BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF001B14

Length=856
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|NP_567286.1|  ubiquitin 11                                          405   8e-140   Arabidopsis thaliana [mouse-ear cress]
gb|ABH08755.1|  ubiquitin                                               405   9e-140   Arabidopsis thaliana [mouse-ear cress]
gb|ABH08753.1|  ubiquitin                                               405   9e-140   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003570150.1|  PREDICTED: polyubiquitin 11 isoform X2             405   2e-139   Brachypodium distachyon [annual false brome]
gb|ACJ85618.1|  unknown                                                 404   2e-139   Medicago truncatula
gb|ACJ85643.1|  unknown                                                 404   3e-139   Medicago truncatula
gb|EEC81189.1|  hypothetical protein OsI_24195                          404   3e-139   Oryza sativa Indica Group [Indian rice]
ref|XP_008358804.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    405   3e-139   
gb|AIZ74335.1|  polyubiquitin 3                                         404   4e-139   Pinus massoniana [Chinese red pine]
ref|XP_003626479.1|  Ubiquitin-like protein                             405   4e-139   
ref|XP_009114489.1|  PREDICTED: polyubiquitin-like                      407   5e-139   Brassica rapa
ref|XP_010931017.1|  PREDICTED: polyubiquitin 11 isoform X1             404   5e-139   Elaeis guineensis
ref|XP_006370634.1|  hypothetical protein POPTR_0001s44440g             405   5e-139   
ref|XP_002317213.1|  polyubiquitin family protein                       404   6e-139   Populus trichocarpa [western balsam poplar]
gb|AAB36546.1|  polyubiquitin                                           403   6e-139   Phaseolus vulgaris [French bean]
dbj|BAC57955.1|  polyubiquitin                                          404   6e-139   Tripolium pannonicum [sea starwort]
ref|XP_002872805.1|  hypothetical protein ARALYDRAFT_490270             406   6e-139   
gb|AET06143.1|  ubiquitin                                               403   6e-139   Papaver somniferum
ref|XP_010235843.1|  PREDICTED: polyubiquitin 11 isoform X1             405   7e-139   Brachypodium distachyon [annual false brome]
gb|AAM64530.1|  ubiquitin homolog                                       403   7e-139   Arabidopsis thaliana [mouse-ear cress]
gb|EYU33610.1|  hypothetical protein MIMGU_mgv1a004315mg                403   7e-139   Erythranthe guttata [common monkey flower]
ref|XP_006288299.1|  hypothetical protein CARUB_v10001544mg             403   8e-139   
ref|XP_010490793.1|  PREDICTED: polyubiquitin 11-like                   403   8e-139   Camelina sativa [gold-of-pleasure]
gb|ABH08754.1|  ubiquitin                                               403   8e-139   Arabidopsis thaliana [mouse-ear cress]
gb|AAF31707.1|AF221858_1  polyubiquitin                                 402   9e-139   Euphorbia esula [wolf's milk]
gb|KJB62484.1|  hypothetical protein B456_009G418900                    403   9e-139   Gossypium raimondii
gb|ABK94002.1|  unknown                                                 406   9e-139   Populus trichocarpa [western balsam poplar]
ref|XP_004968120.1|  PREDICTED: polyubiquitin-like                      403   9e-139   Setaria italica
emb|CAA48140.1|  ubiquitin                                              405   9e-139   Antirrhinum majus [garden snapdragon]
gb|KDO51109.1|  hypothetical protein CISIN_1g026973mg                   403   1e-138   Citrus sinensis [apfelsine]
gb|KJB36627.1|  hypothetical protein B456_006G167800                    403   1e-138   Gossypium raimondii
gb|ABD96088.1|  polyubiquitin                                           404   1e-138   Malus domestica [apple tree]
gb|AAP31578.1|  ubiquitin                                               403   1e-138   Hevea brasiliensis [jebe]
emb|CAH59739.1|  polyubiquitin                                          403   1e-138   Plantago major [cart-track plant]
ref|XP_006428779.1|  hypothetical protein CICLE_v10012654mg             402   1e-138   Citrus clementina [clementine]
ref|NP_849292.1|  polyubiquitin 14                                      405   1e-138   Arabidopsis thaliana [mouse-ear cress]
gb|AFY06654.1|  polyubiquitin                                           404   1e-138   Carica papaya [mamon]
gb|AGV54749.1|  ubiquitin 11                                            404   1e-138   Phaseolus vulgaris [French bean]
gb|AEZ49160.1|  polyubiquitin                                           404   1e-138   Wolffia australiana
gb|KDO51955.1|  hypothetical protein CISIN_1g026932mg                   402   1e-138   Citrus sinensis [apfelsine]
gb|KJB81823.1|  hypothetical protein B456_013G163500                    405   1e-138   Gossypium raimondii
gb|AAO43307.1|  putative polyubiquitin                                  403   2e-138   Arabidopsis thaliana [mouse-ear cress]
gb|AFK41706.1|  unknown                                                 402   2e-138   Medicago truncatula
gb|EPS72031.1|  polyubiquitin                                           404   2e-138   Genlisea aurea
gb|AAC35858.1|  polyubiquitin                                           404   2e-138   Capsicum chinense [bonnet pepper]
emb|CBY46745.1|  polyubiquitin 10 protein                               405   2e-138   Lepidium appelianum [hairy whitetop]
ref|XP_002872746.1|  hypothetical protein ARALYDRAFT_911794             402   2e-138   
ref|XP_003627152.1|  Ubiquitin                                          404   2e-138   
emb|CBI22349.3|  unnamed protein product                                404   2e-138   Vitis vinifera
gb|AES89865.2|  polyubiquitin 3                                         404   3e-138   Medicago truncatula
ref|XP_002438839.1|  hypothetical protein SORBIDRAFT_10g027030          402   3e-138   Sorghum bicolor [broomcorn]
ref|XP_006377830.1|  hypothetical protein POPTR_0011s13770g             404   3e-138   
ref|XP_010453358.1|  PREDICTED: polyubiquitin-like                      404   4e-138   Camelina sativa [gold-of-pleasure]
gb|AES89866.2|  polyubiquitin 3                                         404   4e-138   Medicago truncatula
gb|ABY60454.1|  putative polyubiquitin                                  403   4e-138   Adonis aestivalis var. palaestina
ref|XP_007154495.1|  hypothetical protein PHAVU_003G1236001g            403   4e-138   Phaseolus vulgaris [French bean]
ref|XP_008784557.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    401   5e-138   
ref|XP_007211606.1|  hypothetical protein PRUPE_ppa005503mg             404   5e-138   
ref|XP_007512209.1|  polyubiquitin                                      406   5e-138   Bathycoccus prasinos
ref|XP_006428822.1|  hypothetical protein CICLE_v10012652mg             401   6e-138   Citrus clementina [clementine]
ref|XP_010452435.1|  PREDICTED: polyubiquitin-like                      404   6e-138   Camelina sativa [gold-of-pleasure]
ref|XP_010258950.1|  PREDICTED: polyubiquitin                           404   6e-138   Nelumbo nucifera [Indian lotus]
gb|AAQ84316.1|  fiber polyubiquitin                                     401   7e-138   Gossypium barbadense [Egyptian cotton]
ref|XP_006685644.1|  ubiquitin                                          400   7e-138   Yamadazyma tenuis ATCC 10573
ref|XP_010492041.1|  PREDICTED: polyubiquitin-like                      404   7e-138   Camelina sativa [gold-of-pleasure]
emb|CAA40323.1|  polyubiquitin protein                                  405   7e-138   Helianthus annuus
dbj|BAJ85978.1|  predicted protein                                      404   7e-138   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006428821.1|  hypothetical protein CICLE_v10012292mg             404   7e-138   Citrus clementina [clementine]
gb|AFK43392.1|  unknown                                                 401   7e-138   Medicago truncatula
gb|EYU33609.1|  hypothetical protein MIMGU_mgv1a004315mg                404   7e-138   Erythranthe guttata [common monkey flower]
ref|NP_851029.1|  polyubiquitin 3                                       404   8e-138   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007014924.1|  Polyubiquitin 3                                    404   8e-138   Theobroma cacao [chocolate]
gb|KDP39203.1|  hypothetical protein JCGZ_00960                         404   8e-138   Jatropha curcas
ref|XP_006302387.1|  hypothetical protein CARUB_v10020456mg             404   8e-138   
ref|XP_002456845.1|  hypothetical protein SORBIDRAFT_03g043940          403   8e-138   Sorghum bicolor [broomcorn]
gb|AAB36545.1|  ubiquitin-like protein                                  407   8e-138   Phaseolus vulgaris [French bean]
ref|XP_006654612.1|  PREDICTED: polyubiquitin-like                      403   9e-138   Oryza brachyantha
ref|XP_009112898.1|  PREDICTED: polyubiquitin                           403   9e-138   Brassica rapa
ref|XP_006480631.1|  PREDICTED: polyubiquitin-like                      403   9e-138   Citrus sinensis [apfelsine]
ref|XP_011468094.1|  PREDICTED: polyubiquitin                           403   9e-138   Fragaria vesca subsp. vesca
emb|CAH59740.1|  polyubiquitin                                          403   9e-138   Plantago major [cart-track plant]
gb|AAL09741.1|  AT4g05320/C17L7_240                                     406   1e-137   Arabidopsis thaliana [mouse-ear cress]
emb|CDP08569.1|  unnamed protein product                                403   1e-137   Coffea canephora [robusta coffee]
sp|P69315.2|UBIQP_LINUS  RecName: Full=Polyubiquitin; Contains: R...    403   1e-137   Linum usitatissimum
ref|XP_007205620.1|  hypothetical protein PRUPE_ppa009116mg             403   1e-137   
gb|KJB62487.1|  hypothetical protein B456_009G418900                    403   1e-137   Gossypium raimondii
ref|XP_006396611.1|  hypothetical protein EUTSA_v10028730mg             403   1e-137   
ref|XP_002873083.1|  hypothetical protein ARALYDRAFT_487095             403   1e-137   
gb|AFW66439.1|  putative ubiquitin family protein                       403   1e-137   
gb|AAO42469.1|  putative polyubiquitin                                  402   1e-137   Arabidopsis lyrata [lyrate rockcress]
gb|KDP38838.1|  hypothetical protein JCGZ_04995                         403   1e-137   Jatropha curcas
ref|XP_006428820.1|  hypothetical protein CICLE_v10012290mg             403   1e-137   Citrus clementina [clementine]
emb|CDP05795.1|  unnamed protein product                                406   1e-137   Coffea canephora [robusta coffee]
ref|XP_010240921.1|  PREDICTED: polyubiquitin-like                      406   1e-137   Nelumbo nucifera [Indian lotus]
emb|CBY46746.1|  polyubiquitin 10 protein                               406   1e-137   Lepidium campestre [bastard cress]
prf||1604470A  poly-ubiquitin                                           402   1e-137   Zea mays [maize]
ref|XP_003537278.1|  PREDICTED: polyubiquitin-like                      403   1e-137   Glycine max [soybeans]
gb|ACD31680.1|  ubiquitin                                               403   1e-137   Gossypium hirsutum [American cotton]
sp|P0CG84.1|UBI4P_NICSY  RecName: Full=Polyubiquitin; Contains: R...    405   1e-137   Nicotiana sylvestris
gb|KJB13592.1|  hypothetical protein B456_002G083000                    406   1e-137   Gossypium raimondii
ref|NP_849300.4|  polyubiquitin 10                                      405   1e-137   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011077812.1|  PREDICTED: polyubiquitin 3                         404   2e-137   
gb|AAB68045.1|  polyubiquitin                                           405   2e-137   Fragaria x ananassa
gb|KJB81825.1|  hypothetical protein B456_013G163500                    405   2e-137   Gossypium raimondii
ref|XP_009763135.1|  PREDICTED: polyubiquitin-like                      405   2e-137   Nicotiana sylvestris
ref|XP_010938693.1|  PREDICTED: polyubiquitin                           403   2e-137   Elaeis guineensis
gb|KIM78989.1|  hypothetical protein PILCRDRAFT_573034                  400   2e-137   Piloderma croceum F 1598
ref|XP_006428925.1|  hypothetical protein CICLE_v10012291mg             403   2e-137   Citrus clementina [clementine]
emb|CAA54603.1|  pentameric polyubiquitin                               404   2e-137   Nicotiana tabacum [American tobacco]
ref|XP_002992988.1|  hypothetical protein SELMODRAFT_187148             400   2e-137   Selaginella moellendorffii
ref|XP_009358096.1|  PREDICTED: polyubiquitin isoform X1                406   2e-137   Pyrus x bretschneideri [bai li]
ref|XP_009605659.1|  PREDICTED: polyubiquitin                           402   2e-137   Nicotiana tomentosiformis
gb|AAB95250.1|  ubiquitin                                               402   2e-137   Arabidopsis thaliana [mouse-ear cress]
gb|KIM78981.1|  hypothetical protein PILCRDRAFT_10644                   400   2e-137   Piloderma croceum F 1598
gb|KIR83632.1|  polyubiquitin                                           399   2e-137   Cryptococcus gattii VGIV IND107
gb|AEW46688.1|  polyubiquitin                                           399   2e-137   Ulva linza
ref|XP_006593989.1|  PREDICTED: polyubiquitin 10-like isoform X1        405   2e-137   
ref|XP_009631616.1|  PREDICTED: polyubiquitin-like                      405   2e-137   Nicotiana tomentosiformis
gb|KJB14874.1|  hypothetical protein B456_002G147600                    404   2e-137   Gossypium raimondii
ref|NP_001147027.1|  polyubiquitin containing 7 ubiquitin monomers      402   2e-137   
dbj|BAL61087.1|  polyubiquitin                                          399   2e-137   Dianthus caryophyllus [carnation]
gb|EJU04700.1|  polyubiquitin UbiD/Ubi4                                 399   2e-137   Dacryopinax primogenitus
ref|XP_719867.1|  hypothetical protein CaO19.6771                       399   2e-137   Candida albicans SC5314
gb|KJA26171.1|  hypothetical protein HYPSUDRAFT_354705                  399   2e-137   Hypholoma sublateritium FD-334 SS-4
gb|KDB11907.1|  ubiquitin                                               402   2e-137   Ustilaginoidea virens
ref|XP_011110054.1|  hypothetical protein H072_4094                     399   2e-137   
gb|AAK68824.1|  Unknown protein                                         399   2e-137   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001783045.1|  predicted protein                                  399   3e-137   
ref|XP_008796945.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    402   3e-137   Phoenix dactylifera
gb|KJB62485.1|  hypothetical protein B456_009G418900                    402   3e-137   Gossypium raimondii
ref|XP_007154496.1|  hypothetical protein PHAVU_003G1236001g            402   3e-137   Phaseolus vulgaris [French bean]
ref|XP_003574865.1|  PREDICTED: polyubiquitin-like                      403   3e-137   Brachypodium distachyon [annual false brome]
ref|XP_007339454.1|  ubiquitin                                          402   3e-137   
emb|CDP08567.1|  unnamed protein product                                404   4e-137   Coffea canephora [robusta coffee]
ref|XP_001830230.1|  ubiquitin                                          402   4e-137   Coprinopsis cinerea okayama7#130
ref|XP_006288300.1|  hypothetical protein CARUB_v10001544mg             402   4e-137   Capsella rubella
gb|KIK28767.1|  hypothetical protein PISMIDRAFT_672939                  399   4e-137   Pisolithus microcarpus 441
ref|XP_006372519.1|  polyubiquitin family protein                       402   4e-137   Populus trichocarpa [western balsam poplar]
ref|XP_010227188.1|  PREDICTED: polyubiquitin isoform X1                403   4e-137   
gb|KEH31155.1|  polyubiquitin 3                                         404   4e-137   Medicago truncatula
ref|NP_001148453.1|  LOC100282068                                       404   4e-137   Zea mays [maize]
gb|AIY27743.1|  polyubiquitin Ubi10                                     402   5e-137   Betula luminifera [liang ye hua]
gb|KIK92093.1|  hypothetical protein PAXRUDRAFT_830299                  398   6e-137   Paxillus rubicundulus Ve08.2h10
gb|ADD52202.1|  ubiquitin                                               404   6e-137   Catharanthus roseus [chatas]
ref|XP_002872109.1|  predicted protein                                  404   6e-137   
emb|CEF99839.1|  Ubiquitin conserved site                               402   6e-137   Ostreococcus tauri
gb|EGO00904.1|  hypothetical protein SERLA73DRAFT_178893                401   6e-137   Serpula lacrymans var. lacrymans S7.3
gb|KJB81824.1|  hypothetical protein B456_013G163500                    404   7e-137   Gossypium raimondii
gb|KIL68862.1|  hypothetical protein M378DRAFT_157997                   401   7e-137   Amanita muscaria Koide BX008
gb|EWZ40370.1|  ubiquitin C                                             398   7e-137   Fusarium oxysporum Fo47
ref|XP_008020911.1|  hypothetical protein SETTUDRAFT_162442             401   7e-137   Exserohilum turcica Et28A
ref|XP_006381473.1|  polyubiquitin family protein                       401   8e-137   
emb|CDR41572.1|  RHTO0S06e03070g1_1                                     398   8e-137   Rhodotorula toruloides
ref|XP_009108753.1|  PREDICTED: polyubiquitin 11-like                   398   8e-137   Brassica rapa
ref|XP_007154493.1|  hypothetical protein PHAVU_003G123500g             405   9e-137   Phaseolus vulgaris [French bean]
gb|AGV54228.1|  polyubiquitin-like protein                              404   9e-137   Phaseolus vulgaris [French bean]
ref|XP_006396612.1|  hypothetical protein EUTSA_v10028730mg             404   9e-137   Eutrema salsugineum [saltwater cress]
ref|XP_010270791.1|  PREDICTED: polyubiquitin-like                      404   9e-137   Nelumbo nucifera [Indian lotus]
ref|XP_002874006.1|  hypothetical protein ARALYDRAFT_488966             404   9e-137   
ref|NP_001105376.1|  polyubiquitin                                      404   1e-136   
ref|XP_010240636.1|  PREDICTED: polyubiquitin isoform X1                404   1e-136   
ref|XP_002508175.1|  ubiquitin                                          404   1e-136   Micromonas commoda
gb|EYU33608.1|  hypothetical protein MIMGU_mgv1a004315mg                404   1e-136   Erythranthe guttata [common monkey flower]
gb|ACS68205.1|  ubiquitin 10.2                                          404   1e-136   Brassica napus [oilseed rape]
ref|XP_010911599.1|  PREDICTED: polyubiquitin 4                         404   1e-136   Elaeis guineensis
gb|ABU40645.1|  polyubiquitin                                           404   1e-136   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003670049.1|  hypothetical protein NDAI_0D04930                  398   1e-136   Naumovozyma dairenensis CBS 421
gb|AAQ07453.1|  ubiquitin                                               404   1e-136   Musa acuminata AAA Group [Cavendish banana]
ref|XP_010062974.1|  PREDICTED: polyubiquitin                           405   1e-136   Eucalyptus grandis [rose gum]
ref|NP_001174480.1|  Os05g0504766                                       404   1e-136   
ref|NP_568397.1|  ubiquitin 4                                           404   1e-136   Arabidopsis thaliana [mouse-ear cress]
emb|CAC94926.1|  putative ubiquitin                                     398   1e-136   Pleurotus sp. 'Florida' [Florida oyster mushroom]
ref|XP_001420612.1|  predicted protein                                  404   1e-136   Ostreococcus lucimarinus CCE9901
ref|XP_010558157.1|  PREDICTED: polyubiquitin-like                      404   1e-136   Tarenaya hassleriana [spider flower]
gb|AAM78180.1|  putative polyubiquitin                                  397   1e-136   Gossypium herbaceum [Arabian cotton]
gb|KJB62483.1|  hypothetical protein B456_009G418900                    403   1e-136   Gossypium raimondii
ref|XP_002266370.1|  PREDICTED: polyubiquitin 4-like                    403   1e-136   Vitis vinifera
ref|XP_006302388.1|  hypothetical protein CARUB_v10020456mg             403   1e-136   Capsella rubella
ref|XP_009596689.1|  PREDICTED: polyubiquitin-like                      403   1e-136   Nicotiana tomentosiformis
emb|CCL99875.1|  predicted protein                                      400   1e-136   Fibroporia radiculosa
gb|EYU18102.1|  hypothetical protein MIMGU_mgv1a008166mg                403   1e-136   Erythranthe guttata [common monkey flower]
ref|XP_010454368.1|  PREDICTED: polyubiquitin 4-like                    403   1e-136   Camelina sativa [gold-of-pleasure]
ref|XP_006428816.1|  hypothetical protein CICLE_v10011684mg             403   1e-136   
sp|Q58G87.2|UBQ3_ORYSJ  RecName: Full=Polyubiquitin 3; Contains: ...    403   1e-136   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010696408.1|  PREDICTED: polyubiquitin 4                         403   1e-136   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010431529.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    406   1e-136   Camelina sativa [gold-of-pleasure]
ref|XP_008441422.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    406   1e-136   Cucumis melo [Oriental melon]
ref|NP_849299.4|  polyubiquitin 10                                      406   1e-136   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003542730.1|  PREDICTED: polyubiquitin 10-like                   406   1e-136   
ref|XP_010324327.1|  PREDICTED: polyubiquitin isoform X2                403   1e-136   
gb|AAY86773.1|  polyubiquitin                                           403   1e-136   Noccaea caerulescens
ref|XP_009591312.1|  PREDICTED: polyubiquitin 4                         403   2e-136   Nicotiana tomentosiformis
gb|KJB81827.1|  hypothetical protein B456_013G163500                    406   2e-136   Gossypium raimondii
ref|XP_009784905.1|  PREDICTED: polyubiquitin-like isoform X1           406   2e-136   Nicotiana sylvestris
ref|XP_011038259.1|  PREDICTED: polyubiquitin-like                      400   2e-136   Populus euphratica
emb|CEP60563.1|  LALA0S01e13784g1_1                                     397   2e-136   Lachancea lanzarotensis
gb|EPX74297.1|  ubiquitin                                               397   2e-136   Schizosaccharomyces octosporus yFS286
ref|XP_010421267.1|  PREDICTED: polyubiquitin 4-like                    403   2e-136   Camelina sativa [gold-of-pleasure]
emb|CCT70325.1|  UBI4-Ubiquitin                                         399   2e-136   Fusarium fujikuroi IMI 58289
gb|AAO43308.1|  putative polyubiquitin                                  398   2e-136   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001764949.1|  predicted protein                                  400   2e-136   
gb|KJB62486.1|  hypothetical protein B456_009G418900                    403   2e-136   Gossypium raimondii
ref|XP_004956019.1|  PREDICTED: polyubiquitin 4-like                    403   2e-136   Setaria italica
gb|KJB13590.1|  hypothetical protein B456_002G083000                    406   2e-136   Gossypium raimondii
ref|NP_001053957.1|  Os04g0628100                                       403   2e-136   
ref|XP_007763327.1|  polyubiquitin                                      400   2e-136   Coniophora puteana RWD-64-598 SS2
sp|P0CG73.1|UBI1P_CANAX  RecName: Full=Polyubiquitin; Contains: R...    397   2e-136   Candida albicans
gb|KIJ45725.1|  hypothetical protein M422DRAFT_106821                   400   2e-136   Sphaerobolus stellatus SS14
ref|XP_001755431.1|  predicted protein                                  397   2e-136   
ref|XP_001931824.1|  ubiquitin                                          397   2e-136   Pyrenophora tritici-repentis Pt-1C-BFP
gb|KIY45417.1|  ubiquitin                                               400   2e-136   Fistulina hepatica ATCC 64428
ref|XP_003030030.1|  polyubiquitin                                      400   2e-136   Schizophyllum commune H4-8
gb|EMS65864.1|  Polyubiquitin                                           404   2e-136   Triticum urartu
gb|KDQ20365.1|  hypothetical protein BOTBODRAFT_123907                  400   2e-136   Botryobasidium botryosum FD-172 SS1
emb|CAB81074.1|  polyubiquitin (ubq10)                                  405   2e-136   Arabidopsis thaliana [mouse-ear cress]
gb|KIY53974.1|  polyubiquitin                                           400   2e-136   Fistulina hepatica ATCC 64428
ref|XP_011048569.1|  PREDICTED: polyubiquitin 3-like                    400   2e-136   Populus euphratica
gb|AAX40652.1|  polyubiquitin                                           402   2e-136   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001555417.1|  polyubiquitin                                      400   2e-136   Botrytis cinerea B05.10
ref|XP_002980153.1|  hypothetical protein SELMODRAFT_271419             400   2e-136   
ref|XP_007924320.1|  hypothetical protein MYCFIDRAFT_60610              397   2e-136   Pseudocercospora fijiensis CIRAD86
gb|KIR63773.1|  polyubiquitin                                           400   2e-136   Cryptococcus gattii CA1873
gb|AHC00631.1|  polyubiquitin                                           400   2e-136   Ganoderma lucidum
ref|XP_001828882.1|  ubiquitin C                                        400   2e-136   Coprinopsis cinerea okayama7#130
gb|KIR29996.1|  polyubiquitin                                           400   3e-136   Cryptococcus gattii VGII LA55
ref|XP_011037020.1|  PREDICTED: polyubiquitin-like                      403   3e-136   Populus euphratica
ref|XP_001598085.1|  polyubiquitin                                      400   3e-136   Sclerotinia sclerotiorum 1980 UF-70
ref|XP_008244357.1|  PREDICTED: polyubiquitin isoform X1                405   3e-136   Prunus mume [ume]
ref|XP_006287868.1|  hypothetical protein CARUB_v10001095mg             403   3e-136   
ref|XP_001755307.1|  predicted protein                                  399   3e-136   
gb|EKV18932.1|  hypothetical protein PDIP_25190                         397   3e-136   Penicillium digitatum Pd1
ref|XP_002419618.1|  ubiquitin, putative                                399   3e-136   Candida dubliniensis CD36
ref|XP_010493589.1|  PREDICTED: polyubiquitin-like                      404   3e-136   Camelina sativa [gold-of-pleasure]
ref|XP_007205619.1|  hypothetical protein PRUPE_ppa009116mg             396   4e-136   
ref|XP_001797032.1|  hypothetical protein SNOG_06667                    397   4e-136   Parastagonospora nodorum SN15
gb|KIM67150.1|  hypothetical protein SCLCIDRAFT_1210637                 399   4e-136   Scleroderma citrinum Foug A
ref|XP_007864655.1|  ubiquitin                                          402   4e-136   Gloeophyllum trabeum ATCC 11539
ref|XP_001777816.1|  predicted protein                                  402   4e-136   
ref|XP_002953480.1|  polyubiquitin                                      399   4e-136   Volvox carteri f. nagariensis
emb|CCA70326.1|  related to UBI4-Ubiquitin                              396   4e-136   Serendipita indica DSM 11827
ref|XP_007366816.1|  polyubiquitin                                      399   4e-136   Dichomitus squalens LYAD-421 SS1
ref|XP_003010029.1|  polyubiquitin UbiD/Ubi4, putative                  396   5e-136   Trichophyton benhamiae CBS 112371
gb|KIM30634.1|  hypothetical protein M408DRAFT_328170                   396   5e-136   Serendipita vermifera MAFF 305830
ref|XP_007049060.1|  Polyubiquitin 10                                   404   5e-136   
gb|AAN31845.1|  putative polyubiquitin (UBQ10)                          405   6e-136   Arabidopsis thaliana [mouse-ear cress]
emb|CCG34086.1|  Polyubiquitin                                          399   7e-136   uncultured eukaryote
gb|KIM22018.1|  hypothetical protein M408DRAFT_333137                   395   7e-136   Serendipita vermifera MAFF 305830
gb|AAO43309.1|  putative polyubiquitin                                  396   7e-136   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002551324.1|  ubiquitin                                          398   7e-136   Candida tropicalis MYA-3404
gb|EGA57707.1|  Ubi4p                                                   396   7e-136   Saccharomyces cerevisiae FostersB
dbj|GAK65396.1|  ubiquitin                                              399   8e-136   Moesziomyces antarcticus
gb|KII93501.1|  hypothetical protein PLICRDRAFT_694663                  400   8e-136   Plicaturopsis crispa FD-325 SS-3
ref|XP_003052575.1|  predicted protein                                  398   8e-136   [Nectria] haematococca mpVI 77-13-4
ref|XP_009784908.1|  PREDICTED: polyubiquitin-like isoform X2           404   8e-136   Nicotiana sylvestris
ref|XP_007154492.1|  hypothetical protein PHAVU_003G123400g             400   8e-136   Phaseolus vulgaris [French bean]
ref|XP_010436682.1|  PREDICTED: polyubiquitin 4-like                    404   9e-136   
dbj|BAK02501.1|  predicted protein                                      404   9e-136   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_005644220.1|  polyubiquitin                                      398   9e-136   Coccomyxa subellipsoidea C-169
gb|AAB95252.1|  ubiquitin                                               401   9e-136   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003607669.1|  Multidrug resistance protein ABC transporter...    404   9e-136   
ref|XP_007211609.1|  hypothetical protein PRUPE_ppa005507mg             404   9e-136   Prunus persica
ref|XP_010324326.1|  PREDICTED: polyubiquitin isoform X1                404   9e-136   
gb|EYU33607.1|  hypothetical protein MIMGU_mgv1a004315mg                404   1e-135   Erythranthe guttata [common monkey flower]
gb|AAD03343.1|  ubiquitin                                               404   1e-135   Pisum sativum [garden pea]
ref|XP_004953565.1|  PREDICTED: polyubiquitin-like                      404   1e-135   Setaria italica
gb|KDP42860.1|  hypothetical protein JCGZ_23802                         404   1e-135   Jatropha curcas
emb|CAA40324.1|  hexaubiquitin protein                                  404   1e-135   Helianthus annuus
ref|NP_001045980.1|  Os02g0161900                                       404   1e-135   
ref|XP_006428817.1|  hypothetical protein CICLE_v10011684mg             404   1e-135   
gb|AAB95251.1|  ubiquitin                                               404   1e-135   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010275241.1|  PREDICTED: polyubiquitin-like                      401   1e-135   Nelumbo nucifera [Indian lotus]
ref|XP_010262389.1|  PREDICTED: polyubiquitin                           404   1e-135   Nelumbo nucifera [Indian lotus]
ref|XP_002891806.1|  predicted protein                                  401   1e-135   
ref|XP_010423744.1|  PREDICTED: polyubiquitin                           404   1e-135   Camelina sativa [gold-of-pleasure]
ref|XP_002888365.1|  polyubiquitin                                      404   1e-135   Arabidopsis lyrata subsp. lyrata
ref|XP_002452705.1|  hypothetical protein SORBIDRAFT_04g031060          404   1e-135   Sorghum bicolor [broomcorn]
dbj|BAK03691.1|  predicted protein                                      403   1e-135   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008350368.1|  PREDICTED: polyubiquitin                           403   1e-135   
gb|AAC16012.1|  polyubiquitin                                           403   1e-135   Elaeagnus umbellata [aki-gumi]
gb|AFK47245.1|  unknown                                                 395   1e-135   
gb|EMS60894.1|  Polyubiquitin                                           403   2e-135   
ref|XP_003542728.1|  PREDICTED: polyubiquitin-A-like isoform 1          406   2e-135   
ref|XP_003627151.1|  Ubiquitin                                          406   2e-135   
ref|XP_011094250.1|  PREDICTED: polyubiquitin-like                      403   2e-135   
ref|XP_011094650.1|  PREDICTED: polyubiquitin                           403   2e-135   
dbj|BAJ91912.1|  predicted protein                                      403   2e-135   
ref|XP_009618235.1|  PREDICTED: polyubiquitin-like isoform X1           406   2e-135   
ref|XP_005831810.1|  ubiquitin                                          395   2e-135   
gb|KIW56414.1|  polyubiquitin                                           397   2e-135   
gb|ACN40936.1|  unknown                                                 403   2e-135   
ref|XP_008345409.1|  PREDICTED: polyubiquitin-like                      403   2e-135   
ref|XP_659604.1|  hypothetical protein AN2000.2                         398   2e-135   
gb|EZF98642.1|  polyubiquitin                                           394   2e-135   
ref|XP_002839703.1|  hypothetical protein                               397   2e-135   
ref|XP_002494205.1|  Ubiquitin                                          397   2e-135   
gb|AGT38457.1|  polyubiquitin                                           404   2e-135   
ref|XP_002976481.1|  hypothetical protein SELMODRAFT_271198             400   2e-135   
gb|KDQ30621.1|  hypothetical protein PLEOSDRAFT_1088454                 400   2e-135   
gb|AFR98116.1|  polyubiquitin                                           400   2e-135   
dbj|BAP70433.1|  Ubiquitin                                              397   2e-135   
ref|XP_002888394.1|  hexaubiquitin protein                              404   2e-135   
gb|AAV65292.1|  polyubiquitin                                           397   2e-135   
gb|AFW70219.1|  polyubiquitin-like protein                              404   2e-135   
ref|XP_003350608.1|  hypothetical protein SMAC_07925                    394   2e-135   
gb|AIS40894.1|  polyubiquitin                                           403   2e-135   
gb|AAO43306.1|  putative polyubiquitin                                  398   3e-135   
ref|XP_010537590.1|  PREDICTED: polyubiquitin 11                        394   3e-135   
ref|XP_001880135.1|  ubiquitin                                          400   3e-135   
gb|EGO00841.1|  hypothetical protein SERLA73DRAFT_121253                399   3e-135   
ref|XP_001266981.1|  polyubiquitin (UbiD), putative                     397   3e-135   
ref|XP_001210780.1|  ubiquitin                                          397   3e-135   
gb|EJU00136.1|  ubiquitin                                               400   3e-135   
gb|KIK17147.1|  hypothetical protein PISMIDRAFT_685607                  400   3e-135   
gb|EUC59758.1|  polyubiquitin                                           400   3e-135   
gb|KIJ68260.1|  hypothetical protein HYDPIDRAFT_173033                  400   3e-135   
ref|XP_002992907.1|  hypothetical protein SELMODRAFT_162680             400   3e-135   
gb|KEZ40313.1|  Polyubiquitin                                           397   3e-135   
dbj|BAL61084.1|  polyubiqutin                                           400   3e-135   
ref|XP_001227036.1|  polyubiquitin                                      397   3e-135   
ref|XP_751791.1|  polyubiquitin UbiD/Ubi4                               397   3e-135   
gb|KIM40192.1|  hypothetical protein M413DRAFT_73842                    400   3e-135   
gb|KDR85168.1|  hypothetical protein GALMADRAFT_131895                  400   3e-135   
gb|EFN76024.1|  Ubiquitin                                               394   3e-135   
gb|KII92029.1|  hypothetical protein PLICRDRAFT_172184                  400   3e-135   
ref|XP_007316637.1|  hypothetical protein SERLADRAFT_368035             400   3e-135   
ref|XP_010756991.1|  polyubiquitin                                      397   4e-135   
gb|EEH07231.1|  ubiquitin                                               397   4e-135   
gb|AEZ66647.1|  putative beta-1,6-glucanase                             399   4e-135   
gb|EEH20847.2|  polyubiquitin                                           397   4e-135   
ref|XP_003196661.1|  ATP-dependent protein binding protein              399   4e-135   
ref|XP_010046742.1|  PREDICTED: polyubiquitin-like                      402   4e-135   
gb|EGE85556.1|  hypothetical protein BDDG_08501                         398   4e-135   
gb|EKV13151.1|  hypothetical protein PDIG_39650                         397   4e-135   
gb|KIM48035.1|  hypothetical protein M413DRAFT_16078                    399   4e-135   
tpd|FAA00317.1|  TPA: polyubiquitin                                     396   4e-135   
tpe|CBF85986.1|  TPA: Polyubiquitin Fragment [Source:UniProtKB/Tr...    396   5e-135   
ref|XP_003607670.1|  Ubiquitin                                          405   5e-135   
gb|EEQ88150.1|  ubiquitin                                               396   5e-135   
gb|ACX46987.1|  ubiquitin                                               401   5e-135   
gb|EYU38681.1|  hypothetical protein MIMGU_mgv1a004304mg                404   5e-135   
ref|XP_003607668.1|  Multidrug resistance protein ABC transporter...    403   5e-135   
gb|KIY97628.1|  ubiquitin C                                             396   6e-135   
ref|XP_007808982.1|  ubiquitin                                          397   6e-135   
emb|CCO30833.1|  Polyubiquitin                                          400   6e-135   
gb|AAO43310.1|  putative polyubiquitin                                  394   6e-135   
ref|XP_010451655.1|  PREDICTED: polyubiquitin 4-like                    404   7e-135   
emb|CAA52290.1|  polyubiquitin                                          399   7e-135   
ref|XP_002791169.1|  ubiquitin                                          396   7e-135   
emb|CDH08450.1|  ubiquitin and ubiquitin-like proteins                  396   7e-135   
ref|XP_004341200.1|  polyubiquitin, putative                            393   7e-135   
dbj|GAA87419.1|  polyubiquitin                                          396   7e-135   
ref|XP_001246797.1|  polyubiquitin                                      396   8e-135   
sp|P0CH27.1|RL402_TRYCR  RecName: Full=Ubiquitin-60S ribosomal pr...    398   9e-135   
gb|AAL91103.1|  ubiquitin                                               394   9e-135   
ref|XP_004505453.1|  PREDICTED: polyubiquitin-A-like                    404   1e-134   
emb|CCA16073.1|  polyubiquitin putative                                 404   1e-134   
gb|AAA82978.1|  polyubiquitin                                           398   1e-134   
dbj|GAA27344.2|  polyubiquitin-A                                        395   1e-134   
gb|AFW66445.1|  ubiquitin2                                              404   1e-134   
gb|AAC67552.1|  polyubiquitin                                           398   1e-134   
gb|EYU33611.1|  hypothetical protein MIMGU_mgv1a004315mg                404   1e-134   
emb|CAA51679.1|  ubiquitin                                              404   1e-134   
ref|XP_008645269.1|  PREDICTED: polyubiquitin                           404   1e-134   
ref|XP_004249885.1|  PREDICTED: polyubiquitin-like                      404   1e-134   
ref|XP_001538486.1|  polyubiquitin                                      395   1e-134   
ref|XP_006350990.1|  PREDICTED: polyubiquitin-A-like                    404   1e-134   
ref|XP_007410937.1|  hypothetical protein MELLADRAFT_87680              404   1e-134   
ref|XP_003608276.1|  Ubiquitin                                          404   1e-134   
ref|XP_010553005.1|  PREDICTED: polyubiquitin-like                      404   1e-134   
gb|AAC49013.1|  polyubiquitin containing 7 ubiquitin monomers           404   1e-134   
ref|XP_002171731.1|  ubiquitin                                          398   1e-134   
ref|XP_009620669.1|  PREDICTED: polyubiquitin-like                      406   1e-134   
ref|XP_009150698.1|  PREDICTED: polyubiquitin                           403   1e-134   
gb|ABD32351.2|  Ubiquitin                                               404   1e-134   
gb|AGM32540.1|  polyubiquitin-B-like isoform                            393   2e-134   
dbj|BAK61744.1|  ubiquitin                                              392   2e-134   
gb|EYU18101.1|  hypothetical protein MIMGU_mgv1a004289mg                403   2e-134   
ref|XP_006480550.1|  PREDICTED: polyubiquitin-A-like                    403   2e-134   
gb|KHN45015.1|  Polyubiquitin-A                                         406   2e-134   
gb|KJB62482.1|  hypothetical protein B456_009G418900                    398   2e-134   
gb|AAO43305.1|  putative polyubiquitin                                  395   2e-134   
gb|AAY33920.2|  polyubiquitin                                           398   2e-134   
gb|KDR10312.1|  Ubiquitin                                               392   2e-134   
ref|XP_002842034.1|  hypothetical protein                               395   2e-134   
ref|XP_006694532.1|  hypothetical protein CTHT_0041260                  395   2e-134   
emb|CAN71997.1|  hypothetical protein VITISV_004025                     403   2e-134   
gb|AGM32487.1|  polyubiquitin-B-like isoform 1                          392   2e-134   
emb|CCA40372.1|  Ubiquitin cross-reactive protein                       398   2e-134   
ref|XP_002267017.1|  PREDICTED: polyubiquitin-like                      403   2e-134   
ref|XP_008034069.1|  ubiquitin 10.1                                     400   2e-134   
gb|EYC42800.1|  hypothetical protein Y032_0517g2809                     392   3e-134   
gb|AEH41483.1|  ubiquitin                                               394   3e-134   
ref|XP_001774326.1|  predicted protein                                  400   3e-134   
ref|XP_006352490.1|  PREDICTED: polyubiquitin-A-like isoform X1         405   3e-134   
ref|NP_983342.1|  ACL062Cp                                              397   3e-134   
ref|XP_011275993.1|  ubiquitin C                                        397   3e-134   
ref|XP_003590494.1|  Ubiquitin                                          395   3e-134   
ref|NP_595409.1|  ubiquitin                                             397   3e-134   
dbj|BAO38900.1|  ubiquitin                                              397   3e-134   
ref|NP_013061.1|  ubiquitin                                             397   3e-134   
sp|P23324.2|UBIQP_EUPEU  RecName: Full=Polyubiquitin; Contains: R...    391   3e-134   
ref|XP_958803.1|  ubiquitin                                             394   3e-134   
ref|XP_003402310.1|  PREDICTED: polyubiquitin-B-like isoform 1          391   3e-134   
ref|XP_453980.1|  hypothetical protein                                  397   3e-134   
ref|XP_003675939.1|  hypothetical protein NCAS_0C05850                  397   3e-134   
gb|ELR08709.1|  polyubiquitin                                           397   3e-134   
gb|EMS24129.1|  ubiquitin C                                             392   3e-134   
gb|ETN78467.1|  ubiquitin family protein                                391   4e-134   
ref|XP_007307433.1|  polyubiquitin                                      400   4e-134   
ref|XP_002973843.1|  hypothetical protein SELMODRAFT_173723             400   4e-134   
dbj|GAA55031.1|  ubiquitin C                                            391   4e-134   
tpd|FAA00316.1|  TPA: polyubiquitin                                     397   4e-134   
ref|XP_002627625.1|  ubiquitin                                          397   4e-134   
gb|KDQ63803.1|  hypothetical protein JAAARDRAFT_29850                   400   4e-134   
ref|XP_011302492.1|  PREDICTED: polyubiquitin-B                         394   4e-134   
ref|XP_002553736.1|  KLTH0E05852p                                       398   4e-134   
ref|XP_011388891.1|  putative ubiquitin                                 400   4e-134   
ref|XP_567862.1|  ATP-dependent protein binding protein                 400   4e-134   
tpd|FAA00319.1|  TPA: polyubiquitin                                     400   4e-134   
ref|XP_007861169.1|  polyubiquitin                                      399   4e-134   
pir||T02358  ubiquitin homolog T8F5.13 - Arabidopsis thaliana           395   5e-134   
gb|AFD53810.1|  ubiquitin                                               392   5e-134   
ref|XP_008816966.1|  polyubiquitin                                      394   5e-134   
gb|KFY77115.1|  hypothetical protein V499_03430                         397   5e-134   
dbj|BAK61751.1|  ubiquitin                                              390   6e-134   
ref|XP_003843815.1|  hypothetical protein LEMA_P014660.1                397   7e-134   
gb|KIZ01427.1|  ubiquitin C                                             396   8e-134   
ref|XP_001766873.1|  predicted protein                                  395   8e-134   
ref|XP_004365491.1|  polyubiquitin 5                                    390   9e-134   
ref|NP_176714.4|  ubiquitin 13                                          394   9e-134   
emb|CAA11269.1|  polyubiquitin                                          396   1e-133   
gb|AAP80689.1|  polyubiquitin                                           390   1e-133   
ref|XP_008243902.1|  PREDICTED: polyubiquitin-like isoform X1           401   1e-133   
ref|XP_003331105.1|  polyubiquitin-A                                    404   1e-133   
emb|CDI53149.1|  probable Polyubiquitin protein                         393   1e-133   
gb|AAL91109.1|  ubiquitin                                               393   1e-133   
gb|ABV22331.1|  ubiquitin                                               392   1e-133   
gb|ABR25697.1|  polyubiquitin containing 7 ubiquitin monomers           389   1e-133   
emb|CAJ41447.1|  polyubiquitin                                          392   1e-133   
gb|AAO43304.1|  putative polyubiquitin                                  393   2e-133   
gb|EIE87024.1|  polyubiquitin                                           390   2e-133   
ref|XP_001761027.1|  predicted protein                                  401   2e-133   
gb|KFY10578.1|  hypothetical protein V492_04946                         397   2e-133   
gb|AAO43303.1|  putative polyubiquitin                                  393   2e-133   
gb|EJD76734.1|  polyubiquitin, variant 2                                393   2e-133   
gb|ADD24466.1|  Ubiquitin                                               389   2e-133   
emb|CEL52635.1|  Polyubiquitin OS=Petroselinum crispum GN=PCUBI4-...    400   2e-133   
gb|EWS74283.1|  polyubiquitin                                           389   2e-133   
ref|XP_002498336.1|  ZYRO0G07854p                                       398   2e-133   
emb|CAI83758.1|  Polyubiqutin 5                                         389   2e-133   
ref|XP_004505084.1|  PREDICTED: polyubiquitin-A-like                    405   2e-133   
ref|XP_006593991.1|  PREDICTED: polyubiquitin 10-like isoform X3        405   3e-133   
ref|XP_005056764.1|  PREDICTED: polyubiquitin-C-like isoform X2         389   3e-133   
ref|XP_011094688.1|  PREDICTED: polyubiquitin-like                      403   3e-133   
ref|XP_002964737.1|  hypothetical protein SELMODRAFT_270468             400   3e-133   
gb|ABF66639.1|  ubiquitin                                               392   3e-133   
ref|XP_008796191.1|  PREDICTED: polyubiquitin-like                      392   3e-133   
gb|AGZ15412.1|  fiber polyubiquitin                                     389   3e-133   
ref|XP_460488.1|  DEHA2F02816p                                          397   3e-133   
gb|ABI53721.1|  polyubiquitin                                           397   3e-133   
ref|XP_001486573.1|  ubiquitin                                          397   4e-133   
gb|ESA16475.1|  hypothetical protein GLOINDRAFT_345541                  389   5e-133   
ref|XP_006306291.1|  hypothetical protein CARUB_v10012156mg             397   5e-133   
emb|CDP08561.1|  unnamed protein product                                403   5e-133   
gb|KFK28664.1|  hypothetical protein AALP_AA7G029700                    391   6e-133   
gb|KIJ26545.1|  hypothetical protein M422DRAFT_216245                   400   6e-133   
emb|CAA72799.1|  polyubiquitin precursor                                394   6e-133   
ref|XP_011152175.1|  PREDICTED: polyubiquitin                           394   6e-133   
gb|EXX50352.1|  ubiquitin                                               394   7e-133   
ref|XP_002674746.1|  polyubiquitin                                      388   7e-133   
gb|EXX61285.1|  ubiquitin                                               391   7e-133   
ref|XP_002723083.2|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    389   7e-133   
dbj|BAH71115.1|  ACYPI006410                                            388   7e-133   
ref|XP_004946727.1|  PREDICTED: polyubiquitin-C-like isoform X9         388   7e-133   
ref|XP_007545871.1|  PREDICTED: polyubiquitin-B isoform X2              389   8e-133   
ref|XP_010669246.1|  PREDICTED: polyubiquitin-like                      396   8e-133   
ref|XP_003290908.1|  ubiquitin                                          388   8e-133   
gb|EMS54972.1|  Polyubiquitin-A                                         403   8e-133   
ref|XP_004946726.1|  PREDICTED: polyubiquitin-C-like isoform X8         389   8e-133   
gb|AAA31133.1|  poly-ubiquitin precursor                                389   9e-133   
ref|XP_010293819.1|  PREDICTED: polyubiquitin-B isoform X15             389   9e-133   
ref|XP_008426285.1|  PREDICTED: polyubiquitin-B isoform X1              389   9e-133   
ref|XP_005650632.1|  hexaubiquitin protein                              396   9e-133   
dbj|BAB63443.1|  ubiquitin 2                                            387   1e-132   
emb|CDP91931.1|  Protein Bm3564, isoform e                              393   1e-132   
gb|ACZ69386.1|  polyubiquitin UBQ14                                     386   1e-132   
ref|XP_001897032.1|  polyubiquitin precursor                            394   1e-132   
ref|XP_010602597.1|  PREDICTED: polyubiquitin-C                         388   1e-132   
gb|EDM13555.1|  rCG21222, isoform CRA_a                                 389   1e-132   
ref|XP_007265753.1|  polyubiquitin                                      391   1e-132   
emb|CDH53788.1|  polyubiquitin                                          390   1e-132   
emb|CAX72421.1|  ubiquitin C                                            387   1e-132   
ref|XP_445631.1|  hypothetical protein                                  398   2e-132   
gb|EIE84010.1|  polyubiquitin                                           390   2e-132   
gb|ELU42015.1|  polyubiquitin                                           403   2e-132   
ref|XP_667472.1|  ubiquitin B                                           387   2e-132   
ref|NP_061828.1|  polyubiquitin-B precursor                             387   2e-132   
dbj|BAE40351.1|  unnamed protein product                                389   2e-132   
ref|XP_007057723.1|  PREDICTED: polyubiquitin-C isoform X1              387   2e-132   
ref|XP_010298600.1|  PREDICTED: polyubiquitin-B isoform X2              387   2e-132   



>ref|NP_567286.1| ubiquitin 11 [Arabidopsis thaliana]
 ref|NP_849291.1| polyubiquitin 14 [Arabidopsis thaliana]
 ref|NP_001031585.1| ubiquitin 11 [Arabidopsis thaliana]
 ref|NP_567247.2| polyubiquitin 14 [Arabidopsis thaliana]
 ref|NP_001118936.1| ubiquitin 11 [Arabidopsis thaliana]
 ref|XP_002305607.1| hypothetical protein POPTR_0004s02080g [Populus trichocarpa]
 ref|XP_006370636.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 ref|XP_007157173.1| hypothetical protein PHAVU_002G048800g [Phaseolus vulgaris]
 ref|XP_007211604.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_007211605.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_007211608.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_008349294.1| PREDICTED: polyubiquitin 11 [Malus domestica]
 ref|XP_010437606.1| PREDICTED: polyubiquitin 11 isoform X1 [Camelina sativa]
 ref|XP_010437607.1| PREDICTED: polyubiquitin 11 isoform X2 [Camelina sativa]
 ref|XP_010491428.1| PREDICTED: polyubiquitin 11 [Camelina sativa]
 sp|P0CH33.1|UBQ11_ARATH RecName: Full=Polyubiquitin 11; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAD48980.1|AF162444_12 contains similarity to Pfam family PF00240 - Ubiquitin family; 
score=526.5, E=1.9e-154, N=3 [Arabidopsis thaliana]
 emb|CAA10056.1| polyubiquitin [Vicia faba]
 emb|CAB81047.1| AT4g05050 [Arabidopsis thaliana]
 emb|CAC27335.1| putative polyubiquitin [Picea abies]
 gb|AAK96565.1| AT4g05050/T32N4_13 [Arabidopsis thaliana]
 gb|AAL06940.1| AT4g05050/T32N4_13 [Arabidopsis thaliana]
 gb|AAL09770.1| AT4g05050/T32N4_13 [Arabidopsis thaliana]
 gb|AAM19968.1| AT4g05050/T32N4_13 [Arabidopsis thaliana]
 gb|AAN65052.1| Unknown protein [Arabidopsis thaliana]
 gb|AAV92464.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92465.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92466.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92467.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92468.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92469.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92470.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92471.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92472.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92473.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92474.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92475.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92476.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92477.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92478.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92479.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92480.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92481.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92482.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92483.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92484.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92485.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92486.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92487.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92488.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92489.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92490.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 dbj|BAE98552.1| hypothetical protein [Arabidopsis thaliana]
 gb|EEE86118.1| hypothetical protein POPTR_0004s02080g [Populus trichocarpa]
 gb|AEE82244.1| polyubiquitin 14 [Arabidopsis thaliana]
 gb|AEE82245.1| polyubiquitin 14 [Arabidopsis thaliana]
 gb|AEE82468.1| ubiquitin 11 [Arabidopsis thaliana]
 gb|AEE82469.1| ubiquitin 11 [Arabidopsis thaliana]
 gb|AEE82470.1| ubiquitin 11 [Arabidopsis thaliana]
 gb|AFP43343.1| polyubiquitin [Arabidopsis thaliana]
 gb|EMJ12803.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|EMJ12804.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|EMJ12807.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|AGV54265.1| ubiquitin 11 [Phaseolus vulgaris]
 gb|ERP67205.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ESW29167.1| hypothetical protein PHAVU_002G048800g [Phaseolus vulgaris]
 gb|AES82698.2| polyubiquitin 3 [Medicago truncatula]
 gb|AJA29686.1| polyubiquitin Ubi4 [Betula luminifera]
 gb|KJB67136.1| hypothetical protein B456_010G177000 [Gossypium raimondii]
 gb|KJB69250.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
 gb|KJB69251.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
 gb|KJB69252.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
Length=229

 Score =   405 bits (1042),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 205/214 (96%), Positives = 205/214 (96%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  229


 Score =   303 bits (775),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|ABH08755.1| ubiquitin [Arabidopsis thaliana]
Length=221

 Score =   405 bits (1041),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 205/214 (96%), Positives = 205/214 (96%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  8    EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  67

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  68   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  127

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  128  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  187

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  188  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  221


 Score =   287 bits (734),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 144/145 (99%), Positives = 144/145 (99%), Gaps = 0/145 (0%)
 Frame = -1

Query  511  TGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH  332
            TGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH
Sbjct  1    TGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH  60

Query  331  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  152
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  61   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  120

Query  151  GRTLADYNIQKESTLHLVLRLRGGF  77
            GRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  GRTLADYNIQKESTLHLVLRLRGGM  145



>gb|ABH08753.1| ubiquitin [Arabidopsis thaliana]
Length=219

 Score =   405 bits (1041),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 205/214 (96%), Positives = 205/214 (96%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  6    EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  65

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  66   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  125

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  126  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  185

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  186  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  219


 Score =   283 bits (724),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 142/143 (99%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  505  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  326
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  1    KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  60

Query  325  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  146
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  61   LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  120

Query  145  TLADYNIQKESTLHLVLRLRGGF  77
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  121  TLADYNIQKESTLHLVLRLRGGM  143



>ref|XP_003570150.1| PREDICTED: polyubiquitin 11 isoform X2 [Brachypodium distachyon]
Length=241

 Score =   405 bits (1041),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 206/221 (93%), Positives = 207/221 (94%), Gaps = 0/221 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF*IP*CPN  56
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  +  C N
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGALMQWCLN  236


 Score =   303 bits (776),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|ACJ85618.1| unknown [Medicago truncatula]
Length=229

 Score =   404 bits (1039),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 205/214 (96%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGY  229


 Score =   303 bits (775),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|ACJ85643.1| unknown [Medicago truncatula]
Length=229

 Score =   404 bits (1039),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 205/214 (96%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQ+KEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQNKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  229


 Score =   301 bits (771),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQ+KEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQNKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|EEC81189.1| hypothetical protein OsI_24195 [Oryza sativa Indica Group]
Length=223

 Score =   404 bits (1038),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  10   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  69

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  70   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  129

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  130  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  189

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  190  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  222


 Score =   278 bits (710),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 138/140 (99%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = -1

Query  496  TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRL  317
            T EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRL
Sbjct  8    TCEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRL  67

Query  316  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  137
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  68   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  127

Query  136  DYNIQKESTLHLVLRLRGGF  77
            DYNIQKESTLHLVLRLRGG 
Sbjct  128  DYNIQKESTLHLVLRLRGGM  147



>ref|XP_008358804.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin 11-like, partial 
[Malus domestica]
Length=260

 Score =   405 bits (1041),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   305 bits (780),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 155/166 (93%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK  221
            NIQKESTLHLVLRLRGGMQIFVKT TGKTITLE ESSDTIDNVKAK
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTXTGKTITLEXESSDTIDNVKAK  257


 Score =   304 bits (779),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|AIZ74335.1| polyubiquitin 3, partial [Pinus massoniana]
Length=244

 Score =   404 bits (1039),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  5    ELESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  64

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  65   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  124

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  125  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  184

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  185  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  218


 Score =   303 bits (777),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 154/164 (94%), Positives = 155/164 (95%), Gaps = 0/164 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  81   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  140

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  141  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  200

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  227
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTIDNVK
Sbjct  201  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVK  244


 Score =   281 bits (719),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 140/142 (99%), Positives = 141/142 (99%), Gaps = 0/142 (0%)
 Frame = -1

Query  502  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  323
            TITLE+ESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL
Sbjct  1    TITLELESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  60

Query  322  RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT  143
            RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT
Sbjct  61   RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT  120

Query  142  LADYNIQKESTLHLVLRLRGGF  77
            LADYNIQKESTLHLVLRLRGG 
Sbjct  121  LADYNIQKESTLHLVLRLRGGM  142



>ref|XP_003626479.1| Ubiquitin-like protein [Medicago truncatula]
 gb|AES82697.1| polyubiquitin 3 [Medicago truncatula]
Length=277

 Score =   405 bits (1042),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 205/214 (96%), Positives = 205/214 (96%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  64   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  123

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  124  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  183

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  184  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  243

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  244  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  277


 Score =   303 bits (776),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  49   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  108

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  109  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  168

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  169  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  201



>ref|XP_009114489.1| PREDICTED: polyubiquitin-like [Brassica rapa]
Length=305

 Score =   407 bits (1045),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 205/214 (96%), Positives = 205/214 (96%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305


 Score =   400 bits (1029),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 203/214 (95%), Positives = 203/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIP DQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPQDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   300 bits (768),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP DQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPQDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_010931017.1| PREDICTED: polyubiquitin 11 isoform X1 [Elaeis guineensis]
 ref|XP_010931026.1| PREDICTED: polyubiquitin 11 isoform X2 [Elaeis guineensis]
 ref|XP_010923942.1| PREDICTED: polyubiquitin 11 [Elaeis guineensis]
Length=229

 Score =   404 bits (1037),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   303 bits (776),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_006370634.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ERP67203.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
Length=261

 Score =   405 bits (1040),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   304 bits (778),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   301 bits (772),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 153/162 (94%), Positives = 153/162 (94%), Gaps = 0/162 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDN  233
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDN
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDN  253



>ref|XP_002317213.1| polyubiquitin family protein [Populus trichocarpa]
 gb|ABK95814.1| unknown [Populus trichocarpa]
 gb|EEE97825.1| polyubiquitin family protein [Populus trichocarpa]
Length=229

 Score =   404 bits (1037),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGI  229


 Score =   303 bits (776),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|AAB36546.1| polyubiquitin [Phaseolus vulgaris]
Length=215

 Score =   403 bits (1035),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  2    EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  61

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  62   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  121

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  122  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  181

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  182  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  215


 Score =   276 bits (706),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 138/139 (99%), Positives = 138/139 (99%), Gaps = 0/139 (0%)
 Frame = -1

Query  493  LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR  314
            LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR
Sbjct  1    LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR  60

Query  313  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  61   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  120

Query  133  YNIQKESTLHLVLRLRGGF  77
            YNIQKESTLHLVLRLRGG 
Sbjct  121  YNIQKESTLHLVLRLRGGM  139



>dbj|BAC57955.1| polyubiquitin [Aster tripolium]
Length=229

 Score =   404 bits (1037),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  229


 Score =   303 bits (776),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_002872805.1| hypothetical protein ARALYDRAFT_490270 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49064.1| hypothetical protein ARALYDRAFT_490270 [Arabidopsis lyrata subsp. 
lyrata]
Length=309

 Score =   406 bits (1044),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   317 bits (813),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 161/171 (94%), Positives = 162/171 (95%), Gaps = 0/171 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE  206
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK+
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKK  262


 Score =   305 bits (781),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|AET06143.1| ubiquitin [Papaver somniferum]
Length=229

 Score =   403 bits (1036),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   303 bits (776),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_010235843.1| PREDICTED: polyubiquitin 11 isoform X1 [Brachypodium distachyon]
Length=265

 Score =   405 bits (1040),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 206/221 (93%), Positives = 207/221 (94%), Gaps = 0/221 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  40   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  99

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  100  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  159

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  160  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  219

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF*IP*CPN  56
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  +  C N
Sbjct  220  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGALMQWCLN  260


 Score =   304 bits (779),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 154/159 (97%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = -1

Query  553  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  374
            L  R  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  19   LECRKMMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  78

Query  373  TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  194
            TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP
Sbjct  79   TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  138

Query  193  DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  139  DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  177



>gb|AAM64530.1| ubiquitin homolog [Arabidopsis thaliana]
Length=229

 Score =   403 bits (1036),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVL LRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLXLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  229


 Score =   300 bits (769),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVL LRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLXLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|EYU33610.1| hypothetical protein MIMGU_mgv1a004315mg [Erythranthe guttata]
Length=229

 Score =   403 bits (1036),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   303 bits (776),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   254 bits (649),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 128/138 (93%), Positives = 129/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGM  305
            NIQKESTLHLVLRLRGG+
Sbjct  212  NIQKESTLHLVLRLRGGV  229



>ref|XP_006288299.1| hypothetical protein CARUB_v10001544mg [Capsella rubella]
 gb|EOA21197.1| hypothetical protein CARUB_v10001544mg [Capsella rubella]
Length=230

 Score =   403 bits (1036),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   303 bits (776),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_010490793.1| PREDICTED: polyubiquitin 11-like [Camelina sativa]
Length=230

 Score =   403 bits (1036),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   303 bits (776),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|ABH08754.1| ubiquitin [Arabidopsis thaliana]
Length=220

 Score =   403 bits (1035),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  6    EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  65

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  66   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  125

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  126  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  185

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  186  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  218


 Score =   283 bits (724),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 142/143 (99%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  505  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  326
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  1    KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  60

Query  325  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  146
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  61   LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  120

Query  145  TLADYNIQKESTLHLVLRLRGGF  77
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  121  TLADYNIQKESTLHLVLRLRGGM  143



>gb|AAF31707.1|AF221858_1 polyubiquitin [Euphorbia esula]
Length=215

 Score =   402 bits (1034),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  2    EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  61

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  62   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  121

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  122  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  181

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  182  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  214


 Score =   276 bits (706),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 138/139 (99%), Positives = 138/139 (99%), Gaps = 0/139 (0%)
 Frame = -1

Query  493  LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR  314
            LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR
Sbjct  1    LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR  60

Query  313  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  61   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  120

Query  133  YNIQKESTLHLVLRLRGGF  77
            YNIQKESTLHLVLRLRGG 
Sbjct  121  YNIQKESTLHLVLRLRGGM  139



>gb|KJB62484.1| hypothetical protein B456_009G418900 [Gossypium raimondii]
Length=229

 Score =   403 bits (1035),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   301 bits (772),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|ABK94002.1| unknown [Populus trichocarpa]
Length=305

 Score =   406 bits (1043),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 205/214 (96%), Positives = 205/214 (96%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305


 Score =   400 bits (1027),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 203/214 (95%), Positives = 203/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA  NIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADNNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   299 bits (766),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD N
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADNN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_004968120.1| PREDICTED: polyubiquitin-like [Setaria italica]
 ref|XP_009404996.1| PREDICTED: polyubiquitin 11 [Musa acuminata subsp. malaccensis]
 gb|ABS18744.1| ubiqutin ligase-like protein [Oryza sativa Japonica Group]
 dbj|BAJ88219.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=229

 Score =   403 bits (1035),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   303 bits (776),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>emb|CAA48140.1| ubiquitin [Antirrhinum majus]
Length=296

 Score =   405 bits (1042),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 205/214 (96%), Positives = 205/214 (96%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  83   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  142

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  143  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  202

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  203  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  262

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  263  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  296


 Score =   403 bits (1035),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  7    EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  66

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  67   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  126

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  127  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  186

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  187  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  220


 Score =   285 bits (730),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 143/144 (99%), Positives = 143/144 (99%), Gaps = 0/144 (0%)
 Frame = -1

Query  508  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  329
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  1    GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  60

Query  328  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  149
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  61   VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  120

Query  148  RTLADYNIQKESTLHLVLRLRGGF  77
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  RTLADYNIQKESTLHLVLRLRGGM  144



>gb|KDO51109.1| hypothetical protein CISIN_1g026973mg [Citrus sinensis]
Length=230

 Score =   403 bits (1035),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   303 bits (775),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|KJB36627.1| hypothetical protein B456_006G167800 [Gossypium raimondii]
Length=229

 Score =   403 bits (1035),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   303 bits (775),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|ABD96088.1| polyubiquitin [Malus domestica]
Length=270

 Score =   404 bits (1039),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 205/214 (96%), Positives = 205/214 (96%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  57   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  116

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  117  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  176

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  177  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  236

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  237  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  270


 Score =   379 bits (972),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 190/194 (98%), Positives = 190/194 (98%), Gaps = 0/194 (0%)
 Frame = -1

Query  658  IPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  479
            IPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  1    IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  60

Query  478  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  299
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  61   SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  120

Query  298  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  119
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  121  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180

Query  118  ESTLHLVLRLRGGF  77
            ESTLHLVLRLRGG 
Sbjct  181  ESTLHLVLRLRGGM  194



>gb|AAP31578.1| ubiquitin [Hevea brasiliensis]
Length=230

 Score =   403 bits (1035),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   303 bits (775),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>emb|CAH59739.1| polyubiquitin [Plantago major]
Length=232

 Score =   403 bits (1035),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  229


 Score =   302 bits (774),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   255 bits (651),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 129/141 (91%), Positives = 130/141 (92%), Gaps = 0/141 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIF  296
            NIQKESTLHLVLRLRGG+  F
Sbjct  212  NIQKESTLHLVLRLRGGLTGF  232



>ref|XP_006428779.1| hypothetical protein CICLE_v10012654mg [Citrus clementina]
 ref|XP_006594132.1| PREDICTED: polyubiquitin-like [Glycine max]
 gb|ESR42019.1| hypothetical protein CICLE_v10012654mg [Citrus clementina]
 gb|KDO45140.1| hypothetical protein CISIN_1g0269401mg [Citrus sinensis]
 gb|KDO45141.1| hypothetical protein CISIN_1g0269401mg [Citrus sinensis]
 gb|KHN48309.1| Polyubiquitin [Glycine soja]
Length=230

 Score =   402 bits (1034),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   303 bits (775),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|NP_849292.1| polyubiquitin 14 [Arabidopsis thaliana]
 ref|NP_001118922.1| polyubiquitin 14 [Arabidopsis thaliana]
 ref|NP_974516.4| polyubiquitin 10 [Arabidopsis thaliana]
 ref|XP_002316978.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_002874829.1| hypothetical protein ARALYDRAFT_490155 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_004146845.1| PREDICTED: polyubiquitin-like [Cucumis sativus]
 ref|XP_004165599.1| PREDICTED: polyubiquitin-like [Cucumis sativus]
 ref|XP_004293260.1| PREDICTED: polyubiquitin [Fragaria vesca subsp. vesca]
 ref|XP_006383941.1| hypothetical protein POPTR_0004s02080g [Populus trichocarpa]
 ref|XP_006377831.1| polyubiquitin family protein [Populus trichocarpa]
 ref|XP_006377832.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_006377833.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_006372945.1| hypothetical protein POPTR_0017s06450g [Populus trichocarpa]
 ref|XP_006396614.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 ref|XP_006396615.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 ref|XP_006589609.1| PREDICTED: polyubiquitin [Glycine max]
 ref|XP_006593990.1| PREDICTED: polyubiquitin 10-like isoform X2 [Glycine max]
 ref|XP_006606032.1| PREDICTED: polyubiquitin [Glycine max]
 ref|XP_007211603.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_008454542.1| PREDICTED: polyubiquitin [Cucumis melo]
 ref|XP_009134330.1| PREDICTED: polyubiquitin [Brassica rapa]
 ref|XP_010422419.1| PREDICTED: polyubiquitin [Camelina sativa]
 ref|XP_011007895.1| PREDICTED: polyubiquitin [Populus euphratica]
 ref|XP_011010177.1| PREDICTED: polyubiquitin [Populus euphratica]
 sp|P69325.2|UBIQP_SOYBN RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Glycine max]
 sp|Q3E7T8.2|UBQ14_ARATH RecName: Full=Polyubiquitin 14; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Arabidopsis thaliana]
 pir||S49332 polyubiquitin 4 - common sunflower
 pir||G85036 polyubiquitin [imported] - Arabidopsis thaliana
 dbj|BAA03764.1| ubiquitin [Glycine max]
 dbj|BAA05670.1| ubiquitin [Glycine max]
 emb|CAA84440.1| seed tetraubiquitin [Helianthus annuus]
 dbj|BAA05085.1| Ubiquitin [Glycine max]
 gb|AAD15340.1| putative polyubiquitin [Arabidopsis thaliana]
 emb|CAB77774.1| polyubiquitin [Arabidopsis thaliana]
 gb|AAM65295.1| polyubiquitin (UBQ14) [Arabidopsis thaliana]
 emb|CAH59738.1| polyubiquitin [Plantago major]
 dbj|BAH19554.1| AT4G02890 [Arabidopsis thaliana]
 gb|EEE97590.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|EFH51088.1| hypothetical protein ARALYDRAFT_490155 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AEE82246.1| polyubiquitin 14 [Arabidopsis thaliana]
 gb|AEE82247.1| polyubiquitin 14 [Arabidopsis thaliana]
 gb|AEE82503.1| polyubiquitin 10 [Arabidopsis thaliana]
 gb|AFP43341.1| polyubiquitin [Arabidopsis thaliana]
 gb|EMJ12802.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|ERP50742.1| hypothetical protein POPTR_0017s06450g [Populus trichocarpa]
 gb|ERP55628.1| polyubiquitin family protein [Populus trichocarpa]
 gb|ERP55629.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP55630.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP61738.1| hypothetical protein POPTR_0004s02080g [Populus trichocarpa]
 gb|ESQ38067.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 gb|ESQ38068.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 dbj|BAO57270.1| ubiquitin 10 [Ipomoea nil]
 gb|KHN02680.1| Polyubiquitin [Glycine soja]
 gb|KHN15806.1| Polyubiquitin [Glycine soja]
 gb|KJB13594.1| hypothetical protein B456_002G083100 [Gossypium raimondii]
 gb|KJB69249.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
 prf||2111434A tetraubiquitin
Length=305

 Score =   405 bits (1042),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 205/214 (96%), Positives = 205/214 (96%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305


 Score =   403 bits (1035),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   303 bits (775),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|AFY06654.1| polyubiquitin, partial [Carica papaya]
Length=264

 Score =   404 bits (1038),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  51   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  110

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  111  GMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  170

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  171  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  230

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  231  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  264


 Score =   318 bits (815),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 172/177 (97%), Positives = 172/177 (97%), Gaps = 0/177 (0%)
 Frame = -1

Query  607  GRTLAXYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  428
            G TLA YNIQKESTL LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  12   GGTLADYNIQKESTLLLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  71

Query  427  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESS  248
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESS
Sbjct  72   PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESS  131

Query  247  DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            DTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  132  DTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  188



>gb|AGV54749.1| ubiquitin 11 [Phaseolus vulgaris]
Length=269

 Score =   404 bits (1038),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 205/214 (96%), Positives = 205/214 (96%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  56   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  115

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  116  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  175

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  176  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  235

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  236  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  269


 Score =   301 bits (772),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  41   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  100

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  101  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  160

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  161  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  193



>gb|AEZ49160.1| polyubiquitin, partial [Wolffia australiana]
Length=281

 Score =   404 bits (1039),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  36   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  95

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  96   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  155

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  156  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  215

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  216  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  249


 Score =   313 bits (803),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 160/170 (94%), Positives = 160/170 (94%), Gaps = 0/170 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  112  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  171

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  172  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  231

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  209
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV SSDTIDNVKAKIQDK
Sbjct  232  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVASSDTIDNVKAKIQDK  281


 Score =   307 bits (787),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 154/158 (97%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = -1

Query  550  RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT  371
            RL+  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT
Sbjct  16   RLQSKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT  75

Query  370  LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPD  191
            LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPD
Sbjct  76   LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPD  135

Query  190  QQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            QQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  136  QQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  173



>gb|KDO51955.1| hypothetical protein CISIN_1g026932mg [Citrus sinensis]
 gb|KDO51956.1| hypothetical protein CISIN_1g026932mg [Citrus sinensis]
Length=230

 Score =   402 bits (1034),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   303 bits (775),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|KJB81823.1| hypothetical protein B456_013G163500 [Gossypium raimondii]
Length=305

 Score =   405 bits (1042),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 205/214 (96%), Positives = 205/214 (96%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305


 Score =   403 bits (1035),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   301 bits (770),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|AAO43307.1| putative polyubiquitin [Arabidopsis thaliana]
Length=250

 Score =   403 bits (1036),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  36   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  95

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  96   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  155

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  156  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  215

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  216  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  248


 Score =   341 bits (875),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 171/173 (99%), Positives = 171/173 (99%), Gaps = 0/173 (0%)
 Frame = -1

Query  595  AXYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  416
            A YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ
Sbjct  1    ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  60

Query  415  QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  236
            QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID
Sbjct  61   QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  120

Query  235  NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  173



>gb|AFK41706.1| unknown [Medicago truncatula]
 gb|AES60745.2| pentameric polyubiquitin [Medicago truncatula]
Length=233

 Score =   402 bits (1034),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   303 bits (775),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|EPS72031.1| polyubiquitin, partial [Genlisea aurea]
Length=274

 Score =   404 bits (1038),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 205/214 (96%), Positives = 205/214 (96%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  61   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  120

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  121  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  180

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  181  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  240

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  241  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  274


 Score =   386 bits (991),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 194/198 (98%), Positives = 194/198 (98%), Gaps = 0/198 (0%)
 Frame = -1

Query  670  DKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL  491
            DKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL
Sbjct  1    DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL  60

Query  490  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  311
            EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG
Sbjct  61   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  120

Query  310  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  131
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  121  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  180

Query  130  NIQKESTLHLVLRLRGGF  77
            NIQKESTLHLVLRLRGG 
Sbjct  181  NIQKESTLHLVLRLRGGM  198



>gb|AAC35858.1| polyubiquitin [Capsicum chinense]
Length=265

 Score =   404 bits (1037),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  52   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  111

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  112  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  171

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL
Sbjct  172  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRL  231

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  232  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  265


 Score =   367 bits (943),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 185/189 (98%), Positives = 185/189 (98%), Gaps = 0/189 (0%)
 Frame = -1

Query  643  QRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  464
            QR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID
Sbjct  1    QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  60

Query  463  NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTL  284
            NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTL
Sbjct  61   NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTL  120

Query  283  TGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH  104
            TGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH
Sbjct  121  TGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH  180

Query  103  LVLRLRGGF  77
            LVLRLRGG 
Sbjct  181  LVLRLRGGM  189



>emb|CBY46745.1| polyubiquitin 10 protein, partial [Lepidium appelianum]
Length=308

 Score =   405 bits (1041),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 205/214 (96%), Positives = 205/214 (96%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  95   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  154

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  155  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  214

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  215  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  274

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  275  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  308


 Score =   402 bits (1034),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  19   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  78

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  79   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  138

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  139  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  232


 Score =   309 bits (791),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 155/156 (99%), Positives = 155/156 (99%), Gaps = 0/156 (0%)
 Frame = -1

Query  544  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  365
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  1    RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  60

Query  364  DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  185
            DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ
Sbjct  61   DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  120

Query  184  RLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            RLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  RLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  156



>ref|XP_002872746.1| hypothetical protein ARALYDRAFT_911794 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_002872769.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49005.1| hypothetical protein ARALYDRAFT_911794 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49028.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=229

 Score =   402 bits (1033),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP DQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPLDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  229


 Score =   303 bits (775),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_003627152.1| Ubiquitin [Medicago truncatula]
 gb|KEH18411.1| polyubiquitin 3 [Medicago truncatula]
Length=270

 Score =   404 bits (1037),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   319 bits (818),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 170/214 (79%), Positives = 170/214 (79%), Gaps = 35/214 (16%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTIT                             
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTIT-----------------------------  242

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
                  LEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  243  ------LEDGRTLADYNIQKESTLHLVLRLRGGF  270


 Score =   303 bits (776),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>emb|CBI22349.3| unnamed protein product [Vitis vinifera]
Length=298

 Score =   404 bits (1039),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  43   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  102

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  103  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  162

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  163  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  222

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  223  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  256


 Score =   320 bits (821),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 163/173 (94%), Positives = 164/173 (95%), Gaps = 0/173 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  119  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  178

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  179  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  238

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  200
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG+
Sbjct  239  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGM  291


 Score =   304 bits (778),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  28   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  87

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  88   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  147

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  148  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  180



>gb|AES89865.2| polyubiquitin 3 [Medicago truncatula]
Length=278

 Score =   404 bits (1037),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   303 bits (776),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   283 bits (725),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 144/153 (94%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE  260
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE  244



>ref|XP_002438839.1| hypothetical protein SORBIDRAFT_10g027030 [Sorghum bicolor]
 gb|EER90206.1| hypothetical protein SORBIDRAFT_10g027030 [Sorghum bicolor]
Length=229

 Score =   402 bits (1032),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 203/213 (95%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQK+STLHLVLRLRGG
Sbjct  196  IFAGKQLEDGRTLADYNIQKDSTLHLVLRLRGG  228


 Score =   303 bits (776),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_006377830.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP55627.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
Length=297

 Score =   404 bits (1039),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   380 bits (976),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 192/202 (95%), Positives = 193/202 (96%), Gaps = 0/202 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKES  113
            IFAGKQLEDGRTLADYNIQKE+
Sbjct  272  IFAGKQLEDGRTLADYNIQKEN  293


 Score =   304 bits (778),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_010453358.1| PREDICTED: polyubiquitin-like [Camelina sativa]
Length=305

 Score =   404 bits (1039),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 205/214 (96%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  S+  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESTDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305


 Score =   402 bits (1032),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 203/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVES+DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESTDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   301 bits (772),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES+DTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESTDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|AES89866.2| polyubiquitin 3 [Medicago truncatula]
Length=305

 Score =   404 bits (1039),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 205/214 (96%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGY  305


 Score =   403 bits (1035),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   303 bits (775),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|ABY60454.1| putative polyubiquitin [Adonis aestivalis var. palaestina]
Length=281

 Score =   403 bits (1036),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  27   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  86

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  87   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  146

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  147  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  206

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  207  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  240


 Score =   335 bits (858),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 170/179 (95%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  103  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  162

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  163  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  222

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  182
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  223  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  281


 Score =   325 bits (833),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 163/164 (99%), Positives = 163/164 (99%), Gaps = 0/164 (0%)
 Frame = -1

Query  568  TLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQ  389
            TLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQ
Sbjct  1    TLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQ  60

Query  388  LEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  209
            LEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK
Sbjct  61   LEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  120

Query  208  EGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            EGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  EGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  164



>ref|XP_007154495.1| hypothetical protein PHAVU_003G1236001g, partial [Phaseolus vulgaris]
 gb|ESW26489.1| hypothetical protein PHAVU_003G1236001g, partial [Phaseolus vulgaris]
Length=269

 Score =   403 bits (1035),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 203/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   332 bits (850),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 168/178 (94%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  185
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  269


 Score =   303 bits (777),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_008784557.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin 11-like [Phoenix 
dactylifera]
Length=229

 Score =   401 bits (1030),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 203/213 (95%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLV RLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVXRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   301 bits (771),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLV RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVXRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_007211606.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|EMJ12805.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
Length=309

 Score =   404 bits (1038),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   401 bits (1031),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 203/212 (96%), Positives = 203/212 (96%), Gaps = 0/212 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  83
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRG
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  303


 Score =   303 bits (777),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_007512209.1| polyubiquitin [Bathycoccus prasinos]
 emb|CCO66297.1| polyubiquitin [Bathycoccus prasinos]
Length=359

 Score =   406 bits (1043),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  143  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  202

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  203  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  262

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  263  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  322

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  323  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  355


 Score =   385 bits (989),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 192/197 (97%), Positives = 192/197 (97%), Gaps = 0/197 (0%)
 Frame = -1

Query  661  GIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE  482
            GIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE
Sbjct  86   GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE  145

Query  481  SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQ  302
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQ
Sbjct  146  SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQ  205

Query  301  IFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  122
            IFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ
Sbjct  206  IFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  265

Query  121  KESTLHLVLRLRGGF*I  71
            KESTLHLVLRLRGG  I
Sbjct  266  KESTLHLVLRLRGGMQI  282


 Score =   281 bits (720),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 153/206 (74%), Positives = 153/206 (74%), Gaps = 51/206 (25%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE--------------------------  434
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE                          
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGTFRVKSRRLKFCLLALLDSATTIES  60

Query  433  -------------------------GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  329
                                     GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  61   SLALRSKKSSERREREKESALSRARGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  120

Query  328  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  149
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  121  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  180

Query  148  RTLADYNIQKESTLHLVLRLRGGF*I  71
            RTLADYNIQKESTLHLVLRLRGG  I
Sbjct  181  RTLADYNIQKESTLHLVLRLRGGMQI  206



>ref|XP_006428822.1| hypothetical protein CICLE_v10012652mg [Citrus clementina]
 ref|XP_006480632.1| PREDICTED: polyubiquitin 4-like [Citrus sinensis]
 ref|XP_006480634.1| PREDICTED: polyubiquitin 4-like [Citrus sinensis]
 gb|ESR42062.1| hypothetical protein CICLE_v10012652mg [Citrus clementina]
Length=230

 Score =   401 bits (1030),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 203/213 (95%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGG
Sbjct  196  IFAGKQLEDGRNLADYNIQKESTLHLVLRLRGG  228


 Score =   303 bits (775),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_010452435.1| PREDICTED: polyubiquitin-like [Camelina sativa]
Length=305

 Score =   404 bits (1037),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 205/214 (96%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQD+EGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDQEGIPPDQQRFIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305


 Score =   400 bits (1028),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 202/214 (94%), Positives = 203/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQD+EGIPPDQQR IFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDQEGIPPDQQRFIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   300 bits (767),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQD+EGIPPDQQR I
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDQEGIPPDQQRFI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_010258950.1| PREDICTED: polyubiquitin [Nelumbo nucifera]
Length=306

 Score =   404 bits (1038),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   404 bits (1037),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGI  305


 Score =   303 bits (777),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|AAQ84316.1| fiber polyubiquitin [Gossypium barbadense]
Length=229

 Score =   401 bits (1030),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTL LVLRLRGGF
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLPLVLRLRGGF  229


 Score =   300 bits (769),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_006685644.1| ubiquitin [Candida tenuis ATCC 10573]
 gb|EGV64838.1| ubiquitin [Candida tenuis ATCC 10573]
Length=229

 Score =   400 bits (1029),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 202/213 (95%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   301 bits (770),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_010492041.1| PREDICTED: polyubiquitin-like [Camelina sativa]
Length=305

 Score =   404 bits (1037),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAG QLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGTQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305


 Score =   401 bits (1030),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 203/214 (95%), Positives = 203/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG QLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGTQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   301 bits (770),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAG QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGTQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>emb|CAA40323.1| polyubiquitin protein [Helianthus annuus]
Length=334

 Score =   405 bits (1040),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   405 bits (1040),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   310 bits (794),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 158/167 (95%), Positives = 158/167 (95%), Gaps = 0/167 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  168  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  227

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  228  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  287

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI  218
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI
Sbjct  288  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI  334


 Score =   304 bits (778),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>dbj|BAJ85978.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91581.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=305

 Score =   404 bits (1037),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   403 bits (1036),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   302 bits (773),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_006428821.1| hypothetical protein CICLE_v10012292mg [Citrus clementina]
 ref|XP_006480633.1| PREDICTED: polyubiquitin-like [Citrus sinensis]
 gb|ESR42061.1| hypothetical protein CICLE_v10012292mg [Citrus clementina]
Length=306

 Score =   404 bits (1037),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   403 bits (1036),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   303 bits (776),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|AFK43392.1| unknown [Medicago truncatula]
Length=233

 Score =   401 bits (1030),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 203/213 (95%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID  K KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNAKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   301 bits (770),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDN KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNAKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|EYU33609.1| hypothetical protein MIMGU_mgv1a004315mg [Erythranthe guttata]
 gb|EYU33612.1| hypothetical protein MIMGU_mgv1a004315mg [Erythranthe guttata]
Length=305

 Score =   404 bits (1037),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   403 bits (1036),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   303 bits (776),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   254 bits (649),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 128/138 (93%), Positives = 129/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  168  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  227

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  228  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  287

Query  358  NIQKESTLHLVLRLRGGM  305
            NIQKESTLHLVLRLRGG+
Sbjct  288  NIQKESTLHLVLRLRGGV  305



>ref|NP_851029.1| polyubiquitin 3 [Arabidopsis thaliana]
 ref|NP_568112.2| polyubiquitin 3 [Arabidopsis thaliana]
 ref|NP_001031824.1| polyubiquitin 3 [Arabidopsis thaliana]
 ref|XP_006288303.1| hypothetical protein CARUB_v10001548mg [Capsella rubella]
 ref|XP_009122723.1| PREDICTED: polyubiquitin 3 [Brassica rapa]
 sp|Q1EC66.1|UBQ3_ARATH RecName: Full=Polyubiquitin 3; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAB86091.1| polyubiquitin (ubq3) [Arabidopsis thaliana]
 dbj|BAB08384.1| polyubiquitin [Arabidopsis thaliana]
 gb|AAO00780.1| polyubiquitin (UBQ3) [Arabidopsis thaliana]
 gb|ABF85770.1| At5g03240 [Arabidopsis thaliana]
 dbj|BAH19791.1| AT5G03240 [Arabidopsis thaliana]
 gb|AED90574.1| polyubiquitin 3 [Arabidopsis thaliana]
 gb|AED90575.1| polyubiquitin 3 [Arabidopsis thaliana]
 gb|AED90576.1| polyubiquitin 3 [Arabidopsis thaliana]
 gb|EOA21201.1| hypothetical protein CARUB_v10001548mg [Capsella rubella]
Length=306

 Score =   404 bits (1037),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   403 bits (1036),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   303 bits (776),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_007014924.1| Polyubiquitin 3 [Theobroma cacao]
 gb|EOY32543.1| Polyubiquitin 3 [Theobroma cacao]
Length=305

 Score =   404 bits (1037),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   403 bits (1036),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   303 bits (776),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|KDP39203.1| hypothetical protein JCGZ_00960 [Jatropha curcas]
Length=317

 Score =   404 bits (1038),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   404 bits (1038),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   303 bits (777),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   260 bits (665),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 131/141 (93%), Positives = 131/141 (93%), Gaps = 0/141 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  168  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  227

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  228  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  287

Query  358  NIQKESTLHLVLRLRGGMQIF  296
            NIQKESTLHLVLRLRGGMQI 
Sbjct  288  NIQKESTLHLVLRLRGGMQIL  308



>ref|XP_006302387.1| hypothetical protein CARUB_v10020456mg [Capsella rubella]
 gb|EOA35285.1| hypothetical protein CARUB_v10020456mg [Capsella rubella]
Length=307

 Score =   404 bits (1037),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   403 bits (1036),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   303 bits (776),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_002456845.1| hypothetical protein SORBIDRAFT_03g043940 [Sorghum bicolor]
 ref|XP_002453347.1| hypothetical protein SORBIDRAFT_04g004280 [Sorghum bicolor]
 ref|XP_003574869.1| PREDICTED: polyubiquitin [Brachypodium distachyon]
 ref|XP_007695807.1| hypothetical protein COCSADRAFT_108224 [Bipolaris sorokiniana 
ND90Pr]
 ref|XP_009412665.1| PREDICTED: polyubiquitin isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009412666.1| PREDICTED: polyubiquitin isoform X2 [Musa acuminata subsp. malaccensis]
 ref|XP_010227192.1| PREDICTED: polyubiquitin isoform X2 [Brachypodium distachyon]
 sp|P69309.2|UBIQP_AVEFA RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Avena fatua]
 pir||S28426 polyubiquitin 4 - wild oat
 emb|CAA49200.1| tetraubiquitin [Avena fatua]
 gb|AAC37466.1| polyubiquitin [Saccharum hybrid cultivar H65-7052]
 gb|AAM28291.1| tetrameric ubiquitin [Ananas comosus]
 gb|EES01965.1| hypothetical protein SORBIDRAFT_03g043940 [Sorghum bicolor]
 gb|EES06323.1| hypothetical protein SORBIDRAFT_04g004280 [Sorghum bicolor]
 gb|AEE65379.1| ubiquitin 1 [Panicum virgatum]
 gb|EMD68114.1| hypothetical protein COCSADRAFT_108224 [Bipolaris sorokiniana 
ND90Pr]
 gb|EMD93446.1| hypothetical protein COCHEDRAFT_1202381 [Bipolaris maydis C5]
 gb|EMS58836.1| Polyubiquitin [Triticum urartu]
 gb|ENI07106.1| hypothetical protein COCC4DRAFT_70576 [Bipolaris maydis ATCC 
48331]
 gb|AGT16802.1| polyubiquitin-like protein [Saccharum hybrid cultivar R570]
 gb|EUN28034.1| hypothetical protein COCVIDRAFT_96666 [Bipolaris victoriae FI3]
Length=305

 Score =   403 bits (1036),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   403 bits (1036),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   303 bits (776),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|AAB36545.1| ubiquitin-like protein [Phaseolus vulgaris]
Length=407

 Score =   407 bits (1046),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 205/214 (96%), Positives = 205/214 (96%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  194  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  253

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  254  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  313

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  314  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  373

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  374  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  407


 Score =   405 bits (1040),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  118  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  177

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  178  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  237

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  238  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  297

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  298  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  331


 Score =   359 bits (922),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 180/183 (98%), Positives = 180/183 (98%), Gaps = 0/183 (0%)
 Frame = -1

Query  625  GKQLEDGRTLAXYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI  446
             KQLEDGRTLA YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI
Sbjct  73   AKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI  132

Query  445  QDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTIT  266
            QDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTIT
Sbjct  133  QDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTIT  192

Query  265  LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR  86
            LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR
Sbjct  193  LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR  252

Query  85   GGF  77
            GG 
Sbjct  253  GGM  255



>ref|XP_006654612.1| PREDICTED: polyubiquitin-like [Oryza brachyantha]
Length=305

 Score =   403 bits (1036),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   402 bits (1032),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 203/213 (95%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQL+DGRTLADYNIQKESTLHLVLRLRGG
Sbjct  272  IFAGKQLDDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   303 bits (776),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_009112898.1| PREDICTED: polyubiquitin [Brassica rapa]
Length=305

 Score =   403 bits (1036),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   403 bits (1036),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGI  305


 Score =   303 bits (776),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_006480631.1| PREDICTED: polyubiquitin-like [Citrus sinensis]
Length=306

 Score =   403 bits (1036),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   403 bits (1036),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   303 bits (776),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_011468094.1| PREDICTED: polyubiquitin [Fragaria vesca subsp. vesca]
Length=306

 Score =   403 bits (1036),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   403 bits (1036),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 203/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  +D VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   303 bits (775),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>emb|CAH59740.1| polyubiquitin [Plantago major]
Length=305

 Score =   403 bits (1036),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   403 bits (1035),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   303 bits (776),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|AAL09741.1| AT4g05320/C17L7_240 [Arabidopsis thaliana]
Length=381

 Score =   406 bits (1043),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 205/214 (96%), Positives = 205/214 (96%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  168  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  227

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  228  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  287

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  288  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score =   401 bits (1030),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 203/214 (95%), Positives = 203/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVL LRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLSLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   401 bits (1030),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 203/214 (95%), Positives = 203/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVL LRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLSLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   300 bits (769),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVL LRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLSLRGGM  153



>emb|CDP08569.1| unnamed protein product [Coffea canephora]
Length=306

 Score =   403 bits (1036),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   403 bits (1036),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGI  305


 Score =   301 bits (772),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>sp|P69315.2|UBIQP_LINUS RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Contains: RecName: Full=Ubiquitin-related; Flags: Precursor, 
partial [Linum usitatissimum]
 gb|AAA33401.1| ubiquitin, partial [Linum usitatissimum]
Length=305

 Score =   403 bits (1036),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  57   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  116

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  117  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  176

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  177  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  236

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  237  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  270


 Score =   379 bits (972),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 189/194 (97%), Positives = 190/194 (98%), Gaps = 0/194 (0%)
 Frame = -1

Query  658  IPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  479
            IPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRGGMQIF+KTLTGKTITLEVES
Sbjct  1    IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFLKTLTGKTITLEVES  60

Query  478  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  299
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  61   SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  120

Query  298  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  119
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK
Sbjct  121  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  180

Query  118  ESTLHLVLRLRGGF  77
            ESTLHLVLRLRGG 
Sbjct  181  ESTLHLVLRLRGGM  194


 Score =   320 bits (821),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 164/173 (95%), Positives = 164/173 (95%), Gaps = 0/173 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  133  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  192

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  193  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  252

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  200
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  253  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  305



>ref|XP_007205620.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
 ref|XP_007205621.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
 gb|EMJ06819.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
 gb|EMJ06820.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
Length=306

 Score =   403 bits (1036),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   403 bits (1035),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   302 bits (774),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQ+FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQVFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|KJB62487.1| hypothetical protein B456_009G418900 [Gossypium raimondii]
Length=305

 Score =   403 bits (1036),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   402 bits (1033),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 203/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   301 bits (770),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_006396611.1| hypothetical protein EUTSA_v10028730mg [Eutrema salsugineum]
 gb|AAL27563.1|AF429429_1 polyubiquitin OUB1 [Olea europaea]
 gb|ESQ38064.1| hypothetical protein EUTSA_v10028730mg [Eutrema salsugineum]
Length=305

 Score =   403 bits (1036),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  305


 Score =   403 bits (1036),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   303 bits (775),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_002873083.1| hypothetical protein ARALYDRAFT_487095 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49342.1| hypothetical protein ARALYDRAFT_487095 [Arabidopsis lyrata subsp. 
lyrata]
Length=306

 Score =   403 bits (1036),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   402 bits (1032),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 203/214 (95%), Positives = 203/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTL  YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLTDYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   301 bits (771),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLTDYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|AFW66439.1| putative ubiquitin family protein [Zea mays]
Length=297

 Score =   403 bits (1035),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   382 bits (980),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 196/214 (92%), Positives = 197/214 (92%), Gaps = 8/214 (4%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD        IQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD--------IQDKEGIPPDQQRL  263

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  264  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGY  297


 Score =   303 bits (775),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|AAO42469.1| putative polyubiquitin [Arabidopsis lyrata]
Length=289

 Score =   402 bits (1034),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  7    EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  66

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  67   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  126

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  127  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  186

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  187  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  220


 Score =   378 bits (971),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 196/213 (92%), Gaps = 8/213 (4%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  83   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  142

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  143  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  202

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESS+        IQDKEGIPPDQQRL
Sbjct  203  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSE--------IQDKEGIPPDQQRL  254

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  255  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  287


 Score =   285 bits (730),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 143/144 (99%), Positives = 143/144 (99%), Gaps = 0/144 (0%)
 Frame = -1

Query  508  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  329
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  1    GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  60

Query  328  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  149
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  61   VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  120

Query  148  RTLADYNIQKESTLHLVLRLRGGF  77
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  RTLADYNIQKESTLHLVLRLRGGM  144



>gb|KDP38838.1| hypothetical protein JCGZ_04995 [Jatropha curcas]
Length=308

 Score =   403 bits (1036),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   403 bits (1035),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   303 bits (776),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_006428820.1| hypothetical protein CICLE_v10012290mg [Citrus clementina]
 gb|ESR42060.1| hypothetical protein CICLE_v10012290mg [Citrus clementina]
Length=306

 Score =   403 bits (1036),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   401 bits (1030),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 203/214 (95%), Positives = 203/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQ KEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQHKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   300 bits (769),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQ KEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQHKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>emb|CDP05795.1| unnamed protein product [Coffea canephora]
Length=381

 Score =   406 bits (1043),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 205/214 (96%), Positives = 205/214 (96%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  168  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  227

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  228  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  287

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  288  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score =   402 bits (1032),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 203/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQ+KEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQEKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   402 bits (1032),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 203/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQ+KEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQEKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   301 bits (771),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQ+KEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQEKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_010240921.1| PREDICTED: polyubiquitin-like [Nelumbo nucifera]
Length=381

 Score =   406 bits (1043),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 205/214 (96%), Positives = 205/214 (96%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  168  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  227

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  228  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  287

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  288  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score =   403 bits (1036),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   403 bits (1035),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 203/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YN+QKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNVQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   302 bits (774),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            +QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   VQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>emb|CBY46746.1| polyubiquitin 10 protein, partial [Lepidium campestre]
Length=381

 Score =   406 bits (1043),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 205/214 (96%), Positives = 205/214 (96%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  168  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  227

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  228  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  287

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  288  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score =   403 bits (1036),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   403 bits (1035),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 203/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  +D VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   302 bits (774),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>prf||1604470A poly-ubiquitin
Length=272

 Score =   402 bits (1032),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  59   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  118

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  119  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  178

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  179  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  238

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  239  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  271


 Score =   381 bits (978),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 191/195 (98%), Positives = 191/195 (98%), Gaps = 0/195 (0%)
 Frame = -1

Query  661  GIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE  482
            GIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE
Sbjct  2    GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE  61

Query  481  SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQ  302
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQ
Sbjct  62   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQ  121

Query  301  IFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  122
            IFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ
Sbjct  122  IFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  181

Query  121  KESTLHLVLRLRGGF  77
            KESTLHLVLRLRGG 
Sbjct  182  KESTLHLVLRLRGGM  196



>ref|XP_003537278.1| PREDICTED: polyubiquitin-like [Glycine max]
 ref|XP_010454744.1| PREDICTED: polyubiquitin 3 [Camelina sativa]
 gb|KHN39094.1| Polyubiquitin [Glycine soja]
Length=306

 Score =   403 bits (1035),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   403 bits (1035),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   303 bits (775),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|ACD31680.1| ubiquitin [Gossypium hirsutum]
Length=305

 Score =   403 bits (1035),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTL DYNIQKESTLHLVLRLRGGF
Sbjct  272  IFAGKQLEDGRTLPDYNIQKESTLHLVLRLRGGF  305


 Score =   402 bits (1034),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   301 bits (770),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>sp|P0CG84.1|UBI4P_NICSY RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor, partial [Nicotiana sylvestris]
 gb|AAA34124.1| pentameric polyubiquitin, partial [Nicotiana sylvestris]
Length=377

 Score =   405 bits (1042),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 205/214 (96%), Positives = 205/214 (96%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  164  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  223

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  224  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  283

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  284  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  343

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  344  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  377


 Score =   403 bits (1036),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  12   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  71

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  72   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  131

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  132  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  191

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  192  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  225


 Score =   403 bits (1036),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  88   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  147

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  148  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  207

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  208  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  267

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  268  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  301


 Score =   294 bits (752),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 148/149 (99%), Positives = 148/149 (99%), Gaps = 0/149 (0%)
 Frame = -1

Query  523  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  344
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  1    VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  60

Query  343  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  164
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  61   STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  120

Query  163  QLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  QLEDGRTLADYNIQKESTLHLVLRLRGGM  149



>gb|KJB13592.1| hypothetical protein B456_002G083000 [Gossypium raimondii]
Length=385

 Score =   406 bits (1043),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 205/214 (96%), Positives = 205/214 (96%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  168  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  227

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  228  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  287

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  288  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score =   403 bits (1036),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   403 bits (1036),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   303 bits (776),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   254 bits (650),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 128/140 (91%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  244  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  303

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  304  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  363

Query  358  NIQKESTLHLVLRLRGGMQI  299
            NIQKESTLHLVLRLRGG ++
Sbjct  364  NIQKESTLHLVLRLRGGFRM  383



>ref|NP_849300.4| polyubiquitin 10 [Arabidopsis thaliana]
 ref|NP_567291.4| polyubiquitin 10 [Arabidopsis thaliana]
 ref|NP_001078353.4| polyubiquitin 10 [Arabidopsis thaliana]
 ref|XP_004134747.1| PREDICTED: polyubiquitin-like isoform 1 [Cucumis sativus]
 ref|XP_004134748.1| PREDICTED: polyubiquitin-like isoform 2 [Cucumis sativus]
 ref|XP_004496773.1| PREDICTED: polyubiquitin-like [Cicer arietinum]
 ref|XP_006360087.1| PREDICTED: polyubiquitin-like isoform X2 [Solanum tuberosum]
 ref|XP_006287939.1| hypothetical protein CARUB_v10001174mg [Capsella rubella]
 ref|XP_006370633.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 ref|XP_006370635.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 ref|XP_006370637.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 ref|XP_006380307.1| hypothetical protein POPTR_0007s02460g [Populus trichocarpa]
 ref|XP_006377834.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_006377835.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_006372946.1| UBIQUITIN 11 family protein [Populus trichocarpa]
 ref|XP_006396616.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 ref|XP_006396617.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 ref|XP_006452184.1| hypothetical protein CICLE_v10008642mg [Citrus clementina]
 ref|XP_007021032.1| Polyubiquitin 10 isoform 1 [Theobroma cacao]
 ref|XP_007021033.1| Polyubiquitin 10 isoform 1 [Theobroma cacao]
 ref|XP_007021035.1| Polyubiquitin 10 [Theobroma cacao]
 ref|XP_007025987.1| Polyubiquitin 10 [Theobroma cacao]
 ref|XP_007143204.1| hypothetical protein PHAVU_007G052600g [Phaseolus vulgaris]
 ref|XP_007211430.1| hypothetical protein PRUPE_ppa007117mg [Prunus persica]
 ref|XP_007211607.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_008244360.1| PREDICTED: polyubiquitin isoform X2 [Prunus mume]
 ref|XP_009365167.1| PREDICTED: polyubiquitin [Pyrus x bretschneideri]
 ref|XP_009358097.1| PREDICTED: polyubiquitin isoform X2 [Pyrus x bretschneideri]
 ref|XP_009358098.1| PREDICTED: polyubiquitin isoform X2 [Pyrus x bretschneideri]
 ref|XP_009343085.1| PREDICTED: polyubiquitin isoform X2 [Pyrus x bretschneideri]
 ref|XP_009343086.1| PREDICTED: polyubiquitin isoform X2 [Pyrus x bretschneideri]
 ref|XP_009611794.1| PREDICTED: polyubiquitin [Nicotiana tomentosiformis]
 ref|XP_009792849.1| PREDICTED: polyubiquitin [Nicotiana sylvestris]
 ref|XP_009793738.1| PREDICTED: polyubiquitin [Nicotiana sylvestris]
 ref|XP_010267760.1| PREDICTED: polyubiquitin [Nelumbo nucifera]
 ref|XP_010423137.1| PREDICTED: polyubiquitin [Camelina sativa]
 ref|XP_010447068.1| PREDICTED: polyubiquitin [Camelina sativa]
 ref|XP_010455857.1| PREDICTED: polyubiquitin [Camelina sativa]
 ref|XP_010644407.1| PREDICTED: polyubiquitin [Vitis vinifera]
 ref|XP_011026350.1| PREDICTED: polyubiquitin [Populus euphratica]
 ref|XP_011030849.1| PREDICTED: polyubiquitin [Populus euphratica]
 ref|XP_011048300.1| PREDICTED: polyubiquitin [Populus euphratica]
 ref|XP_011460984.1| PREDICTED: polyubiquitin [Fragaria vesca subsp. vesca]
 ref|XP_011460993.1| PREDICTED: polyubiquitin [Fragaria vesca subsp. vesca]
 sp|P69322.2|UBIQP_PEA RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Pisum sativum]
 emb|CAA34886.1| unnamed protein product [Pisum sativum]
 gb|AAD03344.1| ubiquitin [Pisum sativum]
 gb|AAK96602.1| AT4g05320/C17L7_240 [Arabidopsis thaliana]
 dbj|BAD26592.1| polyubiquitin [Populus nigra]
 gb|ABB73307.1| ubiquitin [Lotus japonicus]
 gb|ABK92512.1| unknown [Populus trichocarpa]
 gb|ABK93264.1| unknown [Populus trichocarpa]
 gb|ABK95903.1| unknown [Populus trichocarpa]
 gb|ABK96012.1| unknown [Populus trichocarpa]
 gb|ABK96127.1| unknown [Populus trichocarpa]
 gb|ACK56276.1| ubiquitin [Populus trichocarpa]
 gb|AEE82501.1| polyubiquitin 10 [Arabidopsis thaliana]
 gb|AEE82504.1| polyubiquitin 10 [Arabidopsis thaliana]
 gb|AEE82505.1| polyubiquitin 10 [Arabidopsis thaliana]
 gb|EMJ12629.1| hypothetical protein PRUPE_ppa007117mg [Prunus persica]
 gb|EMJ12806.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|EOA20837.1| hypothetical protein CARUB_v10001174mg [Capsella rubella]
 gb|EOY12557.1| Polyubiquitin 10 isoform 1 [Theobroma cacao]
 gb|EOY12558.1| Polyubiquitin 10 isoform 1 [Theobroma cacao]
 gb|EOY12560.1| Polyubiquitin 10 [Theobroma cacao]
 gb|EOY28609.1| Polyubiquitin 10 [Theobroma cacao]
 gb|ERP50743.1| UBIQUITIN 11 family protein [Populus trichocarpa]
 gb|ERP55631.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP55632.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP58104.1| hypothetical protein POPTR_0007s02460g [Populus trichocarpa]
 gb|ERP67202.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ERP67204.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ERP67206.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ESQ38069.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 gb|ESQ38070.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 gb|ESR65424.1| hypothetical protein CICLE_v10008642mg [Citrus clementina]
 gb|ESW15198.1| hypothetical protein PHAVU_007G052600g [Phaseolus vulgaris]
 gb|KDO52961.1| hypothetical protein CISIN_1g009518mg [Citrus sinensis]
 gb|KDP20793.1| hypothetical protein JCGZ_21264 [Jatropha curcas]
 gb|AET01628.2| polyubiquitin 3 [Medicago truncatula]
 gb|KEH30745.1| polyubiquitin 3 [Medicago truncatula]
 gb|KJB13593.1| hypothetical protein B456_002G083100 [Gossypium raimondii]
 gb|KJB62633.1| hypothetical protein B456_009G427000 [Gossypium raimondii]
 prf||1603402A poly-ubiquitin
Length=381

 Score =   405 bits (1042),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 205/214 (96%), Positives = 205/214 (96%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  168  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  227

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  228  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  287

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  288  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score =   403 bits (1036),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   403 bits (1036),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   303 bits (775),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_011077812.1| PREDICTED: polyubiquitin 3 [Sesamum indicum]
 ref|XP_011077813.1| PREDICTED: polyubiquitin 3 [Sesamum indicum]
Length=334

 Score =   404 bits (1038),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  44   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  103

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  104  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  163

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  164  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  223

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  224  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  257


 Score =   404 bits (1037),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  120  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  179

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  180  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  239

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  240  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  299

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  300  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  332


 Score =   333 bits (853),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 167/168 (99%), Positives = 167/168 (99%), Gaps = 0/168 (0%)
 Frame = -1

Query  580  QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF  401
            QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF
Sbjct  14   QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF  73

Query  400  AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK  221
            AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK
Sbjct  74   AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK  133

Query  220  IQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  134  IQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  181



>gb|AAB68045.1| polyubiquitin [Fragaria x ananassa]
Length=381

 Score =   405 bits (1042),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 205/214 (96%), Positives = 205/214 (96%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  168  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  227

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  228  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  287

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  288  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score =   401 bits (1030),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 203/214 (95%), Positives = 203/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   401 bits (1030),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 203/214 (95%), Positives = 203/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KI DKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIXDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   300 bits (769),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|KJB81825.1| hypothetical protein B456_013G163500 [Gossypium raimondii]
 gb|KJB81826.1| hypothetical protein B456_013G163500 [Gossypium raimondii]
Length=381

 Score =   405 bits (1042),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 205/214 (96%), Positives = 205/214 (96%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  168  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  227

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  228  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  287

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  288  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score =   403 bits (1035),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   403 bits (1035),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   301 bits (770),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_009763135.1| PREDICTED: polyubiquitin-like [Nicotiana sylvestris]
Length=381

 Score =   405 bits (1042),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 205/214 (96%), Positives = 205/214 (96%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  168  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  227

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  228  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  287

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  288  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score =   402 bits (1033),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 203/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  S+  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESTDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   402 bits (1033),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 203/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVES+DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESTDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   300 bits (769),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES+DTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESTDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_010938693.1| PREDICTED: polyubiquitin [Elaeis guineensis]
Length=307

 Score =   403 bits (1035),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 203/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIF+KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFIKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   401 bits (1031),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 205/224 (92%), Positives = 206/224 (92%), Gaps = 8/224 (4%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF*IP*CPNDVC  47
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG        D+C
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG--------DLC  307


 Score =   302 bits (774),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIF+KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFIKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|KIM78989.1| hypothetical protein PILCRDRAFT_573034 [Piloderma croceum F 1598]
Length=229

 Score =   400 bits (1027),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 201/213 (94%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTL+ YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228


 Score =   301 bits (770),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>ref|XP_006428925.1| hypothetical protein CICLE_v10012291mg [Citrus clementina]
 gb|ESR42165.1| hypothetical protein CICLE_v10012291mg [Citrus clementina]
Length=306

 Score =   403 bits (1035),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   402 bits (1034),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   303 bits (775),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>emb|CAA54603.1| pentameric polyubiquitin [Nicotiana tabacum]
Length=346

 Score =   404 bits (1039),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   404 bits (1039),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   324 bits (831),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 165/174 (95%), Positives = 165/174 (95%), Gaps = 0/174 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  168  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  227

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  228  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  287

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  197
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP
Sbjct  288  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score =   303 bits (777),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_002992988.1| hypothetical protein SELMODRAFT_187148 [Selaginella moellendorffii]
 ref|XP_002994514.1| hypothetical protein SELMODRAFT_138728 [Selaginella moellendorffii]
 gb|EFJ04422.1| hypothetical protein SELMODRAFT_138728 [Selaginella moellendorffii]
 gb|EFJ05934.1| hypothetical protein SELMODRAFT_187148 [Selaginella moellendorffii]
Length=229

 Score =   400 bits (1027),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 202/214 (94%), Positives = 202/214 (94%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   299 bits (766),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_009358096.1| PREDICTED: polyubiquitin isoform X1 [Pyrus x bretschneideri]
 ref|XP_009343084.1| PREDICTED: polyubiquitin isoform X1 [Pyrus x bretschneideri]
Length=401

 Score =   406 bits (1044),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 205/214 (96%), Positives = 205/214 (96%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  188  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  247

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  248  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  307

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  308  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  367

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  368  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  401


 Score =   404 bits (1037),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  36   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  95

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  96   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  155

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  156  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  215

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  216  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  249


 Score =   404 bits (1037),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  112  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  171

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  172  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  231

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  232  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  291

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  292  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  325


 Score =   303 bits (776),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  21   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  80

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  81   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  140

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  141  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  173



>ref|XP_009605659.1| PREDICTED: polyubiquitin [Nicotiana tomentosiformis]
Length=305

 Score =   402 bits (1034),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLED RTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDERTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305


 Score =   400 bits (1028),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 203/214 (95%), Positives = 203/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED RTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDERTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   300 bits (767),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLED RTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDERTLADYNIQKESTLHLVLRLRGGM  153



>gb|AAB95250.1| ubiquitin [Arabidopsis thaliana]
Length=304

 Score =   402 bits (1034),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 203/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQ+ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQRESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   402 bits (1033),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 203/213 (95%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQ+ESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQRESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   302 bits (774),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQ+ESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQRESTLHLVLRLRGGM  153



>gb|KIM78981.1| hypothetical protein PILCRDRAFT_10644 [Piloderma croceum F 1598]
Length=229

 Score =   400 bits (1027),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 201/213 (94%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTL+ YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228


 Score =   301 bits (770),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153


 Score =   252 bits (643),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 126/138 (91%), Positives = 129/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTL+ YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  211

Query  358  NIQKESTLHLVLRLRGGM  305
            NIQKESTLHLVLRLRGG+
Sbjct  212  NIQKESTLHLVLRLRGGV  229



>gb|KIR83632.1| polyubiquitin, partial [Cryptococcus gattii IND107]
Length=218

 Score =   399 bits (1025),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 201/213 (94%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTL+ YNIQKESTLHLVLRLRG
Sbjct  5    EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG  64

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  65   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  124

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  125  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  184

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  185  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  217


 Score =   279 bits (714),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 139/142 (98%), Positives = 141/142 (99%), Gaps = 0/142 (0%)
 Frame = -1

Query  502  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  323
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVL
Sbjct  1    TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  60

Query  322  RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT  143
            RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT
Sbjct  61   RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT  120

Query  142  LADYNIQKESTLHLVLRLRGGF  77
            L+DYNIQKESTLHLVLRLRGG 
Sbjct  121  LSDYNIQKESTLHLVLRLRGGM  142



>gb|AEW46688.1| polyubiquitin, partial [Ulva linza]
Length=226

 Score =   399 bits (1026),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 202/211 (96%), Positives = 202/211 (96%), Gaps = 0/211 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLR  86
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLR
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLR  226


 Score =   304 bits (778),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_006593989.1| PREDICTED: polyubiquitin 10-like isoform X1 [Glycine max]
Length=381

 Score =   405 bits (1041),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 205/214 (96%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  168  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  227

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  228  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  287

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  288  NIQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score =   403 bits (1036),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   403 bits (1036),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   303 bits (776),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_009631616.1| PREDICTED: polyubiquitin-like [Nicotiana tomentosiformis]
Length=381

 Score =   405 bits (1041),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 205/214 (96%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID +K KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  168  EVESSDTIDNIKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  227

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  228  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  287

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  288  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score =   399 bits (1024),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 201/214 (94%), Positives = 203/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG TLADY
Sbjct  76   GMQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGCTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDN+KAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNIKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   399 bits (1024),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 201/214 (94%), Positives = 203/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  +S  ID VK KIQDKEGIPPDQQR  FAGKQLEDG TLA YNIQKESTLHLVLRLRG
Sbjct  92   EVENSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGCTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDN+KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNIKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   299 bits (765),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDG TLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGCTLADYNIQKESTLHLVLRLRGGM  153



>gb|KJB14874.1| hypothetical protein B456_002G147600, partial [Gossypium raimondii]
Length=344

 Score =   404 bits (1038),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  57   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  116

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  117  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  176

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  177  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  236

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  237  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  270


 Score =   401 bits (1031),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 203/212 (96%), Positives = 203/212 (96%), Gaps = 0/212 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  133  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  192

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  193  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  252

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  253  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  312

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  83
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRG
Sbjct  313  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  344


 Score =   355 bits (910),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 178/180 (99%), Positives = 178/180 (99%), Gaps = 0/180 (0%)
 Frame = -1

Query  616  LEDGRTLAXYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  437
            LEDGRTLA YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK
Sbjct  15   LEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  74

Query  436  EGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV  257
            EGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV
Sbjct  75   EGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV  134

Query  256  ESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            ESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  135  ESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  194



>ref|NP_001147027.1| polyubiquitin containing 7 ubiquitin monomers [Zea mays]
 gb|ACG25128.1| polyubiquitin containing 7 ubiquitin monomers [Zea mays]
Length=311

 Score =   402 bits (1034),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  98   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  157

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  158  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  217

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  218  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  277

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  278  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  310


 Score =   351 bits (901),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 186/222 (84%), Positives = 188/222 (85%), Gaps = 10/222 (5%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLR---  548
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGR L      + +  H       
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRNLIFSPFARNA--HTARSPIS  73

Query  547  -----LRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLE  383
                  R  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLE
Sbjct  74   DPRSPRRSKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLE  133

Query  382  DGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG  203
            DGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG
Sbjct  134  DGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG  193

Query  202  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  194  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  235


 Score =   248 bits (632),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 133/161 (83%), Positives = 135/161 (84%), Gaps = 10/161 (6%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR L    
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRNLIFSP  60

Query  355  IQKESTLHLVLR--------LRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  200
              + +  H             R  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  61   FARNA--HTARSPISDPRSPRRSKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  118

Query  199  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  119  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  159



>dbj|BAL61087.1| polyubiquitin [Dianthus caryophyllus]
Length=229

 Score =   399 bits (1026),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 202/213 (95%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   299 bits (766),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|EJU04700.1| polyubiquitin UbiD/Ubi4 [Dacryopinax sp. DJM-731 SS1]
Length=229

 Score =   399 bits (1026),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 201/213 (94%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTL+ YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228


 Score =   301 bits (770),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>ref|XP_719867.1| hypothetical protein CaO19.6771 [Candida albicans SC5314]
 ref|XP_719750.1| hypothetical protein CaO19.14063 [Candida albicans SC5314]
 emb|CAA76783.1| polyubiquitin [Candida albicans]
 gb|EAL00878.1| hypothetical protein CaO19.14063 [Candida albicans SC5314]
 gb|EAL01003.1| hypothetical protein CaO19.6771 [Candida albicans SC5314]
 gb|EEQ44747.1| hypothetical protein CAWG_03035 [Candida albicans WO-1]
 emb|CCE42351.1| hypothetical protein CPAR2_809000 [Candida parapsilosis]
 gb|EMG49099.1| hypothetical protein G210_0209 [Candida maltosa Xu316]
 gb|KHC79264.1| polyubiquitin [Candida albicans SC5314]
Length=229

 Score =   399 bits (1026),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 200/214 (93%), Positives = 205/214 (96%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTL+ YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGF
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGF  229


 Score =   298 bits (762),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 148/153 (97%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>gb|KJA26171.1| hypothetical protein HYPSUDRAFT_354705 [Hypholoma sublateritium 
FD-334 SS-4]
Length=229

 Score =   399 bits (1026),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 201/213 (94%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTL+ YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228


 Score =   301 bits (770),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>gb|KDB11907.1| ubiquitin [Ustilaginoidea virens]
Length=305

 Score =   402 bits (1034),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 203/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   400 bits (1029),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 202/213 (95%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   302 bits (773),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_011110054.1| hypothetical protein H072_4094 [Dactylellina haptotyla CBS 200.50]
 gb|EPS41950.1| hypothetical protein H072_4094 [Dactylellina haptotyla CBS 200.50]
Length=229

 Score =   399 bits (1026),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 201/213 (94%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTL+ YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228


 Score =   300 bits (769),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>gb|AAK68824.1| Unknown protein [Arabidopsis thaliana]
Length=229

 Score =   399 bits (1026),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 203/214 (95%), Positives = 203/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVK L GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKPLPGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  229


 Score =   302 bits (773),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   108 bits (269),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = -1

Query  745  PYPXXPXXXEXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKEST  566
            P P      E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKEST
Sbjct  159  PLPGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKEST  218

Query  565  LHLVLRLRGGM  533
            LHLVLRLRGG 
Sbjct  219  LHLVLRLRGGF  229



>ref|XP_001783045.1| predicted protein [Physcomitrella patens]
 gb|EDQ52114.1| predicted protein [Physcomitrella patens]
Length=229

 Score =   399 bits (1025),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 202/213 (95%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   299 bits (766),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_008796945.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin-like [Phoenix dactylifera]
Length=309

 Score =   402 bits (1033),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 203/214 (95%), Positives = 203/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVES DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESXDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   402 bits (1032),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 203/213 (95%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  S   ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESXDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   301 bits (772),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES DTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESXDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|KJB62485.1| hypothetical protein B456_009G418900 [Gossypium raimondii]
Length=305

 Score =   402 bits (1033),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 203/213 (95%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   401 bits (1030),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 202/214 (94%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   301 bits (770),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_007154496.1| hypothetical protein PHAVU_003G1236001g [Phaseolus vulgaris]
 gb|ESW26490.1| hypothetical protein PHAVU_003G1236001g [Phaseolus vulgaris]
Length=305

 Score =   402 bits (1033),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 203/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  305


 Score =   402 bits (1032),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 203/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   303 bits (775),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_003574865.1| PREDICTED: polyubiquitin-like [Brachypodium distachyon]
Length=341

 Score =   403 bits (1036),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  52   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  111

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  112  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  171

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  172  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  231

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  232  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  265


 Score =   403 bits (1035),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  128  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  187

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  188  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  247

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  248  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  307

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  308  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  340


 Score =   303 bits (776),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  37   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  96

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  97   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  156

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  157  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  189



>ref|XP_007339454.1| ubiquitin [Auricularia delicata TFB-10046 SS5]
 gb|EJD52725.1| ubiquitin [Auricularia delicata TFB-10046 SS5]
 gb|KIM81538.1| hypothetical protein PILCRDRAFT_821319 [Piloderma croceum F 1598]
Length=305

 Score =   402 bits (1032),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 202/214 (94%), Positives = 205/214 (96%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTL+ YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGF
Sbjct  272  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGF  305


 Score =   399 bits (1026),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 201/214 (94%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTL+ YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   300 bits (769),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>emb|CDP08567.1| unnamed protein product [Coffea canephora]
Length=364

 Score =   404 bits (1038),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  69   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  128

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  129  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  188

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  189  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  248

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  249  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  282


 Score =   375 bits (963),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 192/214 (90%), Positives = 194/214 (91%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  145  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  204

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  205  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  264

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  265  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  324

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNI   +   L  + R  F
Sbjct  325  IFAGKQLEDGRTLADYNITPLTMSRLRSKTRRAF  358


 Score =   303 bits (777),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  54   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  113

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  114  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  173

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  174  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  206



>ref|XP_001830230.1| ubiquitin [Coprinopsis cinerea okayama7#130]
 gb|EAU91601.1| ubiquitin [Coprinopsis cinerea okayama7#130]
Length=305

 Score =   402 bits (1032),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 202/214 (94%), Positives = 205/214 (96%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTL+ YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGF
Sbjct  272  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGF  305


 Score =   397 bits (1021),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 200/214 (93%), Positives = 203/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTL+ YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   298 bits (764),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>ref|XP_006288300.1| hypothetical protein CARUB_v10001544mg [Capsella rubella]
 gb|EOA21198.1| hypothetical protein CARUB_v10001544mg [Capsella rubella]
Length=306

 Score =   402 bits (1032),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 203/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQ+KEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQEKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   401 bits (1031),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 203/213 (95%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQ+KEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQEKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   303 bits (776),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|KIK28767.1| hypothetical protein PISMIDRAFT_672939, partial [Pisolithus microcarpus 
441]
Length=247

 Score =   399 bits (1026),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 201/214 (94%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTL+ YNIQKESTLHLVLRLRG
Sbjct  34   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG  93

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  94   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  153

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  154  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  213

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  214  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  247


 Score =   337 bits (864),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 168/171 (98%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = -1

Query  589  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  410
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  1    YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  60

Query  409  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  230
            LIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV
Sbjct  61   LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  120

Query  229  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            KAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  171



>ref|XP_006372519.1| polyubiquitin family protein [Populus trichocarpa]
 gb|ERP50316.1| polyubiquitin family protein [Populus trichocarpa]
Length=305

 Score =   402 bits (1032),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 203/214 (95%), Positives = 203/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305


 Score =   399 bits (1025),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 202/214 (94%), Positives = 202/214 (94%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   299 bits (765),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_010227188.1| PREDICTED: polyubiquitin isoform X1 [Brachypodium distachyon]
Length=339

 Score =   403 bits (1035),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  50   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  109

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  110  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  169

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  170  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  229

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  230  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  263


 Score =   403 bits (1035),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  126  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  185

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  186  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  245

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  246  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  305

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  306  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  338


 Score =   310 bits (793),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 155/156 (99%), Positives = 155/156 (99%), Gaps = 0/156 (0%)
 Frame = -1

Query  544  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  365
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  32   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  91

Query  364  DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  185
            DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ
Sbjct  92   DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  151

Query  184  RLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            RLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  152  RLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  187



>gb|KEH31155.1| polyubiquitin 3 [Medicago truncatula]
Length=381

 Score =   404 bits (1039),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 205/214 (96%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  168  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  227

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  228  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  287

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  288  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score =   403 bits (1036),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   402 bits (1033),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 203/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  305


 Score =   303 bits (775),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|NP_001148453.1| LOC100282068 [Zea mays]
 ref|XP_002299930.1| UBIQUITIN 11 family protein [Populus trichocarpa]
 ref|XP_003607671.1| Ubiquitin [Medicago truncatula]
 gb|AAC49014.1| ubiquitin [Zea mays]
 gb|ACG31521.1| polyubiquitin containing 7 ubiquitin monomers [Zea mays]
 gb|EEE84735.1| UBIQUITIN 11 family protein [Populus trichocarpa]
 gb|ACR37911.1| unknown [Zea mays]
 gb|AES89868.1| polyubiquitin 3 [Medicago truncatula]
 gb|AFW66440.1| putative ubiquitin family protein isoform 1 [Zea mays]
 gb|AFW66441.1| putative ubiquitin family protein isoform 2 [Zea mays]
Length=381

 Score =   404 bits (1039),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 205/214 (96%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  168  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  227

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  228  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  287

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  288  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGY  381


 Score =   403 bits (1036),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   403 bits (1036),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   303 bits (775),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|AIY27743.1| polyubiquitin Ubi10, partial [Betula luminifera]
Length=330

 Score =   402 bits (1034),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 202/214 (94%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  90   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  149

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFV+TLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  150  GMQIFVRTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  209

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  210  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  269

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  270  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  303


 Score =   398 bits (1022),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 198/207 (96%), Positives = 200/207 (97%), Gaps = 0/207 (0%)
 Frame = -1

Query  697  IDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRGGMQIFVK  518
            ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLV RLRGGMQIFVK
Sbjct  21   IDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVFRLRGGMQIFVK  80

Query  517  TLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKEST  338
            TLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKEST
Sbjct  81   TLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKEST  140

Query  337  LHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQL  158
            LHLVLRLRGGMQIFV+TLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQL
Sbjct  141  LHLVLRLRGGMQIFVRTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQL  200

Query  157  EDGRTLADYNIQKESTLHLVLRLRGGF  77
            EDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  201  EDGRTLADYNIQKESTLHLVLRLRGGM  227


 Score =   306 bits (783),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 155/165 (94%), Positives = 156/165 (95%), Gaps = 0/165 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  +D VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  166  EVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  225

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  226  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  285

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  224
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  286  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  330



>gb|KIK92093.1| hypothetical protein PAXRUDRAFT_830299, partial [Paxillus rubicundulus 
Ve08.2h10]
Length=229

 Score =   398 bits (1023),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 201/213 (94%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTL  YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLLDYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228


 Score =   300 bits (767),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLLDYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>gb|ADD52202.1| ubiquitin [Catharanthus roseus]
 gb|AEK98798.1| ubiquitin [Carthamus tinctorius]
Length=381

 Score =   404 bits (1038),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  168  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  227

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  228  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  287

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  288  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            I AGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  348  ILAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score =   399 bits (1024),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 202/214 (94%), Positives = 202/214 (94%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS   D VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA  NIQKESTLHLVLRLRG
Sbjct  92   EVESSDTTDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADCNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   397 bits (1019),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 201/214 (94%), Positives = 201/214 (94%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK K QDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKTQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDT DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD 
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTTDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADC  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   296 bits (758),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 149/153 (97%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAK QDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKTQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT DNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTTDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLAD NIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADCNIQKESTLHLVLRLRGGM  153



>ref|XP_002872109.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48368.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=383

 Score =   404 bits (1038),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  93   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  152

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  153  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  212

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  213  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  272

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  273  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  306


 Score =   403 bits (1036),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 203/213 (95%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  169  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  228

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  229  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  288

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG+PPDQQRL
Sbjct  289  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGVPPDQQRL  348

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  349  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  381


 Score =   400 bits (1028),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 203/214 (95%), Positives = 203/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIP DQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  17   EVESSDTIDNVKAKIQDKEGIPLDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  76

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  77   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  136

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  137  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  196

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  197  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  230


 Score =   300 bits (767),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP DQQRLIFAGKQLEDGRTLADYN
Sbjct  2    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPLDQQRLIFAGKQLEDGRTLADYN  61

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  62   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  121

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  122  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  154



>emb|CEF99839.1| Ubiquitin conserved site [Ostreococcus tauri]
Length=339

 Score =   402 bits (1034),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  50   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  109

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  110  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  169

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  170  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  229

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  230  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  263


 Score =   402 bits (1033),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  126  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  185

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  186  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  245

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  246  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  305

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  306  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  338


 Score =   302 bits (774),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  35   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  94

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  95   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  154

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  155  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  187



>gb|EGO00904.1| hypothetical protein SERLA73DRAFT_178893 [Serpula lacrymans var. 
lacrymans S7.3]
Length=312

 Score =   401 bits (1031),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 201/214 (94%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTL+ YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   389 bits (999),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 195/208 (94%), Positives = 198/208 (95%), Gaps = 0/208 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTL+ YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVL  95
            IFAGKQLEDGRTL+DYNIQKESTLHLV 
Sbjct  272  IFAGKQLEDGRTLSDYNIQKESTLHLVF  299


 Score =   301 bits (772),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>gb|KJB81824.1| hypothetical protein B456_013G163500 [Gossypium raimondii]
Length=393

 Score =   404 bits (1039),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   404 bits (1039),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   381 bits (979),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 193/204 (95%), Positives = 194/204 (95%), Gaps = 0/204 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  168  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  227

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  228  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  287

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  288  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  178  IFAGKQLEDGRTLADYNIQKESTL  107
            IFAGKQLEDGRTLADYNIQKE+ L
Sbjct  348  IFAGKQLEDGRTLADYNIQKENPL  371


 Score =   302 bits (773),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|KIL68862.1| hypothetical protein M378DRAFT_157997 [Amanita muscaria Koide 
BX008]
Length=305

 Score =   401 bits (1030),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 202/214 (94%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  305


 Score =   401 bits (1030),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 202/214 (94%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTL+ YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   302 bits (773),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|EWZ40370.1| ubiquitin C [Fusarium oxysporum Fo47]
Length=229

 Score =   398 bits (1023),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 200/213 (94%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTL+ YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228


 Score =   299 bits (766),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_008020911.1| hypothetical protein SETTUDRAFT_162442 [Setosphaeria turcica 
Et28A]
 gb|EOA91885.1| hypothetical protein SETTUDRAFT_162442 [Setosphaeria turcica 
Et28A]
Length=305

 Score =   401 bits (1030),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 202/214 (94%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   400 bits (1029),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 202/213 (95%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   301 bits (770),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_006381473.1| polyubiquitin family protein [Populus trichocarpa]
 gb|ERP59270.1| polyubiquitin family protein [Populus trichocarpa]
Length=306

 Score =   401 bits (1030),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 203/213 (95%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTG TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGNTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   400 bits (1027),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 202/214 (94%), Positives = 203/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  +S  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVENSDTIDNVKVKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGNTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   300 bits (767),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVE+SDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVENSDTIDNVKVKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>emb|CDR41572.1| RHTO0S06e03070g1_1 [Rhodosporidium toruloides]
Length=230

 Score =   398 bits (1023),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 200/213 (94%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTL+ YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            N+QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NVQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTL DYNIQKESTLHLVLRLRGG
Sbjct  196  IFAGKQLEDGRTLQDYNIQKESTLHLVLRLRGG  228


 Score =   300 bits (769),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTL+DYN+QKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNVQKESTLHLVLRLRGGM  153



>ref|XP_009108753.1| PREDICTED: polyubiquitin 11-like [Brassica rapa]
Length=229

 Score =   398 bits (1022),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 201/214 (94%), Positives = 202/214 (94%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKE+ LHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKETNLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVK LTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKNLTGKTITLEVESSDTIDNVKAKIQDKEDIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  229


 Score =   300 bits (767),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKE+ LHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKETNLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_007154493.1| hypothetical protein PHAVU_003G123500g [Phaseolus vulgaris]
 gb|ESW26487.1| hypothetical protein PHAVU_003G123500g [Phaseolus vulgaris]
Length=429

 Score =   405 bits (1042),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 205/214 (96%), Positives = 205/214 (96%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  216  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  275

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  276  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  335

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  336  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  395

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  396  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  429


 Score =   403 bits (1035),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  64   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  123

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  124  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  183

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  184  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  243

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  244  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  277


 Score =   403 bits (1035),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  140  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  199

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  200  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  259

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  260  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  319

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  320  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  353


 Score =   303 bits (775),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  49   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  108

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  109  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  168

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  169  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  201



>gb|AGV54228.1| polyubiquitin-like protein [Phaseolus vulgaris]
Length=381

 Score =   404 bits (1037),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  168  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  227

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  228  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  287

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  288  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  381


 Score =   398 bits (1023),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 202/214 (94%), Positives = 202/214 (94%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLV  LRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVSWLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   398 bits (1023),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 202/214 (94%), Positives = 202/214 (94%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLV  LRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVSWLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   298 bits (762),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLV  LRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVSWLRGGM  153



>ref|XP_006396612.1| hypothetical protein EUTSA_v10028730mg [Eutrema salsugineum]
 ref|XP_010537979.1| PREDICTED: polyubiquitin [Tarenaya hassleriana]
 emb|CAJ86369.1| OSIGBa0117N13.13 [Oryza sativa Indica Group]
 emb|CAJ86419.1| H0303G06.8 [Oryza sativa Indica Group]
 gb|EAY95663.1| hypothetical protein OsI_17529 [Oryza sativa Indica Group]
 gb|ESQ38065.1| hypothetical protein EUTSA_v10028730mg [Eutrema salsugineum]
Length=381

 Score =   404 bits (1037),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  168  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  227

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  228  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  287

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  288  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  381


 Score =   404 bits (1037),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   404 bits (1037),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   303 bits (776),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_010270791.1| PREDICTED: polyubiquitin-like [Nelumbo nucifera]
Length=382

 Score =   404 bits (1037),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   403 bits (1036),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 203/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   403 bits (1035),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 203/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  168  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  227

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  228  GMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  287

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  288  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGI  381


 Score =   303 bits (776),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_002874006.1| hypothetical protein ARALYDRAFT_488966 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50265.1| hypothetical protein ARALYDRAFT_488966 [Arabidopsis lyrata subsp. 
lyrata]
Length=382

 Score =   404 bits (1037),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   404 bits (1037),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   403 bits (1036),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  168  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  227

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  228  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  287

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  288  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (775),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQ+FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQVFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|NP_001105376.1| polyubiquitin [Zea mays]
 gb|AAC49025.1| polyubiquitin [Zea mays]
Length=381

 Score =   404 bits (1037),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   402 bits (1034),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 203/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLV+RLRGG 
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVVRLRGGM  305


 Score =   402 bits (1033),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 203/213 (95%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  168  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  227

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  228  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  287

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLV+RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  288  NIQKESTLHLVVRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (776),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_010240636.1| PREDICTED: polyubiquitin isoform X1 [Brachypodium distachyon]
 ref|XP_010240784.1| PREDICTED: polyubiquitin isoform X1 [Brachypodium distachyon]
Length=383

 Score =   404 bits (1037),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  18   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  77

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  78   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  137

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  138  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  197

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  198  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  231


 Score =   404 bits (1037),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  94   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  153

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  154  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  213

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  214  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  273

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  274  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  307


 Score =   403 bits (1036),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  170  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  229

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  230  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  289

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  290  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  349

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  350  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  382


 Score =   303 bits (776),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  3    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  62

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  63   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  122

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  123  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  155



>ref|XP_002508175.1| ubiquitin [Micromonas sp. RCC299]
 ref|XP_003061956.1| ubiquitin [Micromonas pusilla CCMP1545]
 gb|EEH53668.1| ubiquitin [Micromonas pusilla CCMP1545]
 gb|ACO69433.1| ubiquitin [Micromonas sp. RCC299]
 gb|KEH20642.1| polyubiquitin 3 [Medicago truncatula]
Length=381

 Score =   404 bits (1037),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   404 bits (1037),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   403 bits (1036),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  168  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  227

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  228  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  287

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  288  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (776),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|EYU33608.1| hypothetical protein MIMGU_mgv1a004315mg [Erythranthe guttata]
Length=381

 Score =   404 bits (1037),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   404 bits (1037),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   403 bits (1036),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  168  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  227

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  228  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  287

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  288  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (776),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   254 bits (649),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 128/138 (93%), Positives = 129/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  244  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  303

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  304  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  363

Query  358  NIQKESTLHLVLRLRGGM  305
            NIQKESTLHLVLRLRGG+
Sbjct  364  NIQKESTLHLVLRLRGGV  381



>gb|ACS68205.1| ubiquitin 10.2 [Brassica napus]
Length=381

 Score =   404 bits (1037),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   404 bits (1037),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   403 bits (1036),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  168  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  227

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  228  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  287

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  288  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGI  381


 Score =   303 bits (776),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_010911599.1| PREDICTED: polyubiquitin 4 [Elaeis guineensis]
Length=384

 Score =   404 bits (1037),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   404 bits (1037),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   403 bits (1036),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  168  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  227

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  228  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  287

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  288  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (776),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|ABU40645.1| polyubiquitin [Triticum aestivum]
Length=380

 Score =   404 bits (1037),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   404 bits (1037),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   403 bits (1036),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  168  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  227

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  228  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  287

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  288  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (776),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_003670049.1| hypothetical protein NDAI_0D04930 [Naumovozyma dairenensis CBS 
421]
 ref|XP_003959063.1| hypothetical protein KAFR_0I01470 [Kazachstania africana CBS 
2517]
 ref|XP_004181533.1| hypothetical protein TBLA_0G00670 [Tetrapisispora blattae CBS 
6284]
 emb|CCD24806.1| hypothetical protein NDAI_0D04930 [Naumovozyma dairenensis CBS 
421]
 emb|CCF59928.1| hypothetical protein KAFR_0I01470 [Kazachstania africana CBS 
2517]
 emb|CCH62014.1| hypothetical protein TBLA_0G00670 [Tetrapisispora blattae CBS 
6284]
Length=229

 Score =   398 bits (1022),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 199/214 (93%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTL+ YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   298 bits (764),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 148/153 (97%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>gb|AAQ07453.1| ubiquitin [Musa acuminata AAA Group]
Length=381

 Score =   404 bits (1037),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   402 bits (1032),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 203/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITL+VESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLKVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   401 bits (1031),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 203/213 (95%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  168  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  227

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITL+VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  228  GMQIFVKTLTGKTITLKVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  287

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  288  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (776),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_010062974.1| PREDICTED: polyubiquitin [Eucalyptus grandis]
Length=425

 Score =   405 bits (1041),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 205/214 (96%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  212  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  271

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  272  GMQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  331

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  332  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  391

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  392  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  425


 Score =   402 bits (1034),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 203/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  +D VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  60   EVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  119

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  120  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  179

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  180  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  239

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  240  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  273


 Score =   402 bits (1034),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 203/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  136  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  195

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  196  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  255

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRL
Sbjct  256  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRL  315

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  316  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  349


 Score =   304 bits (779),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 153/157 (97%), Positives = 154/157 (98%), Gaps = 0/157 (0%)
 Frame = -1

Query  547  LRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL  368
            LR  MQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL
Sbjct  41   LRVKMQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL  100

Query  367  ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  188
            ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ
Sbjct  101  ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  160

Query  187  QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  161  QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  197



>ref|NP_001174480.1| Os05g0504766 [Oryza sativa Japonica Group]
 ref|XP_002438904.1| hypothetical protein SORBIDRAFT_10g028020 [Sorghum bicolor]
 ref|XP_006656385.1| PREDICTED: polyubiquitin-like [Oryza brachyantha]
 ref|XP_007027294.1| Ubiquitin 4 [Theobroma cacao]
 ref|XP_010240640.1| PREDICTED: polyubiquitin isoform X2 [Brachypodium distachyon]
 ref|XP_010240789.1| PREDICTED: polyubiquitin isoform X2 [Brachypodium distachyon]
 gb|AAD30173.1|AF148448_1 polyubiquitin [Sporobolus stapfianus]
 gb|AAW56906.1| polyubiquitin [Oryza sativa Japonica Group]
 gb|EAY98614.1| hypothetical protein OsI_20535 [Oryza sativa Indica Group]
 gb|EEE64284.1| hypothetical protein OsJ_19121 [Oryza sativa Japonica Group]
 gb|EER90271.1| hypothetical protein SORBIDRAFT_10g028020 [Sorghum bicolor]
 dbj|BAH93208.1| Os05g0504766 [Oryza sativa Japonica Group]
 dbj|BAJ91806.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK04112.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|AFH53939.1| polyubiquitin 4 [Brachypodium distachyon]
 gb|AFH53940.1| polyubiquitin 10 [Brachypodium distachyon]
 gb|EOY07796.1| Ubiquitin 4 [Theobroma cacao]
 gb|AGT16803.1| polyubiquitin [Saccharum hybrid cultivar R570]
Length=381

 Score =   404 bits (1037),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   404 bits (1037),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   403 bits (1036),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  168  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  227

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  228  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  287

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  288  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (776),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|NP_568397.1| ubiquitin 4 [Arabidopsis thaliana]
 ref|XP_002881273.1| hypothetical protein ARALYDRAFT_482268 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_010420904.1| PREDICTED: polyubiquitin 4 [Camelina sativa]
 ref|XP_010493166.1| PREDICTED: polyubiquitin 4 [Camelina sativa]
 sp|P0CH32.1|UBQ4_ARATH RecName: Full=Polyubiquitin 4; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAA31331.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAB53929.1| polyubiquitin [Arabidopsis thaliana]
 gb|EFH57532.1| hypothetical protein ARALYDRAFT_482268 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AED92867.1| ubiquitin 4 [Arabidopsis thaliana]
 prf||1515347A poly-ubiquitin
Length=382

 Score =   404 bits (1037),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   404 bits (1037),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   403 bits (1036),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  168  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  227

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  228  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  287

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  288  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (776),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>emb|CAC94926.1| putative ubiquitin [Pleurotus sp. 'Florida']
Length=243

 Score =   398 bits (1023),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 199/210 (95%), Positives = 202/210 (96%), Gaps = 0/210 (0%)
 Frame = -1

Query  706  SAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRGGMQI  527
            S  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTL+ YNIQKESTLHLVLRLRGGMQI
Sbjct  1    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQI  60

Query  526  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  347
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  61   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  120

Query  346  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  167
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  121  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  180

Query  166  KQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            KQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  181  KQLEDGRTLSDYNIQKESTLHLVLRLRGGM  210


 Score =   305 bits (781),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 154/166 (93%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTL+ YNIQKESTLHLVLRLRG
Sbjct  73   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG  132

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  133  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  192

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK  221
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA+
Sbjct  193  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAR  238



>ref|XP_001420612.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98905.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|KHN17791.1| Polyubiquitin 4 [Glycine soja]
Length=381

 Score =   404 bits (1037),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   404 bits (1037),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   403 bits (1036),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  168  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  227

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  228  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  287

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  288  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (776),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_010558157.1| PREDICTED: polyubiquitin-like [Tarenaya hassleriana]
Length=382

 Score =   404 bits (1037),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   404 bits (1037),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   403 bits (1036),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  168  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  227

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  228  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  287

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  288  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (776),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|AAM78180.1| putative polyubiquitin [Gossypium herbaceum]
 gb|AAM78181.1| putative polyubiquitin [Gossypium raimondii]
 gb|AAM78182.1| putative polyubiquitin [Gossypium barbadense]
 gb|AAM78183.1| putative polyubiquitin, partial [Gossypium barbadense]
 gb|AAM78184.1| putative polyubiquitin [Gossypioides kirkii]
Length=204

 Score =   397 bits (1019),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 200/204 (98%), Positives = 200/204 (98%), Gaps = 0/204 (0%)
 Frame = -1

Query  688  VKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRGGMQIFVKTLT  509
            VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  1    VKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  60

Query  508  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  329
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  61   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  120

Query  328  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  149
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  121  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  180

Query  148  RTLADYNIQKESTLHLVLRLRGGF  77
            RTLADYNIQKESTLHLVLRLRGGF
Sbjct  181  RTLADYNIQKESTLHLVLRLRGGF  204


 Score =   253 bits (646),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 128/138 (93%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  67   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  126

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  127  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  186

Query  358  NIQKESTLHLVLRLRGGM  305
            NIQKESTLHLVLRLRGG 
Sbjct  187  NIQKESTLHLVLRLRGGF  204



>gb|KJB62483.1| hypothetical protein B456_009G418900 [Gossypium raimondii]
Length=381

 Score =   403 bits (1036),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  168  EVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  227

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  228  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  287

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  288  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score =   402 bits (1034),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 203/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   401 bits (1031),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 202/214 (94%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   301 bits (770),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_002266370.1| PREDICTED: polyubiquitin 4-like [Vitis vinifera]
Length=383

 Score =   403 bits (1036),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   403 bits (1036),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   403 bits (1036),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  168  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  227

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  228  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  287

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  288  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (776),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_006302388.1| hypothetical protein CARUB_v10020456mg [Capsella rubella]
 gb|EOA35286.1| hypothetical protein CARUB_v10020456mg [Capsella rubella]
Length=383

 Score =   403 bits (1036),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   403 bits (1036),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   403 bits (1036),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  168  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  227

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  228  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  287

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  288  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (776),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_009596689.1| PREDICTED: polyubiquitin-like [Nicotiana tomentosiformis]
Length=382

 Score =   403 bits (1036),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   403 bits (1036),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   403 bits (1035),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  168  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  227

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  228  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  287

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  288  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (776),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>emb|CCL99875.1| predicted protein [Fibroporia radiculosa]
Length=312

 Score =   400 bits (1029),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 201/214 (94%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTL+ YNIQKESTLHLVLRLRG
Sbjct  99   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG  158

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  159  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  218

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  219  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  278

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  279  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  312


 Score =   400 bits (1029),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 201/214 (94%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTL+ YNIQKESTLHLVLRLRG
Sbjct  23   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG  82

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  83   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  142

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  143  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  202

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  203  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  236


 Score =   301 bits (771),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  8    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  67

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  68   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  127

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  128  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  160



>gb|EYU18102.1| hypothetical protein MIMGU_mgv1a008166mg [Erythranthe guttata]
Length=383

 Score =   403 bits (1036),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   403 bits (1036),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  168  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  227

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  228  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  287

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  288  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score =   403 bits (1035),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 203/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  +D VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTVDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   301 bits (771),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDT+DNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTVDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_010454368.1| PREDICTED: polyubiquitin 4-like [Camelina sativa]
Length=382

 Score =   403 bits (1036),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  168  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  227

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  228  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  287

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  288  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score =   403 bits (1036),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 203/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   403 bits (1036),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 203/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  +D VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   303 bits (775),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_006428816.1| hypothetical protein CICLE_v10011684mg [Citrus clementina]
 gb|ESR42056.1| hypothetical protein CICLE_v10011684mg [Citrus clementina]
Length=382

 Score =   403 bits (1036),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   403 bits (1036),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   403 bits (1035),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  168  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  227

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  228  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  287

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  288  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (776),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>sp|Q58G87.2|UBQ3_ORYSJ RecName: Full=Polyubiquitin 3; Contains: RecName: Full=Ubiquitin-related; 
Contains: RecName: Full=Ubiquitin; Flags: Precursor 
[Oryza sativa Japonica Group]
 emb|CAE04243.3| OSJNBa0089N06.4 [Oryza sativa Japonica Group]
 gb|EAZ32071.1| hypothetical protein OsJ_16259 [Oryza sativa Japonica Group]
Length=381

 Score =   403 bits (1036),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  168  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  227

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  228  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  287

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  288  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  381


 Score =   403 bits (1036),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   400 bits (1029),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 203/214 (95%), Positives = 203/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E   S  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVEFSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   300 bits (769),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVE SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVEFSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_010696408.1| PREDICTED: polyubiquitin 4 [Beta vulgaris subsp. vulgaris]
Length=382

 Score =   403 bits (1036),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   403 bits (1036),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   401 bits (1030),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 203/213 (95%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  168  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  227

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  228  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  287

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL
Sbjct  288  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRL  347

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (775),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_010431529.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin-like [Camelina 
sativa]
Length=457

 Score =   406 bits (1043),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 205/214 (96%), Positives = 205/214 (96%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  244  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  303

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  304  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  363

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  364  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  423

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  424  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  457


 Score =   403 bits (1036),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  168  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  227

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  228  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  287

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  288  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  381


 Score =   401 bits (1031),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 203/214 (95%), Positives = 203/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFV TLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVXTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   401 bits (1031),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 203/214 (95%), Positives = 203/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFV TLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVXTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   303 bits (776),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_008441422.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin-like [Cucumis melo]
Length=457

 Score =   406 bits (1043),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 205/214 (96%), Positives = 205/214 (96%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  244  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  303

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  304  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  363

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  364  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  423

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  424  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  457


 Score =   403 bits (1036),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   402 bits (1033),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 203/214 (95%), Positives = 203/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIF KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFCKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   402 bits (1033),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 203/214 (95%), Positives = 203/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  168  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  227

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIF KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  228  GMQIFCKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  287

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  288  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  381


 Score =   303 bits (776),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|NP_849299.4| polyubiquitin 10 [Arabidopsis thaliana]
 ref|NP_849301.4| polyubiquitin 10 [Arabidopsis thaliana]
 ref|XP_002872749.1| hexameric polyubiquitin [Arabidopsis lyrata subsp. lyrata]
 ref|XP_004145098.1| PREDICTED: polyubiquitin 10-like [Cucumis sativus]
 ref|XP_004153450.1| PREDICTED: polyubiquitin 10-like [Cucumis sativus]
 ref|XP_004248312.1| PREDICTED: polyubiquitin [Solanum lycopersicum]
 ref|XP_006360086.1| PREDICTED: polyubiquitin-like isoform X1 [Solanum tuberosum]
 ref|XP_006289516.1| hypothetical protein CARUB_v10003053mg [Capsella rubella]
 ref|XP_006393349.1| hypothetical protein EUTSA_v10011466mg [Eutrema salsugineum]
 ref|XP_006452179.1| hypothetical protein CICLE_v10008240mg [Citrus clementina]
 ref|XP_006452180.1| hypothetical protein CICLE_v10008240mg [Citrus clementina]
 ref|XP_006452185.1| hypothetical protein CICLE_v10007972mg [Citrus clementina]
 ref|XP_006452187.1| hypothetical protein CICLE_v10007972mg [Citrus clementina]
 ref|XP_006475213.1| PREDICTED: polyubiquitin 10-like [Citrus sinensis]
 ref|XP_007154502.1| hypothetical protein PHAVU_003G123900g [Phaseolus vulgaris]
 ref|XP_007211602.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_008371127.1| PREDICTED: polyubiquitin [Malus domestica]
 ref|XP_009357406.1| PREDICTED: polyubiquitin [Pyrus x bretschneideri]
 ref|XP_009340939.1| PREDICTED: polyubiquitin [Pyrus x bretschneideri]
 ref|XP_009594377.1| PREDICTED: polyubiquitin [Nicotiana tomentosiformis]
 ref|XP_009792248.1| PREDICTED: polyubiquitin [Nicotiana sylvestris]
 ref|XP_010023555.1| PREDICTED: polyubiquitin [Eucalyptus grandis]
 ref|XP_010538672.1| PREDICTED: polyubiquitin [Tarenaya hassleriana]
 ref|XP_010694241.1| PREDICTED: polyubiquitin [Beta vulgaris subsp. vulgaris]
 ref|XP_010644404.1| PREDICTED: polyubiquitin [Vitis vinifera]
 ref|XP_010644405.1| PREDICTED: polyubiquitin [Vitis vinifera]
 ref|XP_010644406.1| PREDICTED: polyubiquitin [Vitis vinifera]
 ref|XP_011097919.1| PREDICTED: polyubiquitin [Sesamum indicum]
 sp|P0CG85.1|UBI1P_NICSY RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Nicotiana sylvestris]
 sp|Q8H159.2|UBQ10_ARATH RecName: Full=Polyubiquitin 10; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAA34123.1| hexameric polyubiquitin [Nicotiana sylvestris]
 gb|AAA68878.1| polyubiquitin [Arabidopsis thaliana]
 gb|AAD03341.1| ubiquitin [Pisum sativum]
 gb|AAD03342.1| ubiquitin [Pisum sativum]
 gb|AAM98141.1| polyubiquitin UBQ10 [Arabidopsis thaliana]
 gb|ABK92469.1| unknown [Populus trichocarpa]
 emb|CAN64480.1| hypothetical protein VITISV_002813 [Vitis vinifera]
 gb|ACS68204.1| ubiquitin 10.1 [Brassica napus]
 gb|EFH49008.1| hexameric polyubiquitin [Arabidopsis lyrata subsp. lyrata]
 dbj|BAJ34175.1| unnamed protein product [Thellungiella halophila]
 gb|AEE82500.1| polyubiquitin 10 [Arabidopsis thaliana]
 gb|AEE82502.1| polyubiquitin 10 [Arabidopsis thaliana]
 gb|EMJ12801.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|EOA22414.1| hypothetical protein CARUB_v10003053mg [Capsella rubella]
 emb|CCQ25958.1| polyubiquitin 10 [Coffea arabica]
 gb|ESQ30635.1| hypothetical protein EUTSA_v10011466mg [Eutrema salsugineum]
 gb|ESR65419.1| hypothetical protein CICLE_v10008240mg [Citrus clementina]
 gb|ESR65420.1| hypothetical protein CICLE_v10008240mg [Citrus clementina]
 gb|ESR65425.1| hypothetical protein CICLE_v10007972mg [Citrus clementina]
 gb|ESR65427.1| hypothetical protein CICLE_v10007972mg [Citrus clementina]
 gb|ESW26496.1| hypothetical protein PHAVU_003G123900g [Phaseolus vulgaris]
 gb|EYU19215.1| hypothetical protein MIMGU_mgv1a004313mg [Erythranthe guttata]
 gb|KDO52958.1| hypothetical protein CISIN_1g009518mg [Citrus sinensis]
 gb|KDO52959.1| hypothetical protein CISIN_1g009518mg [Citrus sinensis]
 gb|KDO52960.1| hypothetical protein CISIN_1g009518mg [Citrus sinensis]
 gb|KEH18409.1| polyubiquitin 3 [Medicago truncatula]
 gb|KEH18410.1| polyubiquitin 3 [Medicago truncatula]
 gb|KGN49132.1| hypothetical protein Csa_6G514925 [Cucumis sativus]
 gb|KHN15480.1| Polyubiquitin 10 [Glycine soja]
 gb|AJA36490.1| ubiquitin [Prunus persica]
 gb|KJB62627.1| hypothetical protein B456_009G426900 [Gossypium raimondii]
 gb|KJB62631.1| hypothetical protein B456_009G427000 [Gossypium raimondii]
 gb|KJB62632.1| hypothetical protein B456_009G427000 [Gossypium raimondii]
Length=457

 Score =   406 bits (1043),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 205/214 (96%), Positives = 205/214 (96%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  244  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  303

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  304  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  363

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  364  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  423

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  424  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  457


 Score =   403 bits (1036),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   403 bits (1036),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   403 bits (1036),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  168  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  227

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  228  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  287

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  288  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  381


 Score =   303 bits (776),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_003542730.1| PREDICTED: polyubiquitin 10-like [Glycine max]
 gb|KHN09976.1| Polyubiquitin 10 [Glycine soja]
Length=457

 Score =   406 bits (1043),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 205/214 (96%), Positives = 205/214 (96%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  244  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  303

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  304  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  363

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  364  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  423

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  424  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  457


 Score =   403 bits (1036),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   403 bits (1036),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  168  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  227

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  228  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  287

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  288  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  381


 Score =   403 bits (1036),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   301 bits (772),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_010324327.1| PREDICTED: polyubiquitin isoform X2 [Solanum lycopersicum]
Length=381

 Score =   403 bits (1036),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIP DQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  168  EVESSDTIDNVKAKIQDKEGIPSDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  227

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  228  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  287

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  288  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score =   400 bits (1029),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 203/214 (95%), Positives = 203/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP DQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPSDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   400 bits (1029),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 203/214 (95%), Positives = 203/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP DQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPSDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   303 bits (776),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|AAY86773.1| polyubiquitin [Noccaea caerulescens]
Length=382

 Score =   403 bits (1036),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   403 bits (1036),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   403 bits (1035),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  168  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  227

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  228  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  287

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  288  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (775),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_009591312.1| PREDICTED: polyubiquitin 4 [Nicotiana tomentosiformis]
 ref|XP_011468093.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin 4-like [Fragaria 
vesca subsp. vesca]
Length=382

 Score =   403 bits (1036),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   403 bits (1036),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   403 bits (1035),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  168  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  227

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  228  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  287

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  288  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (775),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|KJB81827.1| hypothetical protein B456_013G163500 [Gossypium raimondii]
Length=457

 Score =   406 bits (1043),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 205/214 (96%), Positives = 205/214 (96%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  244  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  303

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  304  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  363

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  364  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  423

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  424  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  457


 Score =   403 bits (1036),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   403 bits (1036),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  168  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  227

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  228  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  287

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  288  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  381


 Score =   403 bits (1036),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   301 bits (771),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_009784905.1| PREDICTED: polyubiquitin-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009784906.1| PREDICTED: polyubiquitin-like isoform X1 [Nicotiana sylvestris]
Length=457

 Score =   406 bits (1043),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 205/214 (96%), Positives = 205/214 (96%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  244  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  303

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  304  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  363

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  364  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  423

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  424  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  457


 Score =   403 bits (1036),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  168  EVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  227

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  228  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  287

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  288  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  381


 Score =   401 bits (1031),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 203/214 (95%), Positives = 203/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   401 bits (1031),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 203/214 (95%), Positives = 203/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   303 bits (775),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_011038259.1| PREDICTED: polyubiquitin-like [Populus euphratica]
 ref|XP_011038263.1| PREDICTED: polyubiquitin-like [Populus euphratica]
Length=305

 Score =   400 bits (1028),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 202/214 (94%), Positives = 203/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLE+GRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEEGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305


 Score =   397 bits (1021),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 201/214 (94%), Positives = 202/214 (94%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLE+GRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEEGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   297 bits (761),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLE+GRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEEGRTLADYNIQKESTLHLVLRLRGGM  153



>emb|CEP60563.1| LALA0S01e13784g1_1 [Lachancea lanzarotensis]
Length=229

 Score =   397 bits (1020),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 199/214 (93%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTL+ YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGI  229


 Score =   298 bits (763),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 148/153 (97%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>gb|EPX74297.1| ubiquitin [Schizosaccharomyces octosporus yFS286]
Length=230

 Score =   397 bits (1020),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 199/213 (93%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTL+ YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228


 Score =   298 bits (764),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 148/153 (97%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>ref|XP_010421267.1| PREDICTED: polyubiquitin 4-like [Camelina sativa]
Length=382

 Score =   403 bits (1035),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   402 bits (1033),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 203/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKE+TLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLADYNIQKETTLHLVLRLRGGM  305


 Score =   402 bits (1032),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 203/213 (95%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  168  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  227

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  228  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  287

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKE+TLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  288  NIQKETTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (775),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>emb|CCT70325.1| UBI4-Ubiquitin [Fusarium fujikuroi IMI 58289]
Length=281

 Score =   399 bits (1026),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 200/213 (94%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  68   EVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  127

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  128  GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  187

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  188  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  247

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  248  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  280


 Score =   350 bits (899),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 174/180 (97%), Positives = 178/180 (99%), Gaps = 0/180 (0%)
 Frame = -1

Query  616  LEDGRTLAXYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  437
            LEDGRTL+ YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDK
Sbjct  26   LEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDK  85

Query  436  EGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV  257
            EGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV
Sbjct  86   EGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV  145

Query  256  ESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            ESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  146  ESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  205



>gb|AAO43308.1| putative polyubiquitin [Arabidopsis thaliana]
Length=250

 Score =   398 bits (1022),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 202/213 (95%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  36   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  95

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADY
Sbjct  96   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEWIPPDQQRLIFAGKQLEDGRTLADY  155

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  156  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  215

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLA YNIQKESTLHLVLRLRGG
Sbjct  216  IFAGKQLEDGRTLAVYNIQKESTLHLVLRLRGG  248


 Score =   339 bits (870),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 170/173 (98%), Positives = 170/173 (98%), Gaps = 0/173 (0%)
 Frame = -1

Query  595  AXYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  416
            A YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ
Sbjct  1    ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  60

Query  415  QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  236
            QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID
Sbjct  61   QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  120

Query  235  NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            NVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  NVKAKIQDKEWIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  173



>ref|XP_001764949.1| predicted protein [Physcomitrella patens]
 gb|EDQ70165.1| predicted protein [Physcomitrella patens]
Length=318

 Score =   400 bits (1029),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 202/214 (94%), Positives = 202/214 (94%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   400 bits (1029),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 202/214 (94%), Positives = 202/214 (94%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   301 bits (772),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   263 bits (673),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  168  EVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  227

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  228  GMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  287

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTIT  266
            NIQKESTLHLVLRLRGGM+I   TL  K IT
Sbjct  288  NIQKESTLHLVLRLRGGMEIIEDTLASKIIT  318



>gb|KJB62486.1| hypothetical protein B456_009G418900 [Gossypium raimondii]
Length=383

 Score =   403 bits (1035),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  170  EVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  229

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  230  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  289

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  290  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  349

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  350  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  382


 Score =   397 bits (1020),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 203/216 (94%), Positives = 204/216 (94%), Gaps = 2/216 (1%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIF--VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  365
            GMQIF  VKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  152  GMQIFIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  211

Query  364  DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  185
            DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ
Sbjct  212  DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  271

Query  184  RLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            RLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  272  RLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  307


 Score =   395 bits (1016),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 202/216 (94%), Positives = 204/216 (94%), Gaps = 2/216 (1%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQ--IFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  185
            NIQKESTLHLVLRLRGGMQ  IFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQ
Sbjct  136  NIQKESTLHLVLRLRGGMQIFIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQ  195

Query  184  RLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            RLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  RLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  231


 Score =   300 bits (769),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_004956019.1| PREDICTED: polyubiquitin 4-like [Setaria italica]
Length=381

 Score =   403 bits (1035),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  168  EVESSDTIDHVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  227

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  228  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  287

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  288  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score =   401 bits (1031),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 203/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID+VKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDHVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   401 bits (1031),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 203/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTID+VKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDHVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   303 bits (776),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|KJB13590.1| hypothetical protein B456_002G083000 [Gossypium raimondii]
 gb|KJB13591.1| hypothetical protein B456_002G083000 [Gossypium raimondii]
Length=461

 Score =   406 bits (1043),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 205/214 (96%), Positives = 205/214 (96%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  244  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  303

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  304  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  363

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  364  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  423

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  424  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  457


 Score =   403 bits (1036),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   403 bits (1036),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   403 bits (1036),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  168  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  227

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  228  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  287

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  288  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  381


 Score =   303 bits (775),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   254 bits (650),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 128/140 (91%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  320  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  379

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  380  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  439

Query  358  NIQKESTLHLVLRLRGGMQI  299
            NIQKESTLHLVLRLRGG ++
Sbjct  440  NIQKESTLHLVLRLRGGFRM  459



>ref|NP_001053957.1| Os04g0628100 [Oryza sativa Japonica Group]
 dbj|BAF15871.1| Os04g0628100 [Oryza sativa Japonica Group]
Length=392

 Score =   403 bits (1036),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  179  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  238

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  239  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  298

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  299  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  358

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  359  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  392


 Score =   403 bits (1036),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  103  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  162

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  163  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  222

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  223  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  282

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  283  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  316


 Score =   401 bits (1030),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 203/214 (95%), Positives = 203/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E   S  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  27   EVEFSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  86

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  87   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  146

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  147  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  206

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  207  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  240


 Score =   300 bits (769),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVE SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  12   MQIFVKTLTGKTITLEVEFSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  71

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  72   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  131

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  132  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  164



>ref|XP_007763327.1| polyubiquitin [Coniophora puteana RWD-64-598 SS2]
 gb|EIW86558.1| polyubiquitin [Coniophora puteana RWD-64-598 SS2]
 gb|EUC62408.1| polyubiquitin [Rhizoctonia solani AG-3 Rhs1AP]
 gb|KDQ12738.1| hypothetical protein BOTBODRAFT_34195 [Botryobasidium botryosum 
FD-172 SS1]
 gb|KEP53373.1| polyubiquitin [Rhizoctonia solani 123E]
 gb|KIJ12827.1| hypothetical protein PAXINDRAFT_82237 [Paxillus involutus ATCC 
200175]
 gb|KIK47355.1| hypothetical protein CY34DRAFT_799527 [Suillus luteus UH-Slu-Lm8-n1]
Length=305

 Score =   400 bits (1027),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 201/214 (94%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTL+ YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   400 bits (1027),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 201/213 (94%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTL+ YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  272  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304


 Score =   301 bits (770),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>sp|P0CG73.1|UBI1P_CANAX RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin-related; 
Contains: RecName: Full=Ubiquitin; Flags: Precursor 
[Candida albicans]
 gb|AAA84868.1| ubiquitin precursor [Candida albicans]
Length=229

 Score =   397 bits (1020),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 199/214 (93%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTL+ YNIQKESTLHLVLR RG
Sbjct  16   EVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRSRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGF
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGF  229


 Score =   295 bits (756),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 147/153 (96%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLR RGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRSRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>gb|KIJ45725.1| hypothetical protein M422DRAFT_106821, partial [Sphaerobolus 
stellatus SS14]
Length=305

 Score =   400 bits (1027),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 201/214 (94%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTL+ YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   400 bits (1027),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 201/214 (94%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTL+ YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  305


 Score =   301 bits (770),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>ref|XP_001755431.1| predicted protein [Physcomitrella patens]
 gb|EDQ79911.1| predicted protein [Physcomitrella patens]
Length=231

 Score =   397 bits (1020),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 201/212 (95%), Positives = 201/212 (95%), Gaps = 0/212 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  83
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRG
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  227


 Score =   299 bits (766),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_001931824.1| ubiquitin [Pyrenophora tritici-repentis Pt-1C-BFP]
 ref|XP_003305664.1| hypothetical protein PTT_18575 [Pyrenophora teres f. teres 0-1]
 ref|XP_003854274.1| hypothetical protein MYCGRDRAFT_57170 [Zymoseptoria tritici IPO323]
 ref|XP_007275950.1| ubiquitin [Colletotrichum gloeosporioides Nara gc5]
 ref|XP_007376605.1| polyubiquitin [Spathaspora passalidarum NRRL Y-27907]
 ref|XP_007674454.1| hypothetical protein BAUCODRAFT_32336 [Baudoinia compniacensis 
UAMH 10762]
 ref|XP_007741026.1| ubiquitin C [Cladophialophora psammophila CBS 110553]
 ref|XP_009261437.1| hypothetical protein FPSE_10045 [Fusarium pseudograminearum CS3096]
 ref|XP_009650785.1| ubiquitin [Verticillium dahliae VdLs.17]
 ref|XP_011319955.1| ubiquitin [Fusarium graminearum PH-1]
 gb|EDU40929.1| ubiquitin [Pyrenophora tritici-repentis Pt-1C-BFP]
 gb|EFQ86204.1| hypothetical protein PTT_18575 [Pyrenophora teres f. teres 0-1]
 gb|EGP89250.1| hypothetical protein MYCGRDRAFT_57170 [Zymoseptoria tritici IPO323]
 gb|EGW31827.1| polyubiquitin [Spathaspora passalidarum NRRL Y-27907]
 gb|EGY14431.1| ubiquitin [Verticillium dahliae VdLs.17]
 gb|EHK44351.1| hypothetical protein TRIATDRAFT_300588 [Trichoderma atroviride 
IMI 206040]
 gb|EJT46666.1| hypothetical protein A1Q1_04737 [Trichosporon asahii var. asahii 
CBS 2479]
 gb|EKJ69797.1| hypothetical protein FPSE_10045 [Fusarium pseudograminearum CS3096]
 gb|ELA35078.1| ubiquitin [Colletotrichum gloeosporioides Nara gc5]
 gb|EMC98317.1| hypothetical protein BAUCODRAFT_32336 [Baudoinia compniacensis 
UAMH 10762]
 gb|EME45125.1| hypothetical protein DOTSEDRAFT_70987 [Dothistroma septosporum 
NZE10]
 gb|ENH81500.1| ubiquitin [Colletotrichum orbiculare MAFF 240422]
 gb|ESU14530.1| ubiquitin [Fusarium graminearum PH-1]
 emb|CDK27817.1| unnamed protein product [Kuraishia capsulata CBS 1993]
 gb|EXJ73926.1| ubiquitin C [Cladophialophora psammophila CBS 110553]
 gb|EYB28525.1| hypothetical protein FG05_08768 [Fusarium graminearum]
 gb|KEQ58801.1| ubiquitin [Aureobasidium melanogenum CBS 110374]
 gb|KEQ70291.1| ubiquitin [Aureobasidium pullulans var. namibiae CBS 147.97]
 gb|KEQ87814.1| ubiquitin [Aureobasidium pullulans EXF-150]
 gb|KER00813.1| hypothetical protein AUEXF2481DRAFT_25097 [Aureobasidium subglaciale 
EXF-2481]
 emb|CEF77191.1| unnamed protein product [Fusarium graminearum]
 gb|KIV95571.1| polyubiquitin [Exophiala mesophila]
 gb|KIW22916.1| polyubiquitin [Cladophialophora immunda]
 gb|KIW83318.1| polyubiquitin [Fonsecaea pedrosoi CBS 271.37]
 gb|KIW87781.1| polyubiquitin [Cladophialophora bantiana CBS 173.52]
 gb|KIX98997.1| polyubiquitin [Fonsecaea multimorphosa CBS 102226]
Length=229

 Score =   397 bits (1020),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 199/213 (93%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTL+ YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228


 Score =   298 bits (763),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 148/153 (97%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>gb|KIY45417.1| ubiquitin [Fistulina hepatica ATCC 64428]
Length=305

 Score =   400 bits (1027),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 201/214 (94%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTL+ YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   399 bits (1026),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 201/213 (94%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTL+ YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  272  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304


 Score =   301 bits (770),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>ref|XP_003030030.1| polyubiquitin [Schizophyllum commune H4-8]
 ref|XP_006678580.1| polyubiquitin [Batrachochytrium dendrobatidis JAM81]
 ref|XP_007396817.1| hypothetical protein PHACADRAFT_257732 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|AAB94630.1| polyubiquitin [Schizophyllum commune]
 gb|EFI95127.1| polyubiquitin [Schizophyllum commune H4-8]
 gb|EGF80702.1| polyubiquitin [Batrachochytrium dendrobatidis JAM81]
 gb|EKM54116.1| hypothetical protein PHACADRAFT_257732 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EPT04446.1| hypothetical protein FOMPIDRAFT_1021745 [Fomitopsis pinicola 
FP-58527 SS1]
 gb|KDQ24213.1| hypothetical protein PLEOSDRAFT_1058300 [Pleurotus ostreatus 
PC15]
 gb|KDQ28506.1| hypothetical protein PLEOSDRAFT_1089714 [Pleurotus ostreatus 
PC15]
 gb|KDQ53556.1| hypothetical protein JAAARDRAFT_72512 [Jaapia argillacea MUCL 
33604]
 gb|KIK09182.1| hypothetical protein K443DRAFT_671672 [Laccaria amethystina LaAM-08-1]
 gb|KIK44225.1| hypothetical protein CY34DRAFT_648259 [Suillus luteus UH-Slu-Lm8-n1]
 gb|KIM51102.1| hypothetical protein SCLCIDRAFT_144015 [Scleroderma citrinum 
Foug A]
 gb|KIN98337.1| hypothetical protein M404DRAFT_856969 [Pisolithus tinctorius 
Marx 270]
 gb|KIN98894.1| hypothetical protein M404DRAFT_966612 [Pisolithus tinctorius 
Marx 270]
Length=305

 Score =   400 bits (1027),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 201/214 (94%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTL+ YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  305


 Score =   400 bits (1027),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 201/214 (94%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTL+ YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   301 bits (770),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>gb|EMS65864.1| Polyubiquitin [Triticum urartu]
Length=405

 Score =   404 bits (1037),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   404 bits (1037),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   403 bits (1036),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  168  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  227

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  228  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  287

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  288  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (776),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|KDQ20365.1| hypothetical protein BOTBODRAFT_123907 [Botryobasidium botryosum 
FD-172 SS1]
Length=305

 Score =   400 bits (1027),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 201/214 (94%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTL+ YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   399 bits (1026),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 201/213 (94%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTL+ YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  272  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304


 Score =   301 bits (770),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>emb|CAB81074.1| polyubiquitin (ubq10) [Arabidopsis thaliana]
Length=464

 Score =   405 bits (1042),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   405 bits (1042),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   405 bits (1042),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  168  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  227

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  228  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  287

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  288  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  381


 Score =   318 bits (816),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 162/171 (95%), Positives = 162/171 (95%), Gaps = 0/171 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  244  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  303

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  304  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  363

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE  206
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE
Sbjct  364  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE  414


 Score =   305 bits (780),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|KIY53974.1| polyubiquitin [Fistulina hepatica ATCC 64428]
Length=305

 Score =   400 bits (1027),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 201/214 (94%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTL+ YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   397 bits (1021),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 200/214 (93%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTL+ YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTL+DY+IQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLSDYSIQKESTLHLVLRLRGGL  305


 Score =   301 bits (770),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>ref|XP_011048569.1| PREDICTED: polyubiquitin 3-like [Populus euphratica]
Length=306

 Score =   400 bits (1027),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 202/214 (94%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQK+STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKDSTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLE+GRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEEGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   399 bits (1026),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 202/213 (95%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQK+STLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKDSTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLE+GRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEEGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   301 bits (771),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQK+STLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKDSTLHLVLRLRGGM  153



>gb|AAX40652.1| polyubiquitin [Oryza sativa Japonica Group]
Length=381

 Score =   402 bits (1034),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 203/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  168  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  227

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL+FAGKQLEDGRTLADY
Sbjct  228  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLVFAGKQLEDGRTLADY  287

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  288  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  381


 Score =   402 bits (1034),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 203/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            +FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  272  VFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   400 bits (1029),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 203/214 (95%), Positives = 203/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E   S  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVEFSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   300 bits (769),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVE SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVEFSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_001555417.1| polyubiquitin [Botrytis cinerea B05.10]
 ref|XP_001906054.1| hypothetical protein [Podospora anserina S mat+]
 ref|XP_007336907.1| ubiquitin [Auricularia delicata TFB-10046 SS5]
 ref|XP_007390409.1| hypothetical protein PHACADRAFT_247222 [Phanerochaete carnosa 
HHB-10118-sp]
 ref|XP_011121602.1| hypothetical protein AOL_s00078g37 [Arthrobotrys oligospora ATCC 
24927]
 gb|AAC15225.1| polyubiquitin [Botrytis cinerea]
 emb|CAP66720.1| unnamed protein product [Podospora anserina S mat+]
 gb|EGX49548.1| hypothetical protein AOL_s00078g37 [Arthrobotrys oligospora ATCC 
24927]
 emb|CCD51422.1| similar to polyubiquitin protein [Botrytis cinerea T4]
 gb|EJD55630.1| ubiquitin [Auricularia delicata TFB-10046 SS5]
 gb|EKM60970.1| hypothetical protein PHACADRAFT_247222 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EMR84820.1| putative polyubiquitin protein [Botrytis cinerea BcDW1]
 emb|CDP28455.1| Putative Ubiquitin [Podospora anserina S mat+]
 gb|KIP12035.1| hypothetical protein PHLGIDRAFT_17814 [Phlebiopsis gigantea 11061_1 
CR5-6]
Length=305

 Score =   400 bits (1027),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 201/214 (94%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTL+ YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   399 bits (1026),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 201/213 (94%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTL+ YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  272  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304


 Score =   301 bits (770),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>ref|XP_002980153.1| hypothetical protein SELMODRAFT_271419 [Selaginella moellendorffii]
 ref|XP_002991828.1| hypothetical protein SELMODRAFT_162003 [Selaginella moellendorffii]
 gb|EFJ07090.1| hypothetical protein SELMODRAFT_162003 [Selaginella moellendorffii]
 gb|EFJ19023.1| hypothetical protein SELMODRAFT_271419 [Selaginella moellendorffii]
Length=306

 Score =   400 bits (1027),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 202/214 (94%), Positives = 202/214 (94%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   399 bits (1026),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 202/213 (95%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   299 bits (766),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_007924320.1| hypothetical protein MYCFIDRAFT_60610 [Pseudocercospora fijiensis 
CIRAD86]
 gb|EHN05782.1| Ubi4p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii 
VIN7]
 gb|EME83800.1| hypothetical protein MYCFIDRAFT_60610 [Pseudocercospora fijiensis 
CIRAD86]
 gb|EWH17145.1| Ubi4p [Saccharomyces cerevisiae P283]
Length=229

 Score =   397 bits (1019),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 199/213 (93%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTL+ YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228


 Score =   298 bits (763),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 148/153 (97%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>gb|KIR63773.1| polyubiquitin [Cryptococcus gattii CA1873]
 gb|KIR98208.1| polyubiquitin [Cryptococcus gattii 2001/935-1]
Length=305

 Score =   400 bits (1027),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 201/214 (94%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTL+ YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   399 bits (1026),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 201/213 (94%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTL+ YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  272  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304


 Score =   299 bits (766),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>gb|AHC00631.1| polyubiquitin [Ganoderma lucidum]
Length=319

 Score =   400 bits (1028),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 201/214 (94%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTL+ YNIQKESTLHLVLRLRG
Sbjct  106  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG  165

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  166  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  225

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  226  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  285

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  286  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  319


 Score =   400 bits (1028),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 201/214 (94%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTL+ YNIQKESTLHLVLRLRG
Sbjct  30   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG  89

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  90   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  149

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  150  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  209

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  210  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  243


 Score =   301 bits (770),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  15   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  74

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  75   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  134

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  135  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  167



>ref|XP_001828882.1| ubiquitin C [Coprinopsis cinerea okayama7#130]
 ref|XP_001873268.1| ubiquitin [Laccaria bicolor S238N-H82]
 ref|XP_003037536.1| hypothetical protein SCHCODRAFT_64979 [Schizophyllum commune 
H4-8]
 ref|XP_006454479.1| ubiquitin [Agaricus bisporus var. bisporus H97]
 ref|XP_007316692.1| hypothetical protein SERLADRAFT_385284 [Serpula lacrymans var. 
lacrymans S7.9]
 ref|XP_007325267.1| hypothetical protein AGABI1DRAFT_81473 [Agaricus bisporus var. 
burnettii JB137-S8]
 ref|XP_007378433.1| ubiquitin [Punctularia strigosozonata HHB-11173 SS5]
 ref|XP_007842308.1| polyubiquitin [Moniliophthora roreri MCA 2997]
 ref|XP_007879465.1| hypothetical protein PFL1_06871 [Pseudozyma flocculosa PF-1]
 gb|EAU92889.1| ubiquitin C [Coprinopsis cinerea okayama7#130]
 gb|EDR15060.1| ubiquitin [Laccaria bicolor S238N-H82]
 gb|EFJ02634.1| hypothetical protein SCHCODRAFT_64979 [Schizophyllum commune 
H4-8]
 gb|EGO26519.1| hypothetical protein SERLADRAFT_385284 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EIN13516.1| ubiquitin [Punctularia strigosozonata HHB-11173 SS5]
 gb|EKM83733.1| hypothetical protein AGABI1DRAFT_81473 [Agaricus bisporus var. 
burnettii JB137-S8]
 gb|EKV51498.1| ubiquitin [Agaricus bisporus var. bisporus H97]
 dbj|GAC72194.1| ubiquitin and ubiquitin-like proteins [Pseudozyma antarctica 
T-34]
 dbj|GAC93128.1| ubiquitin [Pseudozyma hubeiensis SY62]
 gb|EPQ28867.1| hypothetical protein PFL1_06871 [Pseudozyma flocculosa PF-1]
 gb|ESK98373.1| polyubiquitin [Moniliophthora roreri MCA 2997]
 gb|AHA61591.1| ubiquitin [Volvariella volvacea]
 gb|KIK04252.1| hypothetical protein K443DRAFT_4723 [Laccaria amethystina LaAM-08-1]
 gb|KIO31281.1| hypothetical protein M407DRAFT_241831 [Tulasnella calospora MUT 
4182]
Length=305

 Score =   400 bits (1027),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 201/214 (94%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTL+ YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   399 bits (1026),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 201/213 (94%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTL+ YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  272  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304


 Score =   300 bits (769),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>gb|KIR29996.1| polyubiquitin [Cryptococcus gattii LA55]
 gb|KIR37417.1| polyubiquitin [Cryptococcus gattii MMRL2647]
 gb|KIR43885.1| polyubiquitin [Cryptococcus gattii Ram5]
 gb|KIR92886.1| polyubiquitin [Cryptococcus gattii CBS 10090]
 gb|KIY60273.1| polyubiquitin [Cryptococcus gattii 99/473]
Length=315

 Score =   400 bits (1028),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 201/214 (94%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTL+ YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  305


 Score =   400 bits (1028),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 201/214 (94%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTL+ YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   300 bits (767),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153


 Score =   265 bits (678),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 133/144 (92%), Positives = 135/144 (94%), Gaps = 0/144 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTL+ YNIQKESTLHLVLRLRG
Sbjct  168  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG  227

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  228  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  287

Query  358  NIQKESTLHLVLRLRGGMQIFVKT  287
            NIQKESTLHLVLRLRGGMQIFVKT
Sbjct  288  NIQKESTLHLVLRLRGGMQIFVKT  311



>ref|XP_011037020.1| PREDICTED: polyubiquitin-like [Populus euphratica]
Length=388

 Score =   403 bits (1035),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  175  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  234

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVES DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  235  GMQIFVKTLTGKTITLEVESLDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  294

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  295  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  354

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  355  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  388


 Score =   391 bits (1004),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 202/221 (91%), Positives = 202/221 (91%), Gaps = 7/221 (3%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK-------QLED  380
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF  K       QLED
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFRWKDEGWCLYQLED  135

Query  379  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  200
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  136  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  195

Query  199  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  236


 Score =   388 bits (997),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 201/221 (91%), Positives = 201/221 (91%), Gaps = 7/221 (3%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGK-------QLEDGRTLAXYNIQKESTLH  560
            E  SS  ID VK KIQDKEGIPPDQQR  F  K       QLEDGRTLA YNIQKESTLH
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFRWKDEGWCLYQLEDGRTLADYNIQKESTLH  151

Query  559  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  380
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  152  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  211

Query  379  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  200
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES DTIDNVKAKIQDKEGI
Sbjct  212  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESLDTIDNVKAKIQDKEGI  271

Query  199  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  272  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  312


 Score =   291 bits (744),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 150/160 (94%), Positives = 150/160 (94%), Gaps = 7/160 (4%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGK-------QLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            F  K       QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FRWKDEGWCLYQLEDGRTLADYNIQKESTLHLVLRLRGGM  160



>ref|XP_001598085.1| polyubiquitin [Sclerotinia sclerotiorum 1980]
 gb|EDN90771.1| polyubiquitin [Sclerotinia sclerotiorum 1980 UF-70]
Length=305

 Score =   400 bits (1027),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 201/214 (94%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTL+ YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   398 bits (1023),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 201/213 (94%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTL+ YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTL DYNIQKESTLHLVLRLRGG
Sbjct  272  IFAGKQLEDGRTLLDYNIQKESTLHLVLRLRGG  304


 Score =   300 bits (769),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>ref|XP_008244357.1| PREDICTED: polyubiquitin isoform X1 [Prunus mume]
 ref|XP_008244358.1| PREDICTED: polyubiquitin isoform X1 [Prunus mume]
 ref|XP_008244359.1| PREDICTED: polyubiquitin isoform X1 [Prunus mume]
Length=466

 Score =   405 bits (1042),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 205/214 (96%), Positives = 205/214 (96%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  253  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  312

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  313  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  372

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  373  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  432

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  433  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  466


 Score =   403 bits (1035),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  177  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  236

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  237  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  296

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  297  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  356

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  357  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  390


 Score =   386 bits (991),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 200/223 (90%), Positives = 201/223 (90%), Gaps = 9/223 (4%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFV---------KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQL  386
            G+QIF          KT TG TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQL
Sbjct  152  GVQIFEETHQTQIFEKTHTGNTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQL  211

Query  385  EDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE  206
            EDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE
Sbjct  212  EDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE  271

Query  205  GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  272  GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  314


 Score =   382 bits (981),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 198/223 (89%), Positives = 200/223 (90%), Gaps = 9/223 (4%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLV RLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVRRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            G+QIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GLQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGM---------QIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE  206
            NIQKESTLHLVLRLRGG+         QIF KT TG TITLEVESSDTIDNVKAKIQDKE
Sbjct  136  NIQKESTLHLVLRLRGGVQIFEETHQTQIFEKTHTGNTITLEVESSDTIDNVKAKIQDKE  195

Query  205  GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  238


 Score =   298 bits (763),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 151/152 (99%), Gaps = 0/152 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLV RLRGG+QIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVRRLRGGLQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  152



>ref|XP_006287868.1| hypothetical protein CARUB_v10001095mg, partial [Capsella rubella]
 gb|EOA20766.1| hypothetical protein CARUB_v10001095mg, partial [Capsella rubella]
Length=407

 Score =   403 bits (1036),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  41   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  100

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  101  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  160

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  161  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  220

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  221  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  254


 Score =   403 bits (1036),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  117  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  176

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  177  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  236

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  237  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  296

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  297  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  330


 Score =   403 bits (1036),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  193  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  252

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  253  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  312

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  313  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  372

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  373  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  405


 Score =   303 bits (776),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  26   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  85

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  86   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  145

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  146  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  178



>ref|XP_001755307.1| predicted protein [Physcomitrella patens]
 gb|EDQ79787.1| predicted protein [Physcomitrella patens]
Length=305

 Score =   399 bits (1026),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 202/214 (94%), Positives = 202/214 (94%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   399 bits (1025),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 202/213 (95%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   299 bits (766),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|EKV18932.1| hypothetical protein PDIP_25190 [Penicillium digitatum Pd1]
Length=233

 Score =   397 bits (1019),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 199/213 (93%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTL+ YNIQKESTLHLVLRLRG
Sbjct  20   EVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG  79

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  80   GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  139

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  140  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  199

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  200  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  232


 Score =   283 bits (723),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 140/146 (96%), Positives = 145/146 (99%), Gaps = 0/146 (0%)
 Frame = -1

Query  514  LTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTL  335
            +TGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTL
Sbjct  12   VTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTL  71

Query  334  HLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLE  155
            HLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLE
Sbjct  72   HLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLE  131

Query  154  DGRTLADYNIQKESTLHLVLRLRGGF  77
            DGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  132  DGRTLSDYNIQKESTLHLVLRLRGGM  157



>ref|XP_002419618.1| ubiquitin, putative [Candida dubliniensis CD36]
 sp|P0CG74.1|UBI4P_CANAX RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Candida albicans]
 emb|CAA90901.1| polyubiquitin [Candida albicans]
 emb|CAX43214.1| ubiquitin, putative [Candida dubliniensis CD36]
 gb|KGU10731.1| polyubiquitin [Candida albicans L26]
Length=305

 Score =   399 bits (1026),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 200/214 (93%), Positives = 205/214 (96%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTL+ YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGF
Sbjct  272  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGF  305


 Score =   397 bits (1019),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 199/214 (93%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTL+ YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   298 bits (762),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 148/153 (97%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>ref|XP_010493589.1| PREDICTED: polyubiquitin-like [Camelina sativa]
Length=430

 Score =   404 bits (1038),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  215  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  274

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  275  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  334

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  335  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  394

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  395  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  427


 Score =   402 bits (1033),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 203/214 (95%), Positives = 203/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  63   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  122

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG TLADY
Sbjct  123  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGHTLADY  182

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  183  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  242

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  243  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  276


 Score =   402 bits (1033),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 203/214 (95%), Positives = 203/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDG TLA YNIQKESTLHLVLRLRG
Sbjct  139  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGHTLADYNIQKESTLHLVLRLRG  198

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  199  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  258

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  259  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  318

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  319  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  352


 Score =   301 bits (772),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  48   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  107

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  108  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  167

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDG TLADYNIQKESTLHLVLRLRGG 
Sbjct  168  FAGKQLEDGHTLADYNIQKESTLHLVLRLRGGM  200



>ref|XP_007205619.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
 gb|EMJ06818.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
Length=232

 Score =   396 bits (1018),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 200/210 (95%), Positives = 200/210 (95%), Gaps = 0/210 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRL  89
            IFAGKQLEDGRTLADYNIQKESTLHLVLR 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRF  225


 Score =   303 bits (777),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQ+FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQVFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_001797032.1| hypothetical protein SNOG_06667 [Phaeosphaeria nodorum SN15]
 gb|EAT86498.1| hypothetical protein SNOG_06667 [Phaeosphaeria nodorum SN15]
Length=234

 Score =   397 bits (1019),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 199/213 (93%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTL+ YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228


 Score =   298 bits (762),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 148/153 (97%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>gb|KIM67150.1| hypothetical protein SCLCIDRAFT_1210637 [Scleroderma citrinum 
Foug A]
Length=305

 Score =   399 bits (1026),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 201/213 (94%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTL+ YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  272  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304


 Score =   396 bits (1017),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 200/214 (93%), Positives = 203/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQ KEGIPPDQQR  FAGKQLEDGRTL+ YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQVKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   297 bits (760),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQ KEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQVKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>ref|XP_007864655.1| ubiquitin [Gloeophyllum trabeum ATCC 11539]
 gb|EPQ57585.1| ubiquitin [Gloeophyllum trabeum ATCC 11539]
 gb|KIP08465.1| hypothetical protein PHLGIDRAFT_18910 [Phlebiopsis gigantea 11061_1 
CR5-6]
Length=381

 Score =   402 bits (1033),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 202/214 (94%), Positives = 205/214 (96%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTL+ YNIQKESTLHLVLRLRG
Sbjct  168  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG  227

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  228  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  287

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  288  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGF
Sbjct  348  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGF  381


 Score =   399 bits (1026),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 201/214 (94%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTL+ YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   399 bits (1026),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 201/214 (94%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTL+ YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  305


 Score =   300 bits (769),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>ref|XP_001777816.1| predicted protein [Physcomitrella patens]
 gb|EDQ57354.1| predicted protein [Physcomitrella patens]
Length=381

 Score =   402 bits (1033),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 203/214 (95%), Positives = 203/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  168  EVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  227

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  228  GMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  287

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL
Sbjct  288  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRL  347

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score =   399 bits (1026),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 202/214 (94%), Positives = 202/214 (94%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   399 bits (1026),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 202/214 (94%), Positives = 202/214 (94%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   299 bits (765),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_002953480.1| polyubiquitin [Volvox carteri f. nagariensis]
 gb|EFJ45453.1| polyubiquitin [Volvox carteri f. nagariensis]
Length=305

 Score =   399 bits (1025),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 201/214 (94%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  I+ VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  305


 Score =   399 bits (1025),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 201/214 (94%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  I+ VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   300 bits (769),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>emb|CCA70326.1| related to UBI4-Ubiquitin [Piriformospora indica DSM 11827]
Length=222

 Score =   396 bits (1017),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 199/214 (93%), Positives = 202/214 (94%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTL+ YNIQKESTLHLVLRLRG
Sbjct  9    EVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG  68

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  69   GMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  128

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL
Sbjct  129  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRL  188

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  189  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  222


 Score =   277 bits (709),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 141/153 (92%), Positives = 143/153 (93%), Gaps = 7/153 (5%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIF       TITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIF-------TITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  53

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  54   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  113

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  114  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  146



>ref|XP_007366816.1| polyubiquitin [Dichomitus squalens LYAD-421 SS1]
 gb|EJF60398.1| polyubiquitin [Dichomitus squalens LYAD-421 SS1]
Length=305

 Score =   399 bits (1025),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 201/214 (94%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTL+ YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  305


 Score =   396 bits (1018),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 200/214 (93%), Positives = 203/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGR L+ YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRPLSDYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   297 bits (761),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR L+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRPLSDYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>ref|XP_003010029.1| polyubiquitin UbiD/Ubi4, putative [Arthroderma benhamiae CBS 
112371]
 ref|XP_003170928.1| ubiquitin [Microsporum gypseum CBS 118893]
 ref|XP_003232289.1| polyubiquitin [Trichophyton rubrum CBS 118892]
 gb|EFE29389.1| polyubiquitin UbiD/Ubi4, putative [Arthroderma benhamiae CBS 
112371]
 gb|EFR03920.1| ubiquitin [Microsporum gypseum CBS 118893]
 gb|EGD90914.1| polyubiquitin [Trichophyton rubrum CBS 118892]
 gb|EGD97992.1| polyubiquitin [Trichophyton tonsurans CBS 112818]
 gb|EGE04992.1| ubiquitin [Trichophyton equinum CBS 127.97]
 gb|EZF26278.1| polyubiquitin [Trichophyton rubrum MR850]
 gb|EZF31874.1| polyubiquitin [Trichophyton interdigitale H6]
 gb|EZF45312.1| polyubiquitin [Trichophyton rubrum CBS 100081]
 gb|EZF56062.1| polyubiquitin [Trichophyton rubrum CBS 288.86]
 gb|EZF66560.1| polyubiquitin [Trichophyton rubrum CBS 289.86]
 gb|EZF77169.1| polyubiquitin [Trichophyton soudanense CBS 452.61]
 gb|EZF87859.1| polyubiquitin [Trichophyton rubrum MR1448]
 gb|EZG09817.1| polyubiquitin [Trichophyton rubrum CBS 735.88]
 gb|EZG20358.1| polyubiquitin [Trichophyton rubrum CBS 202.88]
 gb|KDB20983.1| polyubiquitin [Trichophyton interdigitale MR816]
 gb|KDB37038.1| polyubiquitin [Trichophyton rubrum D6]
Length=229

 Score =   396 bits (1017),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 199/213 (93%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTL+ YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228


 Score =   297 bits (760),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 148/153 (97%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>gb|KIM30634.1| hypothetical protein M408DRAFT_328170 [Serendipita vermifera 
MAFF 305830]
Length=229

 Score =   396 bits (1017),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 199/213 (93%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTL+ YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228


 Score =   295 bits (756),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 147/153 (96%), Positives = 149/153 (97%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVK LTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKALTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>ref|XP_007049060.1| Polyubiquitin 10 [Theobroma cacao]
 gb|EOX93217.1| Polyubiquitin 10 [Theobroma cacao]
Length=457

 Score =   404 bits (1039),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 205/214 (96%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  244  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  303

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  304  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  363

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV+SSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  364  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVDSSDTIDNVKAKIQDKEGIPPDQQRL  423

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  424  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  457


 Score =   403 bits (1036),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   403 bits (1036),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   403 bits (1036),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  168  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  227

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  228  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  287

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  288  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  381


 Score =   303 bits (776),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|AAN31845.1| putative polyubiquitin (UBQ10) [Arabidopsis thaliana]
Length=464

 Score =   405 bits (1040),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   405 bits (1040),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   405 bits (1040),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  168  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  227

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  228  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  287

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  288  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  381


 Score =   332 bits (851),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 168/177 (95%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  244  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  303

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  304  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  363

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  188
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ
Sbjct  364  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  420


 Score =   304 bits (778),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>emb|CCG34086.1| Polyubiquitin [uncultured eukaryote]
Length=304

 Score =   399 bits (1024),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 199/214 (93%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTL+ YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   371 bits (952),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 185/202 (92%), Positives = 192/202 (95%), Gaps = 0/202 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTL+ YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGM+IFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMRIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKES  113
            IFAGKQLEDGRTL+DYNIQK +
Sbjct  272  IFAGKQLEDGRTLSDYNIQKRA  293


 Score =   299 bits (765),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 148/153 (97%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>gb|KIM22018.1| hypothetical protein M408DRAFT_333137 [Serendipita vermifera 
MAFF 305830]
Length=229

 Score =   395 bits (1016),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 199/213 (93%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTL+ YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  80
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228


 Score =   297 bits (760),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 148/153 (97%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>gb|AAO43309.1| putative polyubiquitin [Arabidopsis thaliana]
Length=250

 Score =   396 bits (1018),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 201/214 (94%), Positives = 202/214 (94%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTLA YNIQKESTLHLVLRLRG
Sbjct  36   EVQSSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  95

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADY
Sbjct  96   GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEWIPPDQQRLIFAGKQLEDGRTLADY  155

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ+RL
Sbjct  156  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQKRL  215

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTLA YNIQKESTLHLVLRLRGG 
Sbjct  216  IFAGKQLEDGRTLAVYNIQKESTLHLVLRLRGGI  249


 Score =   338 bits (866),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 169/173 (98%), Positives = 170/173 (98%), Gaps = 0/173 (0%)
 Frame = -1

Query  595  AXYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  416
            A YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV+SSDTIDNVKAKIQDKEGIPPDQ
Sbjct  1    ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVQSSDTIDNVKAKIQDKEGIPPDQ  60

Query  415  QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  236
            QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID
Sbjct  61   QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  120

Query  235  NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            NVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  NVKAKIQDKEWIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  173



>ref|XP_002551324.1| ubiquitin [Candida tropicalis MYA-3404]
 gb|EER30626.1| ubiquitin [Candida tropicalis MYA-3404]
Length=299

 Score =   398 bits (1023),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 199/214 (93%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTL+ YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   371 bits (953),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 186/204 (91%), Positives = 193/204 (95%), Gaps = 0/204 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTL+ YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  271

Query  178  IFAGKQLEDGRTLADYNIQKESTL  107
            IFAGKQLEDGRTL+DYNI K++ L
Sbjct  272  IFAGKQLEDGRTLSDYNISKKNLL  295


 Score =   299 bits (765),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 148/153 (97%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>gb|EGA57707.1| Ubi4p [Saccharomyces cerevisiae FostersB]
Length=248

 Score =   396 bits (1018),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 198/214 (93%), Positives = 203/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGK LEDGRTL+ YNIQKESTLHLVLRLRG
Sbjct  16   EVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKXLEDGRTLSDYNIQKESTLHLVLRLRG  75

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  76   GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  135

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  179
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  136  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  195

Query  178  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   296 bits (759),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 147/153 (96%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -1

Query  535  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  356
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGK LEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKXLEDGRTLSDYN  60

Query  355  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  176
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  175  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  77
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153


 Score =   287 bits (735),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 145/157 (92%), Positives = 148/157 (94%), Gaps = 0/157 (0%)
 Frame = -1

Query  718  EXXSSAXIDXVKXKIQDKEGIPPDQQRXXFAGKQLEDGRTLAXYNIQKESTLHLVLRLRG  539
            E  SS  ID VK KIQDKEGIPPDQQR  FAGKQLEDGRTL+ YNIQKESTLHLVLRLRG
Sbjct  92   EVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG  151

Query  538  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  359
            GMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  152  GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  211

Query  358  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESS  248
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESS
Sbjct  212  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESS  248



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1810640443200