRA E GI   +I +Y+DSFRYGAPPHGGFGVGLER
Sbjct  290  FDVFLRGEEIISGAQRIHEPELLAKRAAEHGIGKSSIKSYVDSFRYGAPPHGGFGVGLER  349

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFC L+N+R  SLFPRDPQR++P
Sbjct  350  VVMLFCGLSNVRLASLFPRDPQRLSP  375



>ref|XP_006409074.1| hypothetical protein EUTSA_v10023162mg, partial [Eutrema salsugineum]
 gb|ESQ50527.1| hypothetical protein EUTSA_v10023162mg, partial [Eutrema salsugineum]
Length=303

 Score =   240 bits (613),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 111/146 (76%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KEAG +VDP GDLNT+SERKLGQLVLEKY TEF+IL R+PLA RPFYTMPC ++  YSNS
Sbjct  158  KEAGFEVDPFGDLNTQSERKLGQLVLEKYITEFFILHRFPLAARPFYTMPCAEDPRYSNS  217

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
             DVF+RGEEIISGAQR+H+ ELL +R +EC IDV++IS+Y  SFRYG PPHGGFGVGLER
Sbjct  218  LDVFLRGEEIISGAQRIHISELLKERIDECNIDVESISSYFKSFRYGIPPHGGFGVGLER  277

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFCAL+NIRKTSLFPRD  R+ P
Sbjct  278  VVMLFCALDNIRKTSLFPRDRHRLEP  303



>ref|NP_001172794.1| Os02g0139600 [Oryza sativa Japonica Group]
 dbj|BAH91523.1| Os02g0139600, partial [Oryza sativa Japonica Group]
Length=166

 Score =   235 bits (600),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KEAG+ V+ +GDLNTESE+KLG+LV  KY T+FY+L RYP AVRPFYTMPC D+  YSNS
Sbjct  21   KEAGVHVEAMGDLNTESEKKLGELVHTKYDTDFYMLCRYPSAVRPFYTMPCSDDPRYSNS  80

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVF+RGEEIISGAQRVHVPE+L ++AEE GIDV +I+ Y+D+FRYGAPPHGGFGVGLER
Sbjct  81   FDVFVRGEEIISGAQRVHVPEVLARQAEERGIDVGSIAAYVDAFRYGAPPHGGFGVGLER  140

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFC L NIRK SLFPRDP+R+ P
Sbjct  141  VVMLFCGLGNIRKASLFPRDPRRLNP  166



>ref|XP_004951929.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Setaria 
italica]
Length=495

 Score =   246 bits (627),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAG+ VDP+GDLNTE+E+KLG+LV +KYGTEFY+L RYP AVRPFYTMPC D+  YS S
Sbjct  350  QEAGVHVDPMGDLNTEAEKKLGELVRDKYGTEFYMLCRYPSAVRPFYTMPCSDDPRYSCS  409

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVF+RGEEIISGAQRVH PELL  +AE  GIDV TI+ Y+DSFRYGAPPHGGFGVGLER
Sbjct  410  FDVFVRGEEIISGAQRVHDPELLAAQAEARGIDVGTIAAYVDSFRYGAPPHGGFGVGLER  469

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFC L NIRKTSLFPRDP+R+AP
Sbjct  470  VVMLFCGLGNIRKTSLFPRDPRRLAP  495



>ref|XP_003575513.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Brachypodium 
distachyon]
Length=539

 Score =   244 bits (622),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 111/146 (76%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KEAG +++ +GDLNTE+E+KLG+LV EKY T+F+IL +YPLAVRPFYTMPCY+N  YSNS
Sbjct  394  KEAGTEIEHMGDLNTEAEKKLGRLVREKYDTDFFILYQYPLAVRPFYTMPCYENPLYSNS  453

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVF+RGEEIISGAQR+H PELL KRA ECGI+  +I +Y+ SF YG PPHGGFGVGLER
Sbjct  454  FDVFLRGEEIISGAQRIHDPELLAKRAVECGIEKSSIESYVRSFSYGTPPHGGFGVGLER  513

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFCALNNIRKTSLFPRDPQR+ P
Sbjct  514  VVMLFCALNNIRKTSLFPRDPQRLVP  539



>ref|XP_002451520.1| hypothetical protein SORBIDRAFT_04g003180 [Sorghum bicolor]
 gb|EES04496.1| hypothetical protein SORBIDRAFT_04g003180 [Sorghum bicolor]
Length=307

 Score =   234 bits (597),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAG+ VD +GDLNTE+E+KLG LV ++YGTEFY+L RYP AVRPFYTMPC ++  YS S
Sbjct  162  QEAGVHVDAMGDLNTEAEKKLGDLVRDRYGTEFYMLCRYPSAVRPFYTMPCPEDPRYSCS  221

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVF+RGEEIISGAQRVHVP+LL  +A   GIDV +I+TY+D+FRYGAPPHGGFGVGLER
Sbjct  222  FDVFVRGEEIISGAQRVHVPDLLAAQAAARGIDVASIATYVDAFRYGAPPHGGFGVGLER  281

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFC L NIRKTSLFPRDP+R+AP
Sbjct  282  VVMLFCGLGNIRKTSLFPRDPRRLAP  307



>gb|EEC72451.1| hypothetical protein OsI_05793 [Oryza sativa Indica Group]
Length=490

 Score =   238 bits (607),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KEAG+ V+ +GDLNTESE+KLG+LV  KY T+FY+L RYP AVRPFYTMPC D+  YSNS
Sbjct  345  KEAGVHVEAMGDLNTESEKKLGELVHTKYDTDFYMLCRYPSAVRPFYTMPCSDDPRYSNS  404

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVF+RGEEIISGAQRVHVPE+L ++AEE GIDV +I+ Y+D+FRYGAPPHGGFGVGLER
Sbjct  405  FDVFVRGEEIISGAQRVHVPEVLARQAEERGIDVGSIAAYVDAFRYGAPPHGGFGVGLER  464

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFC L NIRK SLFPRDP+R+ P
Sbjct  465  VVMLFCGLGNIRKASLFPRDPRRLNP  490



>dbj|BAD10253.1| putative Aspartyl-tRNA synthetase [Oryza sativa Japonica Group]
 gb|EAZ21689.1| hypothetical protein OsJ_05322 [Oryza sativa Japonica Group]
Length=508

 Score =   238 bits (608),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KEAG+ V+ +GDLNTESE+KLG+LV  KY T+FY+L RYP AVRPFYTMPC D+  YSNS
Sbjct  363  KEAGVHVEAMGDLNTESEKKLGELVHTKYDTDFYMLCRYPSAVRPFYTMPCSDDPRYSNS  422

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVF+RGEEIISGAQRVHVPE+L ++AEE GIDV +I+ Y+D+FRYGAPPHGGFGVGLER
Sbjct  423  FDVFVRGEEIISGAQRVHVPEVLARQAEERGIDVGSIAAYVDAFRYGAPPHGGFGVGLER  482

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFC L NIRK SLFPRDP+R+ P
Sbjct  483  VVMLFCGLGNIRKASLFPRDPRRLNP  508



>ref|XP_001695300.1| aspartyl-tRNA synthetase [Chlamydomonas reinhardtii]
 gb|EDP01558.1| aspartyl-tRNA synthetase [Chlamydomonas reinhardtii]
Length=545

 Score =   239 bits (609),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 127/147 (86%), Gaps = 1/147 (1%)
 Frame = -2

Query  551  KEAGI-DVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSN  375
            KE G  DVDP+GDLNTE ER LG++V EKYGT+F+IL RYP AVRPFYTMPC D+ AYSN
Sbjct  399  KEGGYPDVDPMGDLNTELERALGRMVKEKYGTDFFILHRYPSAVRPFYTMPCSDDPAYSN  458

Query  374  SFDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLE  195
            S+DVFIRGEEIISGAQRVH PELLT RA ECGI +  I +YIDSF+YGAPPHGG GVGLE
Sbjct  459  SYDVFIRGEEIISGAQRVHDPELLTTRAIECGIPLPEIQSYIDSFKYGAPPHGGAGVGLE  518

Query  194  RVVMLFCALNNIRKTSLFPRDPQRIAP  114
            RVVML+C LNNIRKTS+FPRDP+R+ P
Sbjct  519  RVVMLYCGLNNIRKTSMFPRDPKRLTP  545



>dbj|BAJ97188.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=550

 Score =   238 bits (608),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 108/146 (74%), Positives = 126/146 (86%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KEAG +V+P+GDLNTE+ERKLGQLV EKY T+F+IL RYPLA RPFYTMPCY+N AYSNS
Sbjct  405  KEAGTEVEPMGDLNTEAERKLGQLVREKYDTDFFILYRYPLAARPFYTMPCYENPAYSNS  464

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVF+RGEEIISGAQR+H PELL KR  E GID  +I +Y++SF YG PPHGGFG+GLER
Sbjct  465  FDVFLRGEEIISGAQRIHEPELLAKRVAEHGIDKNSIKSYLESFSYGTPPHGGFGIGLER  524

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VV LFC L++IR  SLFPRDPQR++P
Sbjct  525  VVKLFCGLDDIRMASLFPRDPQRLSP  550



>ref|XP_007011471.1| Class II aminoacyl-tRNA and biotin synthetases superfamily protein 
isoform 2 [Theobroma cacao]
 gb|EOY29090.1| Class II aminoacyl-tRNA and biotin synthetases superfamily protein 
isoform 2 [Theobroma cacao]
Length=526

 Score =   237 bits (605),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 122/146 (84%), Gaps = 17/146 (12%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            K+AG++VDPLGDLNTE+ERKLGQLVLEKYGTEFYIL RYPLAVRPFYTMPCYD+S YSNS
Sbjct  398  KDAGVEVDPLGDLNTEAERKLGQLVLEKYGTEFYILHRYPLAVRPFYTMPCYDDSLYSNS  457

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQR+HVP  L +RA                 RYGAPPHGGFGVGLER
Sbjct  458  FDVFIRGEEIISGAQRIHVPAFLAERA-----------------RYGAPPHGGFGVGLER  500

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFC L NIRKTSLFPRDPQRIAP
Sbjct  501  VVMLFCGLGNIRKTSLFPRDPQRIAP  526



>ref|XP_003612738.1| Aspartyl-tRNA synthetase [Medicago truncatula]
 gb|AES95696.1| aspartate-tRNA ligase [Medicago truncatula]
Length=589

 Score =   238 bits (607),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 125/146 (86%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KE G++++P GDLNTE+ERKLGQLVLEKY  EF IL RYPLAVRPFY+MPC D+  YSNS
Sbjct  444  KEVGVEIEPFGDLNTEAERKLGQLVLEKYEKEFCILHRYPLAVRPFYSMPCSDDQNYSNS  503

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQR+H P+LL +R + CGI+V  IS YI++FRYGAP HGGFG GLER
Sbjct  504  FDVFIRGEEIISGAQRIHEPKLLEERTQACGINVDAISYYIEAFRYGAPLHGGFGAGLER  563

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFC L+NIR TSLFPRDP+RI P
Sbjct  564  VVMLFCGLDNIRMTSLFPRDPKRITP  589



>ref|XP_005851895.1| hypothetical protein CHLNCDRAFT_33640 [Chlorella variabilis]
 gb|EFN59793.1| hypothetical protein CHLNCDRAFT_33640 [Chlorella variabilis]
Length=405

 Score =   229 bits (585),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 124/146 (85%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAG DVDP GDLNTE ER LG+LV +KY TEFY+L RYPLA+RPFYTMPC D++ YS S
Sbjct  260  QEAGYDVDPFGDLNTELERALGKLVKDKYNTEFYMLHRYPLAIRPFYTMPCKDDNRYSCS  319

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            F +FIRGEEIISGAQRVH P LLT+RA E G+ V TI +YIDSF+YG PPHGG GVG+ER
Sbjct  320  FVIFIRGEEIISGAQRVHDPVLLTQRAVELGLPVDTIQSYIDSFKYGVPPHGGAGVGMER  379

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFC L+NIRKTS+FPRDP+R+ P
Sbjct  380  VVMLFCGLDNIRKTSMFPRDPKRLTP  405



>ref|XP_002945972.1| hypothetical protein VOLCADRAFT_72624 [Volvox carteri f. nagariensis]
 gb|EFJ52967.1| hypothetical protein VOLCADRAFT_72624 [Volvox carteri f. nagariensis]
Length=545

 Score =   232 bits (591),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/141 (76%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = -2

Query  536  DVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNSFDVFI  357
            +VDPLGDLNTE ER LG++V EKYGT+F+IL RYP AVRPFYTMPC D+  YSNS+DVFI
Sbjct  405  EVDPLGDLNTELERALGKIVKEKYGTDFFILHRYPSAVRPFYTMPCADDPTYSNSYDVFI  464

Query  356  RGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLERVVMLF  177
            RGEEIISGAQRVH  ELLT+RA  CGI + TI +YIDSF+ GAPPHGG GVGLERVVML+
Sbjct  465  RGEEIISGAQRVHDAELLTERATACGIPLDTIQSYIDSFKLGAPPHGGAGVGLERVVMLY  524

Query  176  CALNNIRKTSLFPRDPQRIAP  114
            C LNNIRKTS+FPRDP+R+ P
Sbjct  525  CGLNNIRKTSMFPRDPKRLTP  545



>gb|KDD76372.1| class II (D, K and N) tRNA synthetase, partial [Helicosporidium 
sp. ATCC 50920]
Length=228

 Score =   222 bits (565),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 125/146 (86%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAG +VDP GDLNTE ER LG+LV +KY T+FY+L RYP A+RPFYTMPC D++ YSNS
Sbjct  83   QEAGHEVDPFGDLNTELERTLGKLVRDKYDTDFYMLHRYPAAIRPFYTMPCPDDARYSNS  142

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+FIRGEEIISGAQR+H P LL KRA E G+ V+ I +YID F++GAPPHGG GVGLER
Sbjct  143  YDIFIRGEEIISGAQRIHDPVLLEKRAAELGVPVEQIQSYIDCFKHGAPPHGGAGVGLER  202

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFC L+NIRKTS++PRDP+R++P
Sbjct  203  VVMLFCGLDNIRKTSMYPRDPKRLSP  228



>ref|XP_011401383.1| Aspartate-tRNA ligase, cytoplasmic [Auxenochlorella protothecoides]
 gb|KFM22516.1| Aspartate-tRNA ligase, cytoplasmic [Auxenochlorella protothecoides]
Length=465

 Score =   226 bits (576),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 101/141 (72%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = -2

Query  536  DVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNSFDVFI  357
            +VDP GDLNTE ER LG++V EKY T+FYIL RYP A+RPFYTMPC D+  YS S+D+FI
Sbjct  325  EVDPFGDLNTELERVLGKIVAEKYNTDFYILHRYPSAIRPFYTMPCKDDERYSCSYDIFI  384

Query  356  RGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLERVVMLF  177
            RGEEIISGAQR+H P LL +RA+ECGI V+TI  Y+DSF+YGA PHGG GVG+ERVVMLF
Sbjct  385  RGEEIISGAQRIHDPSLLERRAKECGIPVETIQAYVDSFKYGAWPHGGIGVGMERVVMLF  444

Query  176  CALNNIRKTSLFPRDPQRIAP  114
            C L+N+RKTS+FPRDP+R+AP
Sbjct  445  CGLDNVRKTSMFPRDPKRLAP  465



>ref|XP_002983062.1| hypothetical protein SELMODRAFT_117697 [Selaginella moellendorffii]
 gb|EFJ15871.1| hypothetical protein SELMODRAFT_117697 [Selaginella moellendorffii]
Length=521

 Score =   226 bits (577),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 109/148 (74%), Positives = 120/148 (81%), Gaps = 2/148 (1%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KEAG + DPLGDL+TE+ER+LG LV E+Y T+FYIL RYPLAVRPFYTMP  D+  YSNS
Sbjct  374  KEAGFETDPLGDLDTETERRLGLLVKERYKTDFYILHRYPLAVRPFYTMPAVDDPKYSNS  433

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTI--STYIDSFRYGAPPHGGFGVGL  198
            FDVFIRGEEIISGAQRVH  +LL KR EEC ID   I    YI+SF YGAPPHGG GVGL
Sbjct  434  FDVFIRGEEIISGAQRVHDKDLLLKRIEECNIDPNAIGLQNYINSFSYGAPPHGGIGVGL  493

Query  197  ERVVMLFCALNNIRKTSLFPRDPQRIAP  114
            ERV MLFC L+NIRK SLFPRDP R+AP
Sbjct  494  ERVAMLFCNLDNIRKASLFPRDPNRLAP  521



>ref|XP_002965575.1| hypothetical protein SELMODRAFT_84215 [Selaginella moellendorffii]
 gb|EFJ32995.1| hypothetical protein SELMODRAFT_84215 [Selaginella moellendorffii]
Length=521

 Score =   226 bits (576),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 109/148 (74%), Positives = 120/148 (81%), Gaps = 2/148 (1%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KEAG + DPLGDL+TE+ER+LG LV E+Y T+FYIL RYPLAVRPFYTMP  D+  YSNS
Sbjct  374  KEAGFETDPLGDLDTETERRLGLLVKERYKTDFYILHRYPLAVRPFYTMPAVDDPKYSNS  433

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTI--STYIDSFRYGAPPHGGFGVGL  198
            FDVFIRGEEIISGAQRVH  +LL KR EEC ID   I    YI+SF YGAPPHGG GVGL
Sbjct  434  FDVFIRGEEIISGAQRVHDKDLLLKRIEECNIDPNAIGLQNYINSFSYGAPPHGGIGVGL  493

Query  197  ERVVMLFCALNNIRKTSLFPRDPQRIAP  114
            ERV MLFC L+NIRK SLFPRDP R+AP
Sbjct  494  ERVAMLFCNLDNIRKVSLFPRDPNRLAP  521



>ref|XP_006409458.1| hypothetical protein EUTSA_v10023019mg [Eutrema salsugineum]
 gb|ESQ50911.1| hypothetical protein EUTSA_v10023019mg [Eutrema salsugineum]
Length=521

 Score =   225 bits (573),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 121/146 (83%), Gaps = 9/146 (6%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            K+AG++++PLGDLNTESERKLGQLVLEKY TEFY+L RYP AVRPFYTMP  D+S YSNS
Sbjct  385  KDAGVEINPLGDLNTESERKLGQLVLEKYNTEFYMLHRYPTAVRPFYTMPSGDDSRYSNS  444

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FD FIRGEEIISGAQRVH+PE L +RA E         TY     YG+PPHGGFG GLER
Sbjct  445  FDAFIRGEEIISGAQRVHIPEFLEERAGEF------FGTYD---WYGSPPHGGFGAGLER  495

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFCALNNIRKTSLFPRDPQR+AP
Sbjct  496  VVMLFCALNNIRKTSLFPRDPQRLAP  521



>ref|XP_003082076.1| OJ1717_A09.34 gene product (ISS) [Ostreococcus tauri]
 emb|CAL55879.1| Aminoacyl-tRNA synthetase, class II (D/K/N)-like [Ostreococcus 
tauri]
Length=542

 Score =   223 bits (569),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 125/146 (86%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            ++AG++VDPLGD+ TE+ER LG+LV EKYGT+FY+L RYP+  RPFYTMP  D+  Y+NS
Sbjct  397  QDAGVEVDPLGDIGTETERILGKLVKEKYGTDFYMLTRYPINARPFYTMPAPDDPNYTNS  456

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FD+FIRG+EIISGAQR+H P+LL +RA  CGI++ TI +YIDSF+YGA PHGG GVGLER
Sbjct  457  FDIFIRGQEIISGAQRIHDPKLLAERALACGIELPTIQSYIDSFKYGATPHGGCGVGLER  516

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  LNNIRKTS+FPRDP+RIAP
Sbjct  517  VAMLFLDLNNIRKTSMFPRDPKRIAP  542



>ref|XP_002509202.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO70460.1| predicted protein [Micromonas sp. RCC299]
Length=405

 Score =   219 bits (558),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 123/147 (84%), Gaps = 1/147 (1%)
 Frame = -2

Query  551  KEAGID-VDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSN  375
            KEAG++ VDPLGDL+TE ER LGQLV EKY T+FY+L +YP A RPFYTMP   +  YSN
Sbjct  259  KEAGVEGVDPLGDLSTEHERILGQLVKEKYDTDFYMLTKYPAAARPFYTMPDPADPDYSN  318

Query  374  SFDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLE  195
            S+D+FIRGEEIISGAQR+H P LLTKRA ECGI+V TI  YID+F+YGA PHGG GVGLE
Sbjct  319  SYDIFIRGEEIISGAQRIHDPALLTKRAVECGIEVDTIQAYIDAFKYGALPHGGCGVGLE  378

Query  194  RVVMLFCALNNIRKTSLFPRDPQRIAP  114
            RVVMLF  L NIRKTS+FPRDP+R+AP
Sbjct  379  RVVMLFLNLGNIRKTSMFPRDPRRLAP  405



>ref|XP_003061556.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH54186.1| predicted protein [Micromonas pusilla CCMP1545]
Length=448

 Score =   220 bits (560),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 103/140 (74%), Positives = 119/140 (85%), Gaps = 0/140 (0%)
 Frame = -2

Query  533  VDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNSFDVFIR  354
            VDPLGDL+TE ER LGQLV EKY T+FYIL +YPL  RPFYTMPC  +  Y+NSFD+FIR
Sbjct  309  VDPLGDLSTEQERVLGQLVKEKYDTDFYILHKYPLNARPFYTMPCPHDGDYTNSFDIFIR  368

Query  353  GEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLERVVMLFC  174
            GEEIISGAQR+H  ELL+KRA ECGI+++TI  YID+F+YGA PHGG GVGLERVVMLF 
Sbjct  369  GEEIISGAQRIHDVELLSKRAVECGIEIETIQAYIDAFKYGALPHGGCGVGLERVVMLFL  428

Query  173  ALNNIRKTSLFPRDPQRIAP  114
             L NIRKTS+FPRDP+R+AP
Sbjct  429  NLGNIRKTSMFPRDPRRLAP  448



>ref|XP_001420524.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98817.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=491

 Score =   219 bits (558),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 122/146 (84%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAG +VDPLGD+ TE+ER LG+LV EKYGT+FY+L RYPL  RPFYTMP  D+  Y+NS
Sbjct  346  QEAGEEVDPLGDIGTETERVLGRLVKEKYGTDFYMLTRYPLNARPFYTMPAPDDPNYTNS  405

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FD+FIRG+EIISGAQR+H P+LL +RAE CGI++ TI  YIDSF+YGA PHGG GVGLER
Sbjct  406  FDIFIRGQEIISGAQRIHDPKLLAERAEACGIELPTIQPYIDSFKYGAMPHGGCGVGLER  465

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  L NIRKTS+FPRDP+R+ P
Sbjct  466  VAMLFLNLPNIRKTSMFPRDPKRLTP  491



>gb|EYU29913.1| hypothetical protein MIMGU_mgv1a018492mg, partial [Erythranthe 
guttata]
Length=454

 Score =   217 bits (552),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 119/147 (81%), Gaps = 15/147 (10%)
 Frame = -2

Query  548  EAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNSF  369
            EAG++VDPLGDL+TE+ERKLGQL+LEKY TEFYIL  YPL+VRPFYTMP +D        
Sbjct  321  EAGVEVDPLGDLSTETERKLGQLILEKYDTEFYILYCYPLSVRPFYTMPSHD--------  372

Query  368  DVFIRGEEIISGAQRVHVPELLTKRAEECGIDV--KTISTYIDSFRYGAPPHGGFGVGLE  195
                 GEEIISG QRVHV +LL + A+ CGIDV  KTI+TYIDSFRYG  PHGGFGVGLE
Sbjct  373  -----GEEIISGGQRVHVADLLREHAQACGIDVTSKTIATYIDSFRYGTAPHGGFGVGLE  427

Query  194  RVVMLFCALNNIRKTSLFPRDPQRIAP  114
            RVVMLFCA NNIRKTSLFPRDPQRI P
Sbjct  428  RVVMLFCAPNNIRKTSLFPRDPQRIVP  454



>ref|XP_005648554.1| aspartyl-tRNA synthetase [Coccomyxa subellipsoidea C-169]
 gb|EIE24010.1| aspartyl-tRNA synthetase [Coccomyxa subellipsoidea C-169]
Length=506

 Score =   218 bits (555),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 125/146 (86%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAG + DPLGDL TE ER LG+++ EKY T+FYIL RYPLAVRPFYTMP  +++ YSNS
Sbjct  361  QEAGFEPDPLGDLTTELERNLGKIMKEKYNTDFYILYRYPLAVRPFYTMPDPEDARYSNS  420

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQRVH   LLT+RA+   I +++I +YI++F++GAPPHGGFGVGLER
Sbjct  421  FDVFIRGEEIISGAQRVHDAALLTERAQVHEIPLESIQSYINAFKFGAPPHGGFGVGLER  480

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVMLFC L+NIRKTSLFPRDP+R+ P
Sbjct  481  VVMLFCGLDNIRKTSLFPRDPKRLTP  506



>ref|XP_006848204.1| hypothetical protein AMTR_s00029p00241780 [Amborella trichopoda]
 gb|ERN09785.1| hypothetical protein AMTR_s00029p00241780 [Amborella trichopoda]
Length=681

 Score =   220 bits (561),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 97/146 (66%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAGI+ D LGDLN E+ERKLGQ+V +K+ T+FYIL RYPLA+RPFYT+PC DN+++  S
Sbjct  536  REAGIEADLLGDLNIETERKLGQIVRDKFNTDFYILHRYPLALRPFYTLPCSDNTSFGRS  595

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVF+RGEEIISG QR+H+P+LL  RA+ CGID    S Y+DSF YG P HGGFG GLER
Sbjct  596  FDVFMRGEEIISGGQRIHIPQLLVYRAKACGIDTNAFSDYLDSFWYGMPAHGGFGCGLER  655

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            +VMLFC L++IRK S FPRDP R+ P
Sbjct  656  LVMLFCGLDDIRKVSAFPRDPYRLTP  681



>gb|EYU31296.1| hypothetical protein MIMGU_mgv1a019826mg, partial [Erythranthe 
guttata]
Length=634

 Score =   215 bits (547),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 119/148 (80%), Gaps = 15/148 (10%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EA ++VDPLGDL+TE++RKLGQ +LEKY TEFYIL RYPL+VRPFYTMP +D       
Sbjct  500  QEASVEVDPLGDLSTETDRKLGQHILEKYDTEFYILYRYPLSVRPFYTMPSHD-------  552

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDV--KTISTYIDSFRYGAPPHGGFGVGL  198
                  GEE ISG QRVHV +LL +RA+ CGIDV  KTISTYIDSFRYG  PHGGFGVGL
Sbjct  553  ------GEETISGGQRVHVADLLRERAQACGIDVTSKTISTYIDSFRYGTAPHGGFGVGL  606

Query  197  ERVVMLFCALNNIRKTSLFPRDPQRIAP  114
            ERVVMLFCA NNIRKTSLFPRDPQRI P
Sbjct  607  ERVVMLFCAPNNIRKTSLFPRDPQRIVP  634



>ref|XP_007213075.1| hypothetical protein PRUPE_ppa021187mg, partial [Prunus persica]
 gb|EMJ14274.1| hypothetical protein PRUPE_ppa021187mg, partial [Prunus persica]
Length=359

 Score =   207 bits (526),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            K+AG++VDP+GDLNTE++RKLGQLVL+KYGTEFYIL  YPLA+RPFYTMPC+ NSAYSNS
Sbjct  231  KDAGVEVDPMGDLNTEAKRKLGQLVLDKYGTEFYILHWYPLAIRPFYTMPCHYNSAYSNS  290

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FDVFIRGEEIISGAQR H P+LL K A+ CGI++KTISTYID+ R G   HGGFG GLER
Sbjct  291  FDVFIRGEEIISGAQREHRPKLLEKIAQACGIELKTISTYIDAIRNGVTLHGGFGAGLER  350

Query  191  VVMLF  177
            VVMLF
Sbjct  351  VVMLF  355



>emb|CDS30263.1| aspartyl tRNA synthetase, cytoplasmic [Hymenolepis microstoma]
Length=518

 Score =   208 bits (529),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/146 (66%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KEAG DV    DL+T +E+ LG+LV EKYGT+FYIL ++PLA+RPFYTMP   N   SNS
Sbjct  373  KEAGWDVGEYDDLSTPAEKFLGKLVKEKYGTDFYILDKFPLAIRPFYTMPDPHNEKVSNS  432

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D F+RGEEI+SGAQR+H PE LT+RA+  GIDV+TI +YIDSFRYG PPH G G+GLER
Sbjct  433  YDFFMRGEEIMSGAQRIHDPEFLTERAKHHGIDVQTIQSYIDSFRYGCPPHAGGGIGLER  492

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  L+NIRK S+FPRDP+R+AP
Sbjct  493  VTMLFLGLDNIRKVSMFPRDPKRLAP  518



>emb|CBJ31343.1| Aspartyl-tRNA Synthetase [Ectocarpus siliculosus]
Length=614

 Score =   209 bits (532),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 118/145 (81%), Gaps = 0/145 (0%)
 Frame = -2

Query  548  EAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNSF  369
            +AG D DPLGDL+TE E+KLG LV EKYGT+F+++ +YPL VRPFYTMPC  N  +SNSF
Sbjct  470  DAGYDADPLGDLSTEHEKKLGDLVAEKYGTDFFMMDKYPLDVRPFYTMPCPSNPKHSNSF  529

Query  368  DVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLERV  189
            D+FIRGEEI+SGAQR+H  E L +RA E  I + +I +Y+D+F++GA PHGG G+GLERV
Sbjct  530  DIFIRGEEIVSGAQRIHDLEFLKERAREHDIPLDSIMSYLDAFKHGAEPHGGGGIGLERV  589

Query  188  VMLFCALNNIRKTSLFPRDPQRIAP  114
            VMLF  L NIRKTS+FPRDP+R AP
Sbjct  590  VMLFLGLKNIRKTSMFPRDPKRCAP  614



>gb|EJK74501.1| hypothetical protein THAOC_03817 [Thalassiosira oceanica]
Length=631

 Score =   209 bits (531),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 97/146 (66%), Positives = 121/146 (83%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAG+D     DL+TE+E+KLG LV EKY T+FYI+ +YPL+VRPFYTMP  +N   SNS
Sbjct  486  REAGVDQGDYEDLSTENEKKLGDLVKEKYNTDFYIMDKYPLSVRPFYTMPDPNNPKLSNS  545

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+FIRG+EI+SGAQRVH PE + KRA+E G+DV TI++YIDSFR GA PHGG G+GLER
Sbjct  546  YDIFIRGQEILSGAQRVHEPEFIEKRAKEWGLDVSTITSYIDSFRNGALPHGGGGIGLER  605

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVML+  L NIRKTS+FPRDP+RI+P
Sbjct  606  VVMLYLGLPNIRKTSMFPRDPKRISP  631



>gb|EUB65062.1| Aspartyl-tRNA synthetase, cytoplasmic [Echinococcus granulosus]
 emb|CDS15377.1| aspartyl tRNA synthetase cytoplasmic [Echinococcus granulosus]
Length=514

 Score =   206 bits (525),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 96/146 (66%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAG DV+   DL+T +E+ LG+LV EKY T+FYIL ++PLA+RPFYTMP   N A SNS
Sbjct  369  REAGWDVEEFADLSTPAEKFLGKLVKEKYRTDFYILDKFPLAIRPFYTMPDPHNKALSNS  428

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D F+RGEEI+SGAQRVH PE LT+RA+   ID+KTI +YIDSFRYG PPH G G+GLER
Sbjct  429  YDFFMRGEEIMSGAQRVHDPEFLTERAKAHDIDIKTIQSYIDSFRYGCPPHAGGGIGLER  488

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  L+NIRK S+FPRDP+R+AP
Sbjct  489  VTMLFLGLDNIRKVSMFPRDPKRLAP  514



>ref|XP_003384922.2| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Amphimedon 
queenslandica]
Length=532

 Score =   206 bits (525),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 96/146 (66%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            + AG D+    DL+T +E+ LG+LV EKY T+FYIL +YPLAVRPFYTMP   +S YSNS
Sbjct  387  RAAGTDIGDEDDLSTPNEKLLGRLVKEKYDTDFYILDKYPLAVRPFYTMPDPHSSIYSNS  446

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H PE LT+RA   GID++ I +YIDSFR+GAPPH G G+GLER
Sbjct  447  YDIFMRGEEIMSGAQRIHDPEFLTERATHHGIDLQKIKSYIDSFRFGAPPHAGGGIGLER  506

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  LNNIRKTSLFPRDP+R+ P
Sbjct  507  VCMLFLGLNNIRKTSLFPRDPKRLTP  532



>emb|CDJ02923.1| aspartyl tRNA synthetase, cytoplasmic [Echinococcus multilocularis]
 emb|CDS40205.1| aspartyl tRNA synthetase, cytoplasmic [Echinococcus multilocularis]
Length=514

 Score =   206 bits (523),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 96/146 (66%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAG DV+   DL+T +E+ LG+LV EKY T+FYIL ++PLA+RPFYTMP   N A SNS
Sbjct  369  REAGWDVEEFADLSTPAEKFLGKLVKEKYKTDFYILDKFPLAIRPFYTMPDPLNKALSNS  428

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D F+RGEEI+SGAQRVH PE LT+RA+   ID+KTI +YIDSFRYG PPH G G+GLER
Sbjct  429  YDFFMRGEEIMSGAQRVHDPEFLTERAKAHDIDIKTIQSYIDSFRYGCPPHAGGGIGLER  488

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  L+NIRK S+FPRDP+R+AP
Sbjct  489  VTMLFLGLDNIRKVSMFPRDPKRLAP  514



>ref|XP_003740658.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Metaseiulus 
occidentalis]
Length=535

 Score =   205 bits (522),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 121/146 (83%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            + AGI+++   DL+T +E+ LG+LV  KY T+FYIL ++PLAVRPFYTMP  +N+ +SNS
Sbjct  390  RSAGIEMEDDEDLSTPNEKLLGRLVKAKYNTDFYILDKFPLAVRPFYTMPDPENTKWSNS  449

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEIISGAQR+H PE L +RA++ GIDV  I +YIDSFRYGAPPH G G+GLER
Sbjct  450  YDMFMRGEEIISGAQRIHDPEFLMQRAKQHGIDVSQIKSYIDSFRYGAPPHAGGGIGLER  509

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVML+  L+NIRKTS+FPRDP+R+ P
Sbjct  510  VVMLYLGLDNIRKTSMFPRDPKRLTP  535



>ref|XP_006727730.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Leptonychotes 
weddellii]
Length=348

 Score =   200 bits (508),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAGI++    DL+T +E+ LG+LV EKY T+FYIL +YPLAVRPFYTMP   N   SNS
Sbjct  203  REAGIEMGDEEDLSTPNEKLLGRLVKEKYDTDFYILDKYPLAVRPFYTMPDPRNPKQSNS  262

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA   GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  263  YDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  322

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  L+N+R+TS+FPRDP+R+ P
Sbjct  323  VTMLFLGLHNVRQTSMFPRDPKRLTP  348



>ref|XP_008141705.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic isoform X2 [Eptesicus 
fuscus]
Length=401

 Score =   200 bits (509),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAGI++    DL+T +E+ LG+LV EKY T+FYIL +YPLAVRPFYTMP   NS  SNS
Sbjct  256  REAGIEMGDEEDLSTPNEKLLGRLVKEKYDTDFYILDKYPLAVRPFYTMPDPRNSKQSNS  315

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA   GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  316  YDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  375

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  L+NIR+TS+FPRDP+R+ P
Sbjct  376  VTMLFLGLHNIRQTSMFPRDPKRLTP  401



>ref|XP_007509366.1| aspartyl-tRNA synthetase [Bathycoccus prasinos]
 emb|CCO19169.1| aspartyl-tRNA synthetase [Bathycoccus prasinos]
Length=537

 Score =   203 bits (516),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 119/147 (81%), Gaps = 2/147 (1%)
 Frame = -2

Query  548  EAGI-DVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPC-YDNSAYSN  375
            EAGI + DP GDL+TE ER LG+LV EKY T+FYIL RYP+  RPFYTMP    N  Y+N
Sbjct  391  EAGITEADPHGDLSTEHERILGKLVKEKYDTDFYILTRYPIEARPFYTMPEPGANPEYTN  450

Query  374  SFDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLE  195
            SFDVFIRGEEIISGAQR+H PELLT+RA+  GI V+ + +YI SFRYGA PHGG GVGLE
Sbjct  451  SFDVFIRGEEIISGAQRIHDPELLTERAKHFGIPVEELESYIRSFRYGALPHGGCGVGLE  510

Query  194  RVVMLFCALNNIRKTSLFPRDPQRIAP  114
            RVVML+  LNNIRK+S+FPRDP+R+ P
Sbjct  511  RVVMLYLGLNNIRKSSMFPRDPKRLTP  537



>ref|XP_007570419.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic [Poecilia formosa]
Length=531

 Score =   202 bits (515),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 121/146 (83%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAG+++    DL+T +E+ LG+LV EKY T+FY+L +YPLAVRPFYTMP  +N  YSNS
Sbjct  386  REAGVEMGDEDDLSTPNEKLLGRLVKEKYDTDFYVLDKYPLAVRPFYTMPDPNNPKYSNS  445

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQRVH P+LLT+RA    ID++ I +YIDSFRYGAPPHGG G+GLER
Sbjct  446  YDMFMRGEEILSGAQRVHDPQLLTERALHHQIDLEKIKSYIDSFRYGAPPHGGGGIGLER  505

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V ML+  L+N+R+TS+FPRDP+R+ P
Sbjct  506  VCMLYLGLHNVRQTSMFPRDPKRLTP  531



>ref|XP_008401396.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic [Poecilia reticulata]
Length=531

 Score =   202 bits (515),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 121/146 (83%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAG+++    DL+T +E+ LG+LV EKY T+FY+L +YPLAVRPFYTMP  +N  YSNS
Sbjct  386  REAGVEMGDEDDLSTPNEKLLGRLVKEKYDTDFYVLDKYPLAVRPFYTMPDPNNPKYSNS  445

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQRVH P+LLT+RA    ID++ I +YIDSFRYGAPPHGG G+GLER
Sbjct  446  YDMFMRGEEILSGAQRVHDPQLLTERALHHQIDLEKIKSYIDSFRYGAPPHGGGGIGLER  505

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V ML+  L+N+R+TS+FPRDP+R+ P
Sbjct  506  VCMLYLGLHNVRQTSMFPRDPKRLTP  531



>ref|XP_006773157.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic [Myotis davidii]
Length=501

 Score =   202 bits (513),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAGI++    DL+T +E+ LG+LV EKY T+FYIL +YPLAVRPFYTMP   NS  SNS
Sbjct  356  REAGIEMGDEEDLSTPNEKLLGRLVKEKYDTDFYILDKYPLAVRPFYTMPDPRNSKQSNS  415

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA   GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  416  YDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  475

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  L+NIR+TS+FPRDP+R+ P
Sbjct  476  VTMLFLGLHNIRQTSMFPRDPKRLTP  501



>ref|XP_006100496.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic [Myotis lucifugus]
Length=501

 Score =   202 bits (513),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAGI++    DL+T +E+ LG+LV EKY T+FYIL +YPLAVRPFYTMP   NS  SNS
Sbjct  356  REAGIEMGDEEDLSTPNEKLLGRLVKEKYDTDFYILDKYPLAVRPFYTMPDPRNSKQSNS  415

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA   GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  416  YDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  475

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  L+NIR+TS+FPRDP+R+ P
Sbjct  476  VTMLFLGLHNIRQTSMFPRDPKRLTP  501



>ref|XP_008141704.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic isoform X1 [Eptesicus 
fuscus]
Length=501

 Score =   202 bits (513),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAGI++    DL+T +E+ LG+LV EKY T+FYIL +YPLAVRPFYTMP   NS  SNS
Sbjct  356  REAGIEMGDEEDLSTPNEKLLGRLVKEKYDTDFYILDKYPLAVRPFYTMPDPRNSKQSNS  415

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA   GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  416  YDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  475

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  L+NIR+TS+FPRDP+R+ P
Sbjct  476  VTMLFLGLHNIRQTSMFPRDPKRLTP  501



>ref|XP_005862923.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic [Myotis brandtii]
Length=501

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAGI++    DL+T +E+ LG+LV EKY T+FYIL +YPLAVRPFYTMP   NS  SNS
Sbjct  356  REAGIEMGDEEDLSTPNEKLLGRLVKEKYDTDFYILDKYPLAVRPFYTMPDPRNSKQSNS  415

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA   GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  416  YDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  475

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  L+NIR+TS+FPRDP+R+ P
Sbjct  476  VTMLFLGLHNIRQTSMFPRDPKRLTP  501



>gb|AAY15029.1| unknown [Homo sapiens]
Length=313

 Score =   196 bits (499),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 117/146 (80%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAG+++    DL+T +E+ LG LV EKY T+FYIL +YPLAVRPFYTMP   N   SNS
Sbjct  168  REAGVEMGDEDDLSTPNEKLLGHLVKEKYDTDFYILDKYPLAVRPFYTMPDPRNPKQSNS  227

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA   GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  228  YDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  287

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  L+N+R+TS+FPRDP+R+ P
Sbjct  288  VTMLFLGLHNVRQTSMFPRDPKRLTP  313



>ref|XP_004616570.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like isoform X2 
[Sorex araneus]
Length=401

 Score =   199 bits (505),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAGI++    DL+T +E+ LG+LV EKY T+F++L +YPLAVRPFYTMP   NS  SNS
Sbjct  256  REAGIEMGDEEDLSTPNEKLLGRLVKEKYDTDFFVLDKYPLAVRPFYTMPDPKNSKQSNS  315

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA   GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  316  YDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  375

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  L+NIR+TS+FPRDP+R+ P
Sbjct  376  VTMLFLGLHNIRQTSMFPRDPKRLTP  401



>ref|XP_005095117.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Aplysia 
californica]
Length=529

 Score =   202 bits (513),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 121/146 (83%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            K+AG++++   DL+T +E+ LG+LV  KY T+F+IL ++PLAVRPFYTMP   ++ +SNS
Sbjct  384  KKAGVEMEDDEDLSTPNEKLLGRLVKAKYDTDFFILDKFPLAVRPFYTMPDPHDNKWSNS  443

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H PE LTKRA+E G+D++ I  YIDSFRYGAPPH G G+GLER
Sbjct  444  YDMFMRGEEILSGAQRIHDPEFLTKRAKEHGVDIEHIKGYIDSFRYGAPPHAGGGIGLER  503

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V ML+  L+NIRKTSLFPRDP+R+ P
Sbjct  504  VTMLYLGLDNIRKTSLFPRDPKRLTP  529



>ref|NP_001080336.1| aspartyl-tRNA synthetase [Xenopus laevis]
 gb|AAH42227.1| Dars-prov protein [Xenopus laevis]
Length=530

 Score =   202 bits (513),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAG+++    DL+T +E+ LG+LV EKY T+FYIL +YPLAVRPFYTMP  +N  YSNS
Sbjct  385  REAGVEMGDEEDLSTPNEKLLGRLVKEKYDTDFYILDKYPLAVRPFYTMPDPNNPKYSNS  444

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQRVH P+LLT RA   GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  445  YDMFMRGEEILSGAQRVHDPQLLTDRATHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  504

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V ML+  L+N+R+TS+FPRDP+R+ P
Sbjct  505  VTMLYLGLHNVRQTSMFPRDPKRLTP  530



>ref|NP_001085490.1| aspartyl-tRNA synthetase [Xenopus laevis]
 gb|AAH72839.1| MGC80207 protein [Xenopus laevis]
Length=530

 Score =   202 bits (513),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAG+++    DL+T +E+ LG+LV EKY T+FYIL +YPLAVRPFYTMP   N  YSNS
Sbjct  385  REAGVEMGDEEDLSTPNEKLLGRLVKEKYDTDFYILDKYPLAVRPFYTMPDPQNPKYSNS  444

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQRVH P+LLT+RA   GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  445  YDMFMRGEEILSGAQRVHDPQLLTERATHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  504

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V ML+  L+N+R+TS+FPRDP+R+ P
Sbjct  505  VTMLYLGLHNVRQTSMFPRDPKRLTP  530



>ref|NP_001279392.1| aspartyl-tRNA synthetase [Callorhinchus milii]
 gb|AFK10795.1| aspartyl-tRNA synthetase [Callorhinchus milii]
Length=528

 Score =   201 bits (512),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KEAG+++    DL+T +E+ LG+LV EKY T+FY+L +YPLAVRPFYTMP    + YSNS
Sbjct  383  KEAGVEMGDEEDLSTPNEKLLGRLVKEKYDTDFYVLDKYPLAVRPFYTMPDPHTAKYSNS  442

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT RA   GIDV+ I +YIDSFR+GAPPH G G+GLER
Sbjct  443  YDMFMRGEEILSGAQRIHDPQLLTDRALHLGIDVEKIKSYIDSFRFGAPPHAGGGIGLER  502

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V ML+  L+N+R+TS+FPRDP+R+ P
Sbjct  503  VTMLYLGLHNVRQTSMFPRDPKRLTP  528



>gb|EPQ05648.1| Aspartyl-tRNA synthetase, cytoplasmic [Myotis brandtii]
Length=505

 Score =   201 bits (511),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAGI++    DL+T +E+ LG+LV EKY T+FYIL +YPLAVRPFYTMP   NS  SNS
Sbjct  360  REAGIEMGDEEDLSTPNEKLLGRLVKEKYDTDFYILDKYPLAVRPFYTMPDPRNSKQSNS  419

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA   GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  420  YDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  479

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  L+NIR+TS+FPRDP+R+ P
Sbjct  480  VTMLFLGLHNIRQTSMFPRDPKRLTP  505



>ref|XP_009945209.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic [Leptosomus discolor]
Length=468

 Score =   200 bits (509),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 120/146 (82%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAG+++    DL+T +E+ LG+LV EKY T+FYIL +YPLAVRPFYTMP   N  YSNS
Sbjct  323  REAGVEMGDEEDLSTPNEKLLGRLVKEKYDTDFYILDKYPLAVRPFYTMPDPVNPKYSNS  382

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA+  GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  383  YDMFMRGEEILSGAQRIHDPQLLTERAQHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  442

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V ML+  L+N+R+TS+FPRDP+R+ P
Sbjct  443  VTMLYLGLHNVRQTSMFPRDPKRLTP  468



>ref|XP_003962102.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Takifugu 
rubripes]
Length=530

 Score =   201 bits (512),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 121/146 (83%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAG+++    DL+T +E+ LG+LV EKY T+FY+L +YPLAVRPFYTMP  +N  YSNS
Sbjct  385  REAGVEMGDEEDLSTPNEKLLGRLVKEKYDTDFYVLDKYPLAVRPFYTMPDPNNMKYSNS  444

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQRVH P+LLT+RA    ID++ I +YIDSFR+GAPPHGG G+GLER
Sbjct  445  YDMFMRGEEILSGAQRVHDPQLLTERAMHHQIDLEKIKSYIDSFRFGAPPHGGGGIGLER  504

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V ML+  L+N+R+TS+FPRDP+R+ P
Sbjct  505  VCMLYLGLHNVRQTSMFPRDPKRLTP  530



>gb|KFV00090.1| Aspartate--tRNA ligase, cytoplasmic, partial [Pterocles gutturalis]
Length=460

 Score =   200 bits (508),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 120/146 (82%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAG+++    DL+T +E+ LG+LV EKY T+FYIL +YPLAVRPFYTMP   N  YSNS
Sbjct  315  REAGVEMGDEEDLSTPNEKLLGRLVKEKYDTDFYILDKYPLAVRPFYTMPDPVNPKYSNS  374

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA+  GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  375  YDMFMRGEEILSGAQRIHDPQLLTERAQHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  434

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V ML+  L+N+R+TS+FPRDP+R+ P
Sbjct  435  VTMLYLGLHNVRQTSMFPRDPKRLTP  460



>ref|XP_010078250.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic [Pterocles gutturalis]
Length=468

 Score =   200 bits (509),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 120/146 (82%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAG+++    DL+T +E+ LG+LV EKY T+FYIL +YPLAVRPFYTMP   N  YSNS
Sbjct  323  REAGVEMGDEEDLSTPNEKLLGRLVKEKYDTDFYILDKYPLAVRPFYTMPDPVNPKYSNS  382

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA+  GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  383  YDMFMRGEEILSGAQRIHDPQLLTERAQHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  442

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V ML+  L+N+R+TS+FPRDP+R+ P
Sbjct  443  VTMLYLGLHNVRQTSMFPRDPKRLTP  468



>ref|XP_009565947.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic [Cuculus canorus]
Length=468

 Score =   200 bits (509),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 120/146 (82%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAG+++    DL+T +E+ LG+LV EKY T+FYIL +YPLAVRPFYTMP   N  YSNS
Sbjct  323  REAGVEMGDEEDLSTPNEKLLGRLVKEKYDTDFYILDKYPLAVRPFYTMPDPVNLKYSNS  382

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA+  GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  383  YDMFMRGEEILSGAQRIHDPQLLTERAQHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  442

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V ML+  L+N+R+TS+FPRDP+R+ P
Sbjct  443  VTMLYLGLHNVRQTSMFPRDPKRLTP  468



>gb|KFQ06975.1| Aspartate--tRNA ligase, cytoplasmic, partial [Leptosomus discolor]
Length=460

 Score =   200 bits (508),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 120/146 (82%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAG+++    DL+T +E+ LG+LV EKY T+FYIL +YPLAVRPFYTMP   N  YSNS
Sbjct  315  REAGVEMGDEEDLSTPNEKLLGRLVKEKYDTDFYILDKYPLAVRPFYTMPDPVNPKYSNS  374

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA+  GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  375  YDMFMRGEEILSGAQRIHDPQLLTERAQHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  434

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V ML+  L+N+R+TS+FPRDP+R+ P
Sbjct  435  VTMLYLGLHNVRQTSMFPRDPKRLTP  460



>gb|KFO81148.1| Aspartate--tRNA ligase, cytoplasmic, partial [Cuculus canorus]
Length=460

 Score =   200 bits (508),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 120/146 (82%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAG+++    DL+T +E+ LG+LV EKY T+FYIL +YPLAVRPFYTMP   N  YSNS
Sbjct  315  REAGVEMGDEEDLSTPNEKLLGRLVKEKYDTDFYILDKYPLAVRPFYTMPDPVNLKYSNS  374

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA+  GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  375  YDMFMRGEEILSGAQRIHDPQLLTERAQHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  434

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V ML+  L+N+R+TS+FPRDP+R+ P
Sbjct  435  VTMLYLGLHNVRQTSMFPRDPKRLTP  460



>dbj|BAE88209.1| unnamed protein product [Macaca fascicularis]
Length=246

 Score =   194 bits (492),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 116/146 (79%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAG+++    DL+T +E+ LG LV EKY T+FYIL +YPLAVRPFYTMP   N   SNS
Sbjct  101  REAGVEMGDEDDLSTPNEKLLGHLVKEKYDTDFYILDKYPLAVRPFYTMPDPRNPKQSNS  160

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+R    GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  161  YDMFMRGEEILSGAQRIHDPQLLTERTLHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  220

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  L+N+R+TS+FPRDP+R+ P
Sbjct  221  VTMLFLGLHNVRQTSMFPRDPKRLTP  246



>ref|XP_006249746.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic isoform X1 [Rattus 
norvegicus]
Length=468

 Score =   200 bits (508),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAG+++D   DL+T +E+ LG+LV EKY T+FY+L +YPLAVRPFYTMP   N   SNS
Sbjct  323  REAGVEMDDEEDLSTPNEKLLGRLVKEKYDTDFYVLDKYPLAVRPFYTMPDPRNPKQSNS  382

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA   GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  383  YDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  442

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  L+N+R+TS+FPRDP+R+ P
Sbjct  443  VTMLFLGLHNVRQTSMFPRDPKRLTP  468



>ref|XP_009874320.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic [Apaloderma vittatum]
Length=318

 Score =   196 bits (498),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAG+++    DL+T +E+ LG+LV EKY T+FYIL +YPLAVRPFYTMP   N   SNS
Sbjct  173  REAGVEMGDEEDLSTPNEKLLGRLVKEKYDTDFYILDKYPLAVRPFYTMPDPVNPKNSNS  232

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA+  GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  233  YDMFMRGEEILSGAQRIHDPQLLTERAQHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  292

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V ML+  L+N+R+TS+FPRDP+R+ P
Sbjct  293  VTMLYLGLHNVRQTSMFPRDPKRLTP  318



>gb|KFP79070.1| Aspartate--tRNA ligase, cytoplasmic, partial [Apaloderma vittatum]
Length=313

 Score =   196 bits (497),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAG+++    DL+T +E+ LG+LV EKY T+FYIL +YPLAVRPFYTMP   N   SNS
Sbjct  168  REAGVEMGDEEDLSTPNEKLLGRLVKEKYDTDFYILDKYPLAVRPFYTMPDPVNPKNSNS  227

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA+  GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  228  YDMFMRGEEILSGAQRIHDPQLLTERAQHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  287

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V ML+  L+N+R+TS+FPRDP+R+ P
Sbjct  288  VTMLYLGLHNVRQTSMFPRDPKRLTP  313



>gb|ELK04585.1| Aspartyl-tRNA synthetase, cytoplasmic [Pteropus alecto]
Length=468

 Score =   200 bits (508),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 95/146 (65%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAGI++    DL+T +E+ LG+LV EKY T+FYIL +YPLAVRPFYTMP   N   SNS
Sbjct  323  REAGIEMGDEEDLSTPNEKLLGRLVKEKYDTDFYILDKYPLAVRPFYTMPDPRNPKQSNS  382

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQRVH P+LLT+RA   GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  383  YDMFMRGEEILSGAQRVHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  442

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  L+NIR+TSLFPRDP+R+ P
Sbjct  443  VTMLFLGLHNIRQTSLFPRDPKRLTP  468



>gb|KFO22727.1| Aspartyl-tRNA synthetase, cytoplasmic, partial [Fukomys damarensis]
Length=460

 Score =   199 bits (507),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAG++++   DL+T +E+ LG+LV EKY T+FYIL +YPLAVRPFYTMP   N   SNS
Sbjct  315  REAGVEMEDEEDLSTPNEKLLGRLVKEKYDTDFYILDKYPLAVRPFYTMPDPRNPKQSNS  374

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA   GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  375  YDMFMRGEEILSGAQRIHDPQLLTERASHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  434

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  L+N+R+TS+FPRDP+R+ P
Sbjct  435  VTMLFLGLHNVRQTSMFPRDPKRLTP  460



>emb|CDQ57315.1| unnamed protein product [Oncorhynchus mykiss]
Length=309

 Score =   195 bits (496),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 89/146 (61%), Positives = 120/146 (82%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAG+++    DL+T +E+ LG+LV EKY T+FY+L +YPLAVRPFYTMP  ++  YSNS
Sbjct  164  REAGVEMGDEEDLSTPNEKLLGRLVKEKYDTDFYVLDKYPLAVRPFYTMPDPNDKKYSNS  223

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H  +LLT+RA    ID++ I +YIDSFRYGAPPHGG G+GLER
Sbjct  224  YDMFMRGEEILSGAQRIHNAQLLTERAMHHNIDLEKIKSYIDSFRYGAPPHGGGGIGLER  283

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V ML+  L+N+R+TS+FPRDP+R+ P
Sbjct  284  VCMLYLGLHNVRQTSMFPRDPKRLTP  309



>ref|XP_010604451.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic [Fukomys damarensis]
Length=501

 Score =   200 bits (509),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAG++++   DL+T +E+ LG+LV EKY T+FYIL +YPLAVRPFYTMP   N   SNS
Sbjct  356  REAGVEMEDEEDLSTPNEKLLGRLVKEKYDTDFYILDKYPLAVRPFYTMPDPRNPKQSNS  415

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA   GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  416  YDMFMRGEEILSGAQRIHDPQLLTERASHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  475

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  L+N+R+TS+FPRDP+R+ P
Sbjct  476  VTMLFLGLHNVRQTSMFPRDPKRLTP  501



>ref|XP_009970796.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic, partial [Tyto 
alba]
 gb|KFV40890.1| Aspartate--tRNA ligase, cytoplasmic, partial [Tyto alba]
Length=313

 Score =   195 bits (496),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAG+++    DL+T +E+ LG+LV EKY T+FYIL +YPLAVRPFYTMP   N   SNS
Sbjct  168  REAGVEMGDEEDLSTPNEKLLGRLVKEKYDTDFYILDKYPLAVRPFYTMPDPVNPKNSNS  227

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA+  GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  228  YDMFMRGEEILSGAQRIHDPQLLTERAQHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  287

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V ML+  L+N+R+TS+FPRDP+R+ P
Sbjct  288  VTMLYLGLHNVRQTSMFPRDPKRLTP  313



>gb|AAH08638.1| Aspartyl-tRNA synthetase [Mus musculus]
Length=501

 Score =   200 bits (509),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAG+++D   DL+T +E+ LG+LV EKY T+FY+L +YPLAVRPFYTMP   N   SNS
Sbjct  356  REAGVEMDDEEDLSTPNEKLLGRLVKEKYDTDFYVLDKYPLAVRPFYTMPDPRNPKQSNS  415

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA   GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  416  YDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  475

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  L+N+R+TS+FPRDP+R+ P
Sbjct  476  VTMLFLGLHNVRQTSMFPRDPKRLTP  501



>ref|NP_446251.1| aspartate--tRNA ligase, cytoplasmic [Rattus norvegicus]
 sp|P15178.1|SYDC_RAT RecName: Full=Aspartate--tRNA ligase, cytoplasmic; AltName: Full=Aspartyl-tRNA 
synthetase; Short=AspRS [Rattus norvegicus]
 gb|AAA40789.1| aspartyl-tRNA synthetase [Rattus norvegicus]
 gb|AAC52981.1| aspartyl-tRNA synthetase [Rattus norvegicus]
 gb|AAH72534.1| Dars protein [Rattus norvegicus]
 gb|EDM09873.1| rCG46287 [Rattus norvegicus]
 dbj|BAF94235.1| aspartyl-tRNA synthetase [Rattus norvegicus]
 dbj|BAF94255.1| aspartyl-tRNA synthetase [Rattus norvegicus]
Length=501

 Score =   200 bits (509),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAG+++D   DL+T +E+ LG+LV EKY T+FY+L +YPLAVRPFYTMP   N   SNS
Sbjct  356  REAGVEMDDEEDLSTPNEKLLGRLVKEKYDTDFYVLDKYPLAVRPFYTMPDPRNPKQSNS  415

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA   GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  416  YDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  475

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  L+N+R+TS+FPRDP+R+ P
Sbjct  476  VTMLFLGLHNVRQTSMFPRDPKRLTP  501



>dbj|BAC36851.1| unnamed protein product [Mus musculus]
Length=501

 Score =   200 bits (509),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAG+++D   DL+T +E+ LG+LV EKY T+FY+L +YPLAVRPFYTMP   N   SNS
Sbjct  356  REAGVEMDDEEDLSTPNEKLLGRLVKEKYDTDFYVLDKYPLAVRPFYTMPDPRNPKQSNS  415

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA   GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  416  YDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  475

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  L+N+R+TS+FPRDP+R+ P
Sbjct  476  VTMLFLGLHNVRQTSMFPRDPKRLTP  501



>ref|NP_803228.2| aspartate--tRNA ligase, cytoplasmic isoform 1 [Mus musculus]
 sp|Q922B2.2|SYDC_MOUSE RecName: Full=Aspartate--tRNA ligase, cytoplasmic; AltName: Full=Aspartyl-tRNA 
synthetase; Short=AspRS [Mus musculus]
 dbj|BAE31847.1| unnamed protein product [Mus musculus]
 dbj|BAE31881.1| unnamed protein product [Mus musculus]
 dbj|BAE41327.1| unnamed protein product [Mus musculus]
 dbj|BAE30045.1| unnamed protein product [Mus musculus]
 dbj|BAE30780.1| unnamed protein product [Mus musculus]
 dbj|BAE31110.1| unnamed protein product [Mus musculus]
 dbj|BAE31315.1| unnamed protein product [Mus musculus]
Length=501

 Score =   200 bits (509),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAG+++D   DL+T +E+ LG+LV EKY T+FY+L +YPLAVRPFYTMP   N   SNS
Sbjct  356  REAGVEMDDEEDLSTPNEKLLGRLVKEKYDTDFYVLDKYPLAVRPFYTMPDPRNPKQSNS  415

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA   GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  416  YDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  475

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  L+N+R+TS+FPRDP+R+ P
Sbjct  476  VTMLFLGLHNVRQTSMFPRDPKRLTP  501



>dbj|BAE41011.1| unnamed protein product [Mus musculus]
Length=501

 Score =   200 bits (509),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAG+++D   DL+T +E+ LG+LV EKY T+FY+L +YPLAVRPFYTMP   N   SNS
Sbjct  356  REAGVEMDDEEDLSTPNEKLLGRLVKEKYDTDFYVLDKYPLAVRPFYTMPDPRNPKQSNS  415

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA   GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  416  YDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  475

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  L+N+R+TS+FPRDP+R+ P
Sbjct  476  VTMLFLGLHNVRQTSMFPRDPKRLTP  501



>dbj|BAE27102.1| unnamed protein product [Mus musculus]
Length=501

 Score =   200 bits (509),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAG+++D   DL+T +E+ LG+LV EKY T+FY+L +YPLAVRPFYTMP   N   SNS
Sbjct  356  REAGVEMDDEEDLSTPNEKLLGRLVKEKYDTDFYVLDKYPLAVRPFYTMPDPRNPKQSNS  415

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA   GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  416  YDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  475

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  L+N+R+TS+FPRDP+R+ P
Sbjct  476  VTMLFLGLHNVRQTSMFPRDPKRLTP  501



>dbj|BAE38517.1| unnamed protein product [Mus musculus]
Length=501

 Score =   200 bits (509),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAG+++D   DL+T +E+ LG+LV EKY T+FY+L +YPLAVRPFYTMP   N   SNS
Sbjct  356  REAGVEMDDEEDLSTPNEKLLGRLVKEKYDTDFYVLDKYPLAVRPFYTMPDPRNPKQSNS  415

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA   GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  416  YDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  475

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  L+N+R+TS+FPRDP+R+ P
Sbjct  476  VTMLFLGLHNVRQTSMFPRDPKRLTP  501



>ref|XP_004616569.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like isoform X1 
[Sorex araneus]
Length=501

 Score =   200 bits (508),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAGI++    DL+T +E+ LG+LV EKY T+F++L +YPLAVRPFYTMP   NS  SNS
Sbjct  356  REAGIEMGDEEDLSTPNEKLLGRLVKEKYDTDFFVLDKYPLAVRPFYTMPDPKNSKQSNS  415

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA   GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  416  YDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  475

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  L+NIR+TS+FPRDP+R+ P
Sbjct  476  VTMLFLGLHNIRQTSMFPRDPKRLTP  501



>ref|XP_006921100.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic isoform X1 [Pteropus 
alecto]
 ref|XP_006921101.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic isoform X2 [Pteropus 
alecto]
Length=501

 Score =   200 bits (508),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 95/146 (65%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAGI++    DL+T +E+ LG+LV EKY T+FYIL +YPLAVRPFYTMP   N   SNS
Sbjct  356  REAGIEMGDEEDLSTPNEKLLGRLVKEKYDTDFYILDKYPLAVRPFYTMPDPRNPKQSNS  415

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQRVH P+LLT+RA   GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  416  YDMFMRGEEILSGAQRVHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  475

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  L+NIR+TSLFPRDP+R+ P
Sbjct  476  VTMLFLGLHNIRQTSLFPRDPKRLTP  501



>ref|XP_006618426.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Apis dorsata]
Length=403

 Score =   197 bits (502),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 92/145 (63%), Positives = 116/145 (80%), Gaps = 0/145 (0%)
 Frame = -2

Query  548  EAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNSF  369
            EAGI +    DL+T  E+ LG+LV  KY T+FYIL +YPLAVRPFYTMP  +N   SNS+
Sbjct  259  EAGITLGEEDDLSTSDEKLLGKLVKAKYDTDFYILDKYPLAVRPFYTMPDPNNPKLSNSY  318

Query  368  DVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLERV  189
            D+F+RGEEIISGAQR+H PELLT+RA+  GID++ I +YID+F+YG PPH G G+G+ERV
Sbjct  319  DMFMRGEEIISGAQRIHDPELLTERAKYHGIDLEKIKSYIDAFKYGCPPHAGGGIGMERV  378

Query  188  VMLFCALNNIRKTSLFPRDPQRIAP  114
            VML+  L+NIRK S+FPRDP+RI P
Sbjct  379  VMLYLGLDNIRKVSMFPRDPKRITP  403



>gb|ELK23193.1| Aspartyl-tRNA synthetase, cytoplasmic [Myotis davidii]
Length=575

 Score =   201 bits (512),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAGI++    DL+T +E+ LG+LV EKY T+FYIL +YPLAVRPFYTMP   NS  SNS
Sbjct  430  REAGIEMGDEEDLSTPNEKLLGRLVKEKYDTDFYILDKYPLAVRPFYTMPDPRNSKQSNS  489

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA   GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  490  YDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  549

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  L+NIR+TS+FPRDP+R+ P
Sbjct  550  VTMLFLGLHNIRQTSMFPRDPKRLTP  575



>gb|EWM24309.1| aspartyl-trna synthetase [Nannochloropsis gaditana]
Length=606

 Score =   202 bits (513),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAG D   + DL+TE E+ LG++V EKY T+FY++ RYPL+VRPFYTMPC D+   SNS
Sbjct  461  REAGYDASEMEDLDTEKEKALGRIVKEKYKTDFYMMDRYPLSVRPFYTMPCPDDPTLSNS  520

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            FD+FIRGEEI+SGAQR+H  ELL +R +  G+  +T+ TY+D+FR+GA PHGG G+GLER
Sbjct  521  FDMFIRGEEIVSGAQRIHDVELLGERIDAMGVPQETLRTYMDAFRHGALPHGGGGIGLER  580

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVML+  L NIRKTSLFPRDP+R+AP
Sbjct  581  VVMLYLGLKNIRKTSLFPRDPKRLAP  606



>emb|CDH50826.1| aspartyl-trna synthetase [Lichtheimia corymbifera JMRC:FSU:9682]
Length=548

 Score =   201 bits (510),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            ++AG+++    DL+T +E+ LG+LV EKY T+FYIL ++PLAVRPFYTMP  +N  YSNS
Sbjct  403  RDAGVELGDYDDLSTTNEKLLGKLVKEKYHTDFYILDKFPLAVRPFYTMPDAENPQYSNS  462

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D F+RGEEI+SGAQR+H P+ L +RA+E G+D+ TI  YID+F+ GAPPH G GVGLER
Sbjct  463  YDFFMRGEEIMSGAQRIHDPDFLVERAKEHGVDISTIQPYIDAFKIGAPPHAGGGVGLER  522

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVML+ AL NIR+TSLFPRDP+R+ P
Sbjct  523  VVMLYLALGNIRRTSLFPRDPKRLEP  548



>ref|XP_006894506.1| PREDICTED: LOW QUALITY PROTEIN: aspartate--tRNA ligase, cytoplasmic 
[Elephantulus edwardii]
Length=500

 Score =   200 bits (508),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAGI++    DL+T +E+ LG+LV EKY T+FYIL +YPLAVRPFYTMP   N   SNS
Sbjct  355  REAGIEMGDEEDLSTPNEKLLGRLVKEKYDTDFYILDKYPLAVRPFYTMPDARNPKQSNS  414

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA   GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  415  YDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  474

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  L+N+R+TS+FPRDP+R+ P
Sbjct  475  VTMLFLGLHNVRQTSMFPRDPKRLTP  500



>emb|CDS12969.1| hypothetical protein LRAMOSA05153 [Absidia idahoensis var. thermophila]
Length=548

 Score =   201 bits (510),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            ++AG+++    DL+T +E+ LG+LV EKY T+FYIL ++PLAVRPFYTMP  +N  YSNS
Sbjct  403  RDAGVELGDYDDLSTTNEKLLGKLVKEKYHTDFYILDKFPLAVRPFYTMPDAENPQYSNS  462

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D F+RGEEI+SGAQR+H P+ L +RA+E G+D+ TI  YID+F+ GAPPH G GVGLER
Sbjct  463  YDFFMRGEEIMSGAQRIHDPDFLVERAKEHGVDISTIQPYIDAFKIGAPPHAGGGVGLER  522

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVML+ AL NIR+TSLFPRDP+R+ P
Sbjct  523  VVMLYLALGNIRRTSLFPRDPKRLEP  548



>ref|XP_008582944.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic isoform X2 [Galeopterus 
variegatus]
Length=400

 Score =   197 bits (501),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAG+++    DL+T +E+ LG+LV EKY T+FYIL +YPLAVRPFYTMP   N   SNS
Sbjct  255  REAGVEMGDEDDLSTPNEKLLGRLVKEKYDTDFYILDKYPLAVRPFYTMPDPRNPKQSNS  314

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA   GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  315  YDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  374

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  L+NIR+TS+FPRDP+R+ P
Sbjct  375  VTMLFLGLHNIRQTSMFPRDPKRLTP  400



>ref|NP_001280241.1| aspartate--tRNA ligase, cytoplasmic isoform 2 [Homo sapiens]
 emb|CAH18669.1| hypothetical protein [Homo sapiens]
Length=401

 Score =   197 bits (501),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 117/146 (80%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAG+++    DL+T +E+ LG LV EKY T+FYIL +YPLAVRPFYTMP   N   SNS
Sbjct  256  REAGVEMGDEDDLSTPNEKLLGHLVKEKYDTDFYILDKYPLAVRPFYTMPDPRNPKQSNS  315

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA   GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  316  YDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  375

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  L+N+R+TS+FPRDP+R+ P
Sbjct  376  VTMLFLGLHNVRQTSMFPRDPKRLTP  401



>ref|XP_005977057.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic isoform X2 [Pantholops 
hodgsonii]
Length=401

 Score =   197 bits (501),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAGI++    DL+T +E+ LG+LV EKY T+FYIL +YPLAVRPFYTMP   N   SNS
Sbjct  256  REAGIEMGDEEDLSTPNEKLLGRLVKEKYDTDFYILDKYPLAVRPFYTMPDPRNPKQSNS  315

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA   GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  316  YDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  375

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  L+N+R+TS+FPRDP+R+ P
Sbjct  376  VTMLFLGLHNVRQTSMFPRDPKRLTP  401



>ref|XP_006196190.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic isoform X2 [Vicugna 
pacos]
Length=401

 Score =   197 bits (501),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAGI++    DL+T +E+ LG+LV EKY T+FYIL +YPLAVRPFYTMP   N   SNS
Sbjct  256  REAGIEMGDEEDLSTPNEKLLGRLVKEKYDTDFYILDKYPLAVRPFYTMPDPRNPKQSNS  315

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA   GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  316  YDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  375

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  L+N+R+TS+FPRDP+R+ P
Sbjct  376  VTMLFLGLHNVRQTSMFPRDPKRLTP  401



>ref|XP_005899557.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic isoform X2 [Bos 
mutus]
Length=401

 Score =   197 bits (501),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAGI++    DL+T +E+ LG+LV EKY T+FYIL +YPLAVRPFYTMP   N   SNS
Sbjct  256  REAGIEMGDEEDLSTPNEKLLGRLVKEKYDTDFYILDKYPLAVRPFYTMPDPRNPKQSNS  315

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA   GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  316  YDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  375

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  L+N+R+TS+FPRDP+R+ P
Sbjct  376  VTMLFLGLHNVRQTSMFPRDPKRLTP  401



>ref|XP_005807733.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Xiphophorus 
maculatus]
Length=531

 Score =   200 bits (509),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 121/146 (83%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            ++AG+++    DL+T +E+ LG+LV EKY T+FY+L +YPL+VRPFYTMP  +N  YSNS
Sbjct  386  RDAGVEMGDEDDLSTPNEKLLGRLVKEKYDTDFYVLDKYPLSVRPFYTMPDPNNPKYSNS  445

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQRVH P+LLT+RA    ID++ I +YIDSFRYGAPPHGG G+GLER
Sbjct  446  YDMFMRGEEILSGAQRVHDPQLLTERALHHQIDLEKIKSYIDSFRYGAPPHGGGGIGLER  505

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V ML+  L+N+R+TS+FPRDP+R+ P
Sbjct  506  VCMLYLGLHNVRQTSMFPRDPKRLTP  531



>ref|XP_004375153.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic isoform 2 [Trichechus 
manatus latirostris]
Length=401

 Score =   197 bits (501),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAGI++    DL+T +E+ LG+LV EKY T+FYIL +YPLAVRPFYTMP   N   SNS
Sbjct  256  REAGIEMGDEEDLSTPNEKLLGRLVKEKYDTDFYILDKYPLAVRPFYTMPDPRNPKQSNS  315

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA   GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  316  YDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  375

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  L+N+R+TS+FPRDP+R+ P
Sbjct  376  VTMLFLGLHNVRQTSMFPRDPKRLTP  401



>ref|XP_003922054.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic isoform X2 [Saimiri 
boliviensis boliviensis]
Length=401

 Score =   197 bits (501),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 117/146 (80%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAG+++    DL+T +E+ LG LV EKY T+FYIL +YPLAVRPFYTMP   N   SNS
Sbjct  256  REAGVEMGDEDDLSTPNEKLLGHLVKEKYDTDFYILDKYPLAVRPFYTMPDPRNPKQSNS  315

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA   GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  316  YDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  375

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  L+N+R+TS+FPRDP+R+ P
Sbjct  376  VTMLFLGLHNVRQTSMFPRDPKRLTP  401



>ref|XP_006748245.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like isoform X2 
[Leptonychotes weddellii]
Length=401

 Score =   197 bits (501),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAGI++    DL+T +E+ LG+LV EKY T+FYIL +YPLAVRPFYTMP   N   SNS
Sbjct  256  REAGIEMGDEEDLSTPNEKLLGRLVKEKYDTDFYILDKYPLAVRPFYTMPDPRNPKQSNS  315

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA   GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  316  YDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  375

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  L+N+R+TS+FPRDP+R+ P
Sbjct  376  VTMLFLGLHNVRQTSMFPRDPKRLTP  401



>ref|XP_008058975.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic isoform X2 [Tarsius 
syrichta]
Length=474

 Score =   199 bits (505),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAGI++    DL+T +E+ LG+LV EKY T+FYIL +YPLAVRPFYTMP   N   SNS
Sbjct  329  REAGIEMGDEDDLSTPNEKLLGRLVKEKYDTDFYILDKYPLAVRPFYTMPDPRNPKQSNS  388

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA   GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  389  YDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  448

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  L+N+R+TS+FPRDP+R+ P
Sbjct  449  VTMLFLGLHNVRQTSMFPRDPKRLTP  474



>ref|XP_007525079.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic isoform X2 [Erinaceus 
europaeus]
Length=440

 Score =   198 bits (503),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAGI++    DL+T +E+ LG+LV EKY T+FYIL +YPLAVRPFYTMP   N   SNS
Sbjct  295  REAGIEMGDEEDLSTPNEKLLGRLVKEKYDTDFYILDKYPLAVRPFYTMPDSRNPKESNS  354

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA   GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  355  YDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  414

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  L+N+R+TS+FPRDP+R+ P
Sbjct  415  VTMLFLGLHNVRQTSMFPRDPKRLTP  440



>gb|EMP34755.1| Aspartyl-tRNA synthetase, cytoplasmic [Chelonia mydas]
Length=454

 Score =   198 bits (504),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAG+++    DL+T +E+ LG+LV EKY T+FYIL +YPLAVRPFYTMP   N   SNS
Sbjct  309  REAGVEMGDEDDLSTPNEKLLGRLVKEKYDTDFYILDKYPLAVRPFYTMPDPGNPKNSNS  368

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA+  GID++ I  YIDSFRYGAPPH G G+GLER
Sbjct  369  YDMFMRGEEILSGAQRIHNPQLLTERAQHHGIDLEKIKAYIDSFRYGAPPHAGGGIGLER  428

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V ML+  L+N+R+TS+FPRDP+R+ P
Sbjct  429  VTMLYLGLSNVRQTSMFPRDPKRLTP  454



>ref|XP_006834638.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic isoform X2 [Chrysochloris 
asiatica]
Length=400

 Score =   197 bits (500),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAGI++    DL+T +E+ LG+LV EKY T+FYIL +YPLAVRPFYTMP   N   SNS
Sbjct  255  REAGIEMGDEEDLSTPNEKLLGRLVKEKYDTDFYILDKYPLAVRPFYTMPDPRNIKQSNS  314

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA   GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  315  YDMFMRGEEILSGAQRIHDPQLLTERAVHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  374

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  L+N+R+TS+FPRDP+R+ P
Sbjct  375  VTMLFLGLHNVRQTSMFPRDPKRLTP  400



>ref|XP_004423920.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic isoform 2 [Ceratotherium 
simum simum]
Length=401

 Score =   197 bits (500),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAGI++    DL+T +E+ LG+LV EKY T+FYIL +YPLAVRPFYTMP   N   SNS
Sbjct  256  REAGIEMGDEEDLSTPNEKLLGRLVKEKYDTDFYILDKYPLAVRPFYTMPDPRNLKQSNS  315

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA   GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  316  YDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  375

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  L+N+R+TS+FPRDP+R+ P
Sbjct  376  VTMLFLGLHNVRQTSMFPRDPKRLTP  401



>ref|XP_003267656.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic isoform 2 [Nomascus 
leucogenys]
 ref|XP_010365544.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic isoform X1 [Rhinopithecus 
roxellana]
Length=401

 Score =   197 bits (500),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 117/146 (80%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAG+++    DL+T +E+ LG LV EKY T+FYIL +YPLAVRPFYTMP   N   SNS
Sbjct  256  REAGVEMGDEDDLSTPNEKLLGHLVKEKYDTDFYILDKYPLAVRPFYTMPDPRNPKQSNS  315

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA   GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  316  YDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  375

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  L+N+R+TS+FPRDP+R+ P
Sbjct  376  VTMLFLGLHNVRQTSMFPRDPKRLTP  401



>ref|XP_007452083.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic isoform X2 [Lipotes 
vexillifer]
Length=401

 Score =   197 bits (500),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAGI++    DL+T +E+ LG+LV EKY T+FYIL +YPLAVRPFYTMP   N   SNS
Sbjct  256  REAGIEMGDEEDLSTPNEKLLGRLVKEKYDTDFYILDKYPLAVRPFYTMPDPRNPKLSNS  315

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA   GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  316  YDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  375

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  L+N+R+TS+FPRDP+R+ P
Sbjct  376  VTMLFLGLHNVRQTSMFPRDPKRLTP  401



>ref|XP_002607648.1| hypothetical protein BRAFLDRAFT_123951 [Branchiostoma floridae]
 gb|EEN63658.1| hypothetical protein BRAFLDRAFT_123951 [Branchiostoma floridae]
Length=454

 Score =   198 bits (504),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 89/146 (61%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAG+++    DL+T  E+ LG+LV  KY T+F+IL ++PLAVRPFYTMP  +N  Y+NS
Sbjct  309  REAGVEIGDEDDLSTPDEKLLGKLVKAKYDTDFFILDKFPLAVRPFYTMPDPNNPKYANS  368

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+++RGEEI+SGAQR+H PE LT+RA+   ID++ I +YIDSFRYG PPHGG G+G+ER
Sbjct  369  YDMYMRGEEILSGAQRIHDPEFLTERAKAHEIDIEKIKSYIDSFRYGCPPHGGGGIGMER  428

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVML+  LNNIRKTS+FPRDP+R+ P
Sbjct  429  VVMLYLGLNNIRKTSMFPRDPKRLTP  454



>ref|XP_004589424.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic isoform X2 [Ochotona 
princeps]
Length=401

 Score =   197 bits (500),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAG+++    DL+T +E+ LG+LV EKY T+FYIL +YPLAVRPFYTMP   N   SNS
Sbjct  256  REAGVEMGDEDDLSTPNEKLLGRLVKEKYDTDFYILDKYPLAVRPFYTMPDPRNPKQSNS  315

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA   GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  316  YDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  375

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  L+N+R+TS+FPRDP+R+ P
Sbjct  376  VTMLFLGLHNVRQTSMFPRDPKRLTP  401



>ref|XP_010304864.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic, partial [Balearica 
regulorum gibbericeps]
 gb|KFO12917.1| Aspartate--tRNA ligase, cytoplasmic, partial [Balearica regulorum 
gibbericeps]
Length=313

 Score =   194 bits (494),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAG+++    DL+T +E+ LG+LV EKY T+FYIL +YPLAVRPFYTMP   N   SNS
Sbjct  168  REAGVEMGDEEDLSTPNEKLLGRLVKEKYDTDFYILDKYPLAVRPFYTMPDPVNPKNSNS  227

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA   GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  228  YDMFMRGEEILSGAQRIHDPQLLTERARHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  287

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V ML+  L+N+R+TS+FPRDP+R+ P
Sbjct  288  VTMLYLGLHNVRQTSMFPRDPKRLTP  313



>ref|XP_011352781.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic [Pteropus vampyrus]
Length=501

 Score =   199 bits (506),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAGI++    DL+T +E+ LG+LV EKY T+FYIL +YPLAVRPFYTMP   N   SNS
Sbjct  356  REAGIEMGDEEDLSTPNEKLLGRLVKEKYDTDFYILDKYPLAVRPFYTMPDPRNPKQSNS  415

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQRVH P+LLT+RA   GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  416  YDMFMRGEEILSGAQRVHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  475

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  L+NIR+TS+FPRDP+R+ P
Sbjct  476  VTMLFLGLHNIRQTSMFPRDPKRLTP  501



>ref|XP_010208384.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic, partial [Colius 
striatus]
 gb|KFP23386.1| Aspartate--tRNA ligase, cytoplasmic, partial [Colius striatus]
Length=313

 Score =   194 bits (494),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 89/146 (61%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            ++AG+++    DL+T +E+ LG+LV EKY T+FYIL +YPLAVRPFYTMP   N   SNS
Sbjct  168  RQAGVEMGDEEDLSTPNEKLLGRLVKEKYDTDFYILDKYPLAVRPFYTMPDPVNPKNSNS  227

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA+  GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  228  YDMFMRGEEILSGAQRIHDPQLLTERAQHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  287

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V ML+  L+N+R+TS+FPRDP+R+ P
Sbjct  288  VTMLYLGLHNVRQTSMFPRDPKRLTP  313



>ref|XP_004086973.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic [Oryzias latipes]
Length=531

 Score =   200 bits (508),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAG+++    DL+T +E+ LG+LV EKY T+FY+L +YPLAVRPFYTMP   N  YSNS
Sbjct  386  REAGVEMGDEDDLSTPNEKLLGRLVKEKYDTDFYVLDKYPLAVRPFYTMPDPHNPKYSNS  445

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQRVH  +LLT+RA+   ID++ I +YIDSFRYGAPPH G G+GLER
Sbjct  446  YDMFMRGEEILSGAQRVHDAQLLTERAQHHQIDLEKIKSYIDSFRYGAPPHAGGGIGLER  505

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V ML+  L+N+R+TS+FPRDP+R+ P
Sbjct  506  VCMLYLGLHNVRQTSMFPRDPKRLTP  531



>ref|XP_002286873.1| aspartate-trna ligase [Thalassiosira pseudonana CCMP1335]
 gb|EED96514.1| aspartate-trna ligase [Thalassiosira pseudonana CCMP1335]
Length=475

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 120/146 (82%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAG+D D L DL+TE+E+KLG +V EKY T+FYI+ +YPL+VRPFYTMP  +N   SNS
Sbjct  330  REAGVDQDDLDDLSTENEKKLGDIVKEKYNTDFYIMDKYPLSVRPFYTMPDPNNPKLSNS  389

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+FIRG+EI+SGAQR+H   LL +RA+  GID++TIS Y+D+FR GA PHGG G+G+ER
Sbjct  390  YDIFIRGQEILSGAQRIHETGLLEERAKAWGIDLETISAYLDAFRNGALPHGGGGIGMER  449

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVML+  L NIRK+S+FPRDP+R+ P
Sbjct  450  VVMLYLGLPNIRKSSMFPRDPRRLLP  475



>ref|XP_968957.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic [Tribolium castaneum]
 gb|EFA00049.1| hypothetical protein TcasGA2_TC002857 [Tribolium castaneum]
Length=533

 Score =   200 bits (508),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/145 (63%), Positives = 119/145 (82%), Gaps = 0/145 (0%)
 Frame = -2

Query  548  EAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNSF  369
            EAG++V P  DL+T +E+ LG+LV  KY T+FYIL +YPLAVRPFYTMP  +    SNS+
Sbjct  389  EAGVEVGPEEDLSTPAEKLLGRLVKAKYDTDFYILDKYPLAVRPFYTMPDPETPRSSNSY  448

Query  368  DVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLERV  189
            D+F+RGEEI+SGAQR+H P+LLT+RA+  GID+K I++YID+F+YG PPH G G+GLERV
Sbjct  449  DMFMRGEEILSGAQRIHDPQLLTERAKHHGIDLKKIASYIDAFKYGCPPHAGGGIGLERV  508

Query  188  VMLFCALNNIRKTSLFPRDPQRIAP  114
            VML+  L+NIRKT +FPRDP+RI P
Sbjct  509  VMLYLGLDNIRKTCMFPRDPKRITP  533



>ref|XP_006275951.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic [Alligator mississippiensis]
Length=501

 Score =   199 bits (506),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KEAG+++    DL+T +E+ LG+LV EKY T+FYIL +YPLAVRPFYTMP   N   SNS
Sbjct  356  KEAGVEMGDEEDLSTPNEKLLGRLVKEKYDTDFYILDKYPLAVRPFYTMPDPVNPKISNS  415

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQRVH P+LLT+RA+  GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  416  YDMFMRGEEILSGAQRVHDPQLLTERAQHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  475

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V ML+  L+N+R+TS+FPRDP+R+ P
Sbjct  476  VTMLYLGLHNVRQTSMFPRDPKRLTP  501



>ref|XP_007525078.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic isoform X1 [Erinaceus 
europaeus]
Length=501

 Score =   199 bits (506),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAGI++    DL+T +E+ LG+LV EKY T+FYIL +YPLAVRPFYTMP   N   SNS
Sbjct  356  REAGIEMGDEEDLSTPNEKLLGRLVKEKYDTDFYILDKYPLAVRPFYTMPDSRNPKESNS  415

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA   GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  416  YDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  475

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  L+N+R+TS+FPRDP+R+ P
Sbjct  476  VTMLFLGLHNVRQTSMFPRDPKRLTP  501



>ref|XP_003794431.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic isoform 2 [Otolemur 
garnettii]
Length=401

 Score =   197 bits (500),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAG+++    DL+T +E+ LG+LV EKY T+FYIL +YPLAVRPFYTMP   N   SNS
Sbjct  256  REAGVEMGDEEDLSTPNEKLLGRLVKEKYDTDFYILDKYPLAVRPFYTMPDPRNPKQSNS  315

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA   GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  316  YDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  375

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  L+N+R+TS+FPRDP+R+ P
Sbjct  376  VTMLFLGLHNVRQTSMFPRDPKRLTP  401



>ref|XP_005315894.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic [Ictidomys tridecemlineatus]
Length=501

 Score =   199 bits (506),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAG+++    DL+T +E+ LG+LV EKY T+FYIL +YPLAVRPFYTMP   N  +SNS
Sbjct  356  REAGVEMGDEEDLSTPNEKLLGRLVKEKYDTDFYILDKYPLAVRPFYTMPDPRNPKHSNS  415

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA   GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  416  YDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  475

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  L+N+R+TS+FPRDP+R+ P
Sbjct  476  VTMLFLGLHNVRQTSMFPRDPKRLTP  501



>ref|XP_004674747.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic isoform X2 [Condylura 
cristata]
Length=401

 Score =   196 bits (499),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAGI++    DL+T +E+ LG+LV EKY T+FYIL +YPLAVRPFYTMP   N   SNS
Sbjct  256  REAGIEMGDEEDLSTPNEKLLGRLVKEKYDTDFYILDKYPLAVRPFYTMPDPRNPKESNS  315

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA   GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  316  YDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  375

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  L+N+R+TS+FPRDP+R+ P
Sbjct  376  VTMLFLGLHNVRQTSMFPRDPKRLTP  401



>ref|XP_009937033.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic [Opisthocomus 
hoazin]
Length=468

 Score =   198 bits (503),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KEAG+++    DL+T +E+ LG+LV EKY T+FYIL +YPLAVRPFYTMP   N   SNS
Sbjct  323  KEAGVEMGDEEDLSTPNEKLLGRLVKEKYDTDFYILDKYPLAVRPFYTMPDPVNPKNSNS  382

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA+  GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  383  YDMFMRGEEILSGAQRIHDPQLLTERAQHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  442

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V ML+  L+N+R+TS+FPRDP+R+ P
Sbjct  443  VTMLYLGLHNVRQTSMFPRDPKRLTP  468



>ref|XP_006992782.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic [Peromyscus maniculatus 
bairdii]
Length=462

 Score =   198 bits (503),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAG+++    DL+T +E+ LG+LV EKY T+FY+L +YPLAVRPFYTMP   N  +SNS
Sbjct  317  REAGVEMGDEEDLSTPNEKLLGRLVKEKYDTDFYVLDKYPLAVRPFYTMPDPRNPKHSNS  376

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA   GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  377  YDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  436

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  L+N+R+TS+FPRDP+R+ P
Sbjct  437  VTMLFLGLHNVRQTSMFPRDPKRLTP  462



>gb|EHJ74756.1| aspartyl-tRNA synthetase [Danaus plexippus]
Length=325

 Score =   194 bits (494),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 89/143 (62%), Positives = 114/143 (80%), Gaps = 0/143 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAG+ + P  DL+T  E+ LG+LV  KY T+FYIL +YPLAVRPFYTMP  +N   SNS
Sbjct  101  REAGVTISPEDDLSTPDEKLLGRLVRSKYDTDFYILDKYPLAVRPFYTMPDPNNPRSSNS  160

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P LLT+RA+  GID+  I+ YI++FR G PPH G G+GLER
Sbjct  161  YDMFMRGEEILSGAQRIHEPALLTERAQHHGIDISKIAAYIEAFRLGCPPHAGGGIGLER  220

Query  191  VVMLFCALNNIRKTSLFPRDPQR  123
            VVML+  L+NIRKTS+FPRDP+R
Sbjct  221  VVMLYLGLDNIRKTSMFPRDPKR  243



>ref|XP_007060951.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic [Chelonia mydas]
Length=495

 Score =   199 bits (505),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAG+++    DL+T +E+ LG+LV EKY T+FYIL +YPLAVRPFYTMP   N   SNS
Sbjct  350  REAGVEMGDEDDLSTPNEKLLGRLVKEKYDTDFYILDKYPLAVRPFYTMPDPGNPKNSNS  409

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA+  GID++ I  YIDSFRYGAPPH G G+GLER
Sbjct  410  YDMFMRGEEILSGAQRIHNPQLLTERAQHHGIDLEKIKAYIDSFRYGAPPHAGGGIGLER  469

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V ML+  L+N+R+TS+FPRDP+R+ P
Sbjct  470  VTMLYLGLSNVRQTSMFPRDPKRLTP  495



>gb|EAX11618.1| aspartyl-tRNA synthetase, isoform CRA_b [Homo sapiens]
 gb|EAX11619.1| aspartyl-tRNA synthetase, isoform CRA_b [Homo sapiens]
Length=468

 Score =   198 bits (503),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 117/146 (80%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAG+++    DL+T +E+ LG LV EKY T+FYIL +YPLAVRPFYTMP   N   SNS
Sbjct  323  REAGVEMGDEDDLSTPNEKLLGHLVKEKYDTDFYILDKYPLAVRPFYTMPDPRNPKQSNS  382

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA   GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  383  YDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  442

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  L+N+R+TS+FPRDP+R+ P
Sbjct  443  VTMLFLGLHNVRQTSMFPRDPKRLTP  468



>gb|KFR14034.1| Aspartate--tRNA ligase, cytoplasmic, partial [Opisthocomus hoazin]
Length=460

 Score =   198 bits (503),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KEAG+++    DL+T +E+ LG+LV EKY T+FYIL +YPLAVRPFYTMP   N   SNS
Sbjct  315  KEAGVEMGDEEDLSTPNEKLLGRLVKEKYDTDFYILDKYPLAVRPFYTMPDPVNPKNSNS  374

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA+  GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  375  YDMFMRGEEILSGAQRIHDPQLLTERAQHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  434

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V ML+  L+N+R+TS+FPRDP+R+ P
Sbjct  435  VTMLYLGLHNVRQTSMFPRDPKRLTP  460



>ref|XP_002737659.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Saccoglossus 
kowalevskii]
Length=532

 Score =   199 bits (507),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 117/146 (80%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KEAG D+    DL+T +E+ LG+LV  KY T+F+IL +YPL VRPFYTMP  ++   SNS
Sbjct  387  KEAGFDIGFQDDLSTPAEKLLGKLVKAKYDTDFFILDKYPLEVRPFYTMPDPNDPKSSNS  446

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H PELL +RA E GI +++I  YIDSFRYGAPPH G G+GLER
Sbjct  447  YDMFMRGEEILSGAQRIHDPELLIERATEHGIGIESIKPYIDSFRYGAPPHAGGGIGLER  506

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  L+NIRKTSLFPRDP+R+AP
Sbjct  507  VTMLFLGLDNIRKTSLFPRDPKRLAP  532



>ref|XP_006636375.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Lepisosteus 
oculatus]
Length=545

 Score =   199 bits (507),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KEAG+++    DL+T +E+ LG+LV EKY T+FY+L +YPLAVRPFYTMP  +N  YSNS
Sbjct  400  KEAGVEMGDEEDLSTPNEKLLGRLVKEKYDTDFYVLDKYPLAVRPFYTMPDPNNPKYSNS  459

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LL++RA    ID++ I  YIDSFRYGAPPH G G+GLER
Sbjct  460  YDMFMRGEEILSGAQRIHDPQLLSERALHHNIDLEKIKAYIDSFRYGAPPHAGGGIGLER  519

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V ML+  L+N+R+TS+FPRDP+R+ P
Sbjct  520  VTMLYLGLHNVRQTSMFPRDPKRLTP  545



>ref|XP_010851973.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic [Bison bison bison]
Length=468

 Score =   198 bits (503),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAGI++    DL+T +E+ LG+LV EKY T+FYIL +YPLAVRPFYTMP   N   SNS
Sbjct  323  REAGIEMGDEEDLSTPNEKLLGRLVKEKYDTDFYILDKYPLAVRPFYTMPDPRNPKQSNS  382

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA   GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  383  YDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  442

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  L+N+R+TS+FPRDP+R+ P
Sbjct  443  VTMLFLGLHNVRQTSMFPRDPKRLTP  468



>ref|XP_008058974.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic isoform X1 [Tarsius 
syrichta]
Length=501

 Score =   199 bits (505),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAGI++    DL+T +E+ LG+LV EKY T+FYIL +YPLAVRPFYTMP   N   SNS
Sbjct  356  REAGIEMGDEDDLSTPNEKLLGRLVKEKYDTDFYILDKYPLAVRPFYTMPDPRNPKQSNS  415

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA   GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  416  YDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  475

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  L+N+R+TS+FPRDP+R+ P
Sbjct  476  VTMLFLGLHNVRQTSMFPRDPKRLTP  501



>ref|XP_006018449.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic [Alligator sinensis]
Length=501

 Score =   199 bits (505),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            KEAG+++    DL+T +E+ LG+LV EKY T+FYIL +YPLAVRPFYTMP   N   SNS
Sbjct  356  KEAGVEMGDEEDLSTPNEKLLGRLVKEKYDTDFYILDKYPLAVRPFYTMPDPVNPKISNS  415

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA+  GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  416  YDMFMRGEEILSGAQRIHDPQLLTERAQHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  475

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V ML+  L+N+R+TS+FPRDP+R+ P
Sbjct  476  VTMLYLGLHNVRQTSMFPRDPKRLTP  501



>ref|XP_003405905.1| PREDICTED: LOW QUALITY PROTEIN: aspartate--tRNA ligase, cytoplasmic 
[Loxodonta africana]
Length=502

 Score =   199 bits (505),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAGI++    DL+T +E+ LG+LV EKY T+FYIL +YPLAVRPFYTMP   N   SNS
Sbjct  357  REAGIEMGDEEDLSTPNEKLLGRLVKEKYDTDFYILDKYPLAVRPFYTMPDPRNPKQSNS  416

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQRVH P+LLT+RA   GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  417  YDMFMRGEEILSGAQRVHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  476

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  L+N+R+TS+FPRDP+R+ P
Sbjct  477  VTMLFLGLHNVRQTSMFPRDPKRLTP  502



>ref|XP_010125958.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic [Chlamydotis macqueenii]
Length=401

 Score =   196 bits (498),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAG+++    DL+T +E+ LG+LV EKY T+FYIL +YPLAVRPFYTMP   N   SNS
Sbjct  256  REAGVEMGDEEDLSTPNEKLLGRLVKEKYDTDFYILDKYPLAVRPFYTMPDPVNPKNSNS  315

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA+  GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  316  YDMFMRGEEILSGAQRIHDPQLLTERAQHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  375

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V ML+  L+N+R+TS+FPRDP+R+ P
Sbjct  376  VTMLYLGLHNVRQTSMFPRDPKRLTP  401



>ref|XP_011494872.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic [Ceratosolen solmsi 
marchali]
Length=526

 Score =   199 bits (506),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 89/146 (61%), Positives = 116/146 (79%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAGI ++   DL+T +E+ LG+++  KY T+FYIL +YPLAVRPFYTMP   N   SNS
Sbjct  381  REAGIVMEDEDDLSTSNEKLLGKIIKAKYDTDFYILDKYPLAVRPFYTMPDSTNPKASNS  440

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEIISGAQR+H P+ LT+RA++ GID+  I  YID+FRYG PPH G G+G+ER
Sbjct  441  YDMFMRGEEIISGAQRIHDPDFLTERAKQHGIDINKIKAYIDAFRYGCPPHAGGGIGMER  500

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVML+  L+NIRK S+FPRDP+RI P
Sbjct  501  VVMLYLGLDNIRKVSMFPRDPKRITP  526



>ref|XP_008582943.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic isoform X1 [Galeopterus 
variegatus]
Length=500

 Score =   199 bits (505),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAG+++    DL+T +E+ LG+LV EKY T+FYIL +YPLAVRPFYTMP   N   SNS
Sbjct  355  REAGVEMGDEDDLSTPNEKLLGRLVKEKYDTDFYILDKYPLAVRPFYTMPDPRNPKQSNS  414

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA   GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  415  YDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  474

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  L+NIR+TS+FPRDP+R+ P
Sbjct  475  VTMLFLGLHNIRQTSMFPRDPKRLTP  500



>ref|XP_005573101.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic isoform X2 [Macaca 
fascicularis]
Length=468

 Score =   198 bits (503),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 117/146 (80%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAG+++    DL+T +E+ LG LV EKY T+FYIL +YPLAVRPFYTMP   N   SNS
Sbjct  323  REAGVEMGDEDDLSTPNEKLLGHLVKEKYDTDFYILDKYPLAVRPFYTMPDPRNPKQSNS  382

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA   GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  383  YDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  442

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  L+N+R+TS+FPRDP+R+ P
Sbjct  443  VTMLFLGLHNVRQTSMFPRDPKRLTP  468



>ref|XP_011283514.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic isoform X3 [Felis 
catus]
Length=468

 Score =   198 bits (503),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAGI++    DL+T +E+ LG+LV EKY T+FYIL +YPLAVRPFYTMP   N   SNS
Sbjct  323  REAGIEMGDEEDLSTPNEKLLGRLVKEKYDTDFYILDKYPLAVRPFYTMPDPRNPKQSNS  382

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA   GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  383  YDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  442

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  L+N+R+TS+FPRDP+R+ P
Sbjct  443  VTMLFLGLHNVRQTSMFPRDPKRLTP  468



>ref|XP_004403601.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic isoform 2 [Odobenus 
rosmarus divergens]
Length=401

 Score =   196 bits (498),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 117/146 (80%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAGI +    DL+T +E+ LG+LV EKY T+FYIL +YPLAVRPFYTMP   N   SNS
Sbjct  256  REAGIKMGDEEDLSTPNEKLLGRLVKEKYDTDFYILDKYPLAVRPFYTMPDPRNPKQSNS  315

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA   GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  316  YDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  375

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  L+N+R+TS+FPRDP+R+ P
Sbjct  376  VTMLFLGLHNVRQTSMFPRDPKRLTP  401



>ref|XP_005899556.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic isoform X1 [Bos 
mutus]
 gb|ELR53721.1| Aspartyl-tRNA synthetase, cytoplasmic [Bos mutus]
Length=501

 Score =   198 bits (504),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAGI++    DL+T +E+ LG+LV EKY T+FYIL +YPLAVRPFYTMP   N   SNS
Sbjct  356  REAGIEMGDEEDLSTPNEKLLGRLVKEKYDTDFYILDKYPLAVRPFYTMPDPRNPKQSNS  415

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA   GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  416  YDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  475

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  L+N+R+TS+FPRDP+R+ P
Sbjct  476  VTMLFLGLHNVRQTSMFPRDPKRLTP  501



>ref|XP_008515152.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic [Equus przewalskii]
Length=502

 Score =   198 bits (504),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAGI++    DL+T +E+ LG+LV EKY T+FYIL +YPLAVRPFYTMP   N   SNS
Sbjct  357  REAGIEMGDEEDLSTPNEKLLGRLVKEKYDTDFYILDKYPLAVRPFYTMPDPRNPKQSNS  416

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA   GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  417  YDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  476

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  L+N+R+TS+FPRDP+R+ P
Sbjct  477  VTMLFLGLHNVRQTSMFPRDPKRLTP  502



>ref|XP_005676244.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic [Capra hircus]
Length=501

 Score =   198 bits (504),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAGI++    DL+T +E+ LG+LV EKY T+FYIL +YPLAVRPFYTMP   N   SNS
Sbjct  356  REAGIEMGDEEDLSTPNEKLLGRLVKEKYDTDFYILDKYPLAVRPFYTMPDPRNPKQSNS  415

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA   GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  416  YDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  475

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  L+N+R+TS+FPRDP+R+ P
Sbjct  476  VTMLFLGLHNVRQTSMFPRDPKRLTP  501



>gb|EFX84904.1| hypothetical protein DAPPUDRAFT_99304 [Daphnia pulex]
Length=468

 Score =   197 bits (502),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 114/146 (78%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            ++AG  +    DL+T  E+ LG+LV  KY T+FYIL +YPLAVRPFYTMP  +N  YSNS
Sbjct  323  RQAGEQIGDEDDLSTPMEKLLGRLVKAKYDTDFYILDKYPLAVRPFYTMPDPNNKKYSNS  382

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H PE L++RA+  GID+  I  YIDSFRYG PPH G G+G+ER
Sbjct  383  YDIFMRGEEIMSGAQRIHDPEYLSERAKHHGIDLSKIKAYIDSFRYGCPPHAGGGIGMER  442

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  L+NIRKTS+FPRDP+RI P
Sbjct  443  VAMLFLGLDNIRKTSMFPRDPKRITP  468



>ref|XP_004774308.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic [Mustela putorius 
furo]
 ref|XP_004806393.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic [Mustela putorius 
furo]
Length=501

 Score =   198 bits (504),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAGI++    DL+T +E+ LG+LV EKY T+FYIL +YPLAVRPFYTMP   N   SNS
Sbjct  356  REAGIEMGDEEDLSTPNEKLLGRLVKEKYDTDFYILDKYPLAVRPFYTMPDPRNPKQSNS  415

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA   GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  416  YDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  475

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  L+N+R+TS+FPRDP+R+ P
Sbjct  476  VTMLFLGLHNVRQTSMFPRDPKRLTP  501



>ref|XP_001490073.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic isoform 1 [Equus 
caballus]
Length=501

 Score =   198 bits (504),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAGI++    DL+T +E+ LG+LV EKY T+FYIL +YPLAVRPFYTMP   N   SNS
Sbjct  356  REAGIEMGDEEDLSTPNEKLLGRLVKEKYDTDFYILDKYPLAVRPFYTMPDPRNPKQSNS  415

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA   GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  416  YDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  475

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  L+N+R+TS+FPRDP+R+ P
Sbjct  476  VTMLFLGLHNVRQTSMFPRDPKRLTP  501



>ref|XP_004668210.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic isoform X2 [Jaculus 
jaculus]
Length=401

 Score =   196 bits (498),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAG+++    DL+T +E+ LG+LV EKY T+FY+L +YPLAVRPFYTMP   N   SNS
Sbjct  256  REAGVEMGDEEDLSTPNEKLLGRLVKEKYDTDFYVLDKYPLAVRPFYTMPDPRNPKQSNS  315

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA   GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  316  YDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  375

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  L+N+R+TS+FPRDP+R+ P
Sbjct  376  VTMLFLGLHNVRQTSMFPRDPKRLTP  401



>ref|XP_005977056.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic isoform X1 [Pantholops 
hodgsonii]
Length=501

 Score =   198 bits (504),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAGI++    DL+T +E+ LG+LV EKY T+FYIL +YPLAVRPFYTMP   N   SNS
Sbjct  356  REAGIEMGDEEDLSTPNEKLLGRLVKEKYDTDFYILDKYPLAVRPFYTMPDPRNPKQSNS  415

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA   GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  416  YDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  475

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  L+N+R+TS+FPRDP+R+ P
Sbjct  476  VTMLFLGLHNVRQTSMFPRDPKRLTP  501



>ref|XP_315584.3| AGAP005576-PA [Anopheles gambiae str. PEST]
 gb|EAA11760.4| AGAP005576-PA [Anopheles gambiae str. PEST]
Length=543

 Score =   199 bits (506),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAG+ +D   DL+T SE+ LG+LV  KY T+FYIL ++PLAVRPFYTMP   N+ YSNS
Sbjct  398  REAGVQMDDEEDLSTPSEKLLGRLVKAKYDTDFYILDKFPLAVRPFYTMPDPANAKYSNS  457

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H PE L +RA+  GID+  I+ YID+FRYG PPH G G+G+ER
Sbjct  458  YDMFMRGEEILSGAQRIHDPEYLIERAKLHGIDLSKIAAYIDAFRYGCPPHAGGGIGMER  517

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            VVML+  L+NIRKTS+FPRDP+R+ P
Sbjct  518  VVMLYLGLDNIRKTSMFPRDPKRLTP  543



>gb|AAP36306.1| Homo sapiens aspartyl-tRNA synthetase [synthetic construct]
 gb|AAX43774.1| aspartyl-tRNA synthetase, partial [synthetic construct]
 gb|AAX43775.1| aspartyl-tRNA synthetase, partial [synthetic construct]
Length=502

 Score =   198 bits (504),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 117/146 (80%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAG+++    DL+T +E+ LG LV EKY T+FYIL +YPLAVRPFYTMP   N   SNS
Sbjct  356  REAGVEMGDEDDLSTPNEKLLGHLVKEKYDTDFYILDKYPLAVRPFYTMPDPRNPKQSNS  415

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA   GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  416  YDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  475

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  L+N+R+TS+FPRDP+R+ P
Sbjct  476  VTMLFLGLHNVRQTSMFPRDPKRLTP  501



>tpg|DAA32651.1| TPA: aspartyl-tRNA synthetase, cytoplasmic [Bos taurus]
Length=501

 Score =   198 bits (504),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAGI++    DL+T +E+ LG+LV EKY T+FYIL +YPLAVRPFYTMP   N   SNS
Sbjct  356  REAGIEMGDEEDLSTPNEKLLGRLVKEKYDTDFYILDKYPLAVRPFYTMPDPRNPKQSNS  415

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA   GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  416  YDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  475

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  L+N+R+TS+FPRDP+R+ P
Sbjct  476  VTMLFLGLHNVRQTSMFPRDPKRLTP  501



>ref|XP_003497764.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic isoform X1 [Cricetulus 
griseus]
Length=501

 Score =   198 bits (504),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAG+++    DL+T +E+ LG+LV EKY T+FY+L +YPLAVRPFYTMP   N  +SNS
Sbjct  356  REAGVEMGDEEDLSTPNEKLLGRLVKEKYDTDFYVLDKYPLAVRPFYTMPDPRNPKHSNS  415

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA   GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  416  YDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  475

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  L+N+R+TS+FPRDP+R+ P
Sbjct  476  VTMLFLGLHNVRQTSMFPRDPKRLTP  501



>gb|AAI07750.1| Aspartyl-tRNA synthetase [Homo sapiens]
Length=501

 Score =   198 bits (504),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 117/146 (80%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAG+++    DL+T +E+ LG LV EKY T+FYIL +YPLAVRPFYTMP   N   SNS
Sbjct  356  REAGVEMGDEDDLSTPNEKLLGHLVKEKYDTDFYILDKYPLAVRPFYTMPDPRNPKQSNS  415

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA   GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  416  YDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  475

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  L+N+R+TS+FPRDP+R+ P
Sbjct  476  VTMLFLGLHNVRQTSMFPRDPKRLTP  501



>ref|XP_006049208.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic isoform X2 [Bubalus 
bubalis]
Length=501

 Score =   198 bits (504),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAGI++    DL+T +E+ LG+LV EKY T+FYIL +YPLAVRPFYTMP   N   SNS
Sbjct  356  REAGIEMGDEEDLSTPNEKLLGRLVKEKYDTDFYILDKYPLAVRPFYTMPDPRNPKQSNS  415

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA   GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  416  YDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  475

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  L+N+R+TS+FPRDP+R+ P
Sbjct  476  VTMLFLGLHNVRQTSMFPRDPKRLTP  501



>ref|NP_001340.2| aspartate--tRNA ligase, cytoplasmic isoform 1 [Homo sapiens]
 ref|XP_003822865.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic [Pan paniscus]
 sp|P14868.2|SYDC_HUMAN RecName: Full=Aspartate--tRNA ligase, cytoplasmic; AltName: Full=Aspartyl-tRNA 
synthetase; Short=AspRS; AltName: Full=Cell 
proliferation-inducing gene 40 protein [Homo sapiens]
 gb|AAH00629.1| Aspartyl-tRNA synthetase [Homo sapiens]
 gb|AAP35356.1| aspartyl-tRNA synthetase [Homo sapiens]
 gb|AAX32149.1| aspartyl-tRNA synthetase [synthetic construct]
 gb|AAX32150.1| aspartyl-tRNA synthetase [synthetic construct]
 gb|EAX11617.1| aspartyl-tRNA synthetase, isoform CRA_a [Homo sapiens]
 gb|EAX11620.1| aspartyl-tRNA synthetase, isoform CRA_a [Homo sapiens]
 gb|ABM81667.1| aspartyl-tRNA synthetase [synthetic construct]
 gb|ABM84838.1| aspartyl-tRNA synthetase [synthetic construct]
 dbj|BAF83296.1| unnamed protein product [Homo sapiens]
 gb|AIC48619.1| DARS, partial [synthetic construct]
Length=501

 Score =   198 bits (504),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 117/146 (80%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAG+++    DL+T +E+ LG LV EKY T+FYIL +YPLAVRPFYTMP   N   SNS
Sbjct  356  REAGVEMGDEDDLSTPNEKLLGHLVKEKYDTDFYILDKYPLAVRPFYTMPDPRNPKQSNS  415

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA   GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  416  YDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  475

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  L+N+R+TS+FPRDP+R+ P
Sbjct  476  VTMLFLGLHNVRQTSMFPRDPKRLTP  501



>gb|KFV43662.1| Aspartate--tRNA ligase, cytoplasmic, partial [Gavia stellata]
Length=460

 Score =   197 bits (502),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 120/146 (82%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAG+++    DL+T +E+ LG+LV EKY T+FYIL +YPLAVRPFYTMP   N   SNS
Sbjct  315  REAGVEMGDEEDLSTPNEKLLGRLVKEKYDTDFYILDKYPLAVRPFYTMPDPVNPKTSNS  374

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA+  GID++ I +YIDSFR+GAPPH G G+GLER
Sbjct  375  YDMFMRGEEILSGAQRIHDPQLLTERAQHHGIDLEKIKSYIDSFRFGAPPHAGGGIGLER  434

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V ML+  L+N+R+TS+FPRDP+R+ P
Sbjct  435  VTMLYLGLHNVRQTSMFPRDPKRLTP  460



>ref|XP_009812359.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic [Gavia stellata]
Length=468

 Score =   197 bits (502),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 120/146 (82%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAG+++    DL+T +E+ LG+LV EKY T+FYIL +YPLAVRPFYTMP   N   SNS
Sbjct  323  REAGVEMGDEEDLSTPNEKLLGRLVKEKYDTDFYILDKYPLAVRPFYTMPDPVNPKTSNS  382

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA+  GID++ I +YIDSFR+GAPPH G G+GLER
Sbjct  383  YDMFMRGEEILSGAQRIHDPQLLTERAQHHGIDLEKIKSYIDSFRFGAPPHAGGGIGLER  442

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V ML+  L+N+R+TS+FPRDP+R+ P
Sbjct  443  VTMLYLGLHNVRQTSMFPRDPKRLTP  468



>ref|XP_004375152.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic isoform 1 [Trichechus 
manatus latirostris]
Length=501

 Score =   198 bits (504),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAGI++    DL+T +E+ LG+LV EKY T+FYIL +YPLAVRPFYTMP   N   SNS
Sbjct  356  REAGIEMGDEEDLSTPNEKLLGRLVKEKYDTDFYILDKYPLAVRPFYTMPDPRNPKQSNS  415

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA   GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  416  YDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  475

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  L+N+R+TS+FPRDP+R+ P
Sbjct  476  VTMLFLGLHNVRQTSMFPRDPKRLTP  501



>ref|XP_848666.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic isoform 2 [Canis 
lupus familiaris]
Length=501

 Score =   198 bits (504),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAGI++    DL+T +E+ LG+LV EKY T+FYIL +YPLAVRPFYTMP   N   SNS
Sbjct  356  REAGIEMGDEEDLSTPNEKLLGRLVKEKYDTDFYILDKYPLAVRPFYTMPDPRNPKQSNS  415

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA   GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  416  YDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  475

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  L+N+R+TS+FPRDP+R+ P
Sbjct  476  VTMLFLGLHNVRQTSMFPRDPKRLTP  501



>gb|AAX07827.1| cell proliferation-inducing protein 40 [Homo sapiens]
Length=501

 Score =   198 bits (504),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 117/146 (80%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAG+++    DL+T +E+ LG LV EKY T+FYIL +YPLAVRPFYTMP   N   SNS
Sbjct  356  REAGVEMGDEDDLSTPNEKLLGHLVKEKYDTDFYILDKYPLAVRPFYTMPDPRNPKQSNS  415

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA   GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  416  YDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  475

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  L+N+R+TS+FPRDP+R+ P
Sbjct  476  VTMLFLGLHNVRQTSMFPRDPKRLTP  501



>ref|XP_006196189.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic isoform X1 [Vicugna 
pacos]
Length=501

 Score =   198 bits (504),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAGI++    DL+T +E+ LG+LV EKY T+FYIL +YPLAVRPFYTMP   N   SNS
Sbjct  356  REAGIEMGDEEDLSTPNEKLLGRLVKEKYDTDFYILDKYPLAVRPFYTMPDPRNPKQSNS  415

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA   GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  416  YDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  475

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  L+N+R+TS+FPRDP+R+ P
Sbjct  476  VTMLFLGLHNVRQTSMFPRDPKRLTP  501



>dbj|BAD96196.1| aspartyl-tRNA synthetase variant [Homo sapiens]
Length=501

 Score =   198 bits (504),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 117/146 (80%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAG+++    DL+T +E+ LG LV EKY T+FYIL +YPLAVRPFYTMP   N   SNS
Sbjct  356  REAGVEMGDEDDLSTPNEKLLGHLVKEKYDTDFYILDKYPLAVRPFYTMPDPRNPKQSNS  415

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQR+H P+LLT+RA   GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  416  YDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  475

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V MLF  L+N+R+TS+FPRDP+R+ P
Sbjct  476  VTMLFLGLHNVRQTSMFPRDPKRLTP  501



>ref|XP_003215139.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic [Anolis carolinensis]
Length=503

 Score =   198 bits (504),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAG+++    DL+T SE+ LG+LV EKY T+FYIL +YPLAVRPFYTMP   N   SNS
Sbjct  358  REAGVEMGDEDDLSTPSEKLLGRLVKEKYDTDFYILDKYPLAVRPFYTMPDPKNPKTSNS  417

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQRVH P+LLT+RA   GID++ I  YIDSFR+GAPPH G G+GLER
Sbjct  418  YDMFMRGEEILSGAQRVHDPQLLTERAMHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLER  477

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V ML+  L+N+R+TS+FPRDP+R+ P
Sbjct  478  VTMLYLGLSNVRQTSMFPRDPKRLTP  503



>ref|XP_010739294.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic [Larimichthys 
crocea]
Length=537

 Score =   199 bits (506),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAG+++    DL+T +E+ LG+LV EKY T+FY+L +YPLAVRPFYTMP  +N  YSNS
Sbjct  392  REAGVEMGDEDDLSTPNEKLLGRLVKEKYDTDFYVLDKYPLAVRPFYTMPDPNNPKYSNS  451

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQRVH  +LLT+RA    ID++ I  YIDSFRYGAPPHGG G+GLER
Sbjct  452  YDMFMRGEEILSGAQRVHDAQLLTERAIHHQIDLEKIKAYIDSFRYGAPPHGGGGIGLER  511

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V ML+  L+N+R+TS+FPRDP+R+ P
Sbjct  512  VCMLYLGLHNVRQTSMFPRDPKRLTP  537



>ref|XP_004563182.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Maylandia 
zebra]
 ref|XP_005919388.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Haplochromis 
burtoni]
Length=531

 Score =   199 bits (505),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = -2

Query  551  KEAGIDVDPLGDLNTESERKLGQLVLEKYGTEFYILPRYPLAVRPFYTMPCYDNSAYSNS  372
            +EAG+++    DL+T +E+ LG+LV EKY T+FY+L +YPLAVRPFYTMP   N  YSNS
Sbjct  386  REAGVEMGDEDDLSTPNEKLLGRLVKEKYDTDFYVLDKYPLAVRPFYTMPDPSNPKYSNS  445

Query  371  FDVFIRGEEIISGAQRVHVPELLTKRAEECGIDVKTISTYIDSFRYGAPPHGGFGVGLER  192
            +D+F+RGEEI+SGAQRVH  +LLT+RA    ID++ I  YIDSFRYGAPPHGG G+GLER
Sbjct  446  YDMFMRGEEILSGAQRVHDAQLLTERAIHHQIDLEKIKAYIDSFRYGAPPHGGGGIGLER  505

Query  191  VVMLFCALNNIRKTSLFPRDPQRIAP  114
            V ML+  L+N+R+TS+FPRDP+R+ P
Sbjct  506  VCMLYLGLHNVRQTSMFPRDPKRLTP  531



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 603802497760