BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF001B09

Length=585
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDO98381.1|  unnamed protein product                                176   3e-63   Coffea canephora [robusta coffee]
ref|XP_009611065.1|  PREDICTED: guanine nucleotide-binding protei...    171   4e-60   Nicotiana tomentosiformis
ref|XP_009780116.1|  PREDICTED: guanine nucleotide-binding protei...    170   2e-59   Nicotiana sylvestris
ref|XP_006341557.1|  PREDICTED: guanine nucleotide-binding protei...    168   8e-59   
emb|CAA96528.1|  G protein beta-subunit-like protein                    167   2e-58   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_009776114.1|  PREDICTED: guanine nucleotide-binding protei...    167   2e-58   Nicotiana sylvestris
ref|XP_004252270.1|  PREDICTED: guanine nucleotide-binding protei...    166   2e-58   Solanum lycopersicum
gb|EYU17645.1|  hypothetical protein MIMGU_mgv1a009858mg                167   2e-58   Erythranthe guttata [common monkey flower]
gb|EYU40229.1|  hypothetical protein MIMGU_mgv1a008949mg                167   2e-58   Erythranthe guttata [common monkey flower]
gb|AJE63428.1|  transcription factor ArcA1                              164   2e-58   Capsicum annuum
ref|NP_001233881.1|  ArcA2 protein                                      164   5e-58   
ref|XP_009600162.1|  PREDICTED: guanine nucleotide-binding protei...    167   5e-58   Nicotiana tomentosiformis
ref|XP_009624187.1|  PREDICTED: guanine nucleotide-binding protei...    166   6e-58   Nicotiana tomentosiformis
gb|ABB86277.1|  ArcA2 protein-like                                      165   6e-58   Solanum tuberosum [potatoes]
ref|XP_006353816.1|  PREDICTED: guanine nucleotide-binding protei...    166   7e-58   Solanum tuberosum [potatoes]
gb|ABB02625.1|  G protein beta subunit-like protein                     164   1e-57   Solanum tuberosum [potatoes]
ref|XP_009778426.1|  PREDICTED: guanine nucleotide-binding protei...    165   1e-57   Nicotiana sylvestris
ref|XP_011072970.1|  PREDICTED: guanine nucleotide-binding protei...    162   2e-57   Sesamum indicum [beniseed]
sp|P93340.1|GBLP_NICPL  RecName: Full=Guanine nucleotide-binding ...    164   3e-57   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
sp|P49026.1|GBLP_TOBAC  RecName: Full=Guanine nucleotide-binding ...    164   5e-57   Nicotiana tabacum [American tobacco]
gb|ACR77528.1|  heterotrimeric G protein beta 1 subunit                 164   7e-57   Nicotiana benthamiana
ref|XP_006365404.1|  PREDICTED: guanine nucleotide-binding protei...    159   8e-57   Solanum tuberosum [potatoes]
gb|EPS70887.1|  hypothetical protein M569_03871                         165   1e-56   Genlisea aurea
ref|NP_001233876.1|  ArcA1 protein                                      159   1e-56   
gb|KJB37175.1|  hypothetical protein B456_006G192600                    156   4e-56   Gossypium raimondii
gb|KHG00880.1|  Guanine nucleotide-binding protein subunit beta-l...    156   6e-56   Gossypium arboreum [tree cotton]
ref|XP_003631071.1|  Guanine nucleotide-binding protein subunit b...    156   1e-55   Medicago truncatula
sp|O24076.1|GBLP_MEDSA  RecName: Full=Guanine nucleotide-binding ...    157   1e-55   Medicago sativa [alfalfa]
gb|KJB53022.1|  hypothetical protein B456_008G288800                    154   3e-55   Gossypium raimondii
gb|KHG17882.1|  Guanine nucleotide-binding protein subunit beta-l...    154   3e-55   Gossypium arboreum [tree cotton]
ref|XP_004299548.1|  PREDICTED: guanine nucleotide-binding protei...    155   4e-55   Fragaria vesca subsp. vesca
ref|XP_007036696.1|  Transducin/WD40 repeat-like superfamily protein    153   4e-55   Theobroma cacao [chocolate]
ref|XP_010537487.1|  PREDICTED: guanine nucleotide-binding protei...    156   4e-55   Tarenaya hassleriana [spider flower]
gb|AFK36580.1|  unknown                                                 154   5e-55   Medicago truncatula
ref|XP_006297909.1|  hypothetical protein CARUB_v10013951mg             154   8e-55   
ref|XP_010097592.1|  Guanine nucleotide-binding protein subunit b...    155   1e-54   Morus notabilis
ref|XP_004137327.1|  PREDICTED: guanine nucleotide-binding protei...    154   1e-54   Cucumis sativus [cucumbers]
ref|XP_010540016.1|  PREDICTED: guanine nucleotide-binding protei...    155   1e-54   Tarenaya hassleriana [spider flower]
ref|XP_009110365.1|  PREDICTED: guanine nucleotide-binding protei...    155   1e-54   Brassica rapa
ref|XP_008453452.1|  PREDICTED: guanine nucleotide-binding protei...    154   1e-54   Cucumis melo [Oriental melon]
ref|XP_002894122.1|  hypothetical protein ARALYDRAFT_474002             155   1e-54   
ref|XP_010549077.1|  PREDICTED: guanine nucleotide-binding protei...    152   1e-54   Tarenaya hassleriana [spider flower]
ref|NP_001241455.1|  uncharacterized protein LOC100778205               153   2e-54   Glycine max [soybeans]
ref|XP_010506450.1|  PREDICTED: guanine nucleotide-binding protei...    153   2e-54   Camelina sativa [gold-of-pleasure]
gb|KHN21658.1|  Guanine nucleotide-binding protein subunit beta-l...    153   2e-54   Glycine soja [wild soybean]
ref|XP_010465892.1|  PREDICTED: guanine nucleotide-binding protei...    153   2e-54   Camelina sativa [gold-of-pleasure]
ref|XP_010549078.1|  PREDICTED: guanine nucleotide-binding protei...    152   3e-54   Tarenaya hassleriana [spider flower]
ref|XP_007160506.1|  hypothetical protein PHAVU_002G327500g             152   3e-54   Phaseolus vulgaris [French bean]
gb|ACJ24167.1|  Rack                                                    152   3e-54   Phaseolus vulgaris [French bean]
ref|XP_009149259.1|  PREDICTED: guanine nucleotide-binding protei...    154   3e-54   Brassica rapa
ref|NP_188441.1|  receptor for activated C kinase 1C                    154   4e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006393380.1|  hypothetical protein EUTSA_v10011646mg             153   4e-54   Eutrema salsugineum [saltwater cress]
gb|KFK39137.1|  guanine nucleotide-binding protein subunit beta-l...    153   4e-54   Arabis alpina [alpine rockcress]
gb|KHN00175.1|  Guanine nucleotide-binding protein subunit beta-l...    152   4e-54   Glycine soja [wild soybean]
ref|XP_009117627.1|  PREDICTED: guanine nucleotide-binding protei...    155   4e-54   Brassica rapa
gb|KHG29145.1|  Guanine nucleotide-binding protein subunit beta-l...    150   5e-54   Gossypium arboreum [tree cotton]
gb|KJB08186.1|  hypothetical protein B456_001G069800                    150   5e-54   Gossypium raimondii
ref|XP_010487724.1|  PREDICTED: guanine nucleotide-binding protei...    152   6e-54   Camelina sativa [gold-of-pleasure]
pdb|3DM0|A  Chain A, Maltose Binding Protein Fusion With Rack1 Fr...    154   7e-54   Escherichia coli K-12
ref|XP_006406649.1|  hypothetical protein EUTSA_v10021128mg             152   8e-54   Eutrema salsugineum [saltwater cress]
ref|XP_002890259.1|  hypothetical protein ARALYDRAFT_889221             154   8e-54   Arabidopsis lyrata subsp. lyrata
ref|XP_006416642.1|  hypothetical protein EUTSA_v10008183mg             154   9e-54   Eutrema salsugineum [saltwater cress]
ref|NP_001235369.1|  guanine nucleotide-binding protein subunit b...    150   1e-53   Glycine max [soybeans]
ref|XP_002529557.1|  receptor for activated protein kinase C, put...    152   1e-53   Ricinus communis
ref|XP_010032559.1|  PREDICTED: guanine nucleotide-binding protei...    150   1e-53   Eucalyptus grandis [rose gum]
ref|XP_006451669.1|  hypothetical protein CICLE_v10008909mg             148   1e-53   Citrus clementina [clementine]
ref|XP_002885240.1|  guanine nucleotide-binding family protein          151   2e-53   Arabidopsis lyrata subsp. lyrata
emb|CDY64888.1|  BnaC06g40840D                                          153   2e-53   Brassica napus [oilseed rape]
ref|XP_006305354.1|  hypothetical protein CARUB_v10009733mg             151   2e-53   Capsella rubella
gb|KFK43977.1|  guanine nucleotide-binding protein subunit beta-l...    153   2e-53   Arabis alpina [alpine rockcress]
ref|XP_006305339.1|  hypothetical protein CARUB_v10009720mg             153   2e-53   Capsella rubella
gb|AAB82647.1|  WD-40 repeat protein                                    153   2e-53   Arabidopsis thaliana [mouse-ear cress]
ref|NP_173248.1|  guanine nucleotide-binding protein subunit beta...    153   2e-53   Arabidopsis thaliana [mouse-ear cress]
gb|KDP37901.1|  hypothetical protein JCGZ_05340                         150   3e-53   Jatropha curcas
ref|NP_175296.1|  receptor for activated C kinase 1B                    150   3e-53   Arabidopsis thaliana [mouse-ear cress]
gb|KDO62873.1|  hypothetical protein CISIN_1g048118mg                   146   3e-53   Citrus sinensis [apfelsine]
sp|Q39336.1|GBLP_BRANA  RecName: Full=Guanine nucleotide-binding ...    152   4e-53   Brassica napus [oilseed rape]
ref|XP_010551145.1|  PREDICTED: guanine nucleotide-binding protei...    149   4e-53   Tarenaya hassleriana [spider flower]
ref|XP_010036939.1|  PREDICTED: guanine nucleotide-binding protei...    150   6e-53   Eucalyptus grandis [rose gum]
ref|XP_010678120.1|  PREDICTED: guanine nucleotide-binding protei...    149   6e-53   Beta vulgaris subsp. vulgaris [field beet]
gb|AGV54321.1|  RACK1                                                   152   7e-53   Phaseolus vulgaris [French bean]
ref|XP_010498185.1|  PREDICTED: guanine nucleotide-binding protei...    151   7e-53   Camelina sativa [gold-of-pleasure]
ref|XP_010476972.1|  PREDICTED: guanine nucleotide-binding protei...    152   7e-53   Camelina sativa [gold-of-pleasure]
ref|XP_009147950.1|  PREDICTED: LOW QUALITY PROTEIN: guanine nucl...    151   8e-53   Brassica rapa
ref|XP_002281279.1|  PREDICTED: guanine nucleotide-binding protei...    148   1e-52   Vitis vinifera
ref|XP_008240184.1|  PREDICTED: guanine nucleotide-binding protei...    152   1e-52   Prunus mume [ume]
ref|XP_008374821.1|  PREDICTED: LOW QUALITY PROTEIN: guanine nucl...    150   1e-52   Malus domestica [apple tree]
ref|XP_009360100.1|  PREDICTED: guanine nucleotide-binding protei...    150   1e-52   Pyrus x bretschneideri [bai li]
ref|XP_008393404.1|  PREDICTED: guanine nucleotide-binding protei...    150   1e-52   Malus domestica [apple tree]
ref|XP_007209348.1|  hypothetical protein PRUPE_ppa008536mg             152   1e-52   Prunus persica
ref|XP_010500401.1|  PREDICTED: guanine nucleotide-binding protei...    148   1e-52   Camelina sativa [gold-of-pleasure]
ref|XP_009145001.1|  PREDICTED: guanine nucleotide-binding protei...    150   2e-52   Brassica rapa
gb|AAM65407.1|  guanine nucleotide-binding protein, putative            148   2e-52   Arabidopsis thaliana [mouse-ear cress]
emb|CDY59680.1|  BnaA05g36460D                                          150   2e-52   Brassica napus [oilseed rape]
emb|CDX95554.1|  BnaC01g34460D                                          149   2e-52   
ref|XP_009113515.1|  PREDICTED: guanine nucleotide-binding protei...    149   3e-52   Brassica rapa
emb|CDY18497.1|  BnaA01g26980D                                          149   3e-52   Brassica napus [oilseed rape]
ref|XP_010479287.1|  PREDICTED: guanine nucleotide-binding protei...    146   4e-52   Camelina sativa [gold-of-pleasure]
ref|XP_011039103.1|  PREDICTED: guanine nucleotide-binding protei...    143   4e-52   Populus euphratica
ref|XP_002318528.1|  GTP-binding protein beta chain                     143   4e-52   Populus trichocarpa [western balsam poplar]
ref|XP_010461692.1|  PREDICTED: guanine nucleotide-binding protei...    146   4e-52   Camelina sativa [gold-of-pleasure]
ref|XP_011039104.1|  PREDICTED: guanine nucleotide-binding protei...    143   5e-52   Populus euphratica
emb|CAA06154.1|  arcA 3                                                 145   6e-52   Nicotiana tabacum [American tobacco]
emb|CDY71917.1|  BnaCnng75080D                                          151   7e-52   Brassica napus [oilseed rape]
emb|CDY44104.1|  BnaA01g13120D                                          146   8e-52   Brassica napus [oilseed rape]
ref|XP_009145932.1|  PREDICTED: guanine nucleotide-binding protei...    146   2e-51   Brassica rapa
emb|CDX92200.1|  BnaA05g22070D                                          146   2e-51   
emb|CDX95784.1|  BnaC05g35350D                                          146   4e-51   
ref|XP_011000479.1|  PREDICTED: guanine nucleotide-binding protei...    139   3e-50   Populus euphratica
ref|XP_004503304.1|  PREDICTED: guanine nucleotide-binding protei...    153   1e-49   Cicer arietinum [garbanzo]
ref|XP_002321505.1|  GTP-binding protein beta chain                     137   2e-49   Populus trichocarpa [western balsam poplar]
ref|XP_011084467.1|  PREDICTED: LOW QUALITY PROTEIN: guanine nucl...    165   1e-48   Sesamum indicum [beniseed]
ref|XP_010256121.1|  PREDICTED: guanine nucleotide-binding protei...    132   2e-47   Nelumbo nucifera [Indian lotus]
emb|CAC09579.1|  gbf1 protein                                           128   3e-47   Fagus sylvatica
ref|XP_010243791.1|  PREDICTED: guanine nucleotide-binding protei...    132   3e-47   Nelumbo nucifera [Indian lotus]
ref|XP_010916329.1|  PREDICTED: guanine nucleotide-binding protei...    130   5e-46   Elaeis guineensis
ref|XP_006837182.1|  hypothetical protein AMTR_s00105p00058690          129   6e-46   Amborella trichopoda
ref|XP_010924141.1|  PREDICTED: guanine nucleotide-binding protei...    127   8e-46   Elaeis guineensis
ref|XP_008803271.1|  PREDICTED: guanine nucleotide-binding protei...    127   4e-45   Phoenix dactylifera
ref|XP_010430893.1|  PREDICTED: guanine nucleotide-binding protei...    126   4e-45   
ref|XP_009400497.1|  PREDICTED: guanine nucleotide-binding protei...    123   6e-45   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009405003.1|  PREDICTED: guanine nucleotide-binding protei...    122   6e-45   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010495439.1|  PREDICTED: guanine nucleotide-binding protei...    125   9e-45   
dbj|BAF47116.1|  G protein beta-subunit-like protein                    122   1e-44   Nicotiana tabacum [American tobacco]
ref|XP_010923802.1|  PREDICTED: guanine nucleotide-binding protei...    124   2e-44   Elaeis guineensis
ref|NP_001136800.1|  guanine nucleotide-binding protein beta subu...    124   4e-44   Zea mays [maize]
gb|ACL54313.1|  unknown                                                 124   6e-44   Zea mays [maize]
ref|XP_008812615.1|  PREDICTED: guanine nucleotide-binding protei...    125   6e-44   
ref|NP_001146976.1|  LOC100280585                                       123   6e-44   Zea mays [maize]
gb|ABK26798.1|  unknown                                                 123   8e-44   Picea sitchensis
dbj|BAF47119.1|  G protein beta-subunit-like protein                    121   1e-43   Nicotiana tabacum [American tobacco]
ref|XP_002440202.1|  hypothetical protein SORBIDRAFT_09g027690          122   1e-43   Sorghum bicolor [broomcorn]
ref|XP_009380503.1|  PREDICTED: guanine nucleotide-binding protei...    122   2e-43   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABK25010.1|  unknown                                                 123   3e-43   Picea sitchensis
gb|ACN41093.1|  unknown                                                 123   3e-43   Picea sitchensis
gb|AFV60006.1|  heterotrimeric guanine nucleotide-binding protein...    117   7e-43   Eschscholzia californica
ref|XP_001754916.1|  predicted protein                                  117   1e-42   
ref|XP_001779496.1|  predicted protein                                  117   1e-42   
ref|XP_001780288.1|  predicted protein                                  117   1e-42   
ref|XP_004961307.1|  PREDICTED: guanine nucleotide-binding protei...    122   2e-42   Setaria italica
gb|EMT00770.1|  hypothetical protein F775_19376                         121   2e-42   
gb|EMS52917.1|  Guanine nucleotide-binding protein subunit beta-l...    120   4e-42   Triticum urartu
ref|XP_006644561.1|  PREDICTED: LOW QUALITY PROTEIN: guanine nucl...    117   5e-42   Oryza brachyantha
ref|XP_004969582.1|  PREDICTED: guanine nucleotide-binding protei...    121   6e-42   Setaria italica
ref|XP_005847990.1|  hypothetical protein CHLNCDRAFT_31033              119   7e-42   Chlorella variabilis
ref|NP_001043910.1|  Os01g0686800                                       116   9e-42   
dbj|BAJ90663.1|  predicted protein                                      119   1e-41   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AEF79971.1|  receptor of activated protein kinase C 1                117   1e-41   Dunaliella salina
gb|ABR25943.1|  guanine nucleotide-binding protein beta subunit         116   2e-41   Oryza sativa Indica Group [Indian rice]
ref|XP_004252271.1|  PREDICTED: guanine nucleotide-binding protei...    108   2e-41   Solanum lycopersicum
gb|KFK36075.1|  hypothetical protein AALP_AA4G074100                    145   2e-41   Arabis alpina [alpine rockcress]
gb|AEO44580.1|  receptor for activated C kinase 1                       117   3e-41   Dunaliella salina
ref|XP_003082627.1|  GTP-binding regulatory protein beta chain ho...    113   3e-41   
ref|XP_003567944.1|  PREDICTED: guanine nucleotide-binding protei...    116   4e-41   Brachypodium distachyon [annual false brome]
gb|EEC79656.1|  hypothetical protein OsI_20897                          119   5e-41   Oryza sativa Indica Group [Indian rice]
ref|NP_001056254.1|  Os05g0552300                                       118   7e-41   
emb|CEG00110.1|  G-protein beta WD-40 repeat                            112   1e-40   Ostreococcus tauri
ref|XP_003569582.1|  PREDICTED: guanine nucleotide-binding protei...    112   3e-40   Brachypodium distachyon [annual false brome]
ref|XP_008811978.1|  PREDICTED: LOW QUALITY PROTEIN: guanine nucl...    127   4e-40   Phoenix dactylifera
ref|XP_001421096.1|  Receptor of activated protein kinase C 1A, c...    112   6e-40   Ostreococcus lucimarinus CCE9901
ref|XP_006654750.1|  PREDICTED: guanine nucleotide-binding protei...    115   9e-40   Oryza brachyantha
gb|KDD72035.1|  hypothetical protein H632_c3969p0                       115   2e-39   Helicosporidium sp. ATCC 50920
ref|XP_003060952.1|  predicted protein                                  107   2e-39   Micromonas pusilla CCMP1545
ref|XP_002502835.1|  predicted protein                                  106   2e-39   Micromonas commoda
ref|XP_002456166.1|  hypothetical protein SORBIDRAFT_03g031520          113   3e-39   Sorghum bicolor [broomcorn]
dbj|BAJ98167.1|  predicted protein                                      110   5e-39   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_005652002.1|  WD40 repeat-like protein                           108   5e-39   Coccomyxa subellipsoidea C-169
emb|CDM83867.1|  unnamed protein product                                109   8e-39   Triticum aestivum [Canadian hard winter wheat]
gb|KIY98327.1|  Guanine nucleotide-binding protein subunit beta-l...    105   2e-38   Monoraphidium neglectum
ref|XP_002967499.1|  hypothetical protein SELMODRAFT_144795             103   5e-38   Selaginella moellendorffii
ref|XP_005711409.1|  receptor for activated protein kinase C            111   7e-38   Chondrus crispus [carageen]
gb|EMP25897.1|  Guanine nucleotide-binding protein subunit beta-2...    103   2e-37   Chelonia mydas [green seaturtle]
ref|XP_002960209.1|  hypothetical protein SELMODRAFT_266532             100   6e-37   
emb|CEG76293.1|  Putative Guanine nucleotide-binding protein subu...    105   7e-37   Rhizopus microsporus
ref|XP_007508318.1|  predicted protein                                97.8    8e-37   Bathycoccus prasinos
emb|CEG67117.1|  Putative Guanine nucleotide-binding protein subu...    105   2e-36   Rhizopus microsporus
gb|EIE78732.1|  guanine nucleotide-binding protein subunit beta-2...    104   2e-36   Rhizopus delemar RA 99-880
ref|XP_011397272.1|  Guanine nucleotide-binding protein subunit b...    105   2e-36   Auxenochlorella protothecoides
dbj|GAN10996.1|  guanine nucleotide-binding protein                     106   2e-36   Mucor ambiguus
dbj|GAN11178.1|  hypothetical protein MAM1_0495d10736                   106   3e-36   Mucor ambiguus
gb|EPB90862.1|  guanine nucleotide-binding protein subunit beta-2...    105   4e-36   Mucor circinelloides f. circinelloides 1006PhL
ref|XP_002286095.1|  guanine nucleotide binding protein beta subu...  99.4    5e-36   Thalassiosira pseudonana CCMP1335
emb|CEP08121.1|  hypothetical protein                                   103   5e-36   Parasitella parasitica
emb|CEP13972.1|  hypothetical protein                                   104   5e-36   Parasitella parasitica
gb|EJT47727.1|  G protein beta subunit-like protein Rkp1                101   6e-36   Trichosporon asahii var. asahii CBS 2479
gb|EAW53699.1|  guanine nucleotide binding protein (G protein), b...    103   6e-36   Homo sapiens [man]
gb|EPB88453.1|  guanine nucleotide-binding protein subunit beta-2...    104   6e-36   Mucor circinelloides f. circinelloides 1006PhL
ref|XP_004696065.1|  PREDICTED: LOW QUALITY PROTEIN: guanine nucl...    103   7e-36   
ref|XP_008681951.1|  PREDICTED: guanine nucleotide-binding protei...    102   9e-36   Ursus maritimus [white bear]
gb|KDO19117.1|  guanine nucleotide-binding protein subunit beta-2...  99.0    9e-36   Saprolegnia parasitica CBS 223.65
ref|XP_005018374.1|  PREDICTED: guanine nucleotide-binding protei...    103   9e-36   
ref|XP_007527211.1|  PREDICTED: guanine nucleotide-binding protei...    102   1e-35   Erinaceus europaeus [common hedgehog]
ref|XP_005795376.1|  PREDICTED: guanine nucleotide-binding protei...    102   1e-35   Xiphophorus maculatus
ref|XP_005862397.1|  PREDICTED: guanine nucleotide-binding protei...    102   1e-35   
ref|XP_009037831.1|  hypothetical protein AURANDRAFT_37768              100   1e-35   Aureococcus anophagefferens
ref|XP_005977784.1|  PREDICTED: guanine nucleotide-binding protei...    102   1e-35   Pantholops hodgsonii [Tibetan antelope]
ref|XP_005891160.1|  PREDICTED: guanine nucleotide-binding protei...    102   1e-35   Bos mutus
ref|XP_006766909.1|  PREDICTED: guanine nucleotide-binding protei...    102   1e-35   
ref|XP_008608530.1|  guanine nucleotide-binding protein subunit b...  99.0    1e-35   Saprolegnia diclina VS20
ref|XP_008156879.1|  PREDICTED: guanine nucleotide-binding protei...    102   1e-35   
ref|XP_006746631.1|  PREDICTED: guanine nucleotide-binding protei...    102   1e-35   Leptonychotes weddellii
ref|XP_008013783.1|  PREDICTED: guanine nucleotide-binding protei...    102   1e-35   Chlorocebus sabaeus
ref|XP_006105825.1|  PREDICTED: LOW QUALITY PROTEIN: guanine nucl...    102   1e-35   
ref|XP_004586327.1|  PREDICTED: guanine nucleotide-binding protei...    102   1e-35   Ochotona princeps [southern American pika]
ref|XP_008955153.1|  PREDICTED: guanine nucleotide-binding protei...    102   1e-35   Pan paniscus [bonobo]
gb|ACJ85349.1|  unknown                                               89.7    1e-35   Medicago truncatula
gb|KDO24030.1|  guanine nucleotide-binding protein subunit beta-2...  99.4    1e-35   Saprolegnia parasitica CBS 223.65
pdb|4AOW|A  Chain A, Crystal Structure Of The Human Rack1 Protein...    102   1e-35   Homo sapiens [man]
dbj|BAE40068.1|  unnamed protein product                                102   1e-35   Mus musculus [mouse]
gb|AAO21313.1|  lung cancer oncogene 7                                  102   1e-35   Homo sapiens [man]
gb|ESA03866.1|  hypothetical protein GLOINDRAFT_336518                98.6    1e-35   
gb|EAW53698.1|  guanine nucleotide binding protein (G protein), b...    102   1e-35   Homo sapiens [man]
gb|ETE60795.1|  Guanine nucleotide-binding protein subunit beta-2...    102   1e-35   Ophiophagus hannah
gb|EAW53694.1|  guanine nucleotide binding protein (G protein), b...    102   1e-35   Homo sapiens [man]
gb|AAI02287.2|  GNB2L1 protein                                          102   1e-35   Bos taurus [bovine]
ref|NP_006089.1|  guanine nucleotide-binding protein subunit beta...    102   1e-35   Homo sapiens [man]
gb|EWM27643.1|  guanine nucleotide binding protein                      100   1e-35   Nannochloropsis gaditana
gb|AAR24619.1|  proliferation-inducing gene 21                          102   1e-35   Homo sapiens [man]
gb|EAW53700.1|  guanine nucleotide binding protein (G protein), b...    102   1e-35   Homo sapiens [man]
gb|KFO20808.1|  Guanine nucleotide-binding protein subunit beta-2...    102   1e-35   Fukomys damarensis [Damara mole rat]
ref|XP_006270088.1|  PREDICTED: guanine nucleotide-binding protei...    102   1e-35   
dbj|BAE40059.1|  unnamed protein product                                102   1e-35   Mus musculus [mouse]
gb|AAP36938.1|  Homo sapiens guanine nucleotide binding protein (...    102   1e-35   synthetic construct
ref|XP_004657524.1|  PREDICTED: guanine nucleotide-binding protei...    102   1e-35   Jaculus jaculus
ref|XP_003900707.2|  PREDICTED: guanine nucleotide-binding protei...    102   1e-35   Papio anubis [baboon]
ref|XP_001105066.1|  PREDICTED: guanine nucleotide-binding protei...    102   1e-35   Macaca mulatta [rhesus macaque]
gb|EPY85923.1|  guanine nucleotide binding protein, beta polypept...    102   1e-35   Camelus ferus
ref|XP_004387229.1|  PREDICTED: guanine nucleotide-binding protei...    102   1e-35   Trichechus manatus latirostris
gb|EPQ05298.1|  Guanine nucleotide-binding protein subunit beta-2...    102   1e-35   Myotis brandtii
gb|EAW53696.1|  guanine nucleotide binding protein (G protein), b...    102   1e-35   Homo sapiens [man]
gb|EHB05258.1|  Guanine nucleotide-binding protein subunit beta-2...    102   1e-35   Heterocephalus glaber [naked mole rat]
dbj|BAG53102.1|  unnamed protein product                                102   1e-35   Homo sapiens [man]
ref|XP_005234127.1|  PREDICTED: LOW QUALITY PROTEIN: guanine nucl...    102   1e-35   Falco peregrinus [peregrine]
gb|KFP61115.1|  Guanine nucleotide-binding protein subunit beta-2...    102   2e-35   Cariama cristata
ref|XP_004073369.1|  PREDICTED: guanine nucleotide-binding protei...    101   2e-35   Oryzias latipes [Japanese rice fish]
gb|AAP04406.1|  G-protein beta subunit like-protein                     102   2e-35   Oryctolagus cuniculus [domestic rabbit]
ref|XP_004540947.1|  PREDICTED: guanine nucleotide-binding protei...    101   2e-35   Maylandia zebra
ref|XP_002804718.1|  PREDICTED: guanine nucleotide-binding protei...    102   2e-35   
ref|XP_009701898.1|  PREDICTED: guanine nucleotide-binding protei...    102   2e-35   Cariama cristata
gb|AAW82329.1|  guanine nucleotide binding 12.3                         102   2e-35   Gallus gallus [bantam]
ref|XP_005435183.1|  PREDICTED: guanine nucleotide-binding protei...    102   2e-35   Falco cherrug
ref|XP_009805348.1|  PREDICTED: LOW QUALITY PROTEIN: guanine nucl...    102   2e-35   Gavia stellata
ref|XP_008063710.1|  PREDICTED: guanine nucleotide-binding protei...    102   2e-35   Carlito syrichta
ref|XP_009931788.1|  PREDICTED: LOW QUALITY PROTEIN: guanine nucl...    102   2e-35   Opisthocomus hoazin [hoatzin]
ref|XP_007431363.1|  PREDICTED: guanine nucleotide-binding protei...    102   2e-35   Python bivittatus
gb|ELK03178.1|  Guanine nucleotide-binding protein subunit beta-2...    102   2e-35   Pteropus alecto
ref|NP_001266445.1|  guanine nucleotide-binding protein subunit b...    101   2e-35   Oreochromis niloticus
ref|XP_009462428.1|  PREDICTED: guanine nucleotide-binding protei...    102   2e-35   Nipponia nippon
ref|XP_005062497.1|  PREDICTED: guanine nucleotide-binding protei...    102   2e-35   Ficedula albicollis
ref|XP_002834824.3|  PREDICTED: guanine nucleotide-binding protei...    102   2e-35   Pongo abelii [orang utan]
ref|XP_006037851.1|  PREDICTED: guanine nucleotide-binding protei...    102   2e-35   
ref|NP_571519.1|  guanine nucleotide-binding protein subunit beta...    102   2e-35   Danio rerio [leopard danio]
ref|XP_004468645.1|  PREDICTED: guanine nucleotide-binding protei...    102   2e-35   
ref|XP_009513424.1|  PREDICTED: guanine nucleotide-binding protei...    102   2e-35   Phalacrocorax carbo [common cormorant]
gb|KFO76552.1|  Guanine nucleotide-binding protein subunit beta-2...    102   2e-35   Cuculus canorus
ref|XP_007083117.1|  PREDICTED: guanine nucleotide-binding protei...    102   2e-35   
ref|XP_009277073.1|  PREDICTED: guanine nucleotide-binding protei...    102   2e-35   
gb|KFQ81036.1|  Guanine nucleotide-binding protein subunit beta-2...    102   2e-35   Phaethon lepturus
ref|XP_005658294.1|  PREDICTED: guanine nucleotide binding protei...    102   2e-35   
gb|KFW73927.1|  Guanine nucleotide-binding protein subunit beta-2...    102   2e-35   Phalacrocorax carbo [common cormorant]
gb|AAA18951.1|  protein kinase C receptor                               102   2e-35   Rattus norvegicus [brown rat]
ref|XP_005534099.1|  PREDICTED: guanine nucleotide-binding protei...    102   2e-35   Pseudopodoces humilis [Tibetan ground-jay]
gb|KFP96911.1|  Guanine nucleotide-binding protein subunit beta-2...    102   2e-35   Haliaeetus albicilla
ref|XP_010291551.1|  PREDICTED: guanine nucleotide-binding protei...    102   2e-35   Phaethon lepturus
ref|XP_008325350.1|  PREDICTED: guanine nucleotide-binding protei...    102   2e-35   Cynoglossus semilaevis [half-smooth tongue sole]
gb|KFQ66729.1|  Guanine nucleotide-binding protein subunit beta-2...    102   2e-35   Pelecanus crispus
gb|KFQ89059.1|  Guanine nucleotide-binding protein subunit beta-2...    102   2e-35   Phoenicopterus ruber ruber
ref|XP_009922131.1|  PREDICTED: guanine nucleotide-binding protei...    102   2e-35   Haliaeetus albicilla
gb|KFQ96249.1|  Guanine nucleotide-binding protein subunit beta-2...    102   2e-35   Nipponia nippon
ref|XP_006875415.1|  PREDICTED: guanine nucleotide-binding protei...    102   2e-35   Chrysochloris asiatica
gb|KFO08948.1|  Guanine nucleotide-binding protein subunit beta-2...    102   2e-35   Balearica regulorum gibbericeps
ref|XP_009489930.1|  PREDICTED: guanine nucleotide-binding protei...    102   2e-35   Pelecanus crispus
gb|EDL33790.1|  guanine nucleotide binding protein (G protein), b...    102   2e-35   Mus musculus [mouse]
gb|KFP58388.1|  Guanine nucleotide-binding protein subunit beta-2...    102   2e-35   Cathartes aura
ref|XP_010223334.1|  PREDICTED: guanine nucleotide-binding protei...    102   2e-35   Tinamus guttatus
ref|XP_009995617.1|  PREDICTED: guanine nucleotide-binding protei...    102   2e-35   Chaetura pelagica
gb|ERE68979.1|  guanine nucleotide-binding protein subunit beta-2...    102   2e-35   Cricetulus griseus [Chinese hamsters]
gb|ELW66848.1|  Guanine nucleotide-binding protein subunit beta-2...    101   3e-35   Tupaia chinensis
gb|EAW53697.1|  guanine nucleotide binding protein (G protein), b...    102   3e-35   Homo sapiens [man]
ref|XP_007070338.1|  PREDICTED: guanine nucleotide-binding protei...    102   3e-35   
ref|XP_009448630.1|  PREDICTED: guanine nucleotide-binding protei...    102   3e-35   
ref|XP_010296751.1|  PREDICTED: guanine nucleotide-binding protei...    102   3e-35   
dbj|BAB28114.1|  unnamed protein product                                101   3e-35   
gb|KFM07186.1|  Guanine nucleotide-binding protein subunit beta-2...    102   3e-35   
gb|KFQ99079.1|  Guanine nucleotide-binding protein subunit beta-2...    102   3e-35   
gb|KGL84405.1|  Guanine nucleotide-binding protein subunit beta-2...    101   3e-35   
ref|XP_009576203.1|  PREDICTED: guanine nucleotide-binding protei...    102   3e-35   
gb|EFB24154.1|  hypothetical protein PANDA_021359                       102   3e-35   
ref|XP_006147504.1|  PREDICTED: guanine nucleotide-binding protei...    102   3e-35   
ref|XP_006631768.1|  PREDICTED: guanine nucleotide-binding protei...    101   3e-35   
gb|ABY75292.1|  putative guanine nucleotide binding protein beta ...    102   3e-35   
dbj|BAE39095.1|  unnamed protein product                                101   3e-35   
ref|XP_009329421.1|  PREDICTED: guanine nucleotide-binding protei...    101   3e-35   
gb|KFW72146.1|  Guanine nucleotide-binding protein subunit beta-2...    101   3e-35   
dbj|BAD96208.1|  guanine nucleotide binding protein (G protein), ...    102   3e-35   
ref|XP_009836542.1|  guanine nucleotide-binding protein subunit b...  98.2    3e-35   
gb|EDL33792.1|  guanine nucleotide binding protein (G protein), b...    101   3e-35   
gb|AAI50408.1|  Guanine nucleotide binding protein (G protein), b...    101   3e-35   
ref|XP_008630825.1|  PREDICTED: guanine nucleotide-binding protei...    101   3e-35   
ref|XP_007548404.1|  PREDICTED: guanine nucleotide-binding protei...    100   3e-35   
ref|XP_005989393.1|  PREDICTED: guanine nucleotide-binding protei...    102   3e-35   
ref|XP_009983622.1|  PREDICTED: guanine nucleotide-binding protei...    101   4e-35   
ref|NP_001004946.1|  guanine nucleotide binding protein (G protei...    101   4e-35   
gb|AAD42045.1|AF105259_1  activated protein kinase C receptor           101   4e-35   
gb|KFO58265.1|  Guanine nucleotide-binding protein subunit beta-2...    101   4e-35   
ref|NP_001086465.1|  uncharacterized protein LOC446289                  101   4e-35   
ref|XP_010391434.1|  PREDICTED: guanine nucleotide-binding protei...    101   4e-35   
ref|NP_001279416.1|  guanine nucleotide-binding protein subunit b...    100   4e-35   
ref|XP_009080129.1|  PREDICTED: guanine nucleotide-binding protei...    101   4e-35   
emb|CDH49812.1|  guanine nucleotide binding protein beta subunit        101   4e-35   
ref|XP_007899557.1|  PREDICTED: guanine nucleotide-binding protei...    100   5e-35   
ref|XP_003530054.1|  PREDICTED: guanine nucleotide-binding protei...    108   6e-35   
ref|XP_007229955.1|  PREDICTED: guanine nucleotide-binding protei...    100   6e-35   
gb|ADO27998.1|  guanine nucleotide-binding protein subunit beta-2...    101   6e-35   
ref|XP_007244608.1|  PREDICTED: guanine nucleotide-binding protei...    101   6e-35   
ref|NP_001187435.1|  guanine nucleotide-binding protein subunit b...    101   7e-35   
ref|XP_008282647.1|  PREDICTED: guanine nucleotide-binding protei...    100   7e-35   
ref|XP_009884754.1|  PREDICTED: guanine nucleotide-binding protei...    100   7e-35   
dbj|BAE35378.1|  unnamed protein product                                100   7e-35   
gb|ABX90099.1|  receptor for activated C kinase 1                       100   8e-35   
dbj|BAA06185.1|  G protein beta subuit like                             100   8e-35   
gb|KHN44614.1|  Guanine nucleotide-binding protein subunit beta-l...    108   9e-35   
gb|AAT35603.1|  receptor for activated protein kinase C               99.8    1e-34   
gb|ACQ83470.1|  receptor of activated protein kinase C                  101   1e-34   
ref|XP_572317.1|  cytoplasm protein                                   97.8    1e-34   
gb|KGQ02984.1|  Guanine nucleotide-binding protein subunit beta-l...  96.7    1e-34   
gb|AAF22119.1|AF124742_1  guanine nucleotide-binding protein          99.0    1e-34   
ref|XP_009665514.1|  PREDICTED: guanine nucleotide-binding protei...    101   1e-34   
gb|AEW43729.1|  activated protein kinase C receptor                     100   1e-34   
gb|ACV53651.1|  guanine nucleotide-binding protein beta polypepti...  99.4    1e-34   
gb|ACQ58047.1|  Guanine nucleotide-binding protein subunit beta-2...    100   1e-34   
gb|KDQ57687.1|  hypothetical protein JAAARDRAFT_35372                 98.2    2e-34   
emb|CAL48986.1|  Receptor of Activated Kinase C 1                     99.4    2e-34   
gb|KIW80333.1|  guanine nucleotide-binding protein subunit beta-l...  98.6    2e-34   
gb|KIW30011.1|  guanine nucleotide-binding protein subunit beta-l...  98.6    2e-34   
gb|KIW99040.1|  guanine nucleotide-binding protein subunit beta-l...  98.6    2e-34   
ref|XP_003197003.1|  G protein beta subunit-like protein Rkp1         97.1    2e-34   
emb|CCQ18636.1|  G protein beta subunit-like protein                  99.0    2e-34   
gb|ABI26262.1|  receptor for activated protein kinase c                 100   2e-34   
dbj|BAE93065.1|  guanine nucleotide binding protein beta polypept...  98.6    2e-34   
ref|XP_007408997.1|  hypothetical protein MELLADRAFT_116221           95.1    2e-34   
emb|CDH49357.1|  guanine nucleotide binding protein beta subunit      99.0    2e-34   
gb|AAX94566.1|  Gpa1 interacting G protein subunit                    97.4    2e-34   
gb|KIW62858.1|  guanine nucleotide-binding protein subunit beta-l...  98.2    2e-34   
ref|XP_007761319.1|  guanine nucleotide-binding protein subunit b...  98.2    2e-34   
gb|AAM88904.1|  guanine nucleotide-binding protein                    98.6    2e-34   
ref|XP_007642752.1|  PREDICTED: guanine nucleotide-binding protei...  98.6    3e-34   
emb|CDS03837.1|  Putative Guanine nucleotide-binding proteinFT su...  98.6    3e-34   
gb|EGV96576.1|  Guanine nucleotide-binding protein subunit beta-2...  98.2    3e-34   
gb|KHJ35931.1|  putative guanine nucleotide-binding protein subun...  99.0    3e-34   
gb|KIR44237.1|  guanine nucleotide-binding protein subunit beta-l...  96.7    3e-34   
emb|CDY21720.1|  BnaA09g44710D                                          132   3e-34   
gb|KIW10778.1|  guanine nucleotide-binding protein subunit beta-l...  97.4    3e-34   
emb|CCX15458.1|  Similar to Guanine nucleotide-binding protein su...  96.7    3e-34   
gb|EGU80238.1|  hypothetical protein FOXB_09165                       94.7    4e-34   
ref|XP_007739518.1|  guanine nucleotide-binding protein subunit b...  97.4    4e-34   
ref|XP_006898235.1|  PREDICTED: guanine nucleotide-binding protei...    100   4e-34   
ref|XP_009160336.1|  guanine nucleotide-binding protein subunit b...  97.1    4e-34   
gb|EEH07310.1|  G-protein comlpex beta subunit CpcB                   94.4    4e-34   
gb|AAS49532.1|  guanine nucleotide binding protein beta polypepti...  99.8    4e-34   
gb|EGC41401.1|  G-protein comlpex beta subunit CpcB                   94.4    5e-34   
ref|XP_007007889.1|  hypothetical protein TREMEDRAFT_45853            96.7    5e-34   
gb|KIW40911.1|  guanine nucleotide-binding protein subunit beta-l...  96.7    5e-34   
gb|KIV82161.1|  guanine nucleotide-binding protein subunit beta-l...  96.7    5e-34   
ref|XP_010780163.1|  PREDICTED: guanine nucleotide-binding protei...  98.2    6e-34   
ref|XP_002850965.1|  G-protein complex beta subunit CpcB              93.2    6e-34   
ref|XP_007730120.1|  guanine nucleotide-binding protein subunit b...  96.3    6e-34   
ref|XP_007723621.1|  guanine nucleotide-binding protein subunit b...  96.3    6e-34   
ref|XP_010480509.1|  PREDICTED: guanine nucleotide-binding protei...  89.4    7e-34   
ref|XP_003333548.2|  guanine nucleotide-binding protein subunit b...  95.5    7e-34   
gb|KIX03579.1|  guanine nucleotide-binding protein subunit beta-l...  96.3    7e-34   
ref|NP_001279371.1|  uncharacterized protein LOC103175775               100   7e-34   
ref|XP_007864562.1|  WD40 repeat-like protein                         96.3    7e-34   
gb|EIE76651.1|  guanine nucleotide-binding protein subunit beta-2...  98.6    9e-34   
gb|EIE91439.1|  guanine nucleotide-binding protein subunit beta-l...  98.6    9e-34   
ref|XP_002735015.1|  PREDICTED: guanine nucleotide-binding protei...    100   1e-33   
gb|AFK73701.1|  receptor of activated kinase C                        98.6    1e-33   
gb|ESZ90478.1|  g-protein beta subunit                                94.7    1e-33   
gb|KIW59315.1|  guanine nucleotide-binding protein subunit beta-l...  95.9    1e-33   
gb|KGB35723.1|  Guanine nucleotide-binding protein subunit beta-2...    102   1e-33   
ref|XP_002181732.1|  predicted protein                                97.1    1e-33   
ref|XP_006695086.1|  putative guanine nucleotide-binding protein      97.1    1e-33   
dbj|BAH56896.1|  AT1G18080                                              131   1e-33   
gb|KFH73669.1|  guanine nucleotide-binding protein subunit beta-l...  95.1    1e-33   
ref|XP_010124278.1|  PREDICTED: LOW QUALITY PROTEIN: guanine nucl...  96.3    1e-33   
ref|XP_008052288.1|  PREDICTED: LOW QUALITY PROTEIN: guanine nucl...    102   1e-33   
ref|NP_001274728.1|  guanine nucleotide-binding protein subunit b...  98.2    2e-33   
ref|XP_003014052.1|  vegetative incompatibility WD repeat protein...  93.2    2e-33   
gb|AAP40018.1|  activated protein kinase C                            97.1    2e-33   
ref|XP_003176836.1|  G-protein comlpex beta subunit CpcB              93.2    2e-33   
emb|CDO70596.1|  hypothetical protein BN946_scf184656.g11             94.4    2e-33   
gb|AAM88903.1|  guanine nucleotide-binding protein                    95.5    2e-33   
dbj|GAE00026.1|  hypothetical protein PVAR5_8757                      94.7    2e-33   
ref|XP_006665983.1|  guanine nucleotide-binding protein beta subu...  95.9    2e-33   
gb|ACJ06767.1|  receptor for activated C-kinase                       99.4    2e-33   
ref|XP_010733915.1|  PREDICTED: guanine nucleotide-binding protei...  97.4    2e-33   
ref|XP_007397219.1|  hypothetical protein PHACADRAFT_258442           94.4    2e-33   
gb|AAM88905.1|  guanine nucleotide-binding protein                    97.4    2e-33   
gb|AAS59422.1|  G-protein beta subunit like-protein                   96.7    2e-33   
ref|XP_003970442.1|  PREDICTED: guanine nucleotide-binding protei...  96.3    3e-33   
ref|XP_008082093.1|  WD40 repeat-like protein                         94.0    3e-33   
emb|CDX96736.1|  BnaA08g22790D                                          130   3e-33   
ref|XP_008034536.1|  guanine nucleotide binding protein beta subunit  94.4    3e-33   
ref|XP_001551314.1|  guanine nucleotide-binding protein beta subunit  94.0    3e-33   
ref|XP_011445926.1|  PREDICTED: guanine nucleotide-binding protei...  98.6    3e-33   
ref|XP_661767.1|  GBLP_NEUCR Guanine nucleotide-binding protein b...  93.2    3e-33   
ref|XP_008600266.1|  WD domain-containing protein                     95.5    3e-33   
gb|AGN75114.1|  receptor for activated C kinase 1                     98.6    3e-33   
gb|ERS97367.1|  guanine nucleotide-binding protein subunit beta-l...  93.6    3e-33   
gb|EWC48866.1|  guanine nucleotide-binding protein subunit beta-l...  94.0    3e-33   
gb|KIH90457.1|  guanine nucleotide-binding protein subunit beta-2...  93.6    4e-33   
ref|XP_001537609.1|  hypothetical protein HCAG_07031                  94.0    4e-33   
ref|XP_005703361.1|  hypothetical protein Gasu_55280                  93.6    4e-33   
gb|ACU33969.1|  receptor of activated kinase C                        98.6    4e-33   
ref|XP_007799385.1|  putative guanine nucleotide-binding protein ...  93.2    4e-33   
gb|KEF54434.1|  guanine nucleotide-binding protein subunit beta-l...  93.6    4e-33   
ref|XP_001903663.1|  hypothetical protein                             95.1    4e-33   
ref|XP_002481861.1|  G-protein complex beta subunit CpcB              93.6    4e-33   
ref|XP_001226350.1|  guanine nucleotide-binding protein beta subu...  94.7    5e-33   
ref|XP_007362000.1|  guanine nucleotide binding protein beta subunit  92.8    5e-33   
gb|KIO09923.1|  hypothetical protein M404DRAFT_995909                 92.8    5e-33   
ref|XP_003664641.1|  hypothetical protein MYCTH_2307651               94.7    5e-33   
dbj|BAK03551.1|  predicted protein                                    93.6    5e-33   
ref|XP_002838384.1|  hypothetical protein                             92.8    5e-33   
ref|XP_002791085.1|  G-protein comlpex beta subunit CpcB              93.2    5e-33   
gb|KFY27537.1|  hypothetical protein V493_03433                       92.8    5e-33   
ref|XP_002147691.1|  G-protein comlpex beta subunit CpcB              93.6    5e-33   
ref|XP_001272169.1|  G-protein comlpex beta subunit CpcB              94.0    5e-33   
ref|XP_010756949.1|  guanine nucleotide-binding protein subunit b...  93.2    5e-33   
gb|ABA33785.1|  RACK1-like protein                                    93.2    5e-33   
ref|XP_003651077.1|  hypothetical protein THITE_2169762               94.4    6e-33   
ref|XP_007292588.1|  putative Guanine nucleotide-binding protein ...  92.8    6e-33   
ref|XP_008873892.1|  guanine nucleotide-binding protein subunit b...  92.8    6e-33   
gb|EPZ34131.1|  Guanine nucleotide-binding protein subunit beta-2...  94.7    6e-33   
gb|AEE61583.1|  unknown                                               92.8    6e-33   
ref|XP_007308233.1|  guanine nucleotide binding protein beta subunit  93.2    6e-33   
gb|ABS18779.1|  putative WD40 protein                                 93.6    6e-33   
gb|KIV92993.1|  guanine nucleotide-binding protein subunit beta-l...  93.2    6e-33   
gb|KIJ49590.1|  hypothetical protein M422DRAFT_205027                 94.7    7e-33   
emb|CAG01204.1|  unnamed protein product                              96.7    7e-33   
ref|XP_003051079.1|  predicted protein                                94.4    7e-33   
ref|XP_751514.1|  G-protein complex beta subunit CpcB                 93.2    7e-33   
gb|KIN05611.1|  hypothetical protein OIDMADRAFT_153920                94.0    7e-33   
dbj|GAC98631.1|  hypothetical protein PHSY_006225                     91.3    8e-33   
ref|XP_007800891.1|  Guanine nucleotide-binding protein subunit b...  94.4    8e-33   
gb|EMD37863.1|  guanine nucleotide binding protein beta subunit       92.4    8e-33   
emb|CCM01124.1|  predicted protein                                    92.8    8e-33   
ref|XP_001266728.1|  G-protein comlpex beta subunit CpcB              93.2    8e-33   
emb|CEF67486.1|  Guanine nucleotide-binding protein subunit beta-...  99.4    8e-33   
ref|XP_001212378.1|  hypothetical protein ATEG_03200                  93.6    8e-33   
emb|CDY60778.1|  BnaC05g50130D                                          129   8e-33   
ref|XP_001816748.1|  guanine nucleotide-binding protein subunit b...  93.2    9e-33   
emb|CDY26186.1|  BnaA06g12310D                                          129   9e-33   
gb|KIK28004.1|  hypothetical protein PISMIDRAFT_148977                92.0    9e-33   
gb|KII92153.1|  hypothetical protein PLICRDRAFT_104409                92.0    9e-33   
gb|KFY70489.1|  hypothetical protein V499_09126                       91.7    9e-33   
gb|KFU89350.1|  Guanine nucleotide-binding protein subunit beta-2...  93.6    9e-33   
ref|XP_001239490.1|  hypothetical protein CIMG_09111                  91.7    1e-32   
gb|KIP05099.1|  hypothetical protein PHLGIDRAFT_74762                 92.4    1e-32   
gb|AAL84173.1|AF422164_1  receptor for activated PKC                  99.0    1e-32   
ref|XP_011126276.1|  hypothetical protein AOL_s00173g232              94.0    1e-32   
emb|CAZ37255.1|  receptor for activated PKC, putative                 99.0    1e-32   
ref|XP_010020213.1|  PREDICTED: guanine nucleotide-binding protei...  93.2    1e-32   
gb|EYE92822.1|  GBLP_NEUCR guanine nucleotide-binding protein bet...  92.8    1e-32   
gb|KFY55396.1|  hypothetical protein V496_07016                       91.7    1e-32   
ref|XP_002564357.1|  Pc22g03140                                       92.4    1e-32   
emb|CDM37037.1|  Guanine nucleotide-binding protein subunit beta-...  92.4    1e-32   
emb|CAZ37256.1|  receptor for activated PKC, putative                 98.6    1e-32   
gb|ELR02852.1|  guanine nucleotide-binding protein subunit beta-l...  91.3    1e-32   
ref|XP_007873857.1|  hypothetical protein PNEG_01883                  95.5    1e-32   
gb|EPT05016.1|  hypothetical protein FOMPIDRAFT_1045684               91.7    1e-32   
emb|CCJ31305.1|  unnamed protein product                              92.0    2e-32   
emb|CEG70023.1|  Putative Guanine nucleotide-binding protein subu...  97.4    2e-32   
gb|KFY13649.1|  hypothetical protein V492_03124                       91.3    2e-32   
gb|KFZ02418.1|  hypothetical protein V501_09567                       90.9    2e-32   
gb|KIL96127.1|  guanine nucleotide-binding protein subunit beta-l...  92.8    2e-32   
ref|XP_009547379.1|  hypothetical protein HETIRDRAFT_418643           91.3    2e-32   
gb|KIV99542.1|  guanine nucleotide-binding protein subunit beta-l...  92.0    2e-32   
ref|XP_011112534.1|  hypothetical protein H072_6755                   94.7    2e-32   
ref|XP_007877264.1|  hypothetical protein PFL1_01563                  90.1    2e-32   
ref|XP_009261603.1|  FGB1                                             92.8    2e-32   
gb|KEQ62286.1|  WD40 repeat-like protein                              90.9    2e-32   
gb|KEI37942.1|  hypothetical protein L969DRAFT_89179                  92.0    2e-32   
gb|AAY66933.1|  guanine nucleotide-binding protein                    98.6    2e-32   
ref|XP_008718711.1|  guanine nucleotide-binding protein subunit b...  92.8    2e-32   
emb|CEJ02996.1|  Putative Guanine nucleotide-binding protein subu...  97.1    2e-32   
emb|CEG70024.1|  Putative Guanine nucleotide-binding protein subu...  97.1    2e-32   
gb|KFX99177.1|  hypothetical protein O988_04003                       90.5    2e-32   
emb|CDX81860.1|  BnaC08g37410D                                          128   2e-32   
gb|KDB16187.1|  G-protein beta subunit                                92.4    2e-32   
gb|EMS22902.1|  G-protein complex beta subunit                        89.7    2e-32   
ref|XP_008494697.1|  PREDICTED: guanine nucleotide-binding protei...  92.0    2e-32   
ref|XP_960070.1|  guanine nucleotide-binding protein subunit beta...  94.4    2e-32   
emb|CEG77190.1|  Putative Guanine nucleotide-binding protein subu...  97.4    2e-32   
sp|Q01369.1|GBLP_NEUCR  RecName: Full=Guanine nucleotide-binding ...  94.4    2e-32   
gb|KDQ21830.1|  hypothetical protein BOTBODRAFT_123721                92.8    2e-32   
ref|XP_006958593.1|  WD40 repeat-like protein                         90.5    2e-32   
gb|EPS33376.1|  hypothetical protein PDE_08338                        91.7    2e-32   
ref|XP_001631784.1|  predicted protein                                97.8    2e-32   
ref|XP_006962578.1|  cross-pathway control WD-repeat-containing p...  92.4    2e-32   



>emb|CDO98381.1| unnamed protein product [Coffea canephora]
Length=1395

 Score =   176 bits (445),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 89/96 (93%), Gaps = 3/96 (3%)
 Frame = -1

Query  456   GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEG---NNTAA  286
             GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEM+AEG     T A
Sbjct  1300  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMAAEGTTVQTTGA  1359

Query  285   KNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
             KNK+I+CTSL+W+ADGSTLFSGYTDGVIRVWGI RY
Sbjct  1360  KNKVIYCTSLNWSADGSTLFSGYTDGVIRVWGIMRY  1395


 Score = 93.2 bits (230),  Expect(2) = 3e-63, Method: Composition-based stats.
 Identities = 42/43 (98%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = -3

Query  583   HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
             HTGYVNT AVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG
Sbjct  1258  HTGYVNTAAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  1300



>ref|XP_009611065.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Nicotiana tomentosiformis]
Length=325

 Score =   171 bits (432),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 83/93 (89%), Positives = 87/93 (94%), Gaps = 1/93 (1%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            GSIIH LCFSPNRYWLCAATE+SIKIWDLESKSIVVDLRVDLKQESEMSAEG   AAKNK
Sbjct  234  GSIIHTLCFSPNRYWLCAATESSIKIWDLESKSIVVDLRVDLKQESEMSAEG-TAAAKNK  292

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            II+CT LSW+ADGSTLF GYTDG+IRVWGIGRY
Sbjct  293  IIYCTCLSWSADGSTLFGGYTDGLIRVWGIGRY  325


 Score = 87.4 bits (215),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 42/43 (98%), Positives = 43/43 (100%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H+GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG
Sbjct  192  HSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  234



>ref|XP_009780116.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Nicotiana sylvestris]
Length=325

 Score =   170 bits (430),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 88/93 (95%), Gaps = 1/93 (1%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            GSIIH+LCFSPNRYWLCAATE+SIKIWDLESKSIVVDL+VDLKQESEMSAEG   AAKNK
Sbjct  234  GSIIHSLCFSPNRYWLCAATESSIKIWDLESKSIVVDLKVDLKQESEMSAEG-TAAAKNK  292

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            II+CT LSW+ADGSTLF GYTDG+IRVWGIGRY
Sbjct  293  IIYCTCLSWSADGSTLFGGYTDGLIRVWGIGRY  325


 Score = 86.3 bits (212),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 41/43 (95%), Positives = 43/43 (100%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H+GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AG
Sbjct  192  HSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAG  234



>ref|XP_006341557.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein-like [Solanum tuberosum]
Length=327

 Score =   168 bits (426),  Expect(2) = 8e-59, Method: Compositional matrix adjust.
 Identities = 78/92 (85%), Positives = 86/92 (93%), Gaps = 0/92 (0%)
 Frame = -1

Query  453  SIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKI  274
            SIIH LCFSPNRYWLCAATE+SIKIWDLESK+IVVDLRVDLK ESEM+A  + TA KNK+
Sbjct  236  SIIHTLCFSPNRYWLCAATESSIKIWDLESKTIVVDLRVDLKHESEMAANESGTAPKNKV  295

Query  273  IFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            I+CTSLSW+ADGSTLFSGYTDG+IRVWGIGRY
Sbjct  296  IYCTSLSWSADGSTLFSGYTDGLIRVWGIGRY  327


 Score = 85.9 bits (211),  Expect(2) = 8e-59, Method: Compositional matrix adjust.
 Identities = 41/42 (98%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDA  458
            H+GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDA
Sbjct  193  HSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDA  234



>emb|CAA96528.1| G protein beta-subunit-like protein [Nicotiana plumbaginifolia]
Length=328

 Score =   167 bits (424),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 87/94 (93%), Gaps = 1/94 (1%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNN-TAAKN  280
            GSIIHALCFSPNRYWLCAATE SIKIWDLESKSIVVDL+VDLKQESEM+ EG   +A KN
Sbjct  235  GSIIHALCFSPNRYWLCAATETSIKIWDLESKSIVVDLKVDLKQESEMATEGTTGSACKN  294

Query  279  KIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            KI++CT LSW+ADGSTLFSGYTDG+IRVWGIGRY
Sbjct  295  KIMYCTCLSWSADGSTLFSGYTDGLIRVWGIGRY  328


 Score = 85.5 bits (210),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 41/43 (95%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H GYVNTVAVSPDGSLCASGGKDG ILLWDLAEGKKLYSLDAG
Sbjct  193  HAGYVNTVAVSPDGSLCASGGKDGTILLWDLAEGKKLYSLDAG  235



>ref|XP_009776114.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Nicotiana sylvestris]
Length=328

 Score =   167 bits (424),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 87/94 (93%), Gaps = 1/94 (1%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNN-TAAKN  280
            GSIIHALCFSPNRYWLCAATE SIKIWDLESKSIVVDL+VDLKQESEM+ EG   +A KN
Sbjct  235  GSIIHALCFSPNRYWLCAATETSIKIWDLESKSIVVDLKVDLKQESEMATEGTTGSACKN  294

Query  279  KIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            KI++CT LSW+ADGSTLFSGYTDG+IRVWGIGRY
Sbjct  295  KIMYCTCLSWSADGSTLFSGYTDGLIRVWGIGRY  328


 Score = 85.5 bits (210),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 41/43 (95%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H GYVNTVAVSPDGSLCASGGKDG ILLWDLAEGKKLYSLDAG
Sbjct  193  HAGYVNTVAVSPDGSLCASGGKDGTILLWDLAEGKKLYSLDAG  235



>ref|XP_004252270.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein isoform X1 [Solanum lycopersicum]
Length=329

 Score =   166 bits (421),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 79/95 (83%), Positives = 88/95 (93%), Gaps = 2/95 (2%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTA--AK  283
            GSIIHALCFSPNRYWLCAATE+SIKIWDLESKSIVVDLRVDLKQE+EMS    +T+  +K
Sbjct  235  GSIIHALCFSPNRYWLCAATESSIKIWDLESKSIVVDLRVDLKQETEMSGNATSTSGNSK  294

Query  282  NKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
             K+I+CTSLSW+ADGSTLFSGYTDG+IRVWGIGRY
Sbjct  295  TKVIYCTSLSWSADGSTLFSGYTDGLIRVWGIGRY  329


 Score = 86.7 bits (213),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 41/43 (95%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGYVNT AVSPDGSLCASGGKDGVILLWDLAEGKKLYSLD+G
Sbjct  193  HTGYVNTAAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDSG  235



>gb|EYU17645.1| hypothetical protein MIMGU_mgv1a009858mg [Erythranthe guttata]
Length=329

 Score =   167 bits (422),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 78/95 (82%), Positives = 88/95 (93%), Gaps = 2/95 (2%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGN--NTAAK  283
            GSI+HA+CFSPNRYWLCAATEA IKIWDLESKS+VVDL+VDLKQESEM +EGN    A+K
Sbjct  235  GSIVHAVCFSPNRYWLCAATEAGIKIWDLESKSVVVDLKVDLKQESEMISEGNGQTAASK  294

Query  282  NKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            NKII+CT L+W+ADGSTLFSGYTDGV+RVWGIGRY
Sbjct  295  NKIIYCTCLNWSADGSTLFSGYTDGVVRVWGIGRY  329


 Score = 86.3 bits (212),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 41/43 (95%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H+GYVNTVAVSPDGSLCASGGKDG ILLWDLAEGKKLYSLDAG
Sbjct  193  HSGYVNTVAVSPDGSLCASGGKDGFILLWDLAEGKKLYSLDAG  235



>gb|EYU40229.1| hypothetical protein MIMGU_mgv1a008949mg [Erythranthe guttata]
Length=357

 Score =   167 bits (423),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 79/95 (83%), Positives = 89/95 (94%), Gaps = 2/95 (2%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEG--NNTAAK  283
            GSII+ALCFSPNRYWLCAATEASIKIWDLESKS+VVDL+VDLK ESE++ EG   + AAK
Sbjct  263  GSIINALCFSPNRYWLCAATEASIKIWDLESKSVVVDLKVDLKHESEIAPEGATQSAAAK  322

Query  282  NKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            NK+I+CTSLSW+ADGSTLFSGYTDGV+RVWGIGRY
Sbjct  323  NKVIYCTSLSWSADGSTLFSGYTDGVVRVWGIGRY  357


 Score = 85.5 bits (210),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 45/50 (90%), Gaps = 2/50 (4%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG--VNHSC  440
            H+GYVNT AVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAG  +N  C
Sbjct  221  HSGYVNTSAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAGSIINALC  270



>gb|AJE63428.1| transcription factor ArcA1 [Capsicum annuum]
Length=330

 Score =   164 bits (414),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 79/96 (82%), Positives = 85/96 (89%), Gaps = 3/96 (3%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSA---EGNNTAA  286
            GSIIH LCFSPNRYWLCAATE+SIKIWDLESKSIVVDLRVDLKQESEM A   +G     
Sbjct  235  GSIIHTLCFSPNRYWLCAATESSIKIWDLESKSIVVDLRVDLKQESEMLAATPDGGAAPV  294

Query  285  KNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            KNKII+CTSLSW+ADGSTL+ GYTDG+IRVWGIGRY
Sbjct  295  KNKIIYCTSLSWSADGSTLYRGYTDGLIRVWGIGRY  330


 Score = 89.0 bits (219),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 43/43 (100%), Positives = 43/43 (100%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG
Sbjct  193  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  235



>ref|NP_001233881.1| ArcA2 protein [Solanum lycopersicum]
 dbj|BAA76896.1| LeArcA2 protein [Solanum lycopersicum]
Length=326

 Score =   164 bits (415),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 78/93 (84%), Positives = 86/93 (92%), Gaps = 1/93 (1%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            GSIIH LCFSPNRYWLCAATE+SIKIWDLESKSIVVDL+VDLK ESEM+ E + TA K K
Sbjct  235  GSIIHTLCFSPNRYWLCAATESSIKIWDLESKSIVVDLKVDLKHESEMANE-SGTAPKTK  293

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            +I+CTSLSW+ADGSTLFSGYTDG+IRVWGIGRY
Sbjct  294  VIYCTSLSWSADGSTLFSGYTDGLIRVWGIGRY  326


 Score = 87.8 bits (216),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 42/43 (98%), Positives = 43/43 (100%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H+GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG
Sbjct  193  HSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  235



>ref|XP_009600162.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Nicotiana tomentosiformis]
Length=328

 Score =   167 bits (422),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 79/94 (84%), Positives = 87/94 (93%), Gaps = 1/94 (1%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNN-TAAKN  280
            GSIIHALCFSPNRYWLCAATE SIKIWDLESKS+VVDL+VDLKQESEM+ EG   +A KN
Sbjct  235  GSIIHALCFSPNRYWLCAATETSIKIWDLESKSVVVDLKVDLKQESEMATEGTTGSACKN  294

Query  279  KIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            KI++CT LSW+ADGSTLFSGYTDG+IRVWGIGRY
Sbjct  295  KIMYCTCLSWSADGSTLFSGYTDGLIRVWGIGRY  328


 Score = 84.3 bits (207),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 41/43 (95%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H GYVNTVAVSPDGSLCASGGKDG ILLWDLAEGKKLYSLDAG
Sbjct  193  HGGYVNTVAVSPDGSLCASGGKDGTILLWDLAEGKKLYSLDAG  235



>ref|XP_009624187.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Nicotiana tomentosiformis]
Length=326

 Score =   166 bits (421),  Expect(2) = 6e-58, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 88/93 (95%), Gaps = 1/93 (1%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            GSIIH+LCFSPNRYWLCAATE+SIKIWDLESKSIV DL+VDLKQESEMS+EG   + KNK
Sbjct  235  GSIIHSLCFSPNRYWLCAATESSIKIWDLESKSIVDDLKVDLKQESEMSSEG-TASGKNK  293

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            +I+CTSLSW+ADGSTLFSGYTDG+IRVWGIGRY
Sbjct  294  VIYCTSLSWSADGSTLFSGYTDGLIRVWGIGRY  326


 Score = 84.7 bits (208),  Expect(2) = 6e-58, Method: Compositional matrix adjust.
 Identities = 40/43 (93%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGYVNT AVSPDGSLCASGGKDGVILLWDLAEGKKLYSL++G
Sbjct  193  HTGYVNTAAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLESG  235



>gb|ABB86277.1| ArcA2 protein-like [Solanum tuberosum]
Length=327

 Score =   165 bits (418),  Expect(2) = 6e-58, Method: Compositional matrix adjust.
 Identities = 77/92 (84%), Positives = 85/92 (92%), Gaps = 0/92 (0%)
 Frame = -1

Query  453  SIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKI  274
            SIIH LCFSPNRYWLCAATE+SIKIWDLESK+IVVDLRVDLKQESEM+A  + T  KNK+
Sbjct  236  SIIHTLCFSPNRYWLCAATESSIKIWDLESKTIVVDLRVDLKQESEMAATESGTGPKNKV  295

Query  273  IFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            I+CTSLSW+ADGSTL SGYTDG+IRVWGIGRY
Sbjct  296  IYCTSLSWSADGSTLSSGYTDGLIRVWGIGRY  327


 Score = 85.9 bits (211),  Expect(2) = 6e-58, Method: Compositional matrix adjust.
 Identities = 41/42 (98%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDA  458
            H+GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDA
Sbjct  193  HSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDA  234



>ref|XP_006353816.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein-like [Solanum tuberosum]
Length=329

 Score =   166 bits (421),  Expect(2) = 7e-58, Method: Compositional matrix adjust.
 Identities = 79/95 (83%), Positives = 88/95 (93%), Gaps = 2/95 (2%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTA--AK  283
            GSIIHALCFSPNRYWLCAATE+SIKIWDLESKSIVVDLRVDLKQE+EMS    +T+  +K
Sbjct  235  GSIIHALCFSPNRYWLCAATESSIKIWDLESKSIVVDLRVDLKQETEMSGNATSTSGNSK  294

Query  282  NKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
             K+I+CTSLSW+ADGSTLFSGYTDG+IRVWGIGRY
Sbjct  295  TKVIYCTSLSWSADGSTLFSGYTDGLIRVWGIGRY  329


 Score = 84.7 bits (208),  Expect(2) = 7e-58, Method: Compositional matrix adjust.
 Identities = 40/43 (93%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H GYVNT AVSPDGSLCASGGKDGVILLWDLAEGKKLYSLD+G
Sbjct  193  HAGYVNTAAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDSG  235



>gb|ABB02625.1| G protein beta subunit-like protein [Solanum tuberosum]
Length=261

 Score =   164 bits (416),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 79/95 (83%), Positives = 87/95 (92%), Gaps = 2/95 (2%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTA--AK  283
            GSIIHALCFSPNRYWLCAATE+SIKIWDLESKSIVVDLRVDLKQE+EM     +T+  AK
Sbjct  167  GSIIHALCFSPNRYWLCAATESSIKIWDLESKSIVVDLRVDLKQETEMFGNATSTSGNAK  226

Query  282  NKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
             K+I+CTSLSW+ADGSTLFSGYTDG+IRVWGIGRY
Sbjct  227  TKVIYCTSLSWSADGSTLFSGYTDGLIRVWGIGRY  261


 Score = 85.9 bits (211),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 41/43 (95%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGYVNT AVSPDGSLCASGGKDGVILLWDLAEGKKLYSLD+G
Sbjct  125  HTGYVNTAAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDSG  167



>ref|XP_009778426.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Nicotiana sylvestris]
Length=326

 Score =   165 bits (418),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 78/93 (84%), Positives = 87/93 (94%), Gaps = 1/93 (1%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            GSIIH+LCFSPNRYWLCAATE+SIKIWDLESK+IV DL+VDLKQESEMSAEG   + KNK
Sbjct  235  GSIIHSLCFSPNRYWLCAATESSIKIWDLESKTIVDDLKVDLKQESEMSAEG-TASGKNK  293

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            +I+CTSL W+ADGSTLFSGYTDG+IRVWGIGRY
Sbjct  294  VIYCTSLGWSADGSTLFSGYTDGLIRVWGIGRY  326


 Score = 85.1 bits (209),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 40/43 (93%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGYVNT AVSPDGSLCASGGKDGVILLWDLAEGKKLYSL++G
Sbjct  193  HTGYVNTTAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLESG  235



>ref|XP_011072970.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Sesamum indicum]
Length=329

 Score =   162 bits (410),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 75/95 (79%), Positives = 87/95 (92%), Gaps = 2/95 (2%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNN--TAAK  283
            GSIIHALCFSPNRYWLCAATEASIKIWDLESKS+VVDL+VDLKQES+++ +G +   A K
Sbjct  235  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSVVVDLKVDLKQESDLAKDGTDQTAAVK  294

Query  282  NKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
             K+I+CT L+W+ADGSTLFSGYTDGV+RVWGIGRY
Sbjct  295  TKVIYCTCLNWSADGSTLFSGYTDGVVRVWGIGRY  329


 Score = 87.4 bits (215),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 41/43 (95%), Positives = 43/43 (100%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H+GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAG
Sbjct  193  HSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAG  235



>sp|P93340.1|GBLP_NICPL RecName: Full=Guanine nucleotide-binding protein subunit beta-like 
protein [Nicotiana plumbaginifolia]
 emb|CAA70705.1| G protein beta subunit [Nicotiana plumbaginifolia]
Length=326

 Score =   164 bits (414),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 87/93 (94%), Gaps = 1/93 (1%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            GSIIH+LCFSPNRYWLCAATE+SIKIWDLESK+IV DL+VDLKQESEMSAEG   + KNK
Sbjct  235  GSIIHSLCFSPNRYWLCAATESSIKIWDLESKTIVDDLKVDLKQESEMSAEG-TASGKNK  293

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            +I+CTSL W+ADGSTLFSGYTDG+IRVWGIGR+
Sbjct  294  VIYCTSLGWSADGSTLFSGYTDGLIRVWGIGRF  326


 Score = 84.7 bits (208),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 40/43 (93%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGYVNT AVSPDGSLCASGGKDGVILLWDLAEGKKLYSL++G
Sbjct  193  HTGYVNTTAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLESG  235



>sp|P49026.1|GBLP_TOBAC RecName: Full=Guanine nucleotide-binding protein subunit beta-like 
protein [Nicotiana tabacum]
 dbj|BAA04478.1| G protein beta subunit-like protein [Nicotiana tabacum]
Length=326

 Score =   164 bits (414),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 78/93 (84%), Positives = 87/93 (94%), Gaps = 1/93 (1%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            GSIIH+LCFSPNRYWLCAATE+SIKIWDLESKSIV DL+VDLKQESEMS+EG   + KNK
Sbjct  235  GSIIHSLCFSPNRYWLCAATESSIKIWDLESKSIVDDLKVDLKQESEMSSEG-TASGKNK  293

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            +I+CTSLSW+ADGSTLFSGYTDG+IRVWGI RY
Sbjct  294  VIYCTSLSWSADGSTLFSGYTDGLIRVWGIDRY  326


 Score = 84.3 bits (207),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 40/43 (93%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGYVNT AVSPDGSLCASGGKDGVILLWDLAEGKKLYSL++G
Sbjct  193  HTGYVNTPAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLESG  235



>gb|ACR77528.1| heterotrimeric G protein beta 1 subunit [Nicotiana benthamiana]
Length=326

 Score =   164 bits (415),  Expect(2) = 7e-57, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 87/93 (94%), Gaps = 1/93 (1%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            GSIIH+LCFSPNRYWLCAATE+SIKIWDLESK+IV DL+VDLKQE+EMSAEG   + KNK
Sbjct  235  GSIIHSLCFSPNRYWLCAATESSIKIWDLESKTIVDDLKVDLKQETEMSAEG-TASGKNK  293

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            +I+CTSL W+ADGSTLFSGYTDG+IRVWGIGRY
Sbjct  294  VIYCTSLGWSADGSTLFSGYTDGLIRVWGIGRY  326


 Score = 83.6 bits (205),  Expect(2) = 7e-57, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGYVNT AVSP+GSLCASGGKDGVILLWDLAEGKKLYSL++G
Sbjct  193  HTGYVNTTAVSPEGSLCASGGKDGVILLWDLAEGKKLYSLESG  235



>ref|XP_006365404.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein-like [Solanum tuberosum]
Length=326

 Score =   159 bits (403),  Expect(2) = 8e-57, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 84/93 (90%), Gaps = 1/93 (1%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            GSIIH LCFSPNRYWLCAATE+SIKIWDLESKS+VVDL+VDLKQESEM      T +K K
Sbjct  235  GSIIHTLCFSPNRYWLCAATESSIKIWDLESKSVVVDLKVDLKQESEMFGTA-ATDSKTK  293

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            +I+CTSLSW+ADGSTLFSGYTDG+IRVWGIGRY
Sbjct  294  VIYCTSLSWSADGSTLFSGYTDGLIRVWGIGRY  326


 Score = 87.8 bits (216),  Expect(2) = 8e-57, Method: Compositional matrix adjust.
 Identities = 42/43 (98%), Positives = 43/43 (100%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H+GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG
Sbjct  193  HSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  235



>gb|EPS70887.1| hypothetical protein M569_03871 [Genlisea aurea]
Length=326

 Score =   165 bits (418),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 78/93 (84%), Positives = 87/93 (94%), Gaps = 1/93 (1%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            GSI HALCFSPNRYWLCAATEASIKIWDLESKS+VVDL+VDLKQESE++AE    + K+K
Sbjct  235  GSITHALCFSPNRYWLCAATEASIKIWDLESKSVVVDLKVDLKQESELAAE-ETASRKHK  293

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            +IFCTSL+W+ADGSTLFSGYTDGVIRVWGIGRY
Sbjct  294  VIFCTSLNWSADGSTLFSGYTDGVIRVWGIGRY  326


 Score = 82.0 bits (201),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 37/43 (86%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGYVN V+VSPDGSLCAS G+DGVILLWDLAEGK+LYSL+AG
Sbjct  193  HTGYVNAVSVSPDGSLCASAGRDGVILLWDLAEGKRLYSLEAG  235



>ref|NP_001233876.1| ArcA1 protein [Solanum lycopersicum]
 dbj|BAA76895.1| LeArcA1 protein [Solanum lycopersicum]
Length=326

 Score =   159 bits (401),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 83/93 (89%), Gaps = 1/93 (1%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            GSIIH  CFSPNRYWLCAATE+SIKIWDLESKSIVVDL+VDLKQESEM      T +K K
Sbjct  235  GSIIHTFCFSPNRYWLCAATESSIKIWDLESKSIVVDLKVDLKQESEMFGTA-ATDSKTK  293

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            +I+CTSLSW+ADGSTLFSGYTDG+IRVWGIGRY
Sbjct  294  VIYCTSLSWSADGSTLFSGYTDGLIRVWGIGRY  326


 Score = 88.2 bits (217),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 42/43 (98%), Positives = 43/43 (100%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H+GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG
Sbjct  193  HSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  235



>gb|KJB37175.1| hypothetical protein B456_006G192600 [Gossypium raimondii]
Length=327

 Score =   156 bits (395),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 74/93 (80%), Positives = 84/93 (90%), Gaps = 1/93 (1%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G++IH+LCFSPNRYWLCAATE SIKIWDLESKSIV DL+VDLK E+E SA  +N A K K
Sbjct  236  GAVIHSLCFSPNRYWLCAATEQSIKIWDLESKSIVEDLKVDLKAEAETSAATDN-ANKKK  294

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            +I+CTSL+W+ADGSTLFSGYTDGVIRVWGIGRY
Sbjct  295  VIYCTSLNWSADGSTLFSGYTDGVIRVWGIGRY  327


 Score = 88.6 bits (218),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 45/48 (94%), Positives = 46/48 (96%), Gaps = 1/48 (2%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG-VNHS  443
            HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AG V HS
Sbjct  194  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGAVIHS  241



>gb|KHG00880.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Gossypium arboreum]
Length=327

 Score =   156 bits (394),  Expect(2) = 6e-56, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 84/93 (90%), Gaps = 1/93 (1%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G++IH+LCFSPNRYWLCAATE SIKIWDLESKS+V DL+VDLK E+E SA  +N A K K
Sbjct  236  GAVIHSLCFSPNRYWLCAATEQSIKIWDLESKSVVEDLKVDLKAEAETSAATDN-ANKKK  294

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            +I+CTSL+W+ADGSTLFSGYTDGVIRVWGIGRY
Sbjct  295  VIYCTSLNWSADGSTLFSGYTDGVIRVWGIGRY  327


 Score = 88.6 bits (218),  Expect(2) = 6e-56, Method: Compositional matrix adjust.
 Identities = 45/48 (94%), Positives = 46/48 (96%), Gaps = 1/48 (2%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG-VNHS  443
            HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AG V HS
Sbjct  194  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGAVIHS  241



>ref|XP_003631071.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Medicago truncatula]
 gb|AET05547.1| guanine nucleotide-binding protein beta subunit-like protein 
[Medicago truncatula]
Length=325

 Score =   156 bits (395),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 74/93 (80%), Positives = 85/93 (91%), Gaps = 1/93 (1%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            GSIIHALCFSPNRYWLCAATE+SIKIWDLESKSIV DL+VDLK E++ +A G +T  K K
Sbjct  234  GSIIHALCFSPNRYWLCAATESSIKIWDLESKSIVEDLKVDLKTEAD-AAIGGDTTTKKK  292

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            +I+CTSL+W+ADGSTLFSGYTDGV+RVWGIGRY
Sbjct  293  VIYCTSLNWSADGSTLFSGYTDGVVRVWGIGRY  325


 Score = 87.0 bits (214),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 41/43 (95%), Positives = 43/43 (100%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H+GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAG
Sbjct  192  HSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAG  234



>sp|O24076.1|GBLP_MEDSA RecName: Full=Guanine nucleotide-binding protein subunit beta-like 
protein [Medicago sativa]
 emb|CAA69934.1| G protein beta subunit-like [Medicago sativa subsp. x varia]
Length=325

 Score =   157 bits (396),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 74/93 (80%), Positives = 85/93 (91%), Gaps = 1/93 (1%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            GSIIHALCFSPNRYWLCAATE+SIKIWDLESKSIV DL+VDLK E++ +A G +T  K K
Sbjct  234  GSIIHALCFSPNRYWLCAATESSIKIWDLESKSIVEDLKVDLKTEAD-AAIGGDTTTKKK  292

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            +I+CTSL+W+ADGSTLFSGYTDGV+RVWGIGRY
Sbjct  293  VIYCTSLNWSADGSTLFSGYTDGVVRVWGIGRY  325


 Score = 87.0 bits (214),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 41/43 (95%), Positives = 43/43 (100%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H+GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAG
Sbjct  192  HSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAG  234



>gb|KJB53022.1| hypothetical protein B456_008G288800 [Gossypium raimondii]
Length=326

 Score =   154 bits (388),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 74/93 (80%), Positives = 83/93 (89%), Gaps = 1/93 (1%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            GS+IH+LCFSPNRYWLCAATE SIKIWDLESKSIV DL+VDLK E+E S   +N A K K
Sbjct  235  GSVIHSLCFSPNRYWLCAATEQSIKIWDLESKSIVEDLKVDLKAEAEKSDVTDN-ANKKK  293

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            +I+CTSL+W+ADGSTLFSGYTDGVIRVWGIGRY
Sbjct  294  VIYCTSLNWSADGSTLFSGYTDGVIRVWGIGRY  326


 Score = 88.6 bits (218),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 45/48 (94%), Positives = 46/48 (96%), Gaps = 1/48 (2%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG-VNHS  443
            H+GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG V HS
Sbjct  193  HSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSVIHS  240



>gb|KHG17882.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Gossypium arboreum]
Length=326

 Score =   154 bits (389),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 74/93 (80%), Positives = 83/93 (89%), Gaps = 1/93 (1%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            GS+IH+LCFSPNRYWLCAATE SIKIWDLESKSIV DL+VDLK E+E S   +N A K K
Sbjct  235  GSVIHSLCFSPNRYWLCAATEQSIKIWDLESKSIVEDLKVDLKAEAEKSDVTDN-ANKKK  293

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            +I+CTSL+W+ADGSTLFSGYTDGVIRVWGIGRY
Sbjct  294  VIYCTSLNWSADGSTLFSGYTDGVIRVWGIGRY  326


 Score = 88.6 bits (218),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 45/48 (94%), Positives = 46/48 (96%), Gaps = 1/48 (2%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG-VNHS  443
            H+GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG V HS
Sbjct  193  HSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSVIHS  240



>ref|XP_004299548.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Fragaria vesca subsp. vesca]
Length=326

 Score =   155 bits (391),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 74/93 (80%), Positives = 83/93 (89%), Gaps = 1/93 (1%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G+IIHALCFSPNRYWLCAATE SIKIWDLESKSIV DL+VDLK E+E + E   TA K K
Sbjct  235  GAIIHALCFSPNRYWLCAATEQSIKIWDLESKSIVEDLKVDLKTEAEKTKE-TGTANKKK  293

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            +I+CTSL+W+ADGSTLFSGYTDGVIRVWGIGR+
Sbjct  294  VIYCTSLNWSADGSTLFSGYTDGVIRVWGIGRF  326


 Score = 87.0 bits (214),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 41/43 (95%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAG
Sbjct  193  HNGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAG  235



>ref|XP_007036696.1| Transducin/WD40 repeat-like superfamily protein [Theobroma cacao]
 gb|EOY21197.1| Transducin/WD40 repeat-like superfamily protein [Theobroma cacao]
Length=327

 Score =   153 bits (386),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 84/93 (90%), Gaps = 1/93 (1%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G++IH+LCFSPNRYWLCAATE SIKIWDLESKSIV DL+VDLK E+E S +  +TA K K
Sbjct  236  GAVIHSLCFSPNRYWLCAATEQSIKIWDLESKSIVEDLKVDLKAEAEKS-DVTDTANKKK  294

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            +I+CTSL+W+ADGSTLFSGYTDGVIRVWGIGR+
Sbjct  295  VIYCTSLNWSADGSTLFSGYTDGVIRVWGIGRF  327


 Score = 89.0 bits (219),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 45/48 (94%), Positives = 46/48 (96%), Gaps = 1/48 (2%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG-VNHS  443
            H+GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG V HS
Sbjct  194  HSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGAVIHS  241



>ref|XP_010537487.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Tarenaya hassleriana]
Length=328

 Score =   156 bits (395),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G++IHALCFSPNRYWLCAATE SIKIWDLESKSIV DL+VDLK E+E S     TA K K
Sbjct  236  GAVIHALCFSPNRYWLCAATEQSIKIWDLESKSIVEDLKVDLKAEAEKSDGAGATANKKK  295

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            +I+CTSL+W+ADG+TLFSGYTDGVIRVWGIGRY
Sbjct  296  VIYCTSLNWSADGNTLFSGYTDGVIRVWGIGRY  328


 Score = 85.5 bits (210),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 41/43 (95%), Positives = 43/43 (100%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGYV+TVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AG
Sbjct  194  HTGYVSTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAG  236



>gb|AFK36580.1| unknown [Medicago truncatula]
Length=325

 Score =   154 bits (390),  Expect(2) = 5e-55, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 84/93 (90%), Gaps = 1/93 (1%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G IIHALCFSPNRYWLCAATE+SIKIWDLESKSIV DL+VDLK E++ +A G +T  K K
Sbjct  234  GFIIHALCFSPNRYWLCAATESSIKIWDLESKSIVEDLKVDLKTEAD-AAIGGDTTTKKK  292

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            +I+CTSL+W+ADGSTLFSGYTDGV+RVWGIGRY
Sbjct  293  VIYCTSLNWSADGSTLFSGYTDGVVRVWGIGRY  325


 Score = 87.0 bits (214),  Expect(2) = 5e-55, Method: Compositional matrix adjust.
 Identities = 41/43 (95%), Positives = 43/43 (100%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H+GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAG
Sbjct  192  HSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAG  234



>ref|XP_006297909.1| hypothetical protein CARUB_v10013951mg, partial [Capsella rubella]
 gb|EOA30807.1| hypothetical protein CARUB_v10013951mg, partial [Capsella rubella]
Length=380

 Score =   154 bits (390),  Expect(2) = 8e-55, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            GSIIH+LCFSPNRYWLCAATE SIKIWDLESKS+V DL+VDLK E+E +  G  T  + K
Sbjct  288  GSIIHSLCFSPNRYWLCAATENSIKIWDLESKSVVEDLKVDLKAEAEKADGGVGTGNQKK  347

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            +I+CTSL+W+ADGSTLFSGYTDGV+RVWGIGRY
Sbjct  348  VIYCTSLNWSADGSTLFSGYTDGVVRVWGIGRY  380


 Score = 86.3 bits (212),  Expect(2) = 8e-55, Method: Compositional matrix adjust.
 Identities = 41/43 (95%), Positives = 43/43 (100%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGY+NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AG
Sbjct  246  HTGYLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAG  288



>ref|XP_010097592.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Morus notabilis]
 gb|EXB69124.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Morus notabilis]
Length=330

 Score =   155 bits (392),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 75/94 (80%), Positives = 84/94 (89%), Gaps = 1/94 (1%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGN-NTAAKN  280
            G+IIHALCFSPNRYWLCAATE SIKIWDLESKSIV DL+VDLK E+E + + +  TA K 
Sbjct  237  GAIIHALCFSPNRYWLCAATENSIKIWDLESKSIVEDLKVDLKTEAEKTEDTHAATANKK  296

Query  279  KIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            K+I+CTSLSW+ADGSTLFSGYTDGVIRVWGIGRY
Sbjct  297  KVIYCTSLSWSADGSTLFSGYTDGVIRVWGIGRY  330


 Score = 85.5 bits (210),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 41/43 (95%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAG
Sbjct  195  HGGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAG  237



>ref|XP_004137327.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein-like [Cucumis sativus]
 ref|XP_004160431.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein-like [Cucumis sativus]
 gb|KGN63851.1| hypothetical protein Csa_1G024830 [Cucumis sativus]
Length=327

 Score =   154 bits (388),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 74/94 (79%), Positives = 84/94 (89%), Gaps = 1/94 (1%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGN-NTAAKN  280
            GSIIHALCFSPNRYWLCAATE+SIKIWDLESKSIV DL+VDLK E+E + + +  TA K 
Sbjct  234  GSIIHALCFSPNRYWLCAATESSIKIWDLESKSIVEDLKVDLKTEAEKTDDTHAATANKI  293

Query  279  KIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            K+I+CTSLSW+ADGSTLF GYTDGV+RVWGIGRY
Sbjct  294  KVIYCTSLSWSADGSTLFGGYTDGVVRVWGIGRY  327


 Score = 86.7 bits (213),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 41/43 (95%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAG
Sbjct  192  HAGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAG  234



>ref|XP_010540016.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Tarenaya hassleriana]
Length=328

 Score =   155 bits (391),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G++IH+LCFSPNRYWLCAATE SIKIWDLESKSIV DL+VDLK E+E S    + A K K
Sbjct  236  GAVIHSLCFSPNRYWLCAATEQSIKIWDLESKSIVEDLKVDLKAEAEKSDGAGSAATKTK  295

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            +I+CTSL+W+ADG+TLFSGYTDGVIRVWGIGRY
Sbjct  296  VIYCTSLNWSADGNTLFSGYTDGVIRVWGIGRY  328


 Score = 85.5 bits (210),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 43/48 (90%), Positives = 46/48 (96%), Gaps = 1/48 (2%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG-VNHS  443
            HTGYV+TVAVSPDGSLCASGGKDGV+LLWDLAEGKKLYSL+AG V HS
Sbjct  194  HTGYVSTVAVSPDGSLCASGGKDGVVLLWDLAEGKKLYSLEAGAVIHS  241



>ref|XP_009110365.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Brassica rapa]
Length=327

 Score =   155 bits (392),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 72/92 (78%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = -1

Query  453  SIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKI  274
            S+IHALCFSPNRYWLCAATE  IKIWDLESKS+V DL+VDLK E+E S        K K+
Sbjct  236  SVIHALCFSPNRYWLCAATEQGIKIWDLESKSVVEDLKVDLKAEAEKSDGSGTAGNKKKV  295

Query  273  IFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            I+CTSLSWNADGSTLFSGYTDGVIRVWGIGRY
Sbjct  296  IYCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  327


 Score = 85.1 bits (209),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 40/42 (95%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDA  458
            HTGYVNTVAVSPDGSLCASGGKDGV+LLWDLAEGKKLYSL+A
Sbjct  193  HTGYVNTVAVSPDGSLCASGGKDGVVLLWDLAEGKKLYSLEA  234



>ref|XP_008453452.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Cucumis melo]
Length=327

 Score =   154 bits (388),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 74/94 (79%), Positives = 84/94 (89%), Gaps = 1/94 (1%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGN-NTAAKN  280
            GSIIHALCFSPNRYWLCAATE+SIKIWDLESKSIV DL+VDLK E+E + + +  TA K 
Sbjct  234  GSIIHALCFSPNRYWLCAATESSIKIWDLESKSIVEDLKVDLKTEAEKTDDTHAATANKI  293

Query  279  KIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            K+I+CTSLSW+ADGSTLF GYTDGV+RVWGIGRY
Sbjct  294  KVIYCTSLSWSADGSTLFGGYTDGVVRVWGIGRY  327


 Score = 86.7 bits (213),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 41/43 (95%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAG
Sbjct  192  HAGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAG  234



>ref|XP_002894122.1| hypothetical protein ARALYDRAFT_474002 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70381.1| hypothetical protein ARALYDRAFT_474002 [Arabidopsis lyrata subsp. 
lyrata]
Length=326

 Score =   155 bits (391),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            GSIIH+LCFSPNRYWLCAATE SI+IWDLESKS+V DL+VDLK E+E S     T  K K
Sbjct  234  GSIIHSLCFSPNRYWLCAATENSIRIWDLESKSVVEDLKVDLKTEAEKSDVSTGTGNKTK  293

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            +I+CTSL+W+ADGSTLFSGYTDGVIRVWGIGRY
Sbjct  294  VIYCTSLNWSADGSTLFSGYTDGVIRVWGIGRY  326


 Score = 85.1 bits (209),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 40/43 (93%), Positives = 43/43 (100%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H+GY+NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AG
Sbjct  192  HSGYLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAG  234



>ref|XP_010549077.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein B [Tarenaya hassleriana]
Length=327

 Score =   152 bits (384),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G++IH+LCFSPNRYWLCAATE  IKIWDLESKSIV DL+VDLK E+E S      A K K
Sbjct  235  GAVIHSLCFSPNRYWLCAATEHGIKIWDLESKSIVEDLKVDLKTEAEKSDGDTGAANKQK  294

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            +I+CTSLSW+ADG+TLFSGYTDG+IRVWGIGRY
Sbjct  295  VIYCTSLSWSADGNTLFSGYTDGIIRVWGIGRY  327


 Score = 87.8 bits (216),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 45/48 (94%), Positives = 46/48 (96%), Gaps = 1/48 (2%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG-VNHS  443
            H+GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG V HS
Sbjct  193  HSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGAVIHS  240



>ref|NP_001241455.1| uncharacterized protein LOC100778205 [Glycine max]
 gb|ACU23023.1| unknown [Glycine max]
Length=325

 Score =   153 bits (387),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 82/93 (88%), Gaps = 1/93 (1%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            GSIIHALCFSPNRYWLCAATE SIKIWDLESKSIV DL+VDLK E++ +  G N   K K
Sbjct  234  GSIIHALCFSPNRYWLCAATEQSIKIWDLESKSIVEDLKVDLKTEADATTGGGN-PNKKK  292

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            +I+CTSL+W++DGSTLFSGYTDGV+RVWGIGRY
Sbjct  293  VIYCTSLNWSSDGSTLFSGYTDGVVRVWGIGRY  325


 Score = 86.7 bits (213),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 41/43 (95%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAG
Sbjct  192  HNGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAG  234



>ref|XP_010506450.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein C [Camelina sativa]
Length=326

 Score =   153 bits (387),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            GSIIH+LCFSPNRYWLCAATE SIKIWDLESK++V DL+VDLK E+E +  G  T  + K
Sbjct  234  GSIIHSLCFSPNRYWLCAATENSIKIWDLESKTVVEDLKVDLKAEAEKADGGVGTGNQKK  293

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            +I+CTSL+W+ADGSTLFSGYTDGV+RVWGIGRY
Sbjct  294  VIYCTSLNWSADGSTLFSGYTDGVVRVWGIGRY  326


 Score = 86.3 bits (212),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 41/43 (95%), Positives = 43/43 (100%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGY+NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AG
Sbjct  192  HTGYLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAG  234



>gb|KHN21658.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Glycine soja]
Length=223

 Score =   153 bits (387),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 83/93 (89%), Gaps = 1/93 (1%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            GSIIHALCFSPNRYWLCAATE SIKIWDLESKSIV DL+VDLK E++ ++ G N A K K
Sbjct  132  GSIIHALCFSPNRYWLCAATEQSIKIWDLESKSIVEDLKVDLKTEADATSGGGN-ANKKK  190

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            +I+CTSL+W+ADGSTLFSGYTDGV+RVW IGRY
Sbjct  191  VIYCTSLNWSADGSTLFSGYTDGVVRVWAIGRY  223


 Score = 86.3 bits (212),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 41/43 (95%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAG
Sbjct  90   HNGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAG  132



>ref|XP_010465892.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein C [Camelina sativa]
Length=326

 Score =   153 bits (387),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            GSIIH+LCFSPNRYWLCAATE SIKIWDLESK++V DL+VDLK E+E +  G  T  + K
Sbjct  234  GSIIHSLCFSPNRYWLCAATENSIKIWDLESKTVVEDLKVDLKAEAEKADGGVGTGNQKK  293

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            +I+CTSL+W+ADGSTLFSGYTDGV+RVWGIGRY
Sbjct  294  VIYCTSLNWSADGSTLFSGYTDGVVRVWGIGRY  326


 Score = 85.9 bits (211),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 41/43 (95%), Positives = 43/43 (100%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGY+NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AG
Sbjct  192  HTGYLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAG  234



>ref|XP_010549078.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein B [Tarenaya hassleriana]
Length=327

 Score =   152 bits (384),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G++IH+LCFSPNRYWLCAATE  IKIWDLESKSIV DL+VDLK E+E S      A K K
Sbjct  235  GAVIHSLCFSPNRYWLCAATEHGIKIWDLESKSIVEDLKVDLKAEAEKSDGDTGAANKQK  294

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            +I+CTSLSW+ADG+TLFSGYTDG+IRVWGIGRY
Sbjct  295  VIYCTSLSWSADGNTLFSGYTDGIIRVWGIGRY  327


 Score = 86.7 bits (213),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 44/48 (92%), Positives = 46/48 (96%), Gaps = 1/48 (2%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG-VNHS  443
            H+GY+NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG V HS
Sbjct  193  HSGYLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGAVIHS  240



>ref|XP_007160506.1| hypothetical protein PHAVU_002G327500g [Phaseolus vulgaris]
 gb|ACV72060.1| RACK1 [Phaseolus vulgaris]
 gb|ESW32500.1| hypothetical protein PHAVU_002G327500g [Phaseolus vulgaris]
Length=324

 Score =   152 bits (383),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 81/93 (87%), Gaps = 2/93 (2%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            GSIIHALCFSPNRYWLCAATE SIKIWDLESKSIV DL+VDLK E++ +  GN    K K
Sbjct  234  GSIIHALCFSPNRYWLCAATEQSIKIWDLESKSIVEDLKVDLKTEADGTTGGNTN--KKK  291

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            +I+CTSL+W+ADGSTLFSGYTDGV+RVW IGRY
Sbjct  292  VIYCTSLNWSADGSTLFSGYTDGVVRVWAIGRY  324


 Score = 87.0 bits (214),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 41/43 (95%), Positives = 43/43 (100%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H+GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAG
Sbjct  192  HSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAG  234



>gb|ACJ24167.1| Rack [Phaseolus vulgaris]
Length=324

 Score =   152 bits (383),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 81/93 (87%), Gaps = 2/93 (2%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            GSIIHALCFSPNRYWLCAATE SIKIWDLESKSIV DL+VDLK E++ +  GN    K K
Sbjct  234  GSIIHALCFSPNRYWLCAATEQSIKIWDLESKSIVEDLKVDLKTEADGTTGGNTN--KKK  291

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            +I+CTSL+W+ADGSTLFSGYTDGV+RVW IGRY
Sbjct  292  VIYCTSLNWSADGSTLFSGYTDGVVRVWAIGRY  324


 Score = 87.0 bits (214),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 41/43 (95%), Positives = 43/43 (100%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H+GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAG
Sbjct  192  HSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAG  234



>ref|XP_009149259.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Brassica rapa]
Length=328

 Score =   154 bits (388),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 71/92 (77%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = -1

Query  453  SIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKI  274
            S+IHALCFSPNRYWLCAATE  IKIWDLESKS+V DL+VDLK E+E S      A K K+
Sbjct  237  SVIHALCFSPNRYWLCAATEQGIKIWDLESKSVVEDLKVDLKAEAEKSDGSGTAATKRKV  296

Query  273  IFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            I+CTSL+W+ADGSTLFSGYTDGVIRVWGIGRY
Sbjct  297  IYCTSLNWSADGSTLFSGYTDGVIRVWGIGRY  328


 Score = 85.1 bits (209),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 40/42 (95%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDA  458
            HTGYVNTVAVSPDGSLCASGGKDGV+LLWDLAEGKKLYSL+A
Sbjct  194  HTGYVNTVAVSPDGSLCASGGKDGVVLLWDLAEGKKLYSLEA  235



>ref|NP_188441.1| receptor for activated C kinase 1C [Arabidopsis thaliana]
 sp|Q9LV28.1|GPLPC_ARATH RecName: Full=Guanine nucleotide-binding protein subunit beta-like 
protein C; AltName: Full=Receptor for activated C kinase 
1C [Arabidopsis thaliana]
 dbj|BAB02025.1| guanine nucleotide-binding protein; activated protein kinase 
C receptor; RACK1 [Arabidopsis thaliana]
 gb|AAK91355.1| AT3g18130/MRC8_11 [Arabidopsis thaliana]
 gb|AAM26650.1| AT3g18130/MRC8_11 [Arabidopsis thaliana]
 gb|AEE76051.1| receptor for activated C kinase 1C [Arabidopsis thaliana]
Length=326

 Score =   154 bits (388),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            GSIIH+LCFSPNRYWLCAATE SI+IWDLESKS+V DL+VDLK E+E +  G  T  + K
Sbjct  234  GSIIHSLCFSPNRYWLCAATENSIRIWDLESKSVVEDLKVDLKSEAEKNEGGVGTGNQKK  293

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            +I+CTSL+W+ADGSTLFSGYTDGV+RVWGIGRY
Sbjct  294  VIYCTSLNWSADGSTLFSGYTDGVVRVWGIGRY  326


 Score = 85.1 bits (209),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 40/43 (93%), Positives = 43/43 (100%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H+GY+NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AG
Sbjct  192  HSGYLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAG  234



>ref|XP_006393380.1| hypothetical protein EUTSA_v10011646mg [Eutrema salsugineum]
 gb|ESQ30666.1| hypothetical protein EUTSA_v10011646mg [Eutrema salsugineum]
Length=327

 Score =   153 bits (387),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            GS+IH+LCFSPNRYWLCAATE+SI+IWDLESKS+V DL+VDLK E+E S     T  K K
Sbjct  235  GSVIHSLCFSPNRYWLCAATESSIRIWDLESKSVVEDLKVDLKAEAEKSDGSAGTGNKTK  294

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            +I+CTSL+W+ADG+TLFSGYTDGVIRVWGIGRY
Sbjct  295  VIYCTSLNWSADGNTLFSGYTDGVIRVWGIGRY  327


 Score = 85.1 bits (209),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 43/48 (90%), Positives = 46/48 (96%), Gaps = 1/48 (2%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG-VNHS  443
            H+GY+NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AG V HS
Sbjct  193  HSGYLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGSVIHS  240



>gb|KFK39137.1| guanine nucleotide-binding protein subunit beta-like protein 
[Arabis alpina]
Length=327

 Score =   153 bits (387),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            GSIIH+LCFSPNRYWLCAATE SIKIWDLESKS+V DL+VDLK E+E S  G     + K
Sbjct  235  GSIIHSLCFSPNRYWLCAATENSIKIWDLESKSVVEDLKVDLKAEAEKSDGGVGMGNQKK  294

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            +I+CTSL+W+ADGSTLFSGYTDGV+RVWGIGRY
Sbjct  295  VIYCTSLNWSADGSTLFSGYTDGVVRVWGIGRY  327


 Score = 85.1 bits (209),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 40/43 (93%), Positives = 43/43 (100%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H+GY+NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AG
Sbjct  193  HSGYLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAG  235



>gb|KHN00175.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Glycine soja]
Length=223

 Score =   152 bits (384),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 82/93 (88%), Gaps = 1/93 (1%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            GSIIHALCFSPNRYWLCAATE SIKIWDLESKSIV DL+VDLK E++ +  G N   K K
Sbjct  132  GSIIHALCFSPNRYWLCAATEQSIKIWDLESKSIVEDLKVDLKTEADATTGGGN-PNKKK  190

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            +I+CTSL+W++DGSTLFSGYTDGV+RVWGIGRY
Sbjct  191  VIYCTSLNWSSDGSTLFSGYTDGVVRVWGIGRY  223


 Score = 86.3 bits (212),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 41/43 (95%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAG
Sbjct  90   HNGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAG  132



>ref|XP_009117627.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Brassica rapa]
Length=327

 Score =   155 bits (392),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 72/92 (78%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = -1

Query  453  SIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKI  274
            S+IHALCFSPNRYWLCAATE  IKIWDLESKS+V DL+VDLK E+E S      A K K+
Sbjct  236  SVIHALCFSPNRYWLCAATEQGIKIWDLESKSVVEDLKVDLKAEAEKSDGSGTAATKRKV  295

Query  273  IFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            I+CTSLSW+ADGSTLFSGYTDGVIRVWGIGRY
Sbjct  296  IYCTSLSWSADGSTLFSGYTDGVIRVWGIGRY  327


 Score = 83.2 bits (204),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDA  458
            HTGYV+TVAVSPDGSLCASGGKDGV+LLWDLAEGKKLYSL+A
Sbjct  193  HTGYVSTVAVSPDGSLCASGGKDGVVLLWDLAEGKKLYSLEA  234



>gb|KHG29145.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Gossypium arboreum]
Length=327

 Score =   150 bits (378),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 81/93 (87%), Gaps = 1/93 (1%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            GS+IH+LCFSPNRYWLCAATE  IKIWDLESKSIV DL+VDLK E+E S +  +   K K
Sbjct  236  GSVIHSLCFSPNRYWLCAATEQGIKIWDLESKSIVEDLKVDLKAEAEKS-DVTDIGNKKK  294

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            +I+CTSL+W+ADGSTLFSGYTDGVIRVWGIGRY
Sbjct  295  VIYCTSLNWSADGSTLFSGYTDGVIRVWGIGRY  327


 Score = 88.2 bits (217),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 45/48 (94%), Positives = 46/48 (96%), Gaps = 1/48 (2%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG-VNHS  443
            H+GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG V HS
Sbjct  194  HSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSVIHS  241



>gb|KJB08186.1| hypothetical protein B456_001G069800 [Gossypium raimondii]
Length=327

 Score =   150 bits (378),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 81/93 (87%), Gaps = 1/93 (1%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            GS+IH+LCFSPNRYWLCAATE  IKIWDLESKSIV DL+VDLK E+E S +  +   K K
Sbjct  236  GSVIHSLCFSPNRYWLCAATEQGIKIWDLESKSIVEDLKVDLKAEAEKS-DVTDIGNKKK  294

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            +I+CTSL+W+ADGSTLFSGYTDGVIRVWGIGRY
Sbjct  295  VIYCTSLNWSADGSTLFSGYTDGVIRVWGIGRY  327


 Score = 88.2 bits (217),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 45/48 (94%), Positives = 46/48 (96%), Gaps = 1/48 (2%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG-VNHS  443
            H+GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG V HS
Sbjct  194  HSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSVIHS  241



>ref|XP_010487724.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein C [Camelina sativa]
Length=326

 Score =   152 bits (383),  Expect(2) = 6e-54, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            GSIIH+LCFSPNRYWLCAATE SIKIWDLESK +V DL+VDLK E+E +  G  T  + K
Sbjct  234  GSIIHSLCFSPNRYWLCAATENSIKIWDLESKLVVEDLKVDLKAEAEKADGGVGTGNQKK  293

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            +I+CTSL+W+ADGSTLFSGYTDGV+RVWGIGRY
Sbjct  294  VIYCTSLNWSADGSTLFSGYTDGVVRVWGIGRY  326


 Score = 86.3 bits (212),  Expect(2) = 6e-54, Method: Compositional matrix adjust.
 Identities = 41/43 (95%), Positives = 43/43 (100%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGY+NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AG
Sbjct  192  HTGYLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAG  234



>pdb|3DM0|A Chain A, Maltose Binding Protein Fusion With Rack1 From A. Thaliana
Length=694

 Score =   154 bits (390),  Expect(2) = 7e-54, Method: Compositional matrix adjust.
 Identities = 71/92 (77%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = -1

Query  453  SIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKI  274
            S+IHALCFSPNRYWLCAATE  IKIWDLESKSIV DL+VDLK E+E +      A K K+
Sbjct  603  SVIHALCFSPNRYWLCAATEHGIKIWDLESKSIVEDLKVDLKAEAEKADNSGPAATKRKV  662

Query  273  IFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            I+CTSL+W+ADGSTLFSGYTDGVIRVWGIGRY
Sbjct  663  IYCTSLNWSADGSTLFSGYTDGVIRVWGIGRY  694


 Score = 83.2 bits (204),  Expect(2) = 7e-54, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDA  458
            HTGYV+TVAVSPDGSLCASGGKDGV+LLWDLAEGKKLYSL+A
Sbjct  560  HTGYVSTVAVSPDGSLCASGGKDGVVLLWDLAEGKKLYSLEA  601



>ref|XP_006406649.1| hypothetical protein EUTSA_v10021128mg [Eutrema salsugineum]
 gb|ESQ48102.1| hypothetical protein EUTSA_v10021128mg [Eutrema salsugineum]
Length=327

 Score =   152 bits (385),  Expect(2) = 8e-54, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            GSIIH+LCFSPNRYWLCAATE SIKIWDLESKS+V DL+VDLK E+E S  G  T  + K
Sbjct  235  GSIIHSLCFSPNRYWLCAATENSIKIWDLESKSVVEDLKVDLKAEAEKSDGGVGTGNQKK  294

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            + +CTSL+W+ADGSTLFSGYTDGV+RVWGIGRY
Sbjct  295  VNYCTSLNWSADGSTLFSGYTDGVVRVWGIGRY  327


 Score = 84.7 bits (208),  Expect(2) = 8e-54, Method: Compositional matrix adjust.
 Identities = 40/43 (93%), Positives = 43/43 (100%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H+GY+NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AG
Sbjct  193  HSGYLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAG  235



>ref|XP_002890259.1| hypothetical protein ARALYDRAFT_889221 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66518.1| hypothetical protein ARALYDRAFT_889221 [Arabidopsis lyrata subsp. 
lyrata]
Length=327

 Score =   154 bits (390),  Expect(2) = 8e-54, Method: Compositional matrix adjust.
 Identities = 72/92 (78%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = -1

Query  453  SIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKI  274
            S+IHALCFSPNRYWLCAATE  IKIWDLESKSIV DL+VDLK E+E S      A K K+
Sbjct  236  SVIHALCFSPNRYWLCAATEQGIKIWDLESKSIVEDLKVDLKAEAEKSDNSGPAATKRKV  295

Query  273  IFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            I+CTSL+W+ADGSTLFSGYTDGVIRVWGIGRY
Sbjct  296  IYCTSLNWSADGSTLFSGYTDGVIRVWGIGRY  327


 Score = 83.2 bits (204),  Expect(2) = 8e-54, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDA  458
            HTGYV+TVAVSPDGSLCASGGKDGV+LLWDLAEGKKLYSL+A
Sbjct  193  HTGYVSTVAVSPDGSLCASGGKDGVVLLWDLAEGKKLYSLEA  234



>ref|XP_006416642.1| hypothetical protein EUTSA_v10008183mg [Eutrema salsugineum]
 gb|ESQ34995.1| hypothetical protein EUTSA_v10008183mg [Eutrema salsugineum]
Length=328

 Score =   154 bits (390),  Expect(2) = 9e-54, Method: Compositional matrix adjust.
 Identities = 72/92 (78%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = -1

Query  453  SIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKI  274
            S+IHALCFSPNRYWLCAATE  IKIWDLESKSIV DL+VDLK E+E S      A K K+
Sbjct  237  SVIHALCFSPNRYWLCAATEQGIKIWDLESKSIVEDLKVDLKAEAEKSDGSGTAATKKKV  296

Query  273  IFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            I+CTSL+W+ADGSTLFSGYTDGVIRVWGIGRY
Sbjct  297  IYCTSLNWSADGSTLFSGYTDGVIRVWGIGRY  328


 Score = 83.2 bits (204),  Expect(2) = 9e-54, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDA  458
            HTGYV+TVAVSPDGSLCASGGKDGV+LLWDLAEGKKLYSL+A
Sbjct  194  HTGYVSTVAVSPDGSLCASGGKDGVVLLWDLAEGKKLYSLEA  235



>ref|NP_001235369.1| guanine nucleotide-binding protein subunit beta-like protein 
[Glycine max]
 sp|Q39836.1|GBLP_SOYBN RecName: Full=Guanine nucleotide-binding protein subunit beta-like 
protein [Glycine max]
 gb|AAB05941.1| G beta-like protein [Glycine max]
Length=325

 Score =   150 bits (380),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 82/93 (88%), Gaps = 1/93 (1%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            GSIIHALCFSP+RYWLCAATE SIKIWDLESKSIV DL+VDLK E++ ++ G N A K K
Sbjct  234  GSIIHALCFSPSRYWLCAATEQSIKIWDLESKSIVEDLKVDLKTEADATSGGGN-ANKKK  292

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            +I+CTSL+W+ADGSTLFSGYTDGV RVW IGRY
Sbjct  293  VIYCTSLNWSADGSTLFSGYTDGVARVWAIGRY  325


 Score = 86.7 bits (213),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 41/43 (95%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAG
Sbjct  192  HNGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAG  234



>ref|XP_002529557.1| receptor for activated protein kinase C, putative [Ricinus communis]
 gb|EEF32826.1| receptor for activated protein kinase C, putative [Ricinus communis]
Length=328

 Score =   152 bits (385),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 75/95 (79%), Positives = 82/95 (86%), Gaps = 2/95 (2%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGN--NTAAK  283
            G++IHALCFSPNRYWLCAATE SIKIWDLESKSIV DL+VDLK E+E S      +T AK
Sbjct  234  GAVIHALCFSPNRYWLCAATENSIKIWDLESKSIVEDLKVDLKAEAEKSDGSTVASTGAK  293

Query  282  NKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
             K I+CTSLSWNADGSTLFSGYTDGVIRVWGIGR+
Sbjct  294  KKNIYCTSLSWNADGSTLFSGYTDGVIRVWGIGRF  328


 Score = 84.3 bits (207),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 40/43 (93%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LY+LDAG
Sbjct  192  HGGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYNLDAG  234



>ref|XP_010032559.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Eucalyptus grandis]
 gb|KCW83972.1| hypothetical protein EUGRSUZ_B00856 [Eucalyptus grandis]
Length=327

 Score =   150 bits (379),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 72/94 (77%), Positives = 81/94 (86%), Gaps = 1/94 (1%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKN-  280
            G+IIH+LCFSPNRYWLCAATE SIKIWDLESKSIV DLRVDLK E++MS       + N 
Sbjct  234  GAIIHSLCFSPNRYWLCAATENSIKIWDLESKSIVEDLRVDLKNEADMSDGTTGAMSSNK  293

Query  279  KIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            K+I+CTSL+W+ADGSTLFSGY DGVIRVWGIGRY
Sbjct  294  KVIYCTSLNWSADGSTLFSGYNDGVIRVWGIGRY  327


 Score = 86.3 bits (212),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 41/43 (95%), Positives = 43/43 (100%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H+GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AG
Sbjct  192  HSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAG  234



>ref|XP_006451669.1| hypothetical protein CICLE_v10008909mg [Citrus clementina]
 ref|XP_006490737.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein-like [Citrus sinensis]
 gb|ESR64909.1| hypothetical protein CICLE_v10008909mg [Citrus clementina]
Length=327

 Score =   148 bits (373),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 73/94 (78%), Positives = 80/94 (85%), Gaps = 1/94 (1%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAA-KN  280
            G++IHALCFSPNRYWLCAATE SIKIWDLESKSIV DL+VDLK E+E S     T   K 
Sbjct  234  GAVIHALCFSPNRYWLCAATEQSIKIWDLESKSIVEDLKVDLKTEAEKSEATTATTTIKK  293

Query  279  KIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            K I+CTSL+W+ADGSTLFSGYTDGVIRVWGIGRY
Sbjct  294  KNIYCTSLNWSADGSTLFSGYTDGVIRVWGIGRY  327


 Score = 89.0 bits (219),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 42/43 (98%), Positives = 43/43 (100%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAG
Sbjct  192  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAG  234



>ref|XP_002885240.1| guanine nucleotide-binding family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH61499.1| guanine nucleotide-binding family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=327

 Score =   151 bits (382),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            GSIIH+LCFSPNRYWLCAATE SIKIWDLESKS+V DL+VDLK E+E +  G  T  + K
Sbjct  235  GSIIHSLCFSPNRYWLCAATENSIKIWDLESKSVVEDLKVDLKAEAEKTDGGVGTGNQKK  294

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            + +CTSL+W+ADGSTLFSGYTDGV+RVWGIGRY
Sbjct  295  VNYCTSLNWSADGSTLFSGYTDGVVRVWGIGRY  327


 Score = 84.7 bits (208),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 40/43 (93%), Positives = 43/43 (100%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H+GY+NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AG
Sbjct  193  HSGYLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAG  235



>emb|CDY64888.1| BnaC06g40840D [Brassica napus]
Length=299

 Score =   153 bits (387),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G+IIH+LCFSPNRYWLCAATE SI+IWDLESKS+V DL+VDLK E+EMS     T  K K
Sbjct  207  GAIIHSLCFSPNRYWLCAATENSIRIWDLESKSVVEDLKVDLKAEAEMSDASVGTGNKTK  266

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            +I+CTSL+W+ADGSTLFSGYTDGVIRVWG+GR+
Sbjct  267  VIYCTSLNWSADGSTLFSGYTDGVIRVWGLGRF  299


 Score = 83.2 bits (204),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H+GY+NTVAVSPDGSLCASGGKDG ILLWDLAEGKKLYSL+AG
Sbjct  165  HSGYLNTVAVSPDGSLCASGGKDGAILLWDLAEGKKLYSLEAG  207



>ref|XP_006305354.1| hypothetical protein CARUB_v10009733mg [Capsella rubella]
 gb|EOA38252.1| hypothetical protein CARUB_v10009733mg [Capsella rubella]
Length=326

 Score =   151 bits (382),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            GSIIH+LCFSPNRYWLCAATE SI+IWDLESKS+V DL+VDLK E+E S     T  K K
Sbjct  234  GSIIHSLCFSPNRYWLCAATENSIRIWDLESKSVVEDLKVDLKVEAEKSDGAVGTGNKTK  293

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            +I+CTSL+W+ADG+TLFSGYTDG+IRVWGIGRY
Sbjct  294  VIYCTSLNWSADGNTLFSGYTDGIIRVWGIGRY  326


 Score = 85.1 bits (209),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 40/43 (93%), Positives = 43/43 (100%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H+GY+NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AG
Sbjct  192  HSGYLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAG  234



>gb|KFK43977.1| guanine nucleotide-binding protein subunit beta-like protein 
[Arabis alpina]
Length=327

 Score =   153 bits (386),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 71/92 (77%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = -1

Query  453  SIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKI  274
            S+IHALCFSPNRYWLCAATE  IKIWDLESKSIV DL+VDLK E+E S      A K K+
Sbjct  236  SVIHALCFSPNRYWLCAATEQGIKIWDLESKSIVEDLKVDLKAEAEKSDGSGTAATKKKV  295

Query  273  IFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            I+CTSL+W+ADGSTLFSGYTDGVIRVWGIGR+
Sbjct  296  IYCTSLNWSADGSTLFSGYTDGVIRVWGIGRF  327


 Score = 83.2 bits (204),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDA  458
            HTGYV+TVAVSPDGSLCASGGKDGV+LLWDLAEGKKLYSL+A
Sbjct  193  HTGYVSTVAVSPDGSLCASGGKDGVVLLWDLAEGKKLYSLEA  234



>ref|XP_006305339.1| hypothetical protein CARUB_v10009720mg [Capsella rubella]
 gb|EOA38237.1| hypothetical protein CARUB_v10009720mg [Capsella rubella]
Length=328

 Score =   153 bits (387),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 71/92 (77%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = -1

Query  453  SIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKI  274
            S+IHALCFSPNRYWLCAATE  IKIWDLESKSIV DL+VDLK E+E +      A K K+
Sbjct  237  SVIHALCFSPNRYWLCAATEQGIKIWDLESKSIVEDLKVDLKAEAEKADNSGPAATKRKV  296

Query  273  IFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            I+CTSL+W+ADGSTLFSGYTDGVIRVWGIGRY
Sbjct  297  IYCTSLNWSADGSTLFSGYTDGVIRVWGIGRY  328


 Score = 82.8 bits (203),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDA  458
            HTGYV+TVAVSPDGSLCASGGKDGV+LLWDLAEGKKLYSL+A
Sbjct  194  HTGYVSTVAVSPDGSLCASGGKDGVVLLWDLAEGKKLYSLEA  235



>gb|AAB82647.1| WD-40 repeat protein [Arabidopsis thaliana]
Length=327

 Score =   153 bits (387),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 71/92 (77%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = -1

Query  453  SIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKI  274
            S+IHALCFSPNRYWLCAATE  IKIWDLESKSIV DL+VDLK E+E +      A K K+
Sbjct  236  SVIHALCFSPNRYWLCAATEHGIKIWDLESKSIVEDLKVDLKAEAEKADNSGPAATKRKV  295

Query  273  IFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            I+CTSL+W+ADGSTLFSGYTDGVIRVWGIGRY
Sbjct  296  IYCTSLNWSADGSTLFSGYTDGVIRVWGIGRY  327


 Score = 83.2 bits (204),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDA  458
            HTGYV+TVAVSPDGSLCASGGKDGV+LLWDLAEGKKLYSL+A
Sbjct  193  HTGYVSTVAVSPDGSLCASGGKDGVVLLWDLAEGKKLYSLEA  234



>ref|NP_173248.1| guanine nucleotide-binding protein subunit beta-like protein 
A [Arabidopsis thaliana]
 sp|O24456.2|GBLPA_ARATH RecName: Full=Guanine nucleotide-binding protein subunit beta-like 
protein A; AltName: Full=Receptor for activated C kinase 
1A; AltName: Full=WD-40 repeat auxin-dependent protein ARCA 
[Arabidopsis thaliana]
 gb|AAF78369.1|AC069551_2 T10O22.6 [Arabidopsis thaliana]
 gb|AAF97825.1|AC034107_8 Identical to WD-40 repeat protein (AtArcA) from Arabidopsis thaliana 
gb|U77381 and contains multiple WD (G-beta repeat) PF|00400 
domains. ESTs gb|Z17972, gb|AI099926, gb|T42961, gb|R30131, 
gb|AV541608, gb|AV532234, gb|AV543299, gb|AV440652 come 
from this gene [Arabidopsis thaliana]
 gb|AAK59512.1| putative WD-40 repeat protein [Arabidopsis thaliana]
 gb|AAL34190.1| putative WD-40 repeat protein [Arabidopsis thaliana]
 gb|AAM66016.1| WD-40 repeat protein [Arabidopsis thaliana]
 gb|AEE29673.1| WD-40 repeat ArcA-like protein [Arabidopsis thaliana]
Length=327

 Score =   153 bits (386),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 71/92 (77%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = -1

Query  453  SIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKI  274
            S+IHALCFSPNRYWLCAATE  IKIWDLESKSIV DL+VDLK E+E +      A K K+
Sbjct  236  SVIHALCFSPNRYWLCAATEHGIKIWDLESKSIVEDLKVDLKAEAEKADNSGPAATKRKV  295

Query  273  IFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            I+CTSL+W+ADGSTLFSGYTDGVIRVWGIGRY
Sbjct  296  IYCTSLNWSADGSTLFSGYTDGVIRVWGIGRY  327


 Score = 82.8 bits (203),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDA  458
            HTGYV+TVAVSPDGSLCASGGKDGV+LLWDLAEGKKLYSL+A
Sbjct  193  HTGYVSTVAVSPDGSLCASGGKDGVVLLWDLAEGKKLYSLEA  234



>gb|KDP37901.1| hypothetical protein JCGZ_05340 [Jatropha curcas]
Length=329

 Score =   150 bits (379),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 72/95 (76%), Positives = 82/95 (86%), Gaps = 2/95 (2%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMS--AEGNNTAAK  283
            G++IHALCFSPNRYWLCAATE SIKIWDLESKSIV DL+VDLK E+E S  +    T+ K
Sbjct  235  GAVIHALCFSPNRYWLCAATEHSIKIWDLESKSIVEDLKVDLKAEAEKSEGSTATGTSIK  294

Query  282  NKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
             K I+CTSL+W+ADGSTLFSGYTDGV+RVWGIGRY
Sbjct  295  KKNIYCTSLNWSADGSTLFSGYTDGVVRVWGIGRY  329


 Score = 85.5 bits (210),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 40/43 (93%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LY+LDAG
Sbjct  193  HNGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYNLDAG  235



>ref|NP_175296.1| receptor for activated C kinase 1B [Arabidopsis thaliana]
 sp|Q9C4Z6.1|GPLPB_ARATH RecName: Full=Guanine nucleotide-binding protein subunit beta-like 
protein B; AltName: Full=Receptor for activated C kinase 
1B [Arabidopsis thaliana]
 gb|AAG50846.1|AC074308_2 guanine nucleotide-binding protein, putative [Arabidopsis thaliana]
 gb|AAG60127.1|AC073555_11 guanine nucleotide-binding protein, putative [Arabidopsis thaliana]
 gb|AAL24080.1| putative guanine nucleotide-binding protein [Arabidopsis thaliana]
 gb|AAM14291.1| putative guanine nucleotide-binding protein [Arabidopsis thaliana]
 gb|AEE32329.1| receptor for activated C kinase 1B [Arabidopsis thaliana]
Length=326

 Score =   150 bits (379),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            GSIIH+LCFSPNRYWLCAATE SI+IWDLESKS+V DL+VDLK E+E +        K K
Sbjct  234  GSIIHSLCFSPNRYWLCAATENSIRIWDLESKSVVEDLKVDLKAEAEKTDGSTGIGNKTK  293

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            +I+CTSL+W+ADG+TLFSGYTDGVIRVWGIGRY
Sbjct  294  VIYCTSLNWSADGNTLFSGYTDGVIRVWGIGRY  326


 Score = 85.1 bits (209),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 40/43 (93%), Positives = 43/43 (100%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H+GY+NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AG
Sbjct  192  HSGYLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAG  234



>gb|KDO62873.1| hypothetical protein CISIN_1g048118mg [Citrus sinensis]
Length=303

 Score =   146 bits (369),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 72/94 (77%), Positives = 79/94 (84%), Gaps = 1/94 (1%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAA-KN  280
            G++IHALCFSPNRYWLCAATE SIKIWDLESKSIV DL+VDLK E+E S     T   K 
Sbjct  210  GAVIHALCFSPNRYWLCAATEQSIKIWDLESKSIVEDLKVDLKTEAEKSEATTATTTIKK  269

Query  279  KIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            K I+CTSL+W+ DGSTLFSGYTDGVIRVWGIGRY
Sbjct  270  KNIYCTSLNWSVDGSTLFSGYTDGVIRVWGIGRY  303


 Score = 89.0 bits (219),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 42/43 (98%), Positives = 43/43 (100%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAG
Sbjct  168  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAG  210



>sp|Q39336.1|GBLP_BRANA RecName: Full=Guanine nucleotide-binding protein subunit beta-like 
protein [Brassica napus]
 emb|CAA83924.1| guanine nucleotide regulatory protein [Brassica napus]
Length=327

 Score =   152 bits (384),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 69/92 (75%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = -1

Query  453  SIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKI  274
            S+IHALCF+PNRYWLCAATE  IKIWDLESK++V DL+VDLK E+E S      A K K+
Sbjct  236  SVIHALCFTPNRYWLCAATEQGIKIWDLESKTVVEDLKVDLKAEAEKSDGSGTAATKRKV  295

Query  273  IFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            I+CTSL+W+ADGSTLFSGYTDGVIRVWGIGRY
Sbjct  296  IYCTSLNWSADGSTLFSGYTDGVIRVWGIGRY  327


 Score = 83.2 bits (204),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDA  458
            HTGYV+TVAVSPDGSLCASGGKDGV+LLWDLAEGKKLYSL+A
Sbjct  193  HTGYVSTVAVSPDGSLCASGGKDGVVLLWDLAEGKKLYSLEA  234



>ref|XP_010551145.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein B [Tarenaya hassleriana]
Length=327

 Score =   149 bits (376),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G +IH+LCFSPNRYWLCAATE SIKIWDLESKS+V DL+VDLK E+E S      A K K
Sbjct  235  GDVIHSLCFSPNRYWLCAATEQSIKIWDLESKSVVEDLKVDLKAEAEKSDGDTGAANKQK  294

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            +I+CTSL+W+ADG+TLFSGY+DG+IRVWGIGR+
Sbjct  295  VIYCTSLNWSADGNTLFSGYSDGIIRVWGIGRF  327


 Score = 85.9 bits (211),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 43/48 (90%), Positives = 46/48 (96%), Gaps = 1/48 (2%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG-VNHS  443
            H+GY+NTVAVSPDGSLCASGGKDG+ILLWDLAEGKKLYSLDAG V HS
Sbjct  193  HSGYLNTVAVSPDGSLCASGGKDGMILLWDLAEGKKLYSLDAGDVIHS  240



>ref|XP_010036939.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Eucalyptus grandis]
 gb|KCW48591.1| hypothetical protein EUGRSUZ_K02261 [Eucalyptus grandis]
Length=326

 Score =   150 bits (379),  Expect(2) = 6e-53, Method: Compositional matrix adjust.
 Identities = 73/94 (78%), Positives = 83/94 (88%), Gaps = 2/94 (2%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKN-  280
            G+IIH+LCFSPNRYWLCAATE SIKIWDLESKSIV DLRVDLK E++ + +G  TAA N 
Sbjct  234  GAIIHSLCFSPNRYWLCAATENSIKIWDLESKSIVEDLRVDLKNEADKT-DGTTTAASNK  292

Query  279  KIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            K+I+CTSL+W+ADGSTLFSGY DGVIRVWG GRY
Sbjct  293  KVIYCTSLNWSADGSTLFSGYNDGVIRVWGTGRY  326


 Score = 84.3 bits (207),  Expect(2) = 6e-53, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LY+L+AG
Sbjct  192  HNGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYNLEAG  234



>ref|XP_010678120.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Beta vulgaris subsp. vulgaris]
Length=326

 Score =   149 bits (377),  Expect(2) = 6e-53, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G+IIHALCFSPNRYWLCAATE+ IKIWDLESKS+V DL+VDLK E++       TA+K K
Sbjct  234  GTIIHALCFSPNRYWLCAATESGIKIWDLESKSVVEDLKVDLKTEADHLEGSGTTASKKK  293

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            +I+CTSLSW+ADG TLFSGYTDGV+RV+GI RY
Sbjct  294  VIYCTSLSWSADGQTLFSGYTDGVVRVYGIARY  326


 Score = 84.7 bits (208),  Expect(2) = 6e-53, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGV  452
            H GYVNTVAVSPDGSLCASGGKD VILLWDLAEGK+LYSLDAG 
Sbjct  192  HNGYVNTVAVSPDGSLCASGGKDSVILLWDLAEGKRLYSLDAGT  235



>gb|AGV54321.1| RACK1 [Phaseolus vulgaris]
Length=324

 Score =   152 bits (383),  Expect(2) = 7e-53, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 81/93 (87%), Gaps = 2/93 (2%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            GSIIHALCFSPNRYWLCAATE SIKIWDLESKSIV DL+VDLK E++ +  GN    K K
Sbjct  234  GSIIHALCFSPNRYWLCAATEQSIKIWDLESKSIVEDLKVDLKTEADGTTGGNTN--KKK  291

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            +I+CTSL+W+ADGSTLFSGYTDGV+RVW IGRY
Sbjct  292  VIYCTSLNWSADGSTLFSGYTDGVVRVWAIGRY  324


 Score = 82.4 bits (202),  Expect(2) = 7e-53, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            ++GYVN VAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAG
Sbjct  192  NSGYVNNVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAG  234



>ref|XP_010498185.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Camelina sativa]
Length=328

 Score =   151 bits (381),  Expect(2) = 7e-53, Method: Compositional matrix adjust.
 Identities = 69/92 (75%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = -1

Query  453  SIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKI  274
            S+IHA+CFSPNRYWLCAATE  IKIWDLESK+IV DL+VDLK E+E +      A K K+
Sbjct  237  SVIHAVCFSPNRYWLCAATEQGIKIWDLESKTIVEDLKVDLKAEAEKADNSGPAATKKKV  296

Query  273  IFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            I+CTSL+W+ADGSTLFSGYTDGVIRVWGIGRY
Sbjct  297  IYCTSLNWSADGSTLFSGYTDGVIRVWGIGRY  328


 Score = 83.2 bits (204),  Expect(2) = 7e-53, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDA  458
            HTGYV+TVAVSPDGSLCASGGKDGV+LLWDLAEGKKLYSL+A
Sbjct  194  HTGYVSTVAVSPDGSLCASGGKDGVVLLWDLAEGKKLYSLEA  235



>ref|XP_010476972.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Camelina sativa]
Length=328

 Score =   152 bits (385),  Expect(2) = 7e-53, Method: Compositional matrix adjust.
 Identities = 70/92 (76%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = -1

Query  453  SIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKI  274
            S+IHALCFSPNRYWLCAATE  IKIWDLESK+IV DL+VDLK E+E +      A K K+
Sbjct  237  SVIHALCFSPNRYWLCAATEQGIKIWDLESKTIVEDLKVDLKAEAEKADNSGPAATKRKV  296

Query  273  IFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            I+CTSL+W+ADGSTLFSGYTDGVIRVWGIGRY
Sbjct  297  IYCTSLNWSADGSTLFSGYTDGVIRVWGIGRY  328


 Score = 82.0 bits (201),  Expect(2) = 7e-53, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDA  458
            HTGYV+TVAVSPDGSLCASGGKDGV+LLWDLAEGKKLYS +A
Sbjct  194  HTGYVSTVAVSPDGSLCASGGKDGVVLLWDLAEGKKLYSFEA  235



>ref|XP_009147950.1| PREDICTED: LOW QUALITY PROTEIN: guanine nucleotide-binding protein 
subunit beta-like protein B [Brassica rapa]
Length=328

 Score =   151 bits (381),  Expect(2) = 8e-53, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G+IIH+LCFSPNRYWLCAATE SI+IWDLESKS+V DL+VDLK E+E S     T  K K
Sbjct  236  GAIIHSLCFSPNRYWLCAATENSIRIWDLESKSVVEDLKVDLKAEAEKSDASVGTGNKTK  295

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            +I+CTSL+W+ADGSTLFSGYTDGVIRVWG+GR+
Sbjct  296  VIYCTSLNWSADGSTLFSGYTDGVIRVWGLGRF  328


 Score = 83.2 bits (204),  Expect(2) = 8e-53, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H+GY+NTVAVSPDGSLCASGGKDG ILLWDLAEGKKLYSL+AG
Sbjct  194  HSGYLNTVAVSPDGSLCASGGKDGAILLWDLAEGKKLYSLEAG  236



>ref|XP_002281279.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Vitis vinifera]
 emb|CAN61810.1| hypothetical protein VITISV_026180 [Vitis vinifera]
Length=327

 Score =   148 bits (373),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 74/94 (79%), Positives = 81/94 (86%), Gaps = 1/94 (1%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAE-GNNTAAKN  280
            G+IIHALCFSPNRYWLCAATE SIKIWDLESKSIV DL+VDLK E+E S +       K 
Sbjct  234  GAIIHALCFSPNRYWLCAATEQSIKIWDLESKSIVEDLKVDLKTEAEKSEDTTTTAKKKG  293

Query  279  KIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            KII+CTSLSW+ADGSTLFSGYTDGV+RVWGIGRY
Sbjct  294  KIIYCTSLSWSADGSTLFSGYTDGVVRVWGIGRY  327


 Score = 85.5 bits (210),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 41/43 (95%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAG
Sbjct  192  HGGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAG  234



>ref|XP_008240184.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Prunus mume]
Length=327

 Score =   152 bits (383),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 72/94 (77%), Positives = 83/94 (88%), Gaps = 1/94 (1%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGN-NTAAKN  280
            G+IIHALCFSPNRYWLCAATE SIKIWDLESK IV DL+VDLK E+E + + +  TA K 
Sbjct  234  GAIIHALCFSPNRYWLCAATEQSIKIWDLESKQIVEDLKVDLKTEAEKTEDTHAATAYKK  293

Query  279  KIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            K+I+CTSL+W+ADGSTLFSGY+DGVIRVWGIGRY
Sbjct  294  KVIYCTSLNWSADGSTLFSGYSDGVIRVWGIGRY  327


 Score = 81.6 bits (200),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 40/43 (93%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGK LYSL AG
Sbjct  192  HNGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKMLYSLGAG  234



>ref|XP_008374821.1| PREDICTED: LOW QUALITY PROTEIN: guanine nucleotide-binding protein 
subunit beta-like protein [Malus domestica]
 ref|XP_008364648.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Malus domestica]
 ref|XP_009347770.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Pyrus x bretschneideri]
Length=326

 Score =   150 bits (378),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 83/93 (89%), Gaps = 1/93 (1%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGN-NTAAKN  280
            GSIIHALCFSPNRYWLCAATE SIKIWDLESKSIV +L+VDLK E+E + + +  T+ K 
Sbjct  234  GSIIHALCFSPNRYWLCAATEQSIKIWDLESKSIVEELKVDLKTEAEKTEDTHAATSYKK  293

Query  279  KIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGR  181
            K+I+CTSL+W+ADGSTLFSGYTDGVIRVWGIGR
Sbjct  294  KVIYCTSLNWSADGSTLFSGYTDGVIRVWGIGR  326


 Score = 83.6 bits (205),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LY L+AG
Sbjct  192  HNGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYHLEAG  234



>ref|XP_009360100.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Pyrus x bretschneideri]
Length=326

 Score =   150 bits (378),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 83/93 (89%), Gaps = 1/93 (1%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGN-NTAAKN  280
            GSIIHALCFSPNRYWLCAATE SIKIWDLESKSIV +L+VDLK E+E + + +  T+ K 
Sbjct  234  GSIIHALCFSPNRYWLCAATEQSIKIWDLESKSIVEELKVDLKTEAEKTEDTHAATSYKK  293

Query  279  KIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGR  181
            K+I+CTSL+W+ADGSTLFSGYTDGVIRVWGIGR
Sbjct  294  KVIYCTSLNWSADGSTLFSGYTDGVIRVWGIGR  326


 Score = 83.6 bits (205),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LY L+AG
Sbjct  192  HNGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYHLEAG  234



>ref|XP_008393404.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Malus domestica]
Length=326

 Score =   150 bits (378),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 83/93 (89%), Gaps = 1/93 (1%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGN-NTAAKN  280
            GSIIHALCFSPNRYWLCAATE SIKIWDLESKSIV +L+VDLK E+E + + +  T+ K 
Sbjct  234  GSIIHALCFSPNRYWLCAATEQSIKIWDLESKSIVEELKVDLKTEAEKTEDTHAATSYKK  293

Query  279  KIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGR  181
            K+I+CTSL+W+ADGSTLFSGYTDGVIRVWGIGR
Sbjct  294  KVIYCTSLNWSADGSTLFSGYTDGVIRVWGIGR  326


 Score = 83.6 bits (205),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LY L+AG
Sbjct  192  HNGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYHLEAG  234



>ref|XP_007209348.1| hypothetical protein PRUPE_ppa008536mg [Prunus persica]
 gb|EMJ10547.1| hypothetical protein PRUPE_ppa008536mg [Prunus persica]
Length=327

 Score =   152 bits (383),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 72/94 (77%), Positives = 83/94 (88%), Gaps = 1/94 (1%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGN-NTAAKN  280
            G+IIHALCFSPNRYWLCAATE SIKIWDLESK IV DL+VDLK E+E + + +  TA K 
Sbjct  234  GAIIHALCFSPNRYWLCAATEQSIKIWDLESKQIVEDLKVDLKTEAEKTEDTHAATAYKK  293

Query  279  KIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            K+I+CTSL+W+ADGSTLFSGY+DGVIRVWGIGRY
Sbjct  294  KVIYCTSLNWSADGSTLFSGYSDGVIRVWGIGRY  327


 Score = 81.6 bits (200),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 40/43 (93%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGK LYSL AG
Sbjct  192  HNGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKMLYSLGAG  234



>ref|XP_010500401.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein B [Camelina sativa]
Length=326

 Score =   148 bits (373),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            GS+IH+LCFSPNRYWLCAATE SI+IWDLESK++V DL+VDLK E+E S        K K
Sbjct  234  GSVIHSLCFSPNRYWLCAATENSIRIWDLESKTVVEDLKVDLKVEAEKSDGAVGIGNKTK  293

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            +I+CTSL+W+ADG+TLFSGYTDG+IRVWGIGRY
Sbjct  294  VIYCTSLNWSADGNTLFSGYTDGIIRVWGIGRY  326


 Score = 85.5 bits (210),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 43/48 (90%), Positives = 46/48 (96%), Gaps = 1/48 (2%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG-VNHS  443
            H+GY+NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AG V HS
Sbjct  192  HSGYLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGSVIHS  239



>ref|XP_009145001.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein B [Brassica rapa]
Length=327

 Score =   150 bits (378),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            GSIIH+LCFSPNRYWLCAATE SI+IWDLESKS+V DL+VDLK E+E S     T  K K
Sbjct  235  GSIIHSLCFSPNRYWLCAATENSIRIWDLESKSVVEDLKVDLKAEAEKSDVSAATGNKTK  294

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            +I+CTSL+W+ADG+TLFSGYTDGVIRVWGIG Y
Sbjct  295  VIYCTSLNWSADGNTLFSGYTDGVIRVWGIGHY  327


 Score = 83.2 bits (204),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H+GY+NTVAVSPDGSLCASGGKDG ILLWDLAEGKKLYSL+AG
Sbjct  193  HSGYLNTVAVSPDGSLCASGGKDGAILLWDLAEGKKLYSLEAG  235



>gb|AAM65407.1| guanine nucleotide-binding protein, putative [Arabidopsis thaliana]
Length=326

 Score =   148 bits (373),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            GSIIH+LCFSPNRYWLCAATE SI+IWDLESKS+V DL+VDLK E+E +        K K
Sbjct  234  GSIIHSLCFSPNRYWLCAATENSIRIWDLESKSVVEDLKVDLKAEAEKTDGSTGIGNKTK  293

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            +I+CTSL+W+ADG+TLFSGYT GVIRVWGIGRY
Sbjct  294  VIYCTSLNWSADGNTLFSGYTHGVIRVWGIGRY  326


 Score = 85.1 bits (209),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 40/43 (93%), Positives = 43/43 (100%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H+GY+NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AG
Sbjct  192  HSGYLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAG  234



>emb|CDY59680.1| BnaA05g36460D [Brassica napus]
Length=225

 Score =   150 bits (378),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 70/94 (74%), Positives = 80/94 (85%), Gaps = 0/94 (0%)
 Frame = -1

Query  459  PGSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKN  280
             GSIIH+LCFSPNRYWLCAATE SI+IWDLESKS+V DL+VDLK E+E S     T  K 
Sbjct  132  AGSIIHSLCFSPNRYWLCAATENSIRIWDLESKSVVEDLKVDLKAEAEKSDVSAATGNKT  191

Query  279  KIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            K+I+CTSL+W+ADG+TLFSGYTDGVIRVWGIG Y
Sbjct  192  KVIYCTSLNWSADGNTLFSGYTDGVIRVWGIGHY  225


 Score = 82.8 bits (203),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H+GY+NTVAVSPDGSLCASGGKDG ILLWDLAEGKKLYSL+AG
Sbjct  91   HSGYLNTVAVSPDGSLCASGGKDGAILLWDLAEGKKLYSLEAG  133



>emb|CDX95554.1| BnaC01g34460D [Brassica napus]
Length=326

 Score =   149 bits (377),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            GSIIH+LCFSPNRYWLCAATE+SIKIWDLESKS+V +L+VDLK E+E    G  T  + K
Sbjct  234  GSIIHSLCFSPNRYWLCAATESSIKIWDLESKSVVDELKVDLKAEAEKCDGGVGTGNQKK  293

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            + +CTSL+W+ADGSTLFSGYTDGV+RVWGIGRY
Sbjct  294  VNYCTSLNWSADGSTLFSGYTDGVVRVWGIGRY  326


 Score = 83.2 bits (204),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H+GY+NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+ G
Sbjct  192  HSGYLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEGG  234



>ref|XP_009113515.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein C [Brassica rapa]
Length=326

 Score =   149 bits (377),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            GSIIH+LCFSPNRYWLCAATE+SIKIWDLESKS+V +L+VDLK E+E    G  T  + K
Sbjct  234  GSIIHSLCFSPNRYWLCAATESSIKIWDLESKSVVDELKVDLKAEAEKCDGGVGTGNQKK  293

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            + +CTSL+W+ADGSTLFSGYTDGV+RVWGIGRY
Sbjct  294  VNYCTSLNWSADGSTLFSGYTDGVVRVWGIGRY  326


 Score = 82.8 bits (203),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H+GY+NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+ G
Sbjct  192  HSGYLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEGG  234



>emb|CDY18497.1| BnaA01g26980D [Brassica napus]
Length=326

 Score =   149 bits (377),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            GSIIH+LCFSPNRYWLCAATE+SIKIWDLESKS+V +L+VDLK E+E    G  T  + K
Sbjct  234  GSIIHSLCFSPNRYWLCAATESSIKIWDLESKSVVDELKVDLKAEAEKCDGGVGTGNQKK  293

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            + +CTSL+W+ADGSTLFSGYTDGV+RVWGIGRY
Sbjct  294  VNYCTSLNWSADGSTLFSGYTDGVVRVWGIGRY  326


 Score = 82.8 bits (203),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H+GY+NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+ G
Sbjct  192  HSGYLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEGG  234



>ref|XP_010479287.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein B [Camelina sativa]
Length=326

 Score =   146 bits (369),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            GS+IH+LCFSPNRYWLCAATE SI+IWDLESK++V DL+VDLK E+E S        K K
Sbjct  234  GSVIHSLCFSPNRYWLCAATENSIRIWDLESKTVVEDLKVDLKVEAEKSDGAVGIGNKTK  293

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            +I+CTSL+W+ADG+TLFSGYTDG+IRVWGIGR+
Sbjct  294  VIYCTSLNWSADGNTLFSGYTDGIIRVWGIGRF  326


 Score = 85.5 bits (210),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 43/48 (90%), Positives = 46/48 (96%), Gaps = 1/48 (2%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG-VNHS  443
            H+GY+NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AG V HS
Sbjct  192  HSGYLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGSVIHS  239



>ref|XP_011039103.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Populus euphratica]
Length=328

 Score =   143 bits (361),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 69/94 (73%), Positives = 80/94 (85%), Gaps = 1/94 (1%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTA-AKN  280
            G++I+ALCFSPNRYWLCAATE SIKIWDLESK +V DL+VDLK E+E S     TA +  
Sbjct  235  GAVINALCFSPNRYWLCAATENSIKIWDLESKMVVDDLKVDLKAEAEKSEGTTATAVSTK  294

Query  279  KIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            K I+CTSL+W+ADGSTLFSGYTDGVIRVWG+GRY
Sbjct  295  KKIYCTSLNWSADGSTLFSGYTDGVIRVWGVGRY  328


 Score = 88.6 bits (218),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 46/50 (92%), Gaps = 2/50 (4%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG--VNHSC  440
            H+GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  +N  C
Sbjct  193  HSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGAVINALC  242



>ref|XP_002318528.1| GTP-binding protein beta chain [Populus trichocarpa]
 gb|EEE96748.1| GTP-binding protein beta chain [Populus trichocarpa]
Length=328

 Score =   143 bits (361),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 69/94 (73%), Positives = 80/94 (85%), Gaps = 1/94 (1%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTA-AKN  280
            G++I+ALCFSPNRYWLCAATE SIKIWDLESK +V DL+VDLK E+E S     TA +  
Sbjct  235  GAVINALCFSPNRYWLCAATENSIKIWDLESKMVVDDLKVDLKAEAEKSEGTTATAVSTK  294

Query  279  KIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            K I+CTSL+W+ADGSTLFSGYTDGVIRVWG+GRY
Sbjct  295  KKIYCTSLNWSADGSTLFSGYTDGVIRVWGVGRY  328


 Score = 88.6 bits (218),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 46/50 (92%), Gaps = 2/50 (4%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG--VNHSC  440
            H+GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  +N  C
Sbjct  193  HSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGAVINALC  242



>ref|XP_010461692.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein B [Camelina sativa]
Length=326

 Score =   146 bits (369),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            GS+IH+LCFSPNRYWLCAATE SI+IWDLESK +V DL+VDLK E+E S        K K
Sbjct  234  GSVIHSLCFSPNRYWLCAATENSIRIWDLESKIVVEDLKVDLKVEAEKSDGAVGIGNKTK  293

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            +I+CTSL+W+ADG+TLFSGYTDG+IRVWGIGRY
Sbjct  294  VIYCTSLNWSADGNTLFSGYTDGIIRVWGIGRY  326


 Score = 85.5 bits (210),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 43/48 (90%), Positives = 46/48 (96%), Gaps = 1/48 (2%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG-VNHS  443
            H+GY+NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AG V HS
Sbjct  192  HSGYLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGSVIHS  239



>ref|XP_011039104.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Populus euphratica]
Length=328

 Score =   143 bits (360),  Expect(2) = 5e-52, Method: Compositional matrix adjust.
 Identities = 69/94 (73%), Positives = 80/94 (85%), Gaps = 1/94 (1%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTA-AKN  280
            G++I+ALCFSPNRYWLCAATE SIKIWDLESK +V DL+VDLK E+E S     TA +  
Sbjct  235  GAVINALCFSPNRYWLCAATENSIKIWDLESKLVVDDLKVDLKAEAEKSEGTTATAVSTK  294

Query  279  KIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            K I+CTSL+W+ADGSTLFSGYTDGVIRVWG+GRY
Sbjct  295  KKIYCTSLNWSADGSTLFSGYTDGVIRVWGVGRY  328


 Score = 88.6 bits (218),  Expect(2) = 5e-52, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 46/50 (92%), Gaps = 2/50 (4%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG--VNHSC  440
            H+GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  +N  C
Sbjct  193  HSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGAVINALC  242



>emb|CAA06154.1| arcA 3 [Nicotiana tabacum]
Length=290

 Score =   145 bits (366),  Expect(2) = 6e-52, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 82/93 (88%), Gaps = 2/93 (2%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            GSIIH+LCFSPNRYWLCAATE+SIKIWDLESKSIVVDL+VDLKQESEMSAEG   AAKNK
Sbjct  200  GSIIHSLCFSPNRYWLCAATESSIKIWDLESKSIVVDLKVDLKQESEMSAEG-TAAAKNK  258

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            II+CT LSW+ADGSTLF G T  V+  +G GRY
Sbjct  259  IIYCTCLSWSADGSTLFGG-TQMVLIEYGDGRY  290


 Score = 85.9 bits (211),  Expect(2) = 6e-52, Method: Compositional matrix adjust.
 Identities = 41/43 (95%), Positives = 43/43 (100%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H+GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AG
Sbjct  158  HSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAG  200



>emb|CDY71917.1| BnaCnng75080D [Brassica napus]
Length=244

 Score =   151 bits (382),  Expect(2) = 7e-52, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 83/93 (89%), Gaps = 3/93 (3%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            GSIIH+LCFSPNRYWLCAATE SI+IWDLESKS+V DL+VDLK ES++SA    T  K K
Sbjct  155  GSIIHSLCFSPNRYWLCAATENSIRIWDLESKSVVEDLKVDLKAESDVSA---GTGNKTK  211

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            +I+CTSL+W+ADG+TLFSGYTDGVIRVWGIGRY
Sbjct  212  VIYCTSLNWSADGNTLFSGYTDGVIRVWGIGRY  244


 Score = 79.3 bits (194),  Expect(2) = 7e-52, Method: Compositional matrix adjust.
 Identities = 38/43 (88%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H+GY+NTVAVSPDGSLCASGGKDG ILLWDLAEGKKLY L+AG
Sbjct  113  HSGYLNTVAVSPDGSLCASGGKDGGILLWDLAEGKKLYCLEAG  155



>emb|CDY44104.1| BnaA01g13120D [Brassica napus]
 emb|CDX93686.1| BnaA06g03620D [Brassica napus]
 emb|CDX86074.1| BnaC03g55890D [Brassica napus]
Length=298

 Score =   146 bits (369),  Expect(2) = 8e-52, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G+IIH+LCFSPNRYWLCAATE SI+IWDLESKS+V DL+VDLK E+E S     T  K K
Sbjct  206  GAIIHSLCFSPNRYWLCAATENSIRIWDLESKSVVEDLKVDLKAEAEKSDASVGTGNKTK  265

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            +I CTSL+W+ADGSTLF GYTDGVIRVWG+GR+
Sbjct  266  VICCTSLNWSADGSTLFGGYTDGVIRVWGLGRF  298


 Score = 84.3 bits (207),  Expect(2) = 8e-52, Method: Compositional matrix adjust.
 Identities = 40/43 (93%), Positives = 43/43 (100%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H+GY+NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+AG
Sbjct  164  HSGYLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAG  206



>ref|XP_009145932.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein C [Brassica rapa]
Length=325

 Score =   146 bits (369),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 81/93 (87%), Gaps = 1/93 (1%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            GSIIH+LCFSPNRYWLCAATE+SIKIWDLESK++V +L+VDLK E+E    G  T  + K
Sbjct  234  GSIIHSLCFSPNRYWLCAATESSIKIWDLESKTVVDELKVDLKAEAEKDG-GAGTGNQKK  292

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            + +CTSL+W+ADGSTLFSGYTDGV+RVWGIGRY
Sbjct  293  VNYCTSLNWSADGSTLFSGYTDGVVRVWGIGRY  325


 Score = 82.8 bits (203),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H+GY+NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+ G
Sbjct  192  HSGYLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEGG  234



>emb|CDX92200.1| BnaA05g22070D [Brassica napus]
Length=325

 Score =   146 bits (369),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 81/93 (87%), Gaps = 1/93 (1%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            GSIIH+LCFSPNRYWLCAATE+SIKIWDLESK++V +L+VDLK E+E    G  T  + K
Sbjct  234  GSIIHSLCFSPNRYWLCAATESSIKIWDLESKTVVDELKVDLKAEAEKDG-GAGTGNQKK  292

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            + +CTSL+W+ADGSTLFSGYTDGV+RVWGIGRY
Sbjct  293  VNYCTSLNWSADGSTLFSGYTDGVVRVWGIGRY  325


 Score = 82.8 bits (203),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H+GY+NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+ G
Sbjct  192  HSGYLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEGG  234



>emb|CDX95784.1| BnaC05g35350D [Brassica napus]
Length=325

 Score =   146 bits (369),  Expect(2) = 4e-51, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 81/93 (87%), Gaps = 1/93 (1%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            GSIIH+LCFSPNRYWLCAATE+SIKIWDLESK++V +L+VDLK E+E    G  T  + K
Sbjct  234  GSIIHSLCFSPNRYWLCAATESSIKIWDLESKTVVDELKVDLKAEAEKDG-GAGTGNQKK  292

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            + +CTSL+W+ADGSTLFSGYTDGV+RVWGIGRY
Sbjct  293  VNYCTSLNWSADGSTLFSGYTDGVVRVWGIGRY  325


 Score = 82.0 bits (201),  Expect(2) = 4e-51, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H GY+NTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL+ G
Sbjct  192  HLGYLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEGG  234



>ref|XP_011000479.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Populus euphratica]
Length=328

 Score =   139 bits (351),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 71/95 (75%), Positives = 81/95 (85%), Gaps = 3/95 (3%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEG--NNTAAK  283
            G++I+ALCFSPNRYWLCAATE SIKIWDLESK +V DL+VDLK E+E S EG     A+ 
Sbjct  235  GAVINALCFSPNRYWLCAATENSIKIWDLESKLVVDDLKVDLKAEAEKS-EGTTATAAST  293

Query  282  NKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
             K I+CTSL+W+ADGSTLFSGYTDGVIRVWGIGRY
Sbjct  294  TKKIYCTSLNWSADGSTLFSGYTDGVIRVWGIGRY  328


 Score = 85.9 bits (211),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 45/50 (90%), Gaps = 2/50 (4%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG--VNHSC  440
            H GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAG  +N  C
Sbjct  193  HGGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAGAVINALC  242



>ref|XP_004503304.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein-like [Cicer arietinum]
Length=317

 Score =   153 bits (386),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 81/93 (87%), Gaps = 4/93 (4%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            GSIIHALCFSPNRYWLCAATE SIKIWDLESKSIV DL+VDLK E+E  +E      K K
Sbjct  229  GSIIHALCFSPNRYWLCAATETSIKIWDLESKSIVEDLKVDLKAEAESGSE----TTKKK  284

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            +I+CTSL+W+ADGSTLFSGYTDGV+RVWGIGRY
Sbjct  285  VIYCTSLNWSADGSTLFSGYTDGVVRVWGIGRY  317


 Score = 70.9 bits (172),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG  482
            H+GYVNTVAVSPDGSLCASGGKDGVILLWDLAEG
Sbjct  192  HSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEG  225



>ref|XP_002321505.1| GTP-binding protein beta chain [Populus trichocarpa]
 gb|ABK92879.1| unknown [Populus trichocarpa]
 gb|EEF05632.1| GTP-binding protein beta chain [Populus trichocarpa]
Length=328

 Score =   137 bits (344),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 68/94 (72%), Positives = 78/94 (83%), Gaps = 1/94 (1%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMS-AEGNNTAAKN  280
            G++I+ALCFSPNRYWLCAATE SIKIWDLESK +V DL+VDLK E+E S       A+  
Sbjct  235  GAVINALCFSPNRYWLCAATENSIKIWDLESKLVVDDLKVDLKAEAEKSEGTTGTAASTT  294

Query  279  KIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            K I+CT L+W+ADGSTLFSGYTDGVIRVWGIGRY
Sbjct  295  KKIYCTCLNWSADGSTLFSGYTDGVIRVWGIGRY  328


 Score = 85.9 bits (211),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 45/50 (90%), Gaps = 2/50 (4%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG--VNHSC  440
            H GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAG  +N  C
Sbjct  193  HGGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAGAVINALC  242



>ref|XP_011084467.1| PREDICTED: LOW QUALITY PROTEIN: guanine nucleotide-binding protein 
subunit beta-like protein [Sesamum indicum]
Length=318

 Score =   165 bits (418),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 77/94 (82%), Positives = 89/94 (95%), Gaps = 1/94 (1%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGN-NTAAKN  280
            GSII+ALCFSPNRYWLCAATE+SIKIWDLESKS+VVDL+VDLKQESE++ EG   T+ KN
Sbjct  225  GSIINALCFSPNRYWLCAATESSIKIWDLESKSVVVDLKVDLKQESELATEGTAPTSGKN  284

Query  279  KIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            K+I+CTSL+W+ADGSTLFSGYTDGV+RVWGIGRY
Sbjct  285  KVIYCTSLNWSADGSTLFSGYTDGVVRVWGIGRY  318


 Score = 54.7 bits (130),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 25/26 (96%), Positives = 26/26 (100%), Gaps = 0/26 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVI  506
            H+GYVNTVAVSPDGSLCASGGKDGVI
Sbjct  193  HSGYVNTVAVSPDGSLCASGGKDGVI  218



>ref|XP_010256121.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Nelumbo nucifera]
Length=314

 Score =   132 bits (332),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 74/93 (80%), Gaps = 12/93 (13%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G+IIHALCFSPNRYWLCAAT+ S+KIWDLESKSIV DL+ +  Q             KN+
Sbjct  234  GAIIHALCFSPNRYWLCAATQDSVKIWDLESKSIVQDLKPEATQ------------GKNQ  281

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            +++CTSLSW++DGSTLF+GYTDG IRVWGIGRY
Sbjct  282  MLYCTSLSWSSDGSTLFTGYTDGSIRVWGIGRY  314


 Score = 83.6 bits (205),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 40/43 (93%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H GYVNTVAVSPDGSLCASGGKDGV LLWDLAEGK+LYSLDAG
Sbjct  192  HGGYVNTVAVSPDGSLCASGGKDGVTLLWDLAEGKRLYSLDAG  234



>emb|CAC09579.1| gbf1 protein [Fagus sylvatica]
Length=267

 Score =   128 bits (322),  Expect(2) = 3e-47, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 71/85 (84%), Gaps = 1/85 (1%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNN-TAAKN  280
            G+IIHALCFSPNRYWLCAATE SIKIWDLESKSIV DL+VDLK E+    +     + K 
Sbjct  181  GAIIHALCFSPNRYWLCAATEQSIKIWDLESKSIVEDLKVDLKTEAADKDDATTINSTKK  240

Query  279  KIIFCTSLSWNADGSTLFSGYTDGV  205
            K+I+CTSL+W+ADGSTLFSGYTDGV
Sbjct  241  KVIYCTSLNWSADGSTLFSGYTDGV  265


 Score = 87.0 bits (214),  Expect(2) = 3e-47, Method: Compositional matrix adjust.
 Identities = 41/43 (95%), Positives = 43/43 (100%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H+GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAG
Sbjct  139  HSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAG  181



>ref|XP_010243791.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Nelumbo nucifera]
Length=314

 Score =   132 bits (331),  Expect(2) = 3e-47, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 74/93 (80%), Gaps = 12/93 (13%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G+IIH+LCFSPNRYWLCAAT+ S+KIWDLESKSIV DL+ +  Q             KN+
Sbjct  234  GAIIHSLCFSPNRYWLCAATQDSVKIWDLESKSIVQDLKPEATQ------------GKNQ  281

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            +++CTSLSW++DGSTLF+GYTDG IRVWGIGRY
Sbjct  282  MLYCTSLSWSSDGSTLFTGYTDGAIRVWGIGRY  314


 Score = 83.6 bits (205),  Expect(2) = 3e-47, Method: Compositional matrix adjust.
 Identities = 40/43 (93%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H GYVNTVAVSPDGSLCASGGKDGV LLWDLAEGK+LYSLDAG
Sbjct  192  HGGYVNTVAVSPDGSLCASGGKDGVTLLWDLAEGKRLYSLDAG  234



>ref|XP_010916329.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Elaeis guineensis]
Length=324

 Score =   130 bits (326),  Expect(2) = 5e-46, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 75/93 (81%), Gaps = 12/93 (13%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G+II+ALCFSPNRYWLCAAT+ S+KIWDLESKSIV     DLK E+  S        KN+
Sbjct  244  GAIIYALCFSPNRYWLCAATQDSVKIWDLESKSIV----QDLKPETPTS--------KNQ  291

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            I++CTSL+W+ADGSTLF+GYTDGVIRVWGI RY
Sbjct  292  ILYCTSLNWSADGSTLFTGYTDGVIRVWGISRY  324


 Score = 81.3 bits (199),  Expect(2) = 5e-46, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H GYVN VAVSPDGSLCASGGKDGV LLWDLAEGK+LYSLDAG
Sbjct  202  HGGYVNAVAVSPDGSLCASGGKDGVTLLWDLAEGKRLYSLDAG  244



>ref|XP_006837182.1| hypothetical protein AMTR_s00105p00058690 [Amborella trichopoda]
 gb|ERN00036.1| hypothetical protein AMTR_s00105p00058690 [Amborella trichopoda]
Length=314

 Score =   129 bits (325),  Expect(2) = 6e-46, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 70/93 (75%), Gaps = 12/93 (13%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G IIHALCFSPNRYWLCAATE S+KIWDLESKSIV DL+ D                KN+
Sbjct  234  GGIIHALCFSPNRYWLCAATEESVKIWDLESKSIVQDLKTDAPTN------------KNQ  281

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            +++CTSLSW+ DGSTLF+GYTDG IRVW +GRY
Sbjct  282  MLYCTSLSWSTDGSTLFTGYTDGAIRVWVVGRY  314


 Score = 81.6 bits (200),  Expect(2) = 6e-46, Method: Compositional matrix adjust.
 Identities = 38/43 (88%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H GYVN+VAVSPDGSLCASGGKDGV LLWDLAEGK+LYSL+AG
Sbjct  192  HAGYVNSVAVSPDGSLCASGGKDGVTLLWDLAEGKRLYSLEAG  234



>ref|XP_010924141.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Elaeis guineensis]
Length=323

 Score =   127 bits (319),  Expect(2) = 8e-46, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 73/93 (78%), Gaps = 12/93 (13%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G+IIH+LCFSPNRYWLCAAT+ S+KIWDLESKSIV     DLK E+  S        KN+
Sbjct  243  GAIIHSLCFSPNRYWLCAATQESVKIWDLESKSIV----QDLKPETPTS--------KNQ  290

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            +++CTSLSW+ADGSTLF+GYTDG IRVW I RY
Sbjct  291  MLYCTSLSWSADGSTLFTGYTDGTIRVWEISRY  323


 Score = 83.6 bits (205),  Expect(2) = 8e-46, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H+GYVN VAVSPDGSLCASGGKDGV LLWDLAEGK+LYSLDAG
Sbjct  201  HSGYVNAVAVSPDGSLCASGGKDGVTLLWDLAEGKRLYSLDAG  243



>ref|XP_008803271.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Phoenix dactylifera]
Length=323

 Score =   127 bits (318),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 74/93 (80%), Gaps = 12/93 (13%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G+IIH+LCFSPNRYWLCAAT+ S+KIWDLESKSIV     DLK E+ +S        KN+
Sbjct  243  GAIIHSLCFSPNRYWLCAATQDSVKIWDLESKSIV----QDLKPETPIS--------KNQ  290

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            +++CTSLSW+ADGSTLF+GYTDG IRVW I RY
Sbjct  291  MLYCTSLSWSADGSTLFTGYTDGTIRVWEITRY  323


 Score = 81.6 bits (200),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H GYVN VAVSPDGSLCASGGKDGV LLWDLAEGK+LYSLDAG
Sbjct  201  HGGYVNAVAVSPDGSLCASGGKDGVTLLWDLAEGKRLYSLDAG  243



>ref|XP_010430893.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A, partial [Camelina sativa]
Length=284

 Score =   126 bits (317),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = -1

Query  453  SIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKI  274
            S+IHALCFSPNRYWLCAATE  IKIWDLESK+IV DL+VDLK E+E +      A K K+
Sbjct  170  SVIHALCFSPNRYWLCAATEQGIKIWDLESKTIVEDLKVDLKAEAEKADNSGPAATKRKV  229

Query  273  IFCTSLSWNADGSTLFSGYTD  211
            I+CTSL+W+ADGSTLFSGYT+
Sbjct  230  IYCTSLNWSADGSTLFSGYTE  250


 Score = 81.6 bits (200),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 38/43 (88%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGYV+TVAVSPDGSLCASGGKDGV+LLWDLAEGKKLYS +A 
Sbjct  127  HTGYVSTVAVSPDGSLCASGGKDGVVLLWDLAEGKKLYSFEAN  169



>ref|XP_009400497.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Musa acuminata subsp. malaccensis]
Length=324

 Score =   123 bits (309),  Expect(2) = 6e-45, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 72/93 (77%), Gaps = 13/93 (14%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G+IIH+LCFSPNRYWLCAAT+ S+KIWDLESKSIV DL+ +             T  KN+
Sbjct  245  GAIIHSLCFSPNRYWLCAATQESVKIWDLESKSIVQDLKPE------------TTGTKNQ  292

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            +++CTSL+W+ADGSTLF+GYTDG IRVW I RY
Sbjct  293  MLYCTSLTWSADGSTLFTGYTDGTIRVWEI-RY  324


 Score = 84.3 bits (207),  Expect(2) = 6e-45, Method: Compositional matrix adjust.
 Identities = 40/43 (93%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H GYVNTVAVSPDGSLCASGGKDGV LLWDLAEGK+LYSLDAG
Sbjct  203  HAGYVNTVAVSPDGSLCASGGKDGVTLLWDLAEGKRLYSLDAG  245



>ref|XP_009405003.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Musa acuminata subsp. malaccensis]
Length=324

 Score =   122 bits (307),  Expect(2) = 6e-45, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 72/93 (77%), Gaps = 13/93 (14%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G+IIH+LCFSPNRYWLCAAT+ S+KIWDLESK+IV DL+ +             T  KN+
Sbjct  245  GAIIHSLCFSPNRYWLCAATQESVKIWDLESKTIVQDLKPE------------TTTTKNQ  292

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            +++CTSL+W+ADGSTLF+GYTDG IRVW I RY
Sbjct  293  MLYCTSLTWSADGSTLFTGYTDGTIRVWEI-RY  324


 Score = 85.1 bits (209),  Expect(2) = 6e-45, Method: Compositional matrix adjust.
 Identities = 40/43 (93%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H+GYVNTVAVSPDGSLCASGGKDGV LLWDLAEGK+LYSLDAG
Sbjct  203  HSGYVNTVAVSPDGSLCASGGKDGVTLLWDLAEGKRLYSLDAG  245



>ref|XP_010495439.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Camelina sativa]
Length=308

 Score =   125 bits (313),  Expect(2) = 9e-45, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = -1

Query  453  SIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKI  274
            S+IHALCFSPNRYWLCAATE  IKIWDLESK+IV DL+VDL+ E+E +      A K K+
Sbjct  194  SVIHALCFSPNRYWLCAATEQGIKIWDLESKTIVEDLKVDLEAEAEKADHRGPAATKRKV  253

Query  273  IFCTSLSWNADGSTLFSGYTD  211
            I+CTSL+W+ADGSTLFSGYT+
Sbjct  254  IYCTSLNWSADGSTLFSGYTE  274


 Score = 82.0 bits (201),  Expect(2) = 9e-45, Method: Compositional matrix adjust.
 Identities = 38/43 (88%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGYV+TVAVSPDGSLCASGGKDGV+LLWDLAEGKKLYS +A 
Sbjct  151  HTGYVSTVAVSPDGSLCASGGKDGVVLLWDLAEGKKLYSFEAN  193



>dbj|BAF47116.1| G protein beta-subunit-like protein [Nicotiana tabacum]
Length=144

 Score =   122 bits (306),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 64/73 (88%), Gaps = 1/73 (1%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEG-NNTAAKN  280
            GSIIHALCFSPNRYWLCAATE SIKIWDLESKS+VVDL+VDLKQESEM+ EG    A KN
Sbjct  72   GSIIHALCFSPNRYWLCAATETSIKIWDLESKSVVVDLKVDLKQESEMATEGTTGPACKN  131

Query  279  KIIFCTSLSWNAD  241
            KI++CT LSW AD
Sbjct  132  KIMYCTCLSWCAD  144


 Score = 84.3 bits (207),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 41/43 (95%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H GYVNTVAVSPDGSLCASGGKDG ILLWDLAEGKKLYSLDAG
Sbjct  30   HGGYVNTVAVSPDGSLCASGGKDGTILLWDLAEGKKLYSLDAG  72



>ref|XP_010923802.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Elaeis guineensis]
Length=323

 Score =   124 bits (312),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 73/93 (78%), Gaps = 12/93 (13%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G+II+ALCFSPNRYWLCAAT+ S+KIWDLESKSIV     DLK E+  S        KN+
Sbjct  243  GAIIYALCFSPNRYWLCAATQDSVKIWDLESKSIV----QDLKPETPTS--------KNQ  290

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            +++CTSLSW+ADGSTLF+GYTDG IRVW + RY
Sbjct  291  MLYCTSLSWSADGSTLFTGYTDGTIRVWEVSRY  323


 Score = 80.9 bits (198),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 38/43 (88%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H GYVN VAVSPDGSLCASGGKDG+ LLWDLAEGK+LYSLDAG
Sbjct  201  HGGYVNAVAVSPDGSLCASGGKDGITLLWDLAEGKRLYSLDAG  243



>ref|NP_001136800.1| guanine nucleotide-binding protein beta subunit-like protein 
[Zea mays]
 gb|ACF82664.1| unknown [Zea mays]
 gb|ACG34796.1| guanine nucleotide-binding protein beta subunit-like protein 
[Zea mays]
 gb|AFW81011.1| guanine nucleotide-binding protein beta subunit-like protein 
[Zea mays]
Length=334

 Score =   124 bits (311),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 72/93 (77%), Gaps = 12/93 (13%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            GSIIH+LCFSPNRYWLCAAT+ S+KIWDLESK +V DL+ D++             +KN+
Sbjct  250  GSIIHSLCFSPNRYWLCAATQDSVKIWDLESKHVVQDLKPDIQ------------VSKNQ  297

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            I++CTSLSW+ADGSTL++GYTDG IRVW I  Y
Sbjct  298  ILYCTSLSWSADGSTLYTGYTDGSIRVWKISGY  330


 Score = 80.9 bits (198),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H GYVN VAVSPDGSLCASGGKDGV LLWDLAEGK+LYSLDAG
Sbjct  208  HGGYVNAVAVSPDGSLCASGGKDGVTLLWDLAEGKRLYSLDAG  250



>gb|ACL54313.1| unknown [Zea mays]
Length=334

 Score =   124 bits (310),  Expect(2) = 6e-44, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 72/93 (77%), Gaps = 12/93 (13%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            GSIIH+LCFSPNRYWLCAAT+ S+KIWDLESK +V DL+ D++             +KN+
Sbjct  250  GSIIHSLCFSPNRYWLCAATQDSVKIWDLESKHVVQDLKPDIQ------------ISKNQ  297

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            I++CTSLSW+ADGSTL++GYTDG IRVW I  Y
Sbjct  298  ILYCTSLSWSADGSTLYTGYTDGSIRVWKISGY  330


 Score = 80.9 bits (198),  Expect(2) = 6e-44, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H GYVN VAVSPDGSLCASGGKDGV LLWDLAEGK+LYSLDAG
Sbjct  208  HGGYVNAVAVSPDGSLCASGGKDGVTLLWDLAEGKRLYSLDAG  250



>ref|XP_008812615.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Phoenix dactylifera]
Length=331

 Score =   125 bits (315),  Expect(2) = 6e-44, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 73/93 (78%), Gaps = 12/93 (13%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G+IIHALCFSPNRYWLCAAT+ S+KIWDLE+KSIV     DLK E+  S        KN+
Sbjct  251  GAIIHALCFSPNRYWLCAATQDSVKIWDLENKSIV----QDLKPETPTS--------KNQ  298

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            +++CTSLSW+ADGSTLF+GYTDG IRVW + RY
Sbjct  299  MLYCTSLSWSADGSTLFTGYTDGTIRVWEVSRY  331


 Score = 78.6 bits (192),  Expect(2) = 6e-44, Method: Compositional matrix adjust.
 Identities = 37/43 (86%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H GYV+ VAVSPDGSLCASGGKDG+ LLWDLAEGK+LYSLDAG
Sbjct  209  HGGYVSAVAVSPDGSLCASGGKDGITLLWDLAEGKRLYSLDAG  251



>ref|NP_001146976.1| LOC100280585 [Zea mays]
 gb|ACG24854.1| guanine nucleotide-binding protein beta subunit-like protein 
[Zea mays]
 gb|AFW79043.1| guanine nucleotide-binding protein beta subunit-like protein 
[Zea mays]
Length=334

 Score =   123 bits (309),  Expect(2) = 6e-44, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 72/93 (77%), Gaps = 12/93 (13%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            GSIIH+LCFSPNRYWLCAAT+ S+KIWDLESK +V DL+ D++             +KN+
Sbjct  250  GSIIHSLCFSPNRYWLCAATQDSVKIWDLESKHVVQDLKPDIQ------------ISKNQ  297

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            I++CTSLSW+ADGSTL++GYTDG IRVW I  Y
Sbjct  298  ILYCTSLSWSADGSTLYTGYTDGSIRVWKISGY  330


 Score = 80.9 bits (198),  Expect(2) = 6e-44, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H GYVN VAVSPDGSLCASGGKDGV LLWDLAEGK+LYSLDAG
Sbjct  208  HGGYVNAVAVSPDGSLCASGGKDGVTLLWDLAEGKRLYSLDAG  250



>gb|ABK26798.1| unknown [Picea sitchensis]
 gb|ACN40746.1| unknown [Picea sitchensis]
 gb|ACN40912.1| unknown [Picea sitchensis]
Length=316

 Score =   123 bits (308),  Expect(2) = 8e-44, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 67/92 (73%), Gaps = 11/92 (12%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G II+ALCFSPNRYWLCAAT+  +KIWDLESKSIV DLR D                K +
Sbjct  235  GDIIYALCFSPNRYWLCAATQQCVKIWDLESKSIVADLRPDFIPNK-----------KAQ  283

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGR  181
            I +CTSLSW+ADGSTLFSGYTDG IRVWGIG 
Sbjct  284  IPYCTSLSWSADGSTLFSGYTDGKIRVWGIGH  315


 Score = 80.9 bits (198),  Expect(2) = 8e-44, Method: Compositional matrix adjust.
 Identities = 38/43 (88%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H GYVNT AVSPDGSLCASGGKDGV +LWDLAEGK+LYSLDAG
Sbjct  193  HGGYVNTAAVSPDGSLCASGGKDGVTMLWDLAEGKRLYSLDAG  235



>dbj|BAF47119.1| G protein beta-subunit-like protein [Nicotiana tabacum]
Length=144

 Score =   121 bits (304),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 58/73 (79%), Positives = 65/73 (89%), Gaps = 1/73 (1%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEG-NNTAAKN  280
            GSIIHALCFSPNRYWLCAATE SIKIWDLESKS+VVDL+VDL+QESEM+ EG   +A KN
Sbjct  72   GSIIHALCFSPNRYWLCAATETSIKIWDLESKSVVVDLKVDLEQESEMATEGTTGSACKN  131

Query  279  KIIFCTSLSWNAD  241
            KI++CT LSW AD
Sbjct  132  KIMYCTCLSWCAD  144


 Score = 82.0 bits (201),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 40/43 (93%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H GYVNTVAVSPDGSLCAS GKDG ILLWDLAEGKKLYSLDAG
Sbjct  30   HGGYVNTVAVSPDGSLCASRGKDGTILLWDLAEGKKLYSLDAG  72



>ref|XP_002440202.1| hypothetical protein SORBIDRAFT_09g027690 [Sorghum bicolor]
 gb|EES18632.1| hypothetical protein SORBIDRAFT_09g027690 [Sorghum bicolor]
Length=334

 Score =   122 bits (307),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 72/93 (77%), Gaps = 12/93 (13%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            GSIIH+LCFSPNRYWLCAAT+ S+KIWDLESK +V DL+ D++             +KN+
Sbjct  250  GSIIHSLCFSPNRYWLCAATQDSVKIWDLESKHVVQDLKPDIQ------------ISKNQ  297

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            I++C+SLSW+ADGSTL++GYTDG IRVW I  Y
Sbjct  298  ILYCSSLSWSADGSTLYTGYTDGSIRVWKISAY  330


 Score = 80.9 bits (198),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H GYVN VAVSPDGSLCASGGKDGV LLWDLAEGK+LYSLDAG
Sbjct  208  HGGYVNAVAVSPDGSLCASGGKDGVTLLWDLAEGKRLYSLDAG  250



>ref|XP_009380503.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Musa acuminata subsp. malaccensis]
Length=323

 Score =   122 bits (305),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 73/93 (78%), Gaps = 13/93 (14%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G+IIH+LCFSPNRYWLCAAT+ S+KIWDLESKSIV DL+ ++            T  KN+
Sbjct  244  GAIIHSLCFSPNRYWLCAATQESVKIWDLESKSIVQDLKPEI------------TTTKNQ  291

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            +++CTSL+W+A+GSTLF+GYTDG IRVW I RY
Sbjct  292  MLYCTSLTWSANGSTLFTGYTDGTIRVWEI-RY  323


 Score = 80.9 bits (198),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H G VNTVAVSPDGSLCASGGKDGV LLWDLAEGK+LYSLDAG
Sbjct  202  HAGSVNTVAVSPDGSLCASGGKDGVTLLWDLAEGKRLYSLDAG  244



>gb|ABK25010.1| unknown [Picea sitchensis]
 gb|ACN41136.1| unknown [Picea sitchensis]
Length=321

 Score =   123 bits (308),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 70/92 (76%), Gaps = 11/92 (12%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G II++LCFSPNRYWLCAAT+  +KIWDLESKS+V +LR +            N   K +
Sbjct  240  GDIINSLCFSPNRYWLCAATQQCVKIWDLESKSVVEELRPNF-----------NPTKKGQ  288

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGR  181
            + FCTSL+W+ADGSTLFSGYTDGVIRVWG+GR
Sbjct  289  VPFCTSLAWSADGSTLFSGYTDGVIRVWGVGR  320


 Score = 79.0 bits (193),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 43/50 (86%), Gaps = 2/50 (4%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG--VNHSC  440
            H+GY+NT  VSPDGSLCASGGKDGV +LWDLAEGK+LYSLD+G  +N  C
Sbjct  198  HSGYINTCTVSPDGSLCASGGKDGVAMLWDLAEGKRLYSLDSGDIINSLC  247



>gb|ACN41093.1| unknown [Picea sitchensis]
Length=321

 Score =   123 bits (308),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 70/92 (76%), Gaps = 11/92 (12%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G II++LCFSPNRYWLCAAT+  +KIWDLESKS+V +LR +            N   K +
Sbjct  240  GDIINSLCFSPNRYWLCAATQQCVKIWDLESKSVVEELRPNF-----------NPTKKGQ  288

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGR  181
            + FCTSL+W+ADGSTLFSGYTDGVIRVWG+GR
Sbjct  289  VPFCTSLAWSADGSTLFSGYTDGVIRVWGVGR  320


 Score = 79.0 bits (193),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 43/50 (86%), Gaps = 2/50 (4%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG--VNHSC  440
            H+GY+NT  VSPDGSLCASGGKDGV +LWDLAEGK+LYSLD+G  +N  C
Sbjct  198  HSGYINTCTVSPDGSLCASGGKDGVAMLWDLAEGKRLYSLDSGDIINSLC  247



>gb|AFV60006.1| heterotrimeric guanine nucleotide-binding protein subunit beta 
[Eschscholzia californica]
Length=313

 Score =   117 bits (294),  Expect(2) = 7e-43, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 72/96 (75%), Gaps = 13/96 (14%)
 Frame = -1

Query  465  SMP-GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTA  289
            S+P G IIHALCFSPNRYWLCAAT+  I+IWDLESKS+V +L+ ++ Q            
Sbjct  230  SLPAGHIIHALCFSPNRYWLCAATQGDIQIWDLESKSLVQELKPEVTQ------------  277

Query  288  AKNKIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGR  181
             KNK+ +CTSL+W++DGSTLF+G+TDG IRV+ + R
Sbjct  278  GKNKMFYCTSLNWSSDGSTLFTGFTDGTIRVYAVSR  313


 Score = 83.6 bits (205),  Expect(2) = 7e-43, Method: Compositional matrix adjust.
 Identities = 41/43 (95%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSL AG
Sbjct  192  HGGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLPAG  234



>ref|XP_001754916.1| predicted protein [Physcomitrella patens]
 gb|EDQ80370.1| predicted protein [Physcomitrella patens]
Length=316

 Score =   117 bits (292),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 68/92 (74%), Gaps = 10/92 (11%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G IIH+LCFSPNRYWLCAAT+  IKIWDLESKS+V +LR +    S+          K +
Sbjct  234  GDIIHSLCFSPNRYWLCAATQTCIKIWDLESKSVVDELRPEFTFVSK----------KAQ  283

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGR  181
            I +C SL+W+ADGSTLFSGYTDG IRVW +GR
Sbjct  284  IPYCVSLNWSADGSTLFSGYTDGHIRVWAVGR  315


 Score = 83.6 bits (205),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGYVNTV VSPDGSLCASGGKDGV +LWDLAEGK+LYSLDAG
Sbjct  192  HTGYVNTVTVSPDGSLCASGGKDGVAMLWDLAEGKRLYSLDAG  234



>ref|XP_001779496.1| predicted protein [Physcomitrella patens]
 gb|EDQ55672.1| predicted protein [Physcomitrella patens]
Length=316

 Score =   117 bits (294),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 69/92 (75%), Gaps = 10/92 (11%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G IIH+LCFSPNRYWLCAAT++ IKIWDLESKSIV +LR +    S+          K +
Sbjct  234  GDIIHSLCFSPNRYWLCAATQSCIKIWDLESKSIVDELRPEFTFVSK----------KAQ  283

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGR  181
            I +C SL+W+ADGSTLFSGYTDG IRVW +GR
Sbjct  284  IPYCVSLNWSADGSTLFSGYTDGHIRVWAVGR  315


 Score = 82.4 bits (202),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 38/43 (88%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGYVNTV VSPDGSLCASGGKDGV +LWDL+EGK+LYSLDAG
Sbjct  192  HTGYVNTVTVSPDGSLCASGGKDGVAMLWDLSEGKRLYSLDAG  234



>ref|XP_001780288.1| predicted protein [Physcomitrella patens]
 gb|EDQ54847.1| predicted protein [Physcomitrella patens]
Length=316

 Score =   117 bits (292),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 69/92 (75%), Gaps = 10/92 (11%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G IIH+LCFSPNRYWLCAAT++ IKIWDLESKS+V +LR +    S+          K +
Sbjct  234  GDIIHSLCFSPNRYWLCAATQSCIKIWDLESKSVVDELRPEFTFVSK----------KAQ  283

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGR  181
            + +C SL+W+ADGSTLFSGYTDG IRVW +GR
Sbjct  284  VPYCVSLNWSADGSTLFSGYTDGHIRVWAVGR  315


 Score = 83.6 bits (205),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGYVNTV VSPDGSLCASGGKDGV +LWDLAEGK+LYSLDAG
Sbjct  192  HTGYVNTVTVSPDGSLCASGGKDGVAMLWDLAEGKRLYSLDAG  234



>ref|XP_004961307.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A-like [Setaria italica]
Length=334

 Score =   122 bits (305),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 72/93 (77%), Gaps = 12/93 (13%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            GSIIH+LCFSPNRYWLCAAT+ S+KIWDLESK +V DL+ D++             +KN+
Sbjct  250  GSIIHSLCFSPNRYWLCAATQDSVKIWDLESKHVVQDLKPDIQ------------ISKNQ  297

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            I++CTSLSW+ADGSTL++GYTDG IRVW I  +
Sbjct  298  ILYCTSLSWSADGSTLYTGYTDGSIRVWKISGF  330


 Score = 77.4 bits (189),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 37/43 (86%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H GYVN VAVSPDGSLCASGGKDG  LLWDL EGK+LYSLDAG
Sbjct  208  HGGYVNAVAVSPDGSLCASGGKDGYTLLWDLTEGKRLYSLDAG  250



>gb|EMT00770.1| hypothetical protein F775_19376 [Aegilops tauschii]
Length=599

 Score =   121 bits (304),  Expect(2) = 2e-42, Method: Composition-based stats.
 Identities = 56/90 (62%), Positives = 71/90 (79%), Gaps = 12/90 (13%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            GSIIHALCFSPNRYWLCAATE S+KIWDLESK +V DL+ +++             +KN+
Sbjct  181  GSIIHALCFSPNRYWLCAATEESVKIWDLESKHVVQDLKPEVQ------------VSKNQ  228

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGI  187
            +++CTSLSW+ADGSTL++GYTDG IRV+ I
Sbjct  229  MLYCTSLSWSADGSTLYTGYTDGTIRVFKI  258


 Score = 77.8 bits (190),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 36/43 (84%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H GYVN VAVSPDGSLCASGGKDGV LLWDL+EGK+LY L+AG
Sbjct  139  HGGYVNAVAVSPDGSLCASGGKDGVTLLWDLSEGKRLYQLEAG  181



>gb|EMS52917.1| Guanine nucleotide-binding protein subunit beta-like protein 
B [Triticum urartu]
Length=359

 Score =   120 bits (302),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 71/90 (79%), Gaps = 12/90 (13%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            GSIIHALCFSPNRYWLCAATE S+KIWDLESK +V DL+ +++             +KN+
Sbjct  274  GSIIHALCFSPNRYWLCAATEESVKIWDLESKHVVQDLKPEVQ------------VSKNQ  321

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGI  187
            +++CTSLSW+ADGSTL++GYTDG IRV+ I
Sbjct  322  MLYCTSLSWSADGSTLYTGYTDGTIRVFKI  351


 Score = 77.4 bits (189),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 36/43 (84%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H GYVN VAVSPDGSLCASGGKDGV LLWDL+EGK+LY L+AG
Sbjct  232  HGGYVNAVAVSPDGSLCASGGKDGVTLLWDLSEGKRLYQLEAG  274



>ref|XP_006644561.1| PREDICTED: LOW QUALITY PROTEIN: guanine nucleotide-binding protein 
subunit beta-like protein A-like [Oryza brachyantha]
Length=334

 Score =   117 bits (292),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 71/93 (76%), Gaps = 12/93 (13%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            GSIIH+LCFSPNRYWLCAAT+ SIKIWDLESK IV DL+ ++              +KN+
Sbjct  250  GSIIHSLCFSPNRYWLCAATQDSIKIWDLESKHIVQDLKPEIP------------VSKNQ  297

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            +++CTSL+W+ADGSTL++GYTDG IR++ I  +
Sbjct  298  MLYCTSLNWSADGSTLYAGYTDGTIRIYKISGF  330


 Score = 81.3 bits (199),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H GYVN VAVSPDGSLCASGGKDGV LLWDLAEGK+LYSLDAG
Sbjct  208  HGGYVNAVAVSPDGSLCASGGKDGVTLLWDLAEGKRLYSLDAG  250



>ref|XP_004969582.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A-like [Setaria italica]
Length=334

 Score =   121 bits (303),  Expect(2) = 6e-42, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 72/93 (77%), Gaps = 12/93 (13%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            GSIIH+LCFSPNRYWLCAAT+ SIKIWDLESK IV DLR ++            +A KN+
Sbjct  250  GSIIHSLCFSPNRYWLCAATQDSIKIWDLESKHIVQDLRPEV------------SAGKNQ  297

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            I++CTSLSW+ADGSTL++GYTDG IR++ I  +
Sbjct  298  ILYCTSLSWSADGSTLYAGYTDGTIRIFKISGF  330


 Score = 76.6 bits (187),  Expect(2) = 6e-42, Method: Compositional matrix adjust.
 Identities = 36/43 (84%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H GYVN VAVSPDGSLCASGGKD V LLWDL EGK+LY+LDAG
Sbjct  208  HGGYVNAVAVSPDGSLCASGGKDNVTLLWDLTEGKRLYALDAG  250



>ref|XP_005847990.1| hypothetical protein CHLNCDRAFT_31033 [Chlorella variabilis]
 gb|EFN55888.1| hypothetical protein CHLNCDRAFT_31033 [Chlorella variabilis]
Length=319

 Score =   119 bits (298),  Expect(2) = 7e-42, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 70/90 (78%), Gaps = 10/90 (11%)
 Frame = -1

Query  450  IIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKII  271
            IIH+LCFSPNRYWLCAAT+ SIKIWDLESKS+V +LR +L + S+          K ++ 
Sbjct  238  IIHSLCFSPNRYWLCAATQGSIKIWDLESKSLVDELRPELPERSK----------KAQVP  287

Query  270  FCTSLSWNADGSTLFSGYTDGVIRVWGIGR  181
            +C  L+W+ADGSTL+SGYTDG+IRVW +GR
Sbjct  288  YCVCLAWSADGSTLYSGYTDGLIRVWQVGR  317


 Score = 78.6 bits (192),  Expect(2) = 7e-42, Method: Compositional matrix adjust.
 Identities = 36/42 (86%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDA  458
            H GYVNTV VSPDGSLCASGGKDGV +LWDL+EGK+LYSLDA
Sbjct  194  HQGYVNTVTVSPDGSLCASGGKDGVAMLWDLSEGKRLYSLDA  235



>ref|NP_001043910.1| Os01g0686800 [Oryza sativa Japonica Group]
 sp|P49027.1|GBLPA_ORYSJ RecName: Full=Guanine nucleotide-binding protein subunit beta-like 
protein A; Short=GPB-LR; AltName: Full=RWD; AltName: Full=Receptor 
for activated C kinase 1A [Oryza sativa Japonica 
Group]
 dbj|BAA07404.1| q group of receptor for activated C-kinase [Oryza sativa Japonica 
Group]
 dbj|BAF05824.1| Os01g0686800 [Oryza sativa Japonica Group]
 gb|EAY75412.1| hypothetical protein OsI_03315 [Oryza sativa Indica Group]
 gb|EAZ13132.1| hypothetical protein OsJ_03054 [Oryza sativa Japonica Group]
 dbj|BAG93799.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87442.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00562.1| unnamed protein product [Oryza sativa Japonica Group]
Length=334

 Score =   116 bits (290),  Expect(2) = 9e-42, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 71/93 (76%), Gaps = 12/93 (13%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            GSIIH+LCFSPNRYWLCAAT+ SIKIWDLESK IV DL+ ++              +KN+
Sbjct  250  GSIIHSLCFSPNRYWLCAATQDSIKIWDLESKHIVQDLKPEIP------------VSKNQ  297

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            +++CTSL+W+ADGSTL++GYTDG IR++ I  +
Sbjct  298  MLYCTSLNWSADGSTLYAGYTDGTIRIYKISGF  330


 Score = 80.9 bits (198),  Expect(2) = 9e-42, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H GYVN VAVSPDGSLCASGGKDGV LLWDLAEGK+LYSLDAG
Sbjct  208  HGGYVNAVAVSPDGSLCASGGKDGVTLLWDLAEGKRLYSLDAG  250



>dbj|BAJ90663.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK06408.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91024.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=335

 Score =   119 bits (299),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 71/90 (79%), Gaps = 12/90 (13%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            GSIIH+LCFSPNRYWLCAATE SIKIWDLESK +V DL+ +++             +KN+
Sbjct  250  GSIIHSLCFSPNRYWLCAATEESIKIWDLESKHVVQDLKPEVQ------------VSKNQ  297

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGI  187
            +++CTSLSW+ADGSTL++GYTDG IRV+ I
Sbjct  298  MLYCTSLSWSADGSTLYTGYTDGTIRVFKI  327


 Score = 77.4 bits (189),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 36/43 (84%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H GYVN VAVSPDGSLCASGGKDGV LLWDL+EGK+LY L+AG
Sbjct  208  HGGYVNAVAVSPDGSLCASGGKDGVTLLWDLSEGKRLYQLEAG  250



>gb|AEF79971.1| receptor of activated protein kinase C 1 [Dunaliella salina]
Length=318

 Score =   117 bits (292),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 68/90 (76%), Gaps = 9/90 (10%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G IIHALCFSPNRYWLCAAT +SIKIWDLESKS+V DLR +  +E +  A          
Sbjct  235  GDIIHALCFSPNRYWLCAATSSSIKIWDLESKSVVDDLRPEWNKEFKKKAT---------  285

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGI  187
            + +C SL+W+ADGSTL+SGYTDG+IRVW +
Sbjct  286  VPYCVSLAWSADGSTLYSGYTDGMIRVWNV  315


 Score = 80.1 bits (196),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 38/43 (88%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H GYVNTV VSPDGSLCASGGKDGV +LWDLAEGK+LYSLDAG
Sbjct  193  HMGYVNTVTVSPDGSLCASGGKDGVGMLWDLAEGKRLYSLDAG  235



>gb|ABR25943.1| guanine nucleotide-binding protein beta subunit [Oryza sativa 
Indica Group]
Length=131

 Score =   116 bits (290),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 70/90 (78%), Gaps = 12/90 (13%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            GSIIH+LCFSPNRYWLCAAT+ SIKIWDLESK IV DL+ ++              +KN+
Sbjct  47   GSIIHSLCFSPNRYWLCAATQDSIKIWDLESKHIVQDLKPEIP------------VSKNQ  94

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGI  187
            +++CTSL+W+ADGSTL++GYTDG IR++ I
Sbjct  95   MLYCTSLNWSADGSTLYAGYTDGTIRIYKI  124


 Score = 80.1 bits (196),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H GYVN VAVSPDGSLCASGGKDGV LLWDLAEGK+LYSLDAG
Sbjct  5    HGGYVNAVAVSPDGSLCASGGKDGVTLLWDLAEGKRLYSLDAG  47



>ref|XP_004252271.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein isoform X2 [Solanum lycopersicum]
Length=301

 Score =   108 bits (271),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            GSIIHALCFSPNRYWLCAATE+SIKIWDLESKSIVVDLRVDLKQE+EMS    +T+  +K
Sbjct  235  GSIIHALCFSPNRYWLCAATESSIKIWDLESKSIVVDLRVDLKQETEMSGNATSTSGNSK  294

Query  276  IIFCTSL  256
              F  S 
Sbjct  295  TKFLASF  301


 Score = 87.0 bits (214),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 41/43 (95%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGYVNT AVSPDGSLCASGGKDGVILLWDLAEGKKLYSLD+G
Sbjct  193  HTGYVNTAAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDSG  235



>gb|KFK36075.1| hypothetical protein AALP_AA4G074100 [Arabis alpina]
Length=210

 Score =   145 bits (365),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 87/117 (74%), Gaps = 7/117 (6%)
 Frame = -1

Query  459  PGSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKN  280
             GS+IH++CFSPNRYWLCAATE+SI+IWDLESKS+V DL+VDLK E+E S     T  K 
Sbjct  61   AGSVIHSVCFSPNRYWLCAATESSIRIWDLESKSVVEDLKVDLKAEAEKSDGAVGTGNKT  120

Query  279  KIIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY*MEEFRRSHMIIGHVCYLSHLEF  109
            K+I+CTSL+W+ADG+TLFSGYTDGVIRVW +         R+H+ + H+    H  +
Sbjct  121  KVIYCTSLNWSADGNTLFSGYTDGVIRVWVL-------LHRTHLSVEHILDGQHNHY  170


 Score = 50.8 bits (120),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 32/49 (65%), Gaps = 6/49 (12%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCA------SGGKDGVILLWDLAEGKKLYSLDAG  455
            HT  V  +A   D S         +GGKDGV+LLWDLAEGKKLYSL+AG
Sbjct  14   HTDMVTAIATPIDNSDIIVTSSRDNGGKDGVVLLWDLAEGKKLYSLEAG  62



>gb|AEO44580.1| receptor for activated C kinase 1 [Dunaliella salina]
Length=318

 Score =   117 bits (292),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 68/90 (76%), Gaps = 9/90 (10%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G IIHALCFSPNRYWLCAAT +SIKIWDLESKS+V DLR +  +E +  A          
Sbjct  235  GDIIHALCFSPNRYWLCAATSSSIKIWDLESKSVVDDLRPEWNKEFKKKAT---------  285

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGI  187
            + +C SL+W+ADGSTL+SGYTDG+IRVW +
Sbjct  286  VPYCVSLAWSADGSTLYSGYTDGMIRVWNV  315


 Score = 78.6 bits (192),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 37/43 (86%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H+GYVNTV VSPDGSLCASGGKD V +LWDLAEGK+LYSLDAG
Sbjct  193  HSGYVNTVTVSPDGSLCASGGKDNVGMLWDLAEGKRLYSLDAG  235



>ref|XP_003082627.1| GTP-binding regulatory protein beta chain homolog-Ch (ISS) [Ostreococcus 
tauri]
Length=483

 Score =   113 bits (282),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 65/91 (71%), Gaps = 10/91 (11%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G II+ LCFSPNRYWLCAATE+ +KIWDLESKSIV +LR +                K++
Sbjct  398  GDIIYGLCFSPNRYWLCAATESCVKIWDLESKSIVDELRPEFPP----------VGKKSQ  447

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIG  184
              +CTSL W+ADGSTL++GYTD VIRVW +G
Sbjct  448  QPYCTSLQWSADGSTLYTGYTDNVIRVWSVG  478


 Score = 82.4 bits (202),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 37/43 (86%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGY+NTV VSPDGSLCASGGKDGV +LWDL EGK+LYSLDAG
Sbjct  356  HTGYINTVTVSPDGSLCASGGKDGVAMLWDLGEGKRLYSLDAG  398



>ref|XP_003567944.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Brachypodium distachyon]
Length=333

 Score =   116 bits (291),  Expect(2) = 4e-41, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 69/90 (77%), Gaps = 12/90 (13%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            GSIIH+LCFSPNRYWLCAATE S+KIWDLESK +V DL+ + +             +KN+
Sbjct  248  GSIIHSLCFSPNRYWLCAATEDSVKIWDLESKHVVQDLKPEFQ------------VSKNQ  295

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGI  187
            +++CTSL W+ADGSTL++GYTDG IRV+ I
Sbjct  296  MLYCTSLCWSADGSTLYTGYTDGTIRVFKI  325


 Score = 78.6 bits (192),  Expect(2) = 4e-41, Method: Compositional matrix adjust.
 Identities = 37/43 (86%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H GYVN VAVSPDGSLCASGGKDGV LLWDLAEGK+LY L+AG
Sbjct  206  HGGYVNAVAVSPDGSLCASGGKDGVTLLWDLAEGKRLYQLEAG  248



>gb|EEC79656.1| hypothetical protein OsI_20897 [Oryza sativa Indica Group]
Length=312

 Score =   119 bits (297),  Expect(2) = 5e-41, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 73/96 (76%), Gaps = 15/96 (16%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G+IIH+LCFSPNRYWLCAATE S+KIWDLESK ++ DL+ +++            A K++
Sbjct  227  GAIIHSLCFSPNRYWLCAATEDSVKIWDLESKLVMQDLKPEVQ------------AFKSQ  274

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVW---GIGRY  178
            +++CTSLSW+ADGSTLF+GYTDG IRVW   G G Y
Sbjct  275  MLYCTSLSWSADGSTLFAGYTDGTIRVWKVSGFGGY  310


 Score = 76.3 bits (186),  Expect(2) = 5e-41, Method: Compositional matrix adjust.
 Identities = 36/43 (84%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H GYVN VAVSPDGSLCASGGKDG  LLWDL EGK LY LDAG
Sbjct  185  HNGYVNAVAVSPDGSLCASGGKDGTTLLWDLTEGKMLYKLDAG  227



>ref|NP_001056254.1| Os05g0552300 [Oryza sativa Japonica Group]
 sp|Q6L4F8.1|GBLPB_ORYSJ RecName: Full=Guanine nucleotide-binding protein subunit beta-like 
protein B; Short=GPB-LR; AltName: Full=Receptor for activated 
C kinase 1B [Oryza sativa Japonica Group]
 gb|AAT39277.1| putative guanine nucleotide-binding protein beta subunit [Oryza 
sativa Japonica Group]
 gb|AAT85192.1| putative guanine nucleotide binding protein beta subunit [Oryza 
sativa Japonica Group]
 dbj|BAF18168.1| Os05g0552300 [Oryza sativa Japonica Group]
 dbj|BAG88240.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89443.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00554.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64615.1| hypothetical protein OsJ_19467 [Oryza sativa Japonica Group]
Length=336

 Score =   118 bits (296),  Expect(2) = 7e-41, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 73/96 (76%), Gaps = 15/96 (16%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G+IIH+LCFSPNRYWLCAATE S+KIWDLESK ++ DL+ +++            A K++
Sbjct  251  GAIIHSLCFSPNRYWLCAATEDSVKIWDLESKLVMQDLKPEVQ------------AFKSQ  298

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVW---GIGRY  178
            +++CTSLSW+ADGSTLF+GYTDG IRVW   G G Y
Sbjct  299  MLYCTSLSWSADGSTLFAGYTDGTIRVWKVSGFGGY  334


 Score = 75.9 bits (185),  Expect(2) = 7e-41, Method: Compositional matrix adjust.
 Identities = 36/43 (84%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H GYVN VAVSPDGSLCASGGKDG  LLWDL EGK LY LDAG
Sbjct  209  HNGYVNAVAVSPDGSLCASGGKDGTTLLWDLTEGKMLYKLDAG  251



>emb|CEG00110.1| G-protein beta WD-40 repeat [Ostreococcus tauri]
Length=319

 Score =   112 bits (279),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 65/91 (71%), Gaps = 10/91 (11%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G II+ LCFSPNRYWLCAATE+ +KIWDLESKSIV +LR +                K++
Sbjct  234  GDIIYGLCFSPNRYWLCAATESCVKIWDLESKSIVDELRPEFPP----------VGKKSQ  283

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIG  184
              +CTSL W+ADGSTL++GYTD VIRVW +G
Sbjct  284  QPYCTSLQWSADGSTLYTGYTDNVIRVWSVG  314


 Score = 81.3 bits (199),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 37/43 (86%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGY+NTV VSPDGSLCASGGKDGV +LWDL EGK+LYSLDAG
Sbjct  192  HTGYINTVTVSPDGSLCASGGKDGVAMLWDLGEGKRLYSLDAG  234



>ref|XP_003569582.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Brachypodium distachyon]
Length=331

 Score =   112 bits (280),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 70/93 (75%), Gaps = 12/93 (13%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G+II++LCFSPNRYWLCAAT+ SIKIWDLESK +V DLR ++              +KN+
Sbjct  247  GAIINSLCFSPNRYWLCAATQDSIKIWDLESKHVVQDLRPEVP------------VSKNQ  294

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            +++CT LSW+ADGSTL++GYTDG IR++ I  +
Sbjct  295  MLYCTCLSWSADGSTLYAGYTDGTIRIYKISGF  327


 Score = 79.7 bits (195),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 43/50 (86%), Gaps = 2/50 (4%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG--VNHSC  440
            H GYV+ VAVSPDGSLCASGGKDGV LLWDLAEGK+LYSLDAG  +N  C
Sbjct  205  HGGYVSAVAVSPDGSLCASGGKDGVTLLWDLAEGKRLYSLDAGAIINSLC  254



>ref|XP_008811978.1| PREDICTED: LOW QUALITY PROTEIN: guanine nucleotide-binding protein 
subunit beta-like protein A [Phoenix dactylifera]
Length=316

 Score =   127 bits (319),  Expect(2) = 4e-40, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 70/89 (79%), Gaps = 12/89 (13%)
 Frame = -1

Query  444  HALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKIIFC  265
            H+LCFSPNRYWLCAAT+ S+KIWDLESKSIV DLR +               +KN+I++C
Sbjct  240  HSLCFSPNRYWLCAATQDSVKIWDLESKSIVQDLRPE------------TPTSKNQILYC  287

Query  264  TSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            TSLSW+ADGSTLF+GYTDGVIRVWGI RY
Sbjct  288  TSLSWSADGSTLFTGYTDGVIRVWGISRY  316


 Score = 64.7 bits (156),  Expect(2) = 4e-40, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGK  479
            H GYVN VAVSPDGSLCASGGKDGV LLWDLAE K
Sbjct  202  HGGYVNAVAVSPDGSLCASGGKDGVTLLWDLAEEK  236



>ref|XP_001421096.1| Receptor of activated protein kinase C 1A, component of 40S small 
ribosomal subunit [Ostreococcus lucimarinus CCE9901]
 ref|XP_001422858.1| Receptor of activated protein kinase C 1B, component of 40S small 
ribosomal subunit [Ostreococcus lucimarinus CCE9901]
 gb|ABO99389.1| Receptor of activated protein kinase C 1A, component of 40S small 
ribosomal subunit [Ostreococcus lucimarinus CCE9901]
 gb|ABP01217.1| Receptor of activated protein kinase C 1B, component of 40S small 
ribosomal subunit [Ostreococcus lucimarinus CCE9901]
Length=321

 Score =   112 bits (279),  Expect(2) = 6e-40, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 65/91 (71%), Gaps = 10/91 (11%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G II+ LCFSPNRYWLCAATE+ +KIWDLESKSIV +LR +                K++
Sbjct  234  GDIIYGLCFSPNRYWLCAATESCVKIWDLESKSIVDELRPEFPP----------VGKKSQ  283

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIG  184
              +CTSL W+ADGSTL++GYTD VIRVW +G
Sbjct  284  QPYCTSLQWSADGSTLYTGYTDNVIRVWSVG  314


 Score = 79.3 bits (194),  Expect(2) = 6e-40, Method: Compositional matrix adjust.
 Identities = 36/43 (84%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGY+N V VSPDGSLCASGGKDGV +LWDL EGK+LYSLDAG
Sbjct  192  HTGYINAVTVSPDGSLCASGGKDGVAMLWDLGEGKRLYSLDAG  234



>ref|XP_006654750.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein B-like [Oryza brachyantha]
Length=336

 Score =   115 bits (289),  Expect(2) = 9e-40, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 72/96 (75%), Gaps = 15/96 (16%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G+IIH+LCFSPNRYWLCAATE S+KIWDLESK ++ DL+ +++            A K++
Sbjct  251  GAIIHSLCFSPNRYWLCAATEDSVKIWDLESKLVMQDLKPEVQ------------AFKSQ  298

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVW---GIGRY  178
            ++ CTSLSW+ADGSTL++GYTDG IRVW   G G Y
Sbjct  299  MLHCTSLSWSADGSTLYTGYTDGTIRVWKVSGFGGY  334


 Score = 74.7 bits (182),  Expect(2) = 9e-40, Method: Compositional matrix adjust.
 Identities = 36/43 (84%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H GYVN VAVSPDGSLCASGGKDGV LLWDL EGK LY L+AG
Sbjct  209  HGGYVNAVAVSPDGSLCASGGKDGVTLLWDLTEGKMLYKLEAG  251



>gb|KDD72035.1| hypothetical protein H632_c3969p0, partial [Helicosporidium sp. 
ATCC 50920]
Length=262

 Score =   115 bits (287),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 69/92 (75%), Gaps = 10/92 (11%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G +IH+L FSPNRYWLCAAT++ IKIWDLE KS+V DLR +L + S          AK +
Sbjct  180  GDVIHSLVFSPNRYWLCAATQSGIKIWDLEFKSVVDDLRPELPERS----------AKAQ  229

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGR  181
            + +  SL+W+ADGSTL++GYTDGVIRVW +GR
Sbjct  230  VPYPISLTWSADGSTLYAGYTDGVIRVWQVGR  261


 Score = 74.7 bits (182),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 1/48 (2%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG-VNHS  443
            H GYVN V +SPDGSLCASGGKDG  +LWDLAEGK+LY+L+AG V HS
Sbjct  138  HEGYVNAVTISPDGSLCASGGKDGSAMLWDLAEGKQLYTLEAGDVIHS  185



>ref|XP_003060952.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH54602.1| predicted protein [Micromonas pusilla CCMP1545]
Length=325

 Score =   107 bits (268),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 53/92 (58%), Positives = 64/92 (70%), Gaps = 10/92 (11%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G II+ALCFSPNRYWLCAAT++ +KIWDLESKSIV           E+  E      K+ 
Sbjct  234  GDIIYALCFSPNRYWLCAATQSCVKIWDLESKSIV----------DELHPEFPPVGKKSI  283

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGR  181
              FCTSL+W+ADG TLF+GYTD +IRVW + R
Sbjct  284  PPFCTSLNWSADGGTLFTGYTDCLIRVWTVNR  315


 Score = 82.0 bits (201),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 37/43 (86%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGY+NTV VSPDGSLCASGGKDGV +LWDLAEGK+LY+LDAG
Sbjct  192  HTGYINTVTVSPDGSLCASGGKDGVAMLWDLAEGKRLYTLDAG  234



>ref|XP_002502835.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO64093.1| predicted protein [Micromonas sp. RCC299]
Length=324

 Score =   106 bits (264),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 63/92 (68%), Gaps = 10/92 (11%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G II+ALCFSPNRYWLCAAT++ +KIWDLESKSIV           E+  E      K+ 
Sbjct  235  GDIIYALCFSPNRYWLCAATQSCVKIWDLESKSIV----------DELHPEFPPVGKKSI  284

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGR  181
              FCTSL W++DG+TLF+GYTD  IRVW + R
Sbjct  285  PPFCTSLQWSSDGATLFTGYTDCQIRVWTVSR  316


 Score = 83.2 bits (204),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 38/43 (88%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGY+NTV VSPDGSLCASGGKDGV +LWDLAEGK+LYSLDAG
Sbjct  193  HTGYINTVTVSPDGSLCASGGKDGVAMLWDLAEGKRLYSLDAG  235



>ref|XP_002456166.1| hypothetical protein SORBIDRAFT_03g031520 [Sorghum bicolor]
 gb|EES01286.1| hypothetical protein SORBIDRAFT_03g031520 [Sorghum bicolor]
Length=332

 Score =   113 bits (283),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 70/93 (75%), Gaps = 12/93 (13%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G IIH+LCFSPNRYWLCAAT+ SIKIWDLESK +V DL+ ++            ++ K++
Sbjct  250  GDIIHSLCFSPNRYWLCAATQESIKIWDLESKHVVQDLKPEV------------SSTKDQ  297

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            +++CT LSW+ADGSTL++GYTDG IR++ I  Y
Sbjct  298  MLYCTCLSWSADGSTLYAGYTDGSIRIYKISAY  330


 Score = 75.5 bits (184),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 36/43 (84%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H GYVN VAVSPDGSLCASGGKD V LLWDL EGK+LY+LDAG
Sbjct  208  HGGYVNAVAVSPDGSLCASGGKDHVTLLWDLTEGKRLYALDAG  250



>dbj|BAJ98167.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=332

 Score =   110 bits (274),  Expect(2) = 5e-39, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 69/93 (74%), Gaps = 12/93 (13%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            GSII++LCFSPNRYWLCAAT+ SIKIWDLESK IV DLR ++   S+            +
Sbjct  248  GSIINSLCFSPNRYWLCAATQDSIKIWDLESKHIVQDLRPEVPVSSK------------Q  295

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            +++CT LSW+ADGSTL++GYTDG IR++ I  +
Sbjct  296  MLYCTCLSWSADGSTLYAGYTDGTIRIYKISGF  328


 Score = 78.2 bits (191),  Expect(2) = 5e-39, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 42/50 (84%), Gaps = 2/50 (4%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG--VNHSC  440
            H GYV+ VAVSPDGSLCASGGKDGV LLWDL EGK+LYSLDAG  +N  C
Sbjct  206  HGGYVSAVAVSPDGSLCASGGKDGVTLLWDLTEGKRLYSLDAGSIINSLC  255



>ref|XP_005652002.1| WD40 repeat-like protein [Coccomyxa subellipsoidea C-169]
 gb|EIE27458.1| WD40 repeat-like protein [Coccomyxa subellipsoidea C-169]
Length=317

 Score =   108 bits (271),  Expect(2) = 5e-39, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 64/90 (71%), Gaps = 10/90 (11%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G IIHALCFSPNRYWLCAAT   IKIWDLESKSIV +L+ D  +             K +
Sbjct  235  GEIIHALCFSPNRYWLCAATTNCIKIWDLESKSIVDELKPDFGE----------LGKKAQ  284

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGI  187
            + +C SL+W+ADG+TL+SGYT+G I VWG+
Sbjct  285  VPYCVSLAWSADGATLYSGYTNGKIEVWGV  314


 Score = 79.0 bits (193),  Expect(2) = 5e-39, Method: Compositional matrix adjust.
 Identities = 35/43 (81%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H+GY+NTV VSPDGSLCASGGKDGV +LWDLAEGK+LY+L+AG
Sbjct  193  HSGYINTVTVSPDGSLCASGGKDGVAMLWDLAEGKRLYNLEAG  235



>emb|CDM83867.1| unnamed protein product [Triticum aestivum]
Length=332

 Score =   109 bits (272),  Expect(2) = 8e-39, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 68/93 (73%), Gaps = 12/93 (13%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            GSII++LCFSPNRYWLCAAT+ SIKIWDLESK IV DLR ++              +  +
Sbjct  248  GSIINSLCFSPNRYWLCAATQDSIKIWDLESKHIVQDLRPEVP------------VSTKQ  295

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGRY  178
            +++CT LSW+ADGSTL++GYTDG IR++ I  +
Sbjct  296  MLYCTCLSWSADGSTLYAGYTDGTIRIYKISGF  328


 Score = 78.2 bits (191),  Expect(2) = 8e-39, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 42/50 (84%), Gaps = 2/50 (4%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG--VNHSC  440
            H GYV+ VAVSPDGSLCASGGKDGV LLWDL EGK+LYSLDAG  +N  C
Sbjct  206  HGGYVSAVAVSPDGSLCASGGKDGVTLLWDLTEGKRLYSLDAGSIINSLC  255



>gb|KIY98327.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Monoraphidium neglectum]
Length=319

 Score =   105 bits (261),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 63/88 (72%), Gaps = 9/88 (10%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G IIH+L FSPNRYWLCAAT+ SIKIWDLESKS+V DLR +  +             K  
Sbjct  235  GDIIHSLVFSPNRYWLCAATQTSIKIWDLESKSVVDDLRPEFSK---------TFGKKAT  285

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVW  193
            I +C SL+W+ADGSTL++GY+DG IRV+
Sbjct  286  IPYCVSLAWSADGSTLYAGYSDGDIRVF  313


 Score = 81.3 bits (199),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 37/43 (86%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H GY+NTV VSPDGSLCASGGKDGV +LWDLAEGK+LYSLDAG
Sbjct  193  HAGYINTVTVSPDGSLCASGGKDGVAMLWDLAEGKRLYSLDAG  235



>ref|XP_002967499.1| hypothetical protein SELMODRAFT_144795 [Selaginella moellendorffii]
 gb|EFJ32098.1| hypothetical protein SELMODRAFT_144795 [Selaginella moellendorffii]
Length=315

 Score =   103 bits (258),  Expect(2) = 5e-38, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 64/92 (70%), Gaps = 13/92 (14%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G IIH+LCFSPNRYWLCAAT+  +KIWDLESK+IV +++ +               +K +
Sbjct  237  GDIIHSLCFSPNRYWLCAATQQCVKIWDLESKNIVEEIKPE-------------QVSKKE  283

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGR  181
              +CT+L+W+ DGS LF+GYTDGVIRV  +G 
Sbjct  284  PTYCTTLNWSMDGSKLFAGYTDGVIRVHSVGH  315


 Score = 80.9 bits (198),  Expect(2) = 5e-38, Method: Compositional matrix adjust.
 Identities = 37/43 (86%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H+GYVN+V VSPDGSLCASGGKDGV +LWDLAEGK+LYSLDAG
Sbjct  195  HSGYVNSVTVSPDGSLCASGGKDGVAMLWDLAEGKRLYSLDAG  237



>ref|XP_005711409.1| receptor for activated protein kinase C [Chondrus crispus]
 emb|CDF41115.1| receptor for activated protein kinase C [Chondrus crispus]
Length=320

 Score =   111 bits (277),  Expect(2) = 7e-38, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 64/89 (72%), Gaps = 9/89 (10%)
 Frame = -1

Query  450  IIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNKII  271
            IIHALCFSPNRYWLCAAT + IKIWDLESK++V +LR D         +  +   K    
Sbjct  238  IIHALCFSPNRYWLCAATNSCIKIWDLESKTVVDELRDD---------QAESIGKKAAQP  288

Query  270  FCTSLSWNADGSTLFSGYTDGVIRVWGIG  184
             C SL+W+ADGSTLFSGYTD VIRVWG+G
Sbjct  289  ACISLTWSADGSTLFSGYTDNVIRVWGVG  317


 Score = 73.2 bits (178),  Expect(2) = 7e-38, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H+GY+N V VSPDGSLCASGGKDGV +LWDL EGK LYSL+A 
Sbjct  194  HSGYLNAVTVSPDGSLCASGGKDGVAMLWDLQEGKHLYSLEAN  236



>gb|EMP25897.1| Guanine nucleotide-binding protein subunit beta-2-like 1 [Chelonia 
mydas]
Length=750

 Score =   103 bits (256),  Expect(2) = 2e-37, Method: Composition-based stats.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 10/90 (11%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G II+ALCFSPNRYWLCAAT  SIKIWDLE K I+VD   +LKQE        +T++K +
Sbjct  666  GDIINALCFSPNRYWLCAATGPSIKIWDLEGK-IIVD---ELKQEV------ISTSSKAE  715

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGI  187
               CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  716  PPQCTSLAWSADGQTLFAGYTDNLVRVWQV  745


 Score = 79.7 bits (195),  Expect(2) = 2e-37, Method: Composition-based stats.
 Identities = 36/50 (72%), Positives = 40/50 (80%), Gaps = 2/50 (4%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG--VNHSC  440
            HTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G  +N  C
Sbjct  624  HTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALC  673



>ref|XP_002960209.1| hypothetical protein SELMODRAFT_266532 [Selaginella moellendorffii]
 gb|EFJ37748.1| hypothetical protein SELMODRAFT_266532 [Selaginella moellendorffii]
Length=310

 Score =   100 bits (248),  Expect(2) = 6e-37, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 62/92 (67%), Gaps = 18/92 (20%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G IIH+LCFSPNRYWLCAAT+  +KIWDLESK+IV +++ +                  +
Sbjct  237  GDIIHSLCFSPNRYWLCAATQQCVKIWDLESKNIVEEIKPE------------------Q  278

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGR  181
              +CT+L+W+ DGS LF+GYTDGVIRV  +G 
Sbjct  279  PTYCTTLNWSMDGSKLFAGYTDGVIRVHSVGH  310


 Score = 80.9 bits (198),  Expect(2) = 6e-37, Method: Compositional matrix adjust.
 Identities = 37/43 (86%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H+GYVN+V VSPDGSLCASGGKDGV +LWDLAEGK+LYSLDAG
Sbjct  195  HSGYVNSVTVSPDGSLCASGGKDGVAMLWDLAEGKRLYSLDAG  237



>emb|CEG76293.1| Putative Guanine nucleotide-binding protein subunit beta-2-like 
1 [Rhizopus microsporus]
Length=278

 Score =   105 bits (262),  Expect(2) = 7e-37, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 64/92 (70%), Gaps = 9/92 (10%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            GS++HAL FSPNRYWLCAAT   IKIWDLE+KSIV +LR +  Q  +          KN 
Sbjct  194  GSVVHALTFSPNRYWLCAATANGIKIWDLETKSIVDELRPEFAQLGKR---------KNP  244

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGR  181
               C S++W+ADG+TLFSGY+D +IRVW + R
Sbjct  245  DPECLSVAWSADGATLFSGYSDNIIRVWQVTR  276


 Score = 75.5 bits (184),  Expect(2) = 7e-37, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H GYVNTV +SPDGSLCAS GKDGV++LWDL + K LYSLDAG
Sbjct  152  HNGYVNTVTISPDGSLCASAGKDGVVMLWDLNDAKHLYSLDAG  194



>ref|XP_007508318.1| predicted protein [Bathycoccus prasinos]
 emb|CCO20422.1| predicted protein [Bathycoccus prasinos]
Length=318

 Score = 97.8 bits (242),  Expect(2) = 8e-37, Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 61/92 (66%), Gaps = 10/92 (11%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G II+++CFSPNRYWLCAAT++ +KIWDLESKSIV           E+  E      K+ 
Sbjct  233  GDIIYSMCFSPNRYWLCAATQSCVKIWDLESKSIV----------DELHPEFPPVGKKSM  282

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGR  181
               CTSL W+ADG TL++GY+D  +RV+ + R
Sbjct  283  PPHCTSLQWSADGQTLYTGYSDNKVRVYVVSR  314


 Score = 83.2 bits (204),  Expect(2) = 8e-37, Method: Compositional matrix adjust.
 Identities = 38/43 (88%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGY+NTV VSPDGSLCASGGKDGV +LWDLAEGK+LYSLDAG
Sbjct  191  HTGYINTVTVSPDGSLCASGGKDGVAMLWDLAEGKRLYSLDAG  233



>emb|CEG67117.1| Putative Guanine nucleotide-binding protein subunit beta-2-like 
1 [Rhizopus microsporus]
 emb|CEI95133.1| Putative Guanine nucleotide-binding protein subunit beta-2-like 
1 [Rhizopus microsporus]
 emb|CEI93908.1| Putative Guanine nucleotide-binding protein subunit beta-2-like 
1 [Rhizopus microsporus]
Length=316

 Score =   105 bits (261),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 64/92 (70%), Gaps = 9/92 (10%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            GS++HAL FSPNRYWLCAAT   IKIWDLE+KSIV +LR +  Q  +          KN 
Sbjct  232  GSVVHALTFSPNRYWLCAATANGIKIWDLETKSIVDELRPEFAQLGKR---------KNP  282

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGR  181
               C S++W+ADG+TLFSGY+D +IRVW + R
Sbjct  283  DPECLSVAWSADGATLFSGYSDNIIRVWQVTR  314


 Score = 74.7 bits (182),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H GYVNTV +SPDGSLCAS GKDGV++LWDL + K LYSLDAG
Sbjct  190  HNGYVNTVTISPDGSLCASAGKDGVVMLWDLNDAKHLYSLDAG  232



>gb|EIE78732.1| guanine nucleotide-binding protein subunit beta-2-like 1 [Rhizopus 
delemar RA 99-880]
Length=311

 Score =   104 bits (260),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 64/92 (70%), Gaps = 9/92 (10%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            GS++HAL FSPNRYWLCAAT   IKIWDLE+KSIV +LR +  Q  +          KN 
Sbjct  227  GSVVHALTFSPNRYWLCAATANGIKIWDLETKSIVDELRPEFAQLGKR---------KNP  277

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGR  181
               C S++W+ADG+TLFSGY+D +IRVW + R
Sbjct  278  DPECLSVAWSADGATLFSGYSDNIIRVWQVTR  309


 Score = 74.7 bits (182),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H GYVNTV +SPDGSLCAS GKDGV++LWDL + K LYSLDAG
Sbjct  185  HNGYVNTVTISPDGSLCASAGKDGVVMLWDLNDAKHLYSLDAG  227



>ref|XP_011397272.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Auxenochlorella protothecoides]
 gb|KFM24384.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Auxenochlorella protothecoides]
Length=317

 Score =   105 bits (262),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 66/92 (72%), Gaps = 11/92 (12%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G++I+AL FSPNRYWLCAAT+  IKIWDLE KS+V DL   L        EG   A + K
Sbjct  236  GNVINALVFSPNRYWLCAATDRGIKIWDLEYKSVVDDLDAPL--------EGVEAAKQPK  287

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGR  181
             +   SL+W+ADG+TL+SGYTDGVIRVW +GR
Sbjct  288  PV---SLAWSADGATLYSGYTDGVIRVWAVGR  316


 Score = 74.3 bits (181),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H GY+N+V VSPDGSLCASGGKDGV +LWDL+ GK LYSLDAG
Sbjct  194  HRGYINSVTVSPDGSLCASGGKDGVAMLWDLSVGKHLYSLDAG  236



>dbj|GAN10996.1| guanine nucleotide-binding protein [Mucor ambiguus]
Length=259

 Score =   106 bits (265),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 53/92 (58%), Positives = 63/92 (68%), Gaps = 9/92 (10%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            GS++HAL FSPNRYWLCAAT   IKIWDLESKS+V DLR +  Q  +          KN 
Sbjct  175  GSLVHALTFSPNRYWLCAATANGIKIWDLESKSVVDDLRPEFPQLGKR---------KNP  225

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGR  181
               C S+ W+ADG+TLFSGY+D VIRVW + R
Sbjct  226  DPDCLSVCWSADGATLFSGYSDNVIRVWQVTR  257


 Score = 72.8 bits (177),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H GYVNTV +SPDGSLCAS GKDGV++LWDL + K LYSL+AG
Sbjct  133  HNGYVNTVTISPDGSLCASAGKDGVVMLWDLNDAKHLYSLEAG  175



>dbj|GAN11178.1| hypothetical protein MAM1_0495d10736 [Mucor ambiguus]
Length=136

 Score =   106 bits (264),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 53/92 (58%), Positives = 63/92 (68%), Gaps = 9/92 (10%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            GS++HAL FSPNRYWLCAAT   IKIWDLESKS+V DLR +  Q  +          KN 
Sbjct  52   GSLVHALTFSPNRYWLCAATANGIKIWDLESKSVVDDLRPEFPQLGKR---------KNP  102

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGR  181
               C S+ W+ADG+TLFSGY+D VIRVW + R
Sbjct  103  DPDCLSVCWSADGATLFSGYSDNVIRVWQVTR  134


 Score = 72.8 bits (177),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H GYVNTV +SPDGSLCAS GKDGV++LWDL + K LYSL+AG
Sbjct  10   HNGYVNTVTISPDGSLCASAGKDGVVMLWDLNDAKHLYSLEAG  52



>gb|EPB90862.1| guanine nucleotide-binding protein subunit beta-2-like 1 [Mucor 
circinelloides f. circinelloides 1006PhL]
Length=311

 Score =   105 bits (261),  Expect(2) = 4e-36, Method: Compositional matrix adjust.
 Identities = 53/92 (58%), Positives = 63/92 (68%), Gaps = 9/92 (10%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            GS++HAL FSPNRYWLCAAT   IKIWDLESKSIV +LR +  Q  +          KN 
Sbjct  227  GSLVHALTFSPNRYWLCAATANGIKIWDLESKSIVDELRPEFAQLGKR---------KNP  277

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGR  181
               C S+ W+ADG+TLFSGY+D VIRVW + R
Sbjct  278  DPDCLSVCWSADGATLFSGYSDNVIRVWQVTR  309


 Score = 73.6 bits (179),  Expect(2) = 4e-36, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H GYVNTV +SPDGSLCAS GKDGV++LWDL + K LYSL+AG
Sbjct  185  HNGYVNTVTISPDGSLCASAGKDGVVMLWDLNDAKHLYSLEAG  227



>ref|XP_002286095.1| guanine nucleotide binding protein beta subunit-like protein 
[Thalassiosira pseudonana CCMP1335]
 gb|EED95736.1| guanine nucleotide binding protein beta subunit-like protein 
[Thalassiosira pseudonana CCMP1335]
Length=326

 Score = 99.4 bits (246),  Expect(2) = 5e-36, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 63/88 (72%), Gaps = 5/88 (6%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G IIH+L FSPNRYWLCAAT+  IKIWDLESK +V  LR    +E ++  E     A+  
Sbjct  239  GEIIHSLVFSPNRYWLCAATDECIKIWDLESKVVVDTLR---PEEFDLGNEEGTGHARAP  295

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVW  193
               CTSL+W+ADGSTLF+GY+D VIRV+
Sbjct  296  --HCTSLAWSADGSTLFAGYSDKVIRVY  321


 Score = 79.0 bits (193),  Expect(2) = 5e-36, Method: Compositional matrix adjust.
 Identities = 36/43 (84%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK+LYSLDAG
Sbjct  197  HTGYLNTVCVSPDGSLCASGGKDGTAMLWDLNEGKRLYSLDAG  239



>emb|CEP08121.1| hypothetical protein [Parasitella parasitica]
Length=316

 Score =   103 bits (256),  Expect(2) = 5e-36, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 63/92 (68%), Gaps = 9/92 (10%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            GS++HAL FSPNRYWLCAAT   IKIWDLESKS+V +LR +  Q  +          KN 
Sbjct  232  GSLVHALTFSPNRYWLCAATATGIKIWDLESKSLVDELRPEFPQLGKR---------KNP  282

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGR  181
               C S+ W++DG+TLFSGY+D +IRVW + R
Sbjct  283  DPDCLSVCWSSDGATLFSGYSDNIIRVWQVTR  314


 Score = 74.7 bits (182),  Expect(2) = 5e-36, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H GYVNTV +SPDGSLCAS GKDGV++LWDL E K LYSL+AG
Sbjct  190  HNGYVNTVTISPDGSLCASAGKDGVVMLWDLNEAKHLYSLEAG  232



>emb|CEP13972.1| hypothetical protein [Parasitella parasitica]
Length=316

 Score =   104 bits (260),  Expect(2) = 5e-36, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 63/92 (68%), Gaps = 9/92 (10%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            GS++HAL FSPNRYWLCAAT   IKIWDLESKSIV +LR +  Q  +          KN 
Sbjct  232  GSLVHALTFSPNRYWLCAATANGIKIWDLESKSIVDELRPEFPQLGKR---------KNP  282

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGR  181
               C S+ W+ADG+TLFSGY+D +IRVW + R
Sbjct  283  DPDCLSVCWSADGATLFSGYSDNIIRVWQVTR  314


 Score = 73.2 bits (178),  Expect(2) = 5e-36, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H GYVNTV +SPDGSLCAS GKDGV++LWDL + K LYSL+AG
Sbjct  190  HNGYVNTVTISPDGSLCASAGKDGVVMLWDLNDAKHLYSLEAG  232



>gb|EJT47727.1| G protein beta subunit-like protein Rkp1 [Trichosporon asahii 
var. asahii CBS 2479]
 gb|EKD01510.1| G protein beta subunit-like protein Rkp1 [Trichosporon asahii 
var. asahii CBS 8904]
Length=314

 Score =   101 bits (251),  Expect(2) = 6e-36, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 63/90 (70%), Gaps = 10/90 (11%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G I+++L FSPNRYWLCAAT +SIKI+DLESKSIV DL+ D  + SE          K +
Sbjct  233  GDIVNSLVFSPNRYWLCAATASSIKIFDLESKSIVDDLKPDFNELSE----------KAR  282

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGI  187
               C SL+W+ADG TLF GYTD +IRVW +
Sbjct  283  KPECASLAWSADGQTLFGGYTDNLIRVWAV  312


 Score = 76.3 bits (186),  Expect(2) = 6e-36, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGY+NT+AVSPDGSL ASGGKDG+++LWDL EGK LYSL+AG
Sbjct  191  HTGYINTLAVSPDGSLAASGGKDGIVMLWDLNEGKHLYSLEAG  233



>gb|EAW53699.1| guanine nucleotide binding protein (G protein), beta polypeptide 
2-like 1, isoform CRA_h [Homo sapiens]
Length=365

 Score =   103 bits (257),  Expect(2) = 6e-36, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 10/90 (11%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G II+ALCFSPNRYWLCAAT  SIKIWDLE K I+VD   +LKQE        +T++K +
Sbjct  281  GDIINALCFSPNRYWLCAATGPSIKIWDLEGK-IIVD---ELKQEVI------STSSKAE  330

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGI  187
               CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  331  PPQCTSLAWSADGQTLFAGYTDNLVRVWQV  360


 Score = 74.3 bits (181),  Expect(2) = 6e-36, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G
Sbjct  239  HTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGG  281



>gb|EPB88453.1| guanine nucleotide-binding protein subunit beta-2-like 1 [Mucor 
circinelloides f. circinelloides 1006PhL]
Length=328

 Score =   104 bits (259),  Expect(2) = 6e-36, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 63/92 (68%), Gaps = 9/92 (10%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            GS++HAL FSPNRYWLCAAT   IKIWDLESKSIV +LR +  Q  +          KN 
Sbjct  244  GSLVHALTFSPNRYWLCAATANGIKIWDLESKSIVDELRPEFAQLGKR---------KNP  294

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGR  181
               C S+ W+ADG+TLFSGY+D +IRVW + R
Sbjct  295  DPDCLSVCWSADGATLFSGYSDNIIRVWQVTR  326


 Score = 73.6 bits (179),  Expect(2) = 6e-36, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H GYVNTV +SPDGSLCAS GKDGV++LWDL + K LYSL+AG
Sbjct  202  HNGYVNTVTISPDGSLCASAGKDGVVMLWDLNDAKHLYSLEAG  244



>ref|XP_004696065.1| PREDICTED: LOW QUALITY PROTEIN: guanine nucleotide binding protein 
(G protein), beta polypeptide 2-like 1 [Condylura cristata]
Length=271

 Score =   103 bits (257),  Expect(2) = 7e-36, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 10/90 (11%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G II+ALCFSPNRYWLCAAT  SIKIWDLE K I+VD   +LKQE        +T++K +
Sbjct  187  GDIINALCFSPNRYWLCAATGPSIKIWDLEGK-IIVD---ELKQEVI------STSSKAE  236

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGI  187
               CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  237  PPQCTSLAWSADGQTLFAGYTDNLVRVWQV  266


 Score = 74.3 bits (181),  Expect(2) = 7e-36, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G
Sbjct  145  HTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGG  187



>ref|XP_008681951.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Ursus maritimus]
Length=374

 Score =   102 bits (255),  Expect(2) = 9e-36, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 10/90 (11%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G II+ALCFSPNRYWLCAAT  SIKIWDLE K I+VD   +LKQE        +T++K +
Sbjct  290  GDIINALCFSPNRYWLCAATGPSIKIWDLEGK-IIVD---ELKQEVI------STSSKAE  339

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGI  187
               CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  340  PPQCTSLAWSADGQTLFAGYTDNLVRVWQV  369


 Score = 74.7 bits (182),  Expect(2) = 9e-36, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 40/50 (80%), Gaps = 2/50 (4%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG--VNHSC  440
            HTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G  +N  C
Sbjct  248  HTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALC  297



>gb|KDO19117.1| guanine nucleotide-binding protein subunit beta-2-like 1 [Saprolegnia 
parasitica CBS 223.65]
Length=326

 Score = 99.0 bits (245),  Expect(2) = 9e-36, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 62/91 (68%), Gaps = 10/91 (11%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G IIHAL FSPNRYWLCAAT + IKIWDLESK +VVD         E+  E      K+ 
Sbjct  244  GDIIHALVFSPNRYWLCAATSSGIKIWDLESK-VVVD---------EIVPEFEAVGKKSL  293

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIG  184
               C SL W+ADG++LF+GYTDG++RV+ +G
Sbjct  294  PPHCVSLCWSADGASLFAGYTDGIVRVYAVG  324


 Score = 78.2 bits (191),  Expect(2) = 9e-36, Method: Compositional matrix adjust.
 Identities = 35/43 (81%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGY+NTV VSPDGSLCASGGKDGV +LWDL EGK+LY+L+AG
Sbjct  202  HTGYLNTVTVSPDGSLCASGGKDGVAMLWDLNEGKRLYTLEAG  244



>ref|XP_005018374.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1, partial [Anas platyrhynchos]
Length=351

 Score =   103 bits (256),  Expect(2) = 9e-36, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 65/90 (72%), Gaps = 10/90 (11%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G II+ALCFSPNRYWLCAAT  SIKIWDLE K I+VD         E+  E  +T++K +
Sbjct  267  GDIINALCFSPNRYWLCAATGPSIKIWDLEGK-IIVD---------ELKQEVISTSSKAE  316

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGI  187
               CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  317  PPQCTSLAWSADGQTLFAGYTDNLVRVWQV  346


 Score = 74.3 bits (181),  Expect(2) = 9e-36, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G
Sbjct  225  HTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGG  267



>ref|XP_007527211.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 isoform X2 [Erinaceus europaeus]
Length=271

 Score =   102 bits (255),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 10/90 (11%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G II+ALCFSPNRYWLCAAT  SIKIWDLE K I+VD   +LKQE        +T++K +
Sbjct  187  GDIINALCFSPNRYWLCAATGPSIKIWDLEGK-IIVD---ELKQEVI------STSSKAE  236

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGI  187
               CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  237  PPQCTSLAWSADGQTLFAGYTDNLVRVWQV  266


 Score = 74.3 bits (181),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G
Sbjct  145  HTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGG  187



>ref|XP_005795376.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1-like [Xiphophorus maculatus]
Length=317

 Score =   102 bits (254),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 63/90 (70%), Gaps = 10/90 (11%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G II+ALCFSPNRYWLCAAT  SIKIWDLE K IV +LR           E  +T +K +
Sbjct  233  GDIINALCFSPNRYWLCAATGPSIKIWDLEGKIIVDELR----------QEVISTNSKAE  282

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGI  187
               CTSL+W+ADG TLF+GYTD +IRVW +
Sbjct  283  PPQCTSLAWSADGQTLFAGYTDNLIRVWQV  312


 Score = 75.1 bits (183),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD+G
Sbjct  191  HTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDSG  233



>ref|XP_005862397.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Myotis brandtii]
Length=372

 Score =   102 bits (255),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 10/90 (11%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G II+ALCFSPNRYWLCAAT  SIKIWDLE K I+VD   +LKQE        +T++K +
Sbjct  288  GDIINALCFSPNRYWLCAATGPSIKIWDLEGK-IIVD---ELKQEVI------STSSKAE  337

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGI  187
               CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  338  PPQCTSLAWSADGQTLFAGYTDNLVRVWQV  367


 Score = 74.3 bits (181),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 40/50 (80%), Gaps = 2/50 (4%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG--VNHSC  440
            HTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G  +N  C
Sbjct  246  HTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALC  295



>ref|XP_009037831.1| hypothetical protein AURANDRAFT_37768 [Aureococcus anophagefferens]
 gb|EGB07194.1| hypothetical protein AURANDRAFT_37768 [Aureococcus anophagefferens]
Length=319

 Score =   100 bits (248),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 60/91 (66%), Gaps = 10/91 (11%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G +IH+L FSPNRYWLCAAT   +KIWDLESK +V +L+       E  A G N      
Sbjct  238  GDVIHSLVFSPNRYWLCAATTLGVKIWDLESKVVVDELK------PEFPAMGKNATPP--  289

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIG  184
              +CT + W+ADG+ LFSGYTDG+IR W +G
Sbjct  290  --YCTCICWSADGAVLFSGYTDGLIRAWHVG  318


 Score = 77.0 bits (188),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 41/48 (85%), Gaps = 1/48 (2%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG-VNHS  443
            H GY+NTV VSPDGSLCASGGKDG  +LWDL EGK+LYSLDAG V HS
Sbjct  196  HNGYLNTVTVSPDGSLCASGGKDGTAMLWDLNEGKRLYSLDAGDVIHS  243



>ref|XP_005977784.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1-like isoform X2 [Pantholops hodgsonii]
Length=271

 Score =   102 bits (255),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 10/90 (11%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G II+ALCFSPNRYWLCAAT  SIKIWDLE K I+VD   +LKQE        +T++K +
Sbjct  187  GDIINALCFSPNRYWLCAATGPSIKIWDLEGK-IIVD---ELKQEVI------STSSKAE  236

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGI  187
               CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  237  PPQCTSLAWSADGQTLFAGYTDNLVRVWQV  266


 Score = 74.3 bits (181),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G
Sbjct  145  HTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGG  187



>ref|XP_005891160.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 isoform X2 [Bos mutus]
Length=271

 Score =   102 bits (255),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 10/90 (11%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G II+ALCFSPNRYWLCAAT  SIKIWDLE K I+VD   +LKQE        +T++K +
Sbjct  187  GDIINALCFSPNRYWLCAATGPSIKIWDLEGK-IIVD---ELKQEVI------STSSKAE  236

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGI  187
               CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  237  PPQCTSLAWSADGQTLFAGYTDNLVRVWQV  266


 Score = 74.3 bits (181),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G
Sbjct  145  HTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGG  187



>ref|XP_006766909.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Myotis davidii]
Length=372

 Score =   102 bits (255),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 10/90 (11%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G II+ALCFSPNRYWLCAAT  SIKIWDLE K I+VD   +LKQE        +T++K +
Sbjct  288  GDIINALCFSPNRYWLCAATGPSIKIWDLEGK-IIVD---ELKQEVI------STSSKAE  337

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGI  187
               CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  338  PPQCTSLAWSADGQTLFAGYTDNLVRVWQV  367


 Score = 74.3 bits (181),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 40/50 (80%), Gaps = 2/50 (4%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG--VNHSC  440
            HTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G  +N  C
Sbjct  246  HTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALC  295



>ref|XP_008608530.1| guanine nucleotide-binding protein subunit beta-2-like 1 [Saprolegnia 
diclina VS20]
 gb|EQC38203.1| guanine nucleotide-binding protein subunit beta-2-like 1 [Saprolegnia 
diclina VS20]
Length=319

 Score = 99.0 bits (245),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 62/91 (68%), Gaps = 10/91 (11%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G IIHAL FSPNRYWLCAAT + IKIWDLESK +VVD         E+  E      K+ 
Sbjct  237  GDIIHALVFSPNRYWLCAATSSGIKIWDLESK-VVVD---------EIVPEFEAVGKKSL  286

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIG  184
               C SL W+ADG++LF+GYTDG++RV+ +G
Sbjct  287  PPHCVSLCWSADGASLFAGYTDGIVRVYAVG  317


 Score = 78.2 bits (191),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 35/43 (81%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGY+NTV VSPDGSLCASGGKDGV +LWDL EGK+LY+L+AG
Sbjct  195  HTGYLNTVTVSPDGSLCASGGKDGVAMLWDLNEGKRLYTLEAG  237



>ref|XP_008156879.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Eptesicus fuscus]
Length=372

 Score =   102 bits (255),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 10/90 (11%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G II+ALCFSPNRYWLCAAT  SIKIWDLE K I+VD   +LKQE        +T++K +
Sbjct  288  GDIINALCFSPNRYWLCAATGPSIKIWDLEGK-IIVD---ELKQEVI------STSSKAE  337

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGI  187
               CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  338  PPQCTSLAWSADGQTLFAGYTDNLVRVWQV  367


 Score = 74.3 bits (181),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 40/50 (80%), Gaps = 2/50 (4%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG--VNHSC  440
            HTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G  +N  C
Sbjct  246  HTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALC  295



>ref|XP_006746631.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 isoform X2 [Leptonychotes weddellii]
Length=271

 Score =   102 bits (255),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 10/90 (11%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G II+ALCFSPNRYWLCAAT  SIKIWDLE K I+VD   +LKQE        +T++K +
Sbjct  187  GDIINALCFSPNRYWLCAATGPSIKIWDLEGK-IIVD---ELKQEVI------STSSKAE  236

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGI  187
               CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  237  PPQCTSLAWSADGQTLFAGYTDNLVRVWQV  266


 Score = 74.3 bits (181),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 40/50 (80%), Gaps = 2/50 (4%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG--VNHSC  440
            HTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G  +N  C
Sbjct  145  HTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALC  194



>ref|XP_008013783.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Chlorocebus sabaeus]
Length=394

 Score =   102 bits (255),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 10/90 (11%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G II+ALCFSPNRYWLCAAT  SIKIWDLE K I+VD   +LKQE        +T++K +
Sbjct  310  GDIINALCFSPNRYWLCAATGPSIKIWDLEGK-IIVD---ELKQEVI------STSSKAE  359

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGI  187
               CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  360  PPQCTSLAWSADGQTLFAGYTDNLVRVWQV  389


 Score = 74.3 bits (181),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 40/50 (80%), Gaps = 2/50 (4%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG--VNHSC  440
            HTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G  +N  C
Sbjct  268  HTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALC  317



>ref|XP_006105825.1| PREDICTED: LOW QUALITY PROTEIN: guanine nucleotide-binding protein 
subunit beta-2-like 1 [Myotis lucifugus]
Length=372

 Score =   102 bits (255),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 10/90 (11%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G II+ALCFSPNRYWLCAAT  SIKIWDLE K I+VD   +LKQE        +T++K +
Sbjct  288  GDIINALCFSPNRYWLCAATGPSIKIWDLEGK-IIVD---ELKQEVI------STSSKAE  337

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGI  187
               CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  338  PPQCTSLAWSADGQTLFAGYTDNLVRVWQV  367


 Score = 74.3 bits (181),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G
Sbjct  246  HTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGG  288



>ref|XP_004586327.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Ochotona princeps]
Length=307

 Score =   102 bits (255),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 10/90 (11%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G II+ALCFSPNRYWLCAAT  SIKIWDLE K I+VD   +LKQE        +T++K +
Sbjct  223  GDIINALCFSPNRYWLCAATGPSIKIWDLEGK-IIVD---ELKQEVI------STSSKAE  272

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGI  187
               CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  273  PPQCTSLAWSADGQTLFAGYTDNLVRVWQV  302


 Score = 74.3 bits (181),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G
Sbjct  181  HTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGG  223



>ref|XP_008955153.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 isoform X1 [Pan paniscus]
Length=395

 Score =   102 bits (255),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 10/90 (11%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G II+ALCFSPNRYWLCAAT  SIKIWDLE K I+VD   +LKQE        +T++K +
Sbjct  311  GDIINALCFSPNRYWLCAATGPSIKIWDLEGK-IIVD---ELKQEVI------STSSKAE  360

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGI  187
               CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  361  PPQCTSLAWSADGQTLFAGYTDNLVRVWQV  390


 Score = 74.3 bits (181),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 40/50 (80%), Gaps = 2/50 (4%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG--VNHSC  440
            HTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G  +N  C
Sbjct  269  HTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALC  318



>gb|ACJ85349.1| unknown [Medicago truncatula]
Length=285

 Score = 89.7 bits (221),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 41/47 (87%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESE  316
            GSIIHALCFSPNRYWLCAATE+SIKIWDLESKSIV DL+VDLK E++
Sbjct  234  GSIIHALCFSPNRYWLCAATESSIKIWDLESKSIVEDLKVDLKTEAD  280


 Score = 87.4 bits (215),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 41/43 (95%), Positives = 43/43 (100%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            H+GYVNTVAVSPDGSLCASGGKDGVILLWDLAEGK+LYSLDAG
Sbjct  192  HSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDAG  234



>gb|KDO24030.1| guanine nucleotide-binding protein subunit beta-2-like 1 [Saprolegnia 
parasitica CBS 223.65]
Length=230

 Score = 99.4 bits (246),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 62/91 (68%), Gaps = 10/91 (11%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G IIHAL FSPNRYWLCAAT + IKIWDLESK +VVD         E+  E      K+ 
Sbjct  148  GDIIHALVFSPNRYWLCAATSSGIKIWDLESK-VVVD---------EIVPEFEAVGKKSL  197

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIG  184
               C SL W+ADG++LF+GYTDG++RV+ +G
Sbjct  198  PPHCVSLCWSADGASLFAGYTDGIVRVYAVG  228


 Score = 77.8 bits (190),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 35/43 (81%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGY+NTV VSPDGSLCASGGKDGV +LWDL EGK+LY+L+AG
Sbjct  106  HTGYLNTVTVSPDGSLCASGGKDGVAMLWDLNEGKRLYTLEAG  148



>pdb|4AOW|A Chain A, Crystal Structure Of The Human Rack1 Protein At A Resolution 
Of 2.45 Angstrom
 pdb|4AOW|B Chain B, Crystal Structure Of The Human Rack1 Protein At A Resolution 
Of 2.45 Angstrom
 pdb|4AOW|C Chain C, Crystal Structure Of The Human Rack1 Protein At A Resolution 
Of 2.45 Angstrom
Length=340

 Score =   102 bits (254),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 10/90 (11%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G II+ALCFSPNRYWLCAAT  SIKIWDLE K I+VD   +LKQE        +T++K +
Sbjct  256  GDIINALCFSPNRYWLCAATGPSIKIWDLEGK-IIVD---ELKQEVI------STSSKAE  305

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGI  187
               CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  306  PPQCTSLAWSADGQTLFAGYTDNLVRVWQV  335


 Score = 74.3 bits (181),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G
Sbjct  214  HTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGG  256



>dbj|BAE40068.1| unnamed protein product [Mus musculus]
 dbj|BAE40156.1| unnamed protein product [Mus musculus]
Length=317

 Score =   102 bits (254),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 10/90 (11%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G II+ALCFSPNRYWLCAAT  SIKIWDLE K I+VD   +LKQE        +T++K +
Sbjct  233  GDIINALCFSPNRYWLCAATGPSIKIWDLEGK-IIVD---ELKQEVI------STSSKAE  282

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGI  187
               CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  283  PPQCTSLAWSADGQTLFAGYTDNLVRVWQV  312


 Score = 74.3 bits (181),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G
Sbjct  191  HTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGG  233



>gb|AAO21313.1| lung cancer oncogene 7 [Homo sapiens]
Length=347

 Score =   102 bits (254),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 10/90 (11%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G II+ALCFSPNRYWLCAAT  SIKIWDLE K I+VD   +LKQE        +T++K +
Sbjct  263  GDIINALCFSPNRYWLCAATGPSIKIWDLEGK-IIVD---ELKQEVI------STSSKAE  312

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGI  187
               CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  313  PPQCTSLAWSADGQTLFAGYTDNLVRVWQV  342


 Score = 74.3 bits (181),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G
Sbjct  221  HTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGG  263



>gb|ESA03866.1| hypothetical protein GLOINDRAFT_336518 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX68229.1| Asc1p [Rhizophagus irregularis DAOM 197198w]
Length=315

 Score = 98.6 bits (244),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 63/92 (68%), Gaps = 10/92 (11%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G II+AL FSPNRYWLCAAT + IKIWDLE+K++V DL+ +  +          T  ++K
Sbjct  233  GDIINALVFSPNRYWLCAATASFIKIWDLETKTVVDDLKPEFTE----------TGKQSK  282

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGIGR  181
               C SL+W+ DG+TLF+GYTD  IRVW + R
Sbjct  283  DPECISLAWSPDGTTLFAGYTDNNIRVWQVTR  314


 Score = 78.6 bits (192),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGY+NTV +SPDGSLCASGGKDG+ +LWDL EGK LYSL+AG
Sbjct  191  HTGYINTVTISPDGSLCASGGKDGITMLWDLNEGKHLYSLEAG  233



>gb|EAW53698.1| guanine nucleotide binding protein (G protein), beta polypeptide 
2-like 1, isoform CRA_g [Homo sapiens]
Length=413

 Score =   102 bits (255),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 10/90 (11%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G II+ALCFSPNRYWLCAAT  SIKIWDLE K I+VD   +LKQE        +T++K +
Sbjct  329  GDIINALCFSPNRYWLCAATGPSIKIWDLEGK-IIVD---ELKQEVI------STSSKAE  378

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGI  187
               CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  379  PPQCTSLAWSADGQTLFAGYTDNLVRVWQV  408


 Score = 73.9 bits (180),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G
Sbjct  287  HTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGG  329



>gb|ETE60795.1| Guanine nucleotide-binding protein subunit beta-2-like 1 [Ophiophagus 
hannah]
Length=400

 Score =   102 bits (255),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 66/90 (73%), Gaps = 10/90 (11%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G II+ALCFSPNRYWLCAAT  SIKIWDLE K I+VD   +LKQE         T++K +
Sbjct  316  GDIINALCFSPNRYWLCAATGPSIKIWDLEGK-IIVD---ELKQEVI------TTSSKAE  365

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGI  187
               CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  366  PPQCTSLAWSADGQTLFAGYTDNLVRVWQV  395


 Score = 73.9 bits (180),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G
Sbjct  274  HTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGG  316



>gb|EAW53694.1| guanine nucleotide binding protein (G protein), beta polypeptide 
2-like 1, isoform CRA_c [Homo sapiens]
Length=395

 Score =   102 bits (255),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 10/90 (11%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G II+ALCFSPNRYWLCAAT  SIKIWDLE K I+VD   +LKQE        +T++K +
Sbjct  311  GDIINALCFSPNRYWLCAATGPSIKIWDLEGK-IIVD---ELKQEVI------STSSKAE  360

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGI  187
               CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  361  PPQCTSLAWSADGQTLFAGYTDNLVRVWQV  390


 Score = 73.9 bits (180),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 40/50 (80%), Gaps = 2/50 (4%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG--VNHSC  440
            HTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G  +N  C
Sbjct  269  HTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALC  318



>gb|AAI02287.2| GNB2L1 protein [Bos taurus]
Length=317

 Score =   102 bits (254),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 10/90 (11%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G II+ALCFSPNRYWLCAAT  SIKIWDLE K I+VD   +LKQE        +T++K +
Sbjct  233  GDIINALCFSPNRYWLCAATGPSIKIWDLEGK-IIVD---ELKQEVI------STSSKAE  282

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGI  187
               CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  283  PPQCTSLAWSADGQTLFAGYTDNLVRVWQV  312


 Score = 74.3 bits (181),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G
Sbjct  191  HTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGG  233



>ref|NP_006089.1| guanine nucleotide-binding protein subunit beta-2-like 1 [Homo 
sapiens]
 ref|NP_032169.1| guanine nucleotide-binding protein subunit beta-2-like 1 [Mus 
musculus]
 ref|NP_786996.1| guanine nucleotide-binding protein subunit beta-2-like 1 [Bos 
taurus]
 ref|NP_999497.1| guanine nucleotide-binding protein subunit beta-2-like 1 [Sus 
scrofa]
 ref|NP_001004378.1| guanine nucleotide-binding protein subunit beta-2-like 1 [Gallus 
gallus]
 ref|NP_001088625.1| guanine nucleotide binding protein (G protein), beta polypeptide 
2-like 1 [Xenopus laevis]
 ref|NP_001229375.1| guanine nucleotide binding protein (G protein), beta polypeptide 
2-like 1 [Equus caballus]
 ref|NP_570090.2| guanine nucleotide-binding protein subunit beta-2-like 1 [Rattus 
norvegicus]
 ref|NP_001268408.1| guanine nucleotide binding protein (G protein), beta polypeptide 
2-like 1 [Ovis aries]
 ref|XP_001367237.1| PREDICTED: guanine nucleotide binding protein (G protein), beta 
polypeptide 2-like 1 [Monodelphis domestica]
 ref|XP_003211191.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Meleagris gallopavo]
 ref|XP_003279626.1| PREDICTED: uncharacterized protein LOC100586801 isoform 1 [Nomascus 
leucogenys]
 ref|XP_518165.3| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 isoform X1 [Pan troglodytes]
 ref|XP_002806648.2| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Callithrix jacchus]
 ref|XP_003768880.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Sarcophilus harrisii]
 ref|XP_003800227.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Otolemur garnettii]
 ref|XP_004043221.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Gorilla gorilla gorilla]
 ref|XP_004277688.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Orcinus orca]
 ref|XP_004316725.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 isoform 1 [Tursiops truncatus]
 ref|XP_004316726.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 isoform 2 [Tursiops truncatus]
 ref|XP_004413551.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Odobenus rosmarus divergens]
 ref|XP_004443640.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Ceratotherium simum simum]
 ref|XP_004615363.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Sorex araneus]
 ref|XP_004657523.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 isoform X1 [Jaculus jaculus]
 ref|XP_004641821.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1-like [Octodon degus]
 ref|XP_004888364.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Heterocephalus glaber]
 ref|XP_004875182.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Heterocephalus glaber]
 ref|XP_003472234.2| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Cavia porcellus]
 ref|XP_005199090.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Bos taurus]
 ref|XP_005209294.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Bos taurus]
 ref|XP_005286763.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Chrysemys picta bellii]
 ref|XP_005350255.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Microtus ochrogaster]
 ref|XP_005340941.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Ictidomys tridecemlineatus]
 ref|XP_005410153.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Chinchilla lanigera]
 ref|XP_005626337.1| PREDICTED: guanine nucleotide binding protein (G protein), beta 
polypeptide 2-like 1 [Canis lupus familiaris]
 ref|XP_005682850.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Capra hircus]
 ref|XP_005891159.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 isoform X1 [Bos mutus]
 ref|XP_005977783.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1-like isoform X1 [Pantholops hodgsonii]
 ref|XP_006178047.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Camelus ferus]
 ref|XP_006211974.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Vicugna pacos]
 ref|XP_006746630.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 isoform X1 [Leptonychotes weddellii]
 ref|XP_006877453.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Chrysochloris asiatica]
 ref|XP_006923292.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Pteropus alecto]
 ref|XP_006987200.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 isoform X2 [Peromyscus maniculatus bairdii]
 ref|XP_007117631.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Physeter catodon]
 ref|XP_006075960.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Bubalus bubalis]
 ref|XP_007173555.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Balaenoptera acutorostrata scammoni]
 ref|XP_007461014.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Lipotes vexillifer]
 ref|XP_007527210.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 isoform X1 [Erinaceus europaeus]
 ref|XP_007670784.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Ornithorhynchus anatinus]
 ref|XP_007618481.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 isoform X2 [Cricetulus griseus]
 ref|XP_007952450.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Orycteropus afer afer]
 ref|XP_008103676.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Anolis carolinensis]
 ref|XP_008260230.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Oryctolagus cuniculus]
 ref|XP_008542516.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Equus przewalskii]
 ref|XP_008579732.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Galeopterus variegatus]
 ref|XP_008844172.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Nannospalax galili]
 ref|XP_010382943.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Rhinopithecus roxellana]
 ref|XP_010567583.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Haliaeetus leucocephalus]
 ref|XP_010608822.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Fukomys damarensis]
 ref|XP_010591332.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Loxodonta africana]
 ref|XP_010844776.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Bison bison bison]
 ref|XP_010948587.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Camelus bactrianus]
 ref|XP_010996191.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Camelus dromedarius]
 ref|XP_011215891.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Ailuropoda melanoleuca]
 ref|XP_003980688.3| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Felis catus]
 ref|XP_011360446.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Pteropus vampyrus]
 sp|P63245.3|GBLP_RAT RecName: Full=Guanine nucleotide-binding protein subunit beta-2-like 
1; AltName: Full=Receptor for activated C kinase; AltName: 
Full=Receptor of activated protein kinase C 1; Short=RACK1; 
Contains: RecName: Full=Guanine nucleotide-binding protein 
subunit beta-2-like 1, N-terminally processed [Rattus 
norvegicus]
 sp|P63246.3|GBLP_PIG RecName: Full=Guanine nucleotide-binding protein subunit beta-2-like 
1; AltName: Full=Receptor for activated C kinase; AltName: 
Full=Receptor of activated protein kinase C 1; Short=RACK1; 
Contains: RecName: Full=Guanine nucleotide-binding protein 
subunit beta-2-like 1, N-terminally processed [Sus scrofa]
 sp|P63243.3|GBLP_BOVIN RecName: Full=Guanine nucleotide-binding protein subunit beta-2-like 
1; AltName: Full=Receptor for activated C kinase; AltName: 
Full=Receptor of activated protein kinase C 1; Short=RACK1; 
Contains: RecName: Full=Guanine nucleotide-binding protein 
subunit beta-2-like 1, N-terminally processed [Bos taurus]
 sp|P63244.3|GBLP_HUMAN RecName: Full=Guanine nucleotide-binding protein subunit beta-2-like 
1; AltName: Full=Cell proliferation-inducing gene 21 
protein; AltName: Full=Guanine nucleotide-binding protein subunit 
beta-like protein 12.3; AltName: Full=Human lung cancer 
oncogene 7 protein; Short=HLC-7; AltName: Full=Receptor for 
activated C kinase; AltName: Full=Receptor of activated protein 
kinase C 1; Short=RACK1; Contains: RecName: Full=Guanine 
nucleotide-binding protein subunit beta-2-like 1, N-terminally 
processed [Homo sapiens]
 sp|P63247.1|GBLP_CHICK RecName: Full=Guanine nucleotide-binding protein subunit beta-2-like 
1; AltName: Full=Guanine nucleotide-binding protein 
subunit beta-like protein 12.3; AltName: Full=Receptor for activated 
C kinase; AltName: Full=Receptor of activated protein 
kinase C 1; Short=RACK1 [Gallus gallus]
 sp|P68040.3|GBLP_MOUSE RecName: Full=Guanine nucleotide-binding protein subunit beta-2-like 
1; AltName: Full=12-3; AltName: Full=Receptor for activated 
C kinase; AltName: Full=Receptor of activated protein 
kinase C 1; Short=RACK1; AltName: Full=p205; Contains: RecName: 
Full=Guanine nucleotide-binding protein subunit beta-2-like 
1, N-terminally processed [Mus musculus]
 sp|Q4R7Y4.3|GBLP_MACFA RecName: Full=Guanine nucleotide-binding protein subunit beta-2-like 
1; Contains: RecName: Full=Guanine nucleotide-binding 
protein subunit beta-2-like 1, N-terminally processed [Macaca 
fascicularis]
 pdb|2ZKQ|AA Chain a, Structure Of A Mammalian Ribosomal 40s Subunit Within 
An 80s Complex Obtained By Docking Homology Models Of The 
Rna And Proteins Into An 8.7 A Cryo-em Map
 pdb|3J3A|GG Chain g, Structure Of The Human 40s Ribosomal Proteins
 pdb|4KZX|GG Chain g, Rabbit 40s Ribosomal Subunit In Complex With Eif1.
 pdb|4KZY|GG Chain g, Rabbit 40s Ribosomal Subunit In Complex With Eif1 And 
Eif1a.
 pdb|4KZZ|GG Chain g, Rabbit 40s Ribosomal Subunit In Complex With Mrna, Initiator 
Trna And Eif1a
 pdb|4CXC|GG Chain g, Regulation Of The Mammalian Elongation Cycle By 40s 
Subunit Rolling: A Eukaryotic-specific Ribosome Rearrangement
 pdb|4UQ4|GG Chain g, Mammalian 80s Hcv-ires Initiation Complex With Eif5b 
Post-like State
 pdb|4UQ5|GG Chain g, Mammalian 80s Hcv-ires Initiation Complex With Eif5b 
Pre-like State
 pdb|4W23|GG Chain g, Structure Of The 80s Mammalian Ribosome Bound To Eef2 
(this Entry Contains The Small Ribosomal Subunit)
 pdb|4W28|GG Chain g, Structure Of The Translating Mammalian Ribosome-sec61 
Complex (this Entry Contains The Small Ribosomal Subunit)
 pdb|4D5L|GG Chain g, Cryo-em Structures Of Ribosomal 80s Complexes With Termination 
Factors And Cricket Paralysis Virus Ires Reveal The 
Ires In The Translocated State
 pdb|4D61|GG Chain g, Cryo-em Structures Of Ribosomal 80s Complexes With Termination 
Factors And Cricket Paralysis Virus Ires Reveal The 
Ires In The Translocated State
 gb|AAA50559.1| MHC B complex protein 12.3 [Gallus gallus]
 gb|AAA59626.1| MHC B complex protein 12.3 [Homo sapiens]
 emb|CAA53062.1| B complex protein mRNA 12-3 [Mus musculus]
 emb|CAA83944.1| G-beta like protein [Sus scrofa]
 gb|AAD37978.1| RACK1 [Sus scrofa]
 emb|CAB64792.1| receptor for activated C kinase [Bos taurus]
 gb|AAH00214.1| Guanine nucleotide binding protein (G protein), beta polypeptide 
2-like 1 [Homo sapiens]
 gb|AAH00366.1| Guanine nucleotide binding protein (G protein), beta polypeptide 
2-like 1 [Homo sapiens]
 dbj|BAB22141.1| unnamed protein product [Mus musculus]
 dbj|BAB30920.1| unnamed protein product [Mus musculus]
 gb|AAH10119.1| Guanine nucleotide binding protein (G protein), beta polypeptide 
2-like 1 [Homo sapiens]
 gb|AAH14256.1| Guanine nucleotide binding protein (G protein), beta polypeptide 
2-like 1 [Homo sapiens]
 gb|AAH14788.1| Guanine nucleotide binding protein (G protein), beta polypeptide 
2-like 1 [Homo sapiens]
 gb|AAH17287.1| Guanine nucleotide binding protein (G protein), beta polypeptide 
2-like 1 [Homo sapiens]
 gb|AAH19093.1| Guanine nucleotide binding protein (G protein), beta polypeptide 
2-like 1 [Homo sapiens]
 gb|AAH19362.1| Guanine nucleotide binding protein (G protein), beta polypeptide 
2-like 1 [Homo sapiens]
 gb|AAH21993.1| Guanine nucleotide binding protein (G protein), beta polypeptide 
2-like 1 [Homo sapiens]
 gb|AAH32006.1| Guanine nucleotide binding protein (G protein), beta polypeptide 
2-like 1 [Homo sapiens]
 dbj|BAC34564.1| unnamed protein product [Mus musculus]
 gb|AAH46760.1| Guanine nucleotide binding protein (G protein), beta polypeptide 
2 like 1 [Mus musculus]
 gb|AAH63809.1| Guanine nucleotide binding protein (G protein), beta polypeptide 
2 like 1 [Rattus norvegicus]
 gb|AAS49613.1| guanine nucleotide-binding protein [Gallus gallus]
 emb|CAG33259.1| GNB2L1 [Homo sapiens]
 emb|CAG46707.1| GNB2L1 [Homo sapiens]
 gb|AAH86231.1| LOC495666 protein [Xenopus laevis]
 dbj|BAE00788.1| unnamed protein product [Macaca fascicularis]
 dbj|BAE35846.1| unnamed protein product [Mus musculus]
 dbj|BAE35980.1| unnamed protein product [Mus musculus]
 dbj|BAE36257.1| unnamed protein product [Mus musculus]
 dbj|BAE38762.1| unnamed protein product [Mus musculus]
 dbj|BAE39017.1| unnamed protein product [Mus musculus]
 dbj|BAE39028.1| unnamed protein product [Mus musculus]
 dbj|BAE39133.1| unnamed protein product [Mus musculus]
 dbj|BAE40286.1| unnamed protein product [Mus musculus]
 emb|CAL38537.1| hypothetical protein [synthetic construct]
 gb|EAW53692.1| guanine nucleotide binding protein (G protein), beta polypeptide 
2-like 1, isoform CRA_a [Homo sapiens]
 gb|EAW53702.1| guanine nucleotide binding protein (G protein), beta polypeptide 
2-like 1, isoform CRA_a [Homo sapiens]
 gb|ABM82348.1| guanine nucleotide binding protein (G protein), beta polypeptide 
2-like 1 [synthetic construct]
 gb|ABM85522.1| guanine nucleotide binding protein (G protein), beta polypeptide 
2-like 1 [synthetic construct]
 dbj|BAF62990.1| Guanine nucleotide-binding protein beta subunit 2-like 1 [Gallus 
gallus]
 gb|EDL33791.1| guanine nucleotide binding protein (G protein), beta polypeptide 
2 like 1, isoform CRA_b [Mus musculus]
 gb|EDM04193.1| rCG34190, isoform CRA_a [Rattus norvegicus]
 gb|ACA64762.1| guanine nucleotide-binding protein beta subunit [Meleagris gallopavo]
 dbj|BAG73220.1| guanine nucleotide binding protein (G protein), beta polypeptide 
2-like 1 [synthetic construct]
 dbj|BAJ53010.1| Guanine nucleotide-binding protein beta subunit2-like 1 [Gallus 
gallus]
 gb|ADU87634.1| epididymis tissue sperm binding protein Li 3a [Homo sapiens]
 gb|EHH27132.1| hypothetical protein EGK_17255 [Macaca mulatta]
 gb|EHH54843.1| hypothetical protein EGM_15764 [Macaca fascicularis]
 gb|AGH08168.1| guanine nucleotide-binding protein beta polypeptide 2-like 1 
[Ovis aries]
 gb|AIC55766.1| GNB2L1, partial [synthetic construct]
 gb|AIC63290.1| GNB2L1, partial [synthetic construct]
 gb|AJG01854.1| GNB2L1 [Nipponia nippon]
 prf||2019408A neural differentiation-associated protein
Length=317

 Score =   102 bits (254),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 10/90 (11%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G II+ALCFSPNRYWLCAAT  SIKIWDLE K I+VD   +LKQE        +T++K +
Sbjct  233  GDIINALCFSPNRYWLCAATGPSIKIWDLEGK-IIVD---ELKQEVI------STSSKAE  282

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGI  187
               CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  283  PPQCTSLAWSADGQTLFAGYTDNLVRVWQV  312


 Score = 74.3 bits (181),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G
Sbjct  191  HTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGG  233



>gb|EWM27643.1| guanine nucleotide binding protein [Nannochloropsis gaditana]
Length=314

 Score =   100 bits (248),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 61/90 (68%), Gaps = 8/90 (9%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G IIH+L FSPNRYWLCAAT   IKIWDLESK +V  L      + +   +G ++ +   
Sbjct  232  GDIIHSLVFSPNRYWLCAATSQGIKIWDLESKDMVDHL------QPKWPVQGKHSLSPQP  285

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGI  187
              +CTSL+W+ADG TLFSGYTDG IR W +
Sbjct  286  --YCTSLAWSADGQTLFSGYTDGKIRCWSV  313


 Score = 76.6 bits (187),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 35/43 (81%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGY+N V VSPDGSLCASGGKDG  +LWDL EGK+LYSLDAG
Sbjct  190  HTGYLNVVTVSPDGSLCASGGKDGTAMLWDLNEGKRLYSLDAG  232



>gb|AAR24619.1| proliferation-inducing gene 21 [Homo sapiens]
Length=271

 Score =   102 bits (255),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 10/90 (11%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G II+ALCFSPNRYWLCAAT  SIKIWDLE K I+VD   +LKQE        +T++K +
Sbjct  187  GDIINALCFSPNRYWLCAATGPSIKIWDLEGK-IIVD---ELKQEVI------STSSKAE  236

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGI  187
               CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  237  PPQCTSLAWSADGQTLFAGYTDNLVRVWQV  266


 Score = 73.9 bits (180),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G
Sbjct  145  HTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGG  187



>gb|EAW53700.1| guanine nucleotide binding protein (G protein), beta polypeptide 
2-like 1, isoform CRA_i [Homo sapiens]
Length=435

 Score =   102 bits (255),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 10/90 (11%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G II+ALCFSPNRYWLCAAT  SIKIWDLE K I+VD   +LKQE        +T++K +
Sbjct  351  GDIINALCFSPNRYWLCAATGPSIKIWDLEGK-IIVD---ELKQEVI------STSSKAE  400

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGI  187
               CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  401  PPQCTSLAWSADGQTLFAGYTDNLVRVWQV  430


 Score = 73.9 bits (180),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 40/50 (80%), Gaps = 2/50 (4%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG--VNHSC  440
            HTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G  +N  C
Sbjct  309  HTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALC  358



>gb|KFO20808.1| Guanine nucleotide-binding protein subunit beta-2-like 1 [Fukomys 
damarensis]
Length=323

 Score =   102 bits (254),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 10/90 (11%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G II+ALCFSPNRYWLCAAT  SIKIWDLE K I+VD   +LKQE        +T++K +
Sbjct  239  GDIINALCFSPNRYWLCAATGPSIKIWDLEGK-IIVD---ELKQEVI------STSSKAE  288

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGI  187
               CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  289  PPQCTSLAWSADGQTLFAGYTDNLVRVWQV  318


 Score = 74.3 bits (181),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G
Sbjct  197  HTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGG  239



>ref|XP_006270088.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Alligator mississippiensis]
Length=317

 Score =   102 bits (254),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 10/90 (11%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G II+ALCFSPNRYWLCAAT  SIKIWDLE K I+VD   +LKQE        +T++K +
Sbjct  233  GDIINALCFSPNRYWLCAATGPSIKIWDLEGK-IIVD---ELKQEVI------STSSKAE  282

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGI  187
               CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  283  PPQCTSLAWSADGQTLFAGYTDNLVRVWQV  312


 Score = 74.3 bits (181),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G
Sbjct  191  HTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGG  233



>dbj|BAE40059.1| unnamed protein product [Mus musculus]
Length=317

 Score =   102 bits (254),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 10/90 (11%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G II+ALCFSPNRYWLCAAT  SIKIWDLE K I+VD   +LKQE        +T++K +
Sbjct  233  GDIINALCFSPNRYWLCAATGPSIKIWDLEGK-IIVD---ELKQEVI------STSSKAE  282

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGI  187
               CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  283  PPQCTSLAWSADGQTLFAGYTDNLVRVWQV  312


 Score = 74.3 bits (181),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G
Sbjct  191  HTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGG  233



>gb|AAP36938.1| Homo sapiens guanine nucleotide binding protein (G protein), 
beta polypeptide 2-like 1 [synthetic construct]
 gb|AAX29684.1| guanine nucleotide binding protein beta polypeptide 2-like 1, 
partial [synthetic construct]
 gb|AAX29685.1| guanine nucleotide binding protein beta polypeptide 2-like 1, 
partial [synthetic construct]
Length=318

 Score =   102 bits (254),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 10/90 (11%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G II+ALCFSPNRYWLCAAT  SIKIWDLE K I+VD   +LKQE        +T++K +
Sbjct  233  GDIINALCFSPNRYWLCAATGPSIKIWDLEGK-IIVD---ELKQEVI------STSSKAE  282

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGI  187
               CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  283  PPQCTSLAWSADGQTLFAGYTDNLVRVWQV  312


 Score = 74.3 bits (181),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G
Sbjct  191  HTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGG  233



>ref|XP_004657524.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 isoform X2 [Jaculus jaculus]
Length=267

 Score =   102 bits (255),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 10/90 (11%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G II+ALCFSPNRYWLCAAT  SIKIWDLE K I+VD   +LKQE        +T++K +
Sbjct  183  GDIINALCFSPNRYWLCAATGPSIKIWDLEGK-IIVD---ELKQEVI------STSSKAE  232

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGI  187
               CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  233  PPQCTSLAWSADGQTLFAGYTDNLVRVWQV  262


 Score = 73.9 bits (180),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G
Sbjct  141  HTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGG  183



>ref|XP_003900707.2| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 isoform X1 [Papio anubis]
 ref|XP_009208002.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 isoform X2 [Papio anubis]
Length=393

 Score =   102 bits (254),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 10/90 (11%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G II+ALCFSPNRYWLCAAT  SIKIWDLE K I+VD   +LKQE        +T++K +
Sbjct  309  GDIINALCFSPNRYWLCAATGPSIKIWDLEGK-IIVD---ELKQEVI------STSSKAE  358

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGI  187
               CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  359  PPQCTSLAWSADGQTLFAGYTDNLVRVWQV  388


 Score = 74.3 bits (181),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 40/50 (80%), Gaps = 2/50 (4%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG--VNHSC  440
            HTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G  +N  C
Sbjct  267  HTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALC  316



>ref|XP_001105066.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1-like isoform 4 [Macaca mulatta]
 ref|XP_005558900.1| PREDICTED: Guanine nucleotide-binding protein subunit beta-2-like 
1 [Macaca fascicularis]
Length=393

 Score =   102 bits (254),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 10/90 (11%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G II+ALCFSPNRYWLCAAT  SIKIWDLE K I+VD   +LKQE        +T++K +
Sbjct  309  GDIINALCFSPNRYWLCAATGPSIKIWDLEGK-IIVD---ELKQEVI------STSSKAE  358

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGI  187
               CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  359  PPQCTSLAWSADGQTLFAGYTDNLVRVWQV  388


 Score = 74.3 bits (181),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 40/50 (80%), Gaps = 2/50 (4%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG--VNHSC  440
            HTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G  +N  C
Sbjct  267  HTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALC  316



>gb|EPY85923.1| guanine nucleotide binding protein, beta polypeptide 2-like protein 
[Camelus ferus]
Length=329

 Score =   102 bits (254),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 10/90 (11%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G II+ALCFSPNRYWLCAAT  SIKIWDLE K I+VD   +LKQE        +T++K +
Sbjct  245  GDIINALCFSPNRYWLCAATGPSIKIWDLEGK-IIVD---ELKQEVI------STSSKAE  294

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGI  187
               CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  295  PPQCTSLAWSADGQTLFAGYTDNLVRVWQV  324


 Score = 74.3 bits (181),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G
Sbjct  203  HTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGG  245



>ref|XP_004387229.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Trichechus manatus latirostris]
Length=317

 Score =   102 bits (254),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 10/90 (11%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G II+ALCFSPNRYWLCAAT  SIKIWDLE K I+VD   +LKQE        +T++K +
Sbjct  233  GDIINALCFSPNRYWLCAATGPSIKIWDLEGK-IIVD---ELKQEVI------STSSKAE  282

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGI  187
               CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  283  PPQCTSLAWSADGQTLFAGYTDNLVRVWQV  312


 Score = 74.3 bits (181),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G
Sbjct  191  HTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGG  233



>gb|EPQ05298.1| Guanine nucleotide-binding protein subunit beta-2-like 1 [Myotis 
brandtii]
Length=256

 Score =   102 bits (254),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 10/90 (11%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G II+ALCFSPNRYWLCAAT  SIKIWDLE K I+VD   +LKQE        +T++K +
Sbjct  172  GDIINALCFSPNRYWLCAATGPSIKIWDLEGK-IIVD---ELKQEVI------STSSKAE  221

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGI  187
               CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  222  PPQCTSLAWSADGQTLFAGYTDNLVRVWQV  251


 Score = 73.9 bits (180),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G
Sbjct  130  HTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGG  172



>gb|EAW53696.1| guanine nucleotide binding protein (G protein), beta polypeptide 
2-like 1, isoform CRA_e [Homo sapiens]
Length=351

 Score =   102 bits (254),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 10/90 (11%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G II+ALCFSPNRYWLCAAT  SIKIWDLE K I+VD   +LKQE        +T++K +
Sbjct  267  GDIINALCFSPNRYWLCAATGPSIKIWDLEGK-IIVD---ELKQEVI------STSSKAE  316

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGI  187
               CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  317  PPQCTSLAWSADGQTLFAGYTDNLVRVWQV  346


 Score = 73.9 bits (180),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G
Sbjct  225  HTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGG  267



>gb|EHB05258.1| Guanine nucleotide-binding protein subunit beta-2-like 1 [Heterocephalus 
glaber]
Length=323

 Score =   102 bits (254),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 10/90 (11%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G II+ALCFSPNRYWLCAAT  SIKIWDLE K I+VD   +LKQE        +T++K +
Sbjct  239  GDIINALCFSPNRYWLCAATGPSIKIWDLEGK-IIVD---ELKQEVI------STSSKAE  288

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGI  187
               CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  289  PPQCTSLAWSADGQTLFAGYTDNLVRVWQV  318


 Score = 73.9 bits (180),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G
Sbjct  197  HTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGG  239



>dbj|BAG53102.1| unnamed protein product [Homo sapiens]
Length=275

 Score =   102 bits (254),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 10/90 (11%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G II+ALCFSPNRYWLCAAT  SIKIWDLE K I+VD   +LKQE        +T++K +
Sbjct  191  GDIINALCFSPNRYWLCAATGPSIKIWDLEGK-IIVD---ELKQEVI------STSSKAE  240

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGI  187
               CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  241  PPQCTSLAWSADGQTLFAGYTDNLVRVWQV  270


 Score = 74.3 bits (181),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G
Sbjct  149  HTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGG  191



>ref|XP_005234127.1| PREDICTED: LOW QUALITY PROTEIN: guanine nucleotide-binding protein 
subunit beta-2-like 1 [Falco peregrinus]
Length=310

 Score =   102 bits (254),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 10/90 (11%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G II+ALCFSPNRYWLCAAT  SIKIWDLE K I+VD   +LKQE        +T++K +
Sbjct  226  GDIINALCFSPNRYWLCAATGPSIKIWDLEGK-IIVD---ELKQEVI------STSSKAE  275

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGI  187
               CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  276  PPQCTSLAWSADGQTLFAGYTDNLVRVWQV  305


 Score = 74.3 bits (181),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G
Sbjct  184  HTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGG  226



>gb|KFP61115.1| Guanine nucleotide-binding protein subunit beta-2-like 1, partial 
[Cariama cristata]
Length=300

 Score =   102 bits (254),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 10/90 (11%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G II+ALCFSPNRYWLCAAT  SIKIWDLE K I+VD   +LKQE        +T++K +
Sbjct  216  GDIINALCFSPNRYWLCAATGPSIKIWDLEGK-IIVD---ELKQEVI------STSSKAE  265

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGI  187
               CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  266  PPQCTSLAWSADGQTLFAGYTDNLVRVWQV  295


 Score = 73.9 bits (180),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G
Sbjct  174  HTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGG  216



>ref|XP_004073369.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Oryzias latipes]
Length=317

 Score =   101 bits (252),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 63/90 (70%), Gaps = 10/90 (11%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G +I+ALCFSPNRYWLCAAT  SIKIWDLE K IV +LR           E  +T +K +
Sbjct  233  GDVINALCFSPNRYWLCAATGPSIKIWDLEGKIIVDELR----------QEVISTNSKAE  282

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGI  187
               CTSL+W+ADG TLF+GYTD +IRVW +
Sbjct  283  PPQCTSLAWSADGQTLFAGYTDNLIRVWQV  312


 Score = 74.7 bits (182),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD+G
Sbjct  191  HTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDSG  233



>gb|AAP04406.1| G-protein beta subunit like-protein [Oryctolagus cuniculus]
Length=313

 Score =   102 bits (254),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 10/90 (11%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G II+ALCFSPNRYWLCAAT  SIKIWDLE K I+VD   +LKQE        +T++K +
Sbjct  229  GDIINALCFSPNRYWLCAATGPSIKIWDLEGK-IIVD---ELKQEVI------STSSKAE  278

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGI  187
               CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  279  PPQCTSLAWSADGQTLFAGYTDNLVRVWQV  308


 Score = 74.3 bits (181),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G
Sbjct  187  HTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGG  229



>ref|XP_004540947.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1-like [Maylandia zebra]
 ref|XP_005719882.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1-like [Pundamilia nyererei]
 ref|XP_005921230.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1-like [Haplochromis burtoni]
 ref|XP_006781554.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1-like [Neolamprologus brichardi]
 gb|AAQ91574.1| receptor for activated protein kinase C [Oreochromis mossambicus]
Length=317

 Score =   101 bits (252),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 63/90 (70%), Gaps = 10/90 (11%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G +I+ALCFSPNRYWLCAAT  SIKIWDLE K IV +LR           E  +T +K +
Sbjct  233  GDVINALCFSPNRYWLCAATGPSIKIWDLEGKIIVDELR----------QEVISTNSKAE  282

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGI  187
               CTSL+W+ADG TLF+GYTD +IRVW +
Sbjct  283  PPQCTSLAWSADGQTLFAGYTDNLIRVWQV  312


 Score = 74.7 bits (182),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD+G
Sbjct  191  HTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDSG  233



>ref|XP_002804718.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1-like [Macaca mulatta]
Length=279

 Score =   102 bits (254),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 10/90 (11%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G II+ALCFSPNRYWLCAAT  SIKIWDLE K I+VD   +LKQE        +T++K +
Sbjct  195  GDIINALCFSPNRYWLCAATGPSIKIWDLEGK-IIVD---ELKQEVI------STSSKAE  244

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGI  187
               CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  245  PPQCTSLAWSADGQTLFAGYTDNLVRVWQV  274


 Score = 74.3 bits (181),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G
Sbjct  153  HTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGG  195



>ref|XP_009701898.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1, partial [Cariama cristata]
Length=301

 Score =   102 bits (254),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 10/90 (11%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G II+ALCFSPNRYWLCAAT  SIKIWDLE K I+VD   +LKQE        +T++K +
Sbjct  217  GDIINALCFSPNRYWLCAATGPSIKIWDLEGK-IIVD---ELKQEVI------STSSKAE  266

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGI  187
               CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  267  PPQCTSLAWSADGQTLFAGYTDNLVRVWQV  296


 Score = 73.9 bits (180),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G
Sbjct  175  HTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGG  217



>gb|AAW82329.1| guanine nucleotide binding 12.3 [Gallus gallus]
Length=317

 Score =   102 bits (254),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 10/90 (11%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G II+ALCFSPNRYWLCAAT  SIKIWDLE K I+VD   +LKQE        +T++K +
Sbjct  233  GDIINALCFSPNRYWLCAATGPSIKIWDLEGK-IIVD---ELKQEVI------STSSKAE  282

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGI  187
               CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  283  PPQCTSLAWSADGQTLFAGYTDNLVRVWQV  312


 Score = 74.3 bits (181),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G
Sbjct  191  HTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGG  233



>ref|XP_005435183.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Falco cherrug]
Length=314

 Score =   102 bits (254),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 10/90 (11%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G II+ALCFSPNRYWLCAAT  SIKIWDLE K I+VD   +LKQE        +T++K +
Sbjct  230  GDIINALCFSPNRYWLCAATGPSIKIWDLEGK-IIVD---ELKQEVI------STSSKAE  279

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGI  187
               CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  280  PPQCTSLAWSADGQTLFAGYTDNLVRVWQV  309


 Score = 74.3 bits (181),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G
Sbjct  188  HTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGG  230



>ref|XP_009805348.1| PREDICTED: LOW QUALITY PROTEIN: guanine nucleotide-binding protein 
subunit beta-2-like 1, partial [Gavia stellata]
Length=283

 Score =   102 bits (254),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 10/90 (11%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G II+ALCFSPNRYWLCAAT  SIKIWDLE K I+VD   +LKQE        +T++K +
Sbjct  199  GDIINALCFSPNRYWLCAATGPSIKIWDLEGK-IIVD---ELKQEVI------STSSKAE  248

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGI  187
               CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  249  PPQCTSLAWSADGQTLFAGYTDNLVRVWQV  278


 Score = 74.3 bits (181),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G
Sbjct  157  HTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGG  199



>ref|XP_008063710.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1, partial [Tarsius syrichta]
Length=262

 Score =   102 bits (254),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 65/90 (72%), Gaps = 10/90 (11%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G II+ALCFSPNRYWLCAAT  SIKIWDLE K I+VD         E+  E  +T++K +
Sbjct  178  GDIINALCFSPNRYWLCAATGPSIKIWDLEGK-IIVD---------ELKQEVISTSSKAE  227

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGI  187
               CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  228  PPQCTSLAWSADGQTLFAGYTDNLVRVWQV  257


 Score = 73.9 bits (180),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G
Sbjct  136  HTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGG  178



>ref|XP_009931788.1| PREDICTED: LOW QUALITY PROTEIN: guanine nucleotide-binding protein 
subunit beta-2-like 1 [Opisthocomus hoazin]
Length=325

 Score =   102 bits (254),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 10/90 (11%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G II+ALCFSPNRYWLCAAT  SIKIWDLE K I+VD   +LKQE        +T++K +
Sbjct  241  GDIINALCFSPNRYWLCAATGPSIKIWDLEGK-IIVD---ELKQEVI------STSSKAE  290

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGI  187
               CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  291  PPQCTSLAWSADGQTLFAGYTDNLVRVWQV  320


 Score = 73.9 bits (180),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G
Sbjct  199  HTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGG  241



>ref|XP_007431363.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Python bivittatus]
Length=317

 Score =   102 bits (253),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 66/90 (73%), Gaps = 10/90 (11%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G II+ALCFSPNRYWLCAAT  SIKIWDLE K I+VD   +LKQE         T++K +
Sbjct  233  GDIINALCFSPNRYWLCAATGPSIKIWDLEGK-IIVD---ELKQEVI------TTSSKAE  282

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGI  187
               CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  283  PPQCTSLAWSADGQTLFAGYTDNLVRVWQV  312


 Score = 74.3 bits (181),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G
Sbjct  191  HTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGG  233



>gb|ELK03178.1| Guanine nucleotide-binding protein subunit beta-2-like 1 [Pteropus 
alecto]
Length=251

 Score =   102 bits (254),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 10/90 (11%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G II+ALCFSPNRYWLCAAT  SIKIWDLE K I+VD   +LKQE        +T++K +
Sbjct  167  GDIINALCFSPNRYWLCAATGPSIKIWDLEGK-IIVD---ELKQEVI------STSSKAE  216

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGI  187
               CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  217  PPQCTSLAWSADGQTLFAGYTDNLVRVWQV  246


 Score = 73.9 bits (180),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G
Sbjct  125  HTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGG  167



>ref|NP_001266445.1| guanine nucleotide-binding protein subunit beta-2-like 1 [Oreochromis 
niloticus]
 sp|O42249.1|GBLP_ORENI RecName: Full=Guanine nucleotide-binding protein subunit beta-2-like 
1; AltName: Full=Receptor of activated protein kinase 
C; Short=RACK [Oreochromis niloticus]
 gb|AAB81618.1| receptor for activated protein kinase C [Oreochromis niloticus]
Length=317

 Score =   101 bits (252),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 63/90 (70%), Gaps = 10/90 (11%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G +I+ALCFSPNRYWLCAAT  SIKIWDLE K IV +LR           E  +T +K +
Sbjct  233  GDVINALCFSPNRYWLCAATGPSIKIWDLEGKIIVDELR----------QEVISTNSKAE  282

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGI  187
               CTSL+W+ADG TLF+GYTD +IRVW +
Sbjct  283  PPQCTSLAWSADGQTLFAGYTDNLIRVWQV  312


 Score = 74.7 bits (182),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD+G
Sbjct  191  HTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDSG  233



>ref|XP_009462428.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Nipponia nippon]
Length=307

 Score =   102 bits (254),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 10/90 (11%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G II+ALCFSPNRYWLCAAT  SIKIWDLE K I+VD   +LKQE        +T++K +
Sbjct  223  GDIINALCFSPNRYWLCAATGPSIKIWDLEGK-IIVD---ELKQEVI------STSSKAE  272

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGI  187
               CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  273  PPQCTSLAWSADGQTLFAGYTDNLVRVWQV  302


 Score = 73.9 bits (180),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G
Sbjct  181  HTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGG  223



>ref|XP_005062497.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Ficedula albicollis]
Length=289

 Score =   102 bits (254),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 67/90 (74%), Gaps = 10/90 (11%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G +I+ALCFSPNRYWLCAAT  SIKIWDLE K I+VD   +LKQE        +T++K +
Sbjct  205  GDVINALCFSPNRYWLCAATGPSIKIWDLEGK-IIVD---ELKQEVI------STSSKAE  254

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGI  187
               CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  255  PPQCTSLAWSADGQTLFAGYTDNLVRVWQV  284


 Score = 73.9 bits (180),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 40/50 (80%), Gaps = 2/50 (4%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG--VNHSC  440
            HTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G  +N  C
Sbjct  163  HTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDVINALC  212



>ref|XP_002834824.3| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
1 [Pongo abelii]
Length=416

 Score =   102 bits (254),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 10/90 (11%)
 Frame = -1

Query  456  GSIIHALCFSPNRYWLCAATEASIKIWDLESKSIVVDLRVDLKQESEMSAEGNNTAAKNK  277
            G II+ALCFSPNRYWLCAAT  SIKIWDLE K I+VD   +LKQE        +T++K +
Sbjct  332  GDIINALCFSPNRYWLCAATGPSIKIWDLEGK-IIVD---ELKQEVI------STSSKAE  381

Query  276  IIFCTSLSWNADGSTLFSGYTDGVIRVWGI  187
               CTSL+W+ADG TLF+GYTD ++RVW +
Sbjct  382  PPQCTSLAWSADGQTLFAGYTDNLVRVWQV  411


 Score = 73.9 bits (180),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -3

Query  583  HTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAG  455
            HTGY+NTV VSPDGSLCASGGKDG  +LWDL EGK LY+LD G
Sbjct  290  HTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGG  332



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 737611932690