BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF001A21

Length=662
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009609631.1|  PREDICTED: uncharacterized protein LOC104103435    109   1e-25   
ref|XP_009775161.1|  PREDICTED: uncharacterized protein LOC104225093  89.0    8e-17   Nicotiana sylvestris
ref|XP_006339420.1|  PREDICTED: uncharacterized protein LOC102603324  84.0    4e-15   Solanum tuberosum [potatoes]
gb|KJB72271.1|  hypothetical protein B456_011G168000                  81.6    6e-15   Gossypium raimondii
ref|XP_010322788.1|  PREDICTED: uncharacterized protein LOC101262...  83.2    7e-15   Solanum lycopersicum
ref|XP_004229458.1|  PREDICTED: uncharacterized protein LOC101262...  83.2    7e-15   Solanum lycopersicum
gb|KJB72270.1|  hypothetical protein B456_011G168000                  81.6    1e-14   Gossypium raimondii
gb|KJB72266.1|  hypothetical protein B456_011G168000                  81.3    3e-14   Gossypium raimondii
gb|KHG30285.1|  putative yqkD                                         79.0    2e-13   Gossypium arboreum [tree cotton]
emb|CDO98976.1|  unnamed protein product                              76.6    1e-12   Coffea canephora [robusta coffee]
gb|KDO74882.1|  hypothetical protein CISIN_1g007812mg                 72.0    2e-11   Citrus sinensis [apfelsine]
ref|XP_004154381.1|  PREDICTED: uncharacterized protein LOC101218432  72.8    2e-11   
gb|KDO74881.1|  hypothetical protein CISIN_1g007812mg                 72.4    2e-11   Citrus sinensis [apfelsine]
ref|XP_004145038.1|  PREDICTED: uncharacterized protein LOC101215845  72.8    2e-11   
ref|XP_006489238.1|  PREDICTED: uncharacterized protein LOC102610023  72.0    4e-11   Citrus sinensis [apfelsine]
ref|XP_006419777.1|  hypothetical protein CICLE_v10004606mg           72.0    4e-11   Citrus clementina [clementine]
gb|KDO74878.1|  hypothetical protein CISIN_1g007812mg                 72.0    4e-11   Citrus sinensis [apfelsine]
gb|KDO74880.1|  hypothetical protein CISIN_1g007812mg                 72.0    4e-11   Citrus sinensis [apfelsine]
gb|KDO74879.1|  hypothetical protein CISIN_1g007812mg                 71.6    4e-11   Citrus sinensis [apfelsine]
ref|XP_010649852.1|  PREDICTED: uncharacterized protein LOC100257995  68.2    6e-10   Vitis vinifera
emb|CBI26166.3|  unnamed protein product                              68.2    7e-10   Vitis vinifera
ref|XP_008390806.1|  PREDICTED: uncharacterized protein LOC103453051  67.0    2e-09   
gb|KHN03032.1|  Hypothetical protein glysoja_009898                   65.1    6e-09   Glycine soja [wild soybean]
ref|XP_006584055.1|  PREDICTED: uncharacterized protein LOC100798...  65.1    6e-09   
ref|XP_009339931.1|  PREDICTED: uncharacterized protein LOC103932104  65.1    6e-09   Pyrus x bretschneideri [bai li]
ref|XP_003529600.1|  PREDICTED: uncharacterized protein LOC100798...  65.1    6e-09   
ref|XP_006584056.1|  PREDICTED: uncharacterized protein LOC100798...  65.1    7e-09   Glycine max [soybeans]
gb|AFK48377.1|  unknown                                               62.0    8e-09   Lotus japonicus
ref|XP_006600321.1|  PREDICTED: uncharacterized protein LOC100807...  64.7    9e-09   Glycine max [soybeans]
ref|XP_006600322.1|  PREDICTED: uncharacterized protein LOC100807...  64.7    9e-09   Glycine max [soybeans]
gb|KHN03427.1|  Hypothetical protein glysoja_004453                   64.7    1e-08   Glycine soja [wild soybean]
ref|XP_011014506.1|  PREDICTED: uncharacterized protein LOC105118291  64.7    1e-08   Populus euphratica
ref|XP_008340898.1|  PREDICTED: uncharacterized protein LOC103403829  64.3    1e-08   
ref|XP_004296971.1|  PREDICTED: uncharacterized protein LOC101299950  64.3    1e-08   Fragaria vesca subsp. vesca
gb|EYU45603.1|  hypothetical protein MIMGU_mgv1a0037051mg             64.3    1e-08   Erythranthe guttata [common monkey flower]
ref|XP_008458538.1|  PREDICTED: uncharacterized protein LOC103497...  64.3    1e-08   
ref|XP_008458537.1|  PREDICTED: uncharacterized protein LOC103497...  64.3    1e-08   Cucumis melo [Oriental melon]
ref|XP_008223032.1|  PREDICTED: uncharacterized protein LOC103322864  63.9    1e-08   Prunus mume [ume]
ref|XP_007222369.1|  hypothetical protein PRUPE_ppa003420mg           63.9    1e-08   
ref|XP_004508352.1|  PREDICTED: uncharacterized protein LOC101492...  63.9    2e-08   Cicer arietinum [garbanzo]
ref|XP_004508353.1|  PREDICTED: uncharacterized protein LOC101492...  63.5    2e-08   Cicer arietinum [garbanzo]
gb|KEH32227.1|  alpha/beta-hydrolase superfamily protein              63.5    2e-08   Medicago truncatula
ref|XP_007154170.1|  hypothetical protein PHAVU_003G096200g           63.2    3e-08   Phaseolus vulgaris [French bean]
ref|XP_007154171.1|  hypothetical protein PHAVU_003G096200g           63.2    3e-08   Phaseolus vulgaris [French bean]
ref|XP_009365782.1|  PREDICTED: uncharacterized protein LOC103955607  62.8    3e-08   Pyrus x bretschneideri [bai li]
ref|XP_007147794.1|  hypothetical protein PHAVU_006G155700g           62.0    6e-08   Phaseolus vulgaris [French bean]
ref|XP_007147795.1|  hypothetical protein PHAVU_006G155700g           62.0    6e-08   Phaseolus vulgaris [French bean]
ref|XP_011071522.1|  PREDICTED: uncharacterized protein LOC105156947  62.0    7e-08   
gb|KCW84318.1|  hypothetical protein EUGRSUZ_B01162                   61.6    7e-08   Eucalyptus grandis [rose gum]
ref|XP_010035879.1|  PREDICTED: uncharacterized protein LOC104425...  62.0    8e-08   Eucalyptus grandis [rose gum]
ref|XP_010035885.1|  PREDICTED: uncharacterized protein LOC104425...  61.6    8e-08   Eucalyptus grandis [rose gum]
ref|XP_007034567.1|  Alpha/beta-Hydrolases superfamily protein        61.6    9e-08   
gb|ABK94721.1|  unknown                                               55.8    3e-07   Populus trichocarpa [western balsam poplar]
ref|XP_010278885.1|  PREDICTED: uncharacterized protein LOC104612...  59.7    4e-07   Nelumbo nucifera [Indian lotus]
ref|XP_010278880.1|  PREDICTED: uncharacterized protein LOC104612...  59.3    4e-07   Nelumbo nucifera [Indian lotus]
gb|KDP40084.1|  hypothetical protein JCGZ_02082                       58.9    6e-07   Jatropha curcas
ref|XP_002315536.2|  hypothetical protein POPTR_0010s03020g           57.8    2e-06   
ref|XP_010440498.1|  PREDICTED: uncharacterized protein LOC104723789  55.1    2e-06   
ref|XP_006595393.1|  PREDICTED: uncharacterized protein LOC100815597  57.4    2e-06   
gb|KHN37552.1|  Hypothetical protein glysoja_007255                   57.4    2e-06   Glycine soja [wild soybean]
ref|XP_010105703.1|  hypothetical protein L484_011315                 57.4    2e-06   
ref|XP_006597567.1|  PREDICTED: uncharacterized protein LOC100781...  57.4    3e-06   Glycine max [soybeans]
ref|XP_006597568.1|  PREDICTED: uncharacterized protein LOC100781...  57.0    3e-06   Glycine max [soybeans]
ref|XP_011009031.1|  PREDICTED: uncharacterized protein LOC105114...  57.0    3e-06   Populus euphratica
ref|XP_011009029.1|  PREDICTED: uncharacterized protein LOC105114...  57.0    3e-06   Populus euphratica
ref|XP_011009032.1|  PREDICTED: uncharacterized protein LOC105114...  57.0    3e-06   Populus euphratica
ref|XP_006283452.1|  hypothetical protein CARUB_v10004497mg           56.6    4e-06   Capsella rubella
ref|XP_006283451.1|  hypothetical protein CARUB_v10004497mg           56.6    4e-06   Capsella rubella
ref|XP_010669834.1|  PREDICTED: uncharacterized protein LOC104886965  56.2    6e-06   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002311822.2|  hypothetical protein POPTR_0008s20480g           55.8    6e-06   
ref|XP_009139529.1|  PREDICTED: uncharacterized protein LOC103863...  55.8    7e-06   Brassica rapa
ref|XP_009139528.1|  PREDICTED: uncharacterized protein LOC103863...  55.8    7e-06   Brassica rapa
ref|XP_009139530.1|  PREDICTED: uncharacterized protein LOC103863...  55.8    7e-06   Brassica rapa
emb|CDY49406.1|  BnaCnng17160D                                        55.1    1e-05   Brassica napus [oilseed rape]
ref|XP_010532690.1|  PREDICTED: uncharacterized protein LOC104808...  55.1    1e-05   Tarenaya hassleriana [spider flower]
ref|XP_010532691.1|  PREDICTED: uncharacterized protein LOC104808...  55.1    1e-05   Tarenaya hassleriana [spider flower]
ref|XP_010440497.1|  PREDICTED: uncharacterized protein LOC104723788  55.1    1e-05   Camelina sativa [gold-of-pleasure]
ref|XP_010488423.1|  PREDICTED: uncharacterized protein LOC104766268  52.8    2e-05   
ref|XP_006414745.1|  hypothetical protein EUTSA_v10024836mg           54.7    2e-05   Eutrema salsugineum [saltwater cress]
ref|XP_010435157.1|  PREDICTED: uncharacterized protein LOC104719...  54.7    2e-05   Camelina sativa [gold-of-pleasure]
ref|XP_010435158.1|  PREDICTED: uncharacterized protein LOC104719...  54.7    2e-05   Camelina sativa [gold-of-pleasure]
ref|XP_010450069.1|  PREDICTED: uncharacterized protein LOC104732228  54.3    2e-05   Camelina sativa [gold-of-pleasure]
emb|CDY12752.1|  BnaC04g28890D                                        53.9    3e-05   Brassica napus [oilseed rape]
ref|XP_011090819.1|  PREDICTED: uncharacterized protein LOC105171...  53.9    3e-05   Sesamum indicum [beniseed]
ref|XP_011090820.1|  PREDICTED: uncharacterized protein LOC105171...  53.9    3e-05   Sesamum indicum [beniseed]
ref|XP_011090822.1|  PREDICTED: uncharacterized protein LOC105171...  53.9    3e-05   Sesamum indicum [beniseed]
ref|XP_011090821.1|  PREDICTED: uncharacterized protein LOC105171...  53.9    3e-05   
ref|XP_011090817.1|  PREDICTED: uncharacterized protein LOC105171...  53.9    3e-05   Sesamum indicum [beniseed]
ref|XP_011090818.1|  PREDICTED: uncharacterized protein LOC105171...  53.9    4e-05   Sesamum indicum [beniseed]
ref|XP_011090816.1|  PREDICTED: uncharacterized protein LOC105171...  53.9    4e-05   Sesamum indicum [beniseed]
ref|XP_003594093.1|  hypothetical protein MTR_2g021260                53.1    5e-05   
gb|AES64344.2|  alpha/beta hydrolase family protein                   52.8    7e-05   Medicago truncatula
ref|NP_193165.7|  alpha/beta-hydrolase family protein                 52.8    8e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002868296.1|  predicted protein                                52.4    1e-04   Arabidopsis lyrata subsp. lyrata
ref|XP_010488424.1|  PREDICTED: uncharacterized protein LOC104766...  52.4    1e-04   Camelina sativa [gold-of-pleasure]
ref|XP_006299834.1|  hypothetical protein CARUB_v10016036mg           52.0    1e-04   Capsella rubella
ref|XP_010512570.1|  PREDICTED: uncharacterized protein LOC104788495  51.2    3e-04   Camelina sativa [gold-of-pleasure]
ref|XP_010466700.1|  PREDICTED: uncharacterized protein LOC104746856  50.8    4e-04   Camelina sativa [gold-of-pleasure]
ref|XP_008797057.1|  PREDICTED: uncharacterized protein LOC103712341  50.4    6e-04   Phoenix dactylifera
ref|XP_002883434.1|  hypothetical protein ARALYDRAFT_898866           50.1    6e-04   Arabidopsis lyrata subsp. lyrata



>ref|XP_009609631.1| PREDICTED: uncharacterized protein LOC104103435 [Nicotiana tomentosiformis]
Length=194

 Score =   109 bits (273),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 81/118 (69%), Gaps = 4/118 (3%)
 Frame = -1

Query  644  PDPFPKNILDSSTSKQCVPMNKLPAAGL-ANGHTPAKEPE---TKPRAAGIANGHNPAKE  477
            P P   +  +S+++KQC P  ++ A+ + +NGH    + E   T   +A  AN    AKE
Sbjct  77   PQPLQDSKEESASTKQCTPSKEISASAIVSNGHDSDAKVEVQDTDKVSATPANSTLLAKE  136

Query  476  PESSKASPRRNTSVGNQSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFKNR  303
             +S+ AS  R+TS+ NQSSS+ D+VD TKATVTVVKNP+ NIMDGL+RRWDL+FFKNR
Sbjct  137  VKSNGASSHRDTSISNQSSSNVDVVDGTKATVTVVKNPTSNIMDGLLRRWDLNFFKNR  194



>ref|XP_009775161.1| PREDICTED: uncharacterized protein LOC104225093 [Nicotiana sylvestris]
Length=569

 Score = 89.0 bits (219),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 58/118 (49%), Positives = 77/118 (65%), Gaps = 4/118 (3%)
 Frame = -1

Query  644  PDPFPKNILDSSTSKQCVPMNKLPAAGLA-NGH---TPAKEPETKPRAAGIANGHNPAKE  477
            P P   +  +S+++KQC P  ++ A+ +  NGH      +  +T   +   AN    AKE
Sbjct  452  PQPLQDSKEESASTKQCTPSKEISASPIVSNGHDSDAKVQVQDTVKVSVTPANSTLSAKE  511

Query  476  PESSKASPRRNTSVGNQSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFKNR  303
             +S+  S  R+ SV +QSSSS DMVD TKATVTVVKNP+ NIMDGL+RRWDL+FFKNR
Sbjct  512  VKSNGTSSHRDMSVSSQSSSSVDMVDGTKATVTVVKNPTSNIMDGLLRRWDLNFFKNR  569



>ref|XP_006339420.1| PREDICTED: uncharacterized protein LOC102603324 [Solanum tuberosum]
Length=568

 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 58/118 (49%), Positives = 74/118 (63%), Gaps = 5/118 (4%)
 Frame = -1

Query  644  PDPFPKNILDSSTSKQCVPMNKLPAAGLA-NGH---TPAKEPETKPRAAGIANGHNPAKE  477
            P P      + ST+KQC P  ++ A+ +  N H      + P+TK  +   AN  +  KE
Sbjct  452  PQPLQDTREELSTAKQCTPSKEISASAVVFNEHDSDAKVQVPDTKKVSGTPANSTSSVKE  511

Query  476  PESSKASPRRNTSVGNQSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFKNR  303
             E + AS  R  SV NQSSSS D VD TKATVTVVKNP+ N+MDGL+RRWDL+FFKN+
Sbjct  512  VECNGAS-HREKSVSNQSSSSVDTVDGTKATVTVVKNPTSNVMDGLLRRWDLNFFKNK  568



>gb|KJB72271.1| hypothetical protein B456_011G168000 [Gossypium raimondii]
Length=335

 Score = 81.6 bits (200),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = -1

Query  533  PETKPRAAGIANGHNPAKEPESSKASPRRNTSVGNQSSSSTDMVDHTKATVTVVKNPSGN  354
            P+T   + G A   +P+ E   S +  + +TS   QSSS  DM   TKATVTVV+NPS N
Sbjct  258  PDTSVSSLGRAFDRSPSTEETVSTSCAQTDTSASTQSSSDADMSGSTKATVTVVRNPSNN  317

Query  353  IMDGLMRRWDLSFFKN  306
            IMDGLMRRWDL+FF+N
Sbjct  318  IMDGLMRRWDLNFFRN  333



>ref|XP_010322788.1| PREDICTED: uncharacterized protein LOC101262250 isoform X2 [Solanum 
lycopersicum]
Length=566

 Score = 83.2 bits (204),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 69/107 (64%), Gaps = 5/107 (5%)
 Frame = -1

Query  611  STSKQCVPMNKLPAAGLA----NGHTPAKEPETKPRAAGIANGHNPAKEPESSKASPRRN  444
            ST+KQC P  ++ A+ +     N     + P+TK  +   AN  + AKE E +  S  R 
Sbjct  461  STAKQCTPSKEISASAIVFNEQNSDAKVQVPDTKKVSVTPANSTSSAKEVECNGTS-HRE  519

Query  443  TSVGNQSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFKNR  303
             SV NQSSSS D VD TKATVTVVKNP+ N+MDGL RRWDL+FFKN+
Sbjct  520  KSVSNQSSSSVDTVDGTKATVTVVKNPTSNVMDGLWRRWDLNFFKNK  566



>ref|XP_004229458.1| PREDICTED: uncharacterized protein LOC101262250 isoform X1 [Solanum 
lycopersicum]
Length=568

 Score = 83.2 bits (204),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 69/107 (64%), Gaps = 5/107 (5%)
 Frame = -1

Query  611  STSKQCVPMNKLPAAGLA----NGHTPAKEPETKPRAAGIANGHNPAKEPESSKASPRRN  444
            ST+KQC P  ++ A+ +     N     + P+TK  +   AN  + AKE E +  S  R 
Sbjct  463  STAKQCTPSKEISASAIVFNEQNSDAKVQVPDTKKVSVTPANSTSSAKEVECNGTS-HRE  521

Query  443  TSVGNQSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFKNR  303
             SV NQSSSS D VD TKATVTVVKNP+ N+MDGL RRWDL+FFKN+
Sbjct  522  KSVSNQSSSSVDTVDGTKATVTVVKNPTSNVMDGLWRRWDLNFFKNK  568



>gb|KJB72270.1| hypothetical protein B456_011G168000 [Gossypium raimondii]
Length=387

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = -1

Query  533  PETKPRAAGIANGHNPAKEPESSKASPRRNTSVGNQSSSSTDMVDHTKATVTVVKNPSGN  354
            P+T   + G A   +P+ E   S +  + +TS   QSSS  DM   TKATVTVV+NPS N
Sbjct  310  PDTSVSSLGRAFDRSPSTEETVSTSCAQTDTSASTQSSSDADMSGSTKATVTVVRNPSNN  369

Query  353  IMDGLMRRWDLSFFKN  306
            IMDGLMRRWDL+FF+N
Sbjct  370  IMDGLMRRWDLNFFRN  385



>gb|KJB72266.1| hypothetical protein B456_011G168000 [Gossypium raimondii]
 gb|KJB72267.1| hypothetical protein B456_011G168000 [Gossypium raimondii]
 gb|KJB72269.1| hypothetical protein B456_011G168000 [Gossypium raimondii]
Length=584

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = -1

Query  533  PETKPRAAGIANGHNPAKEPESSKASPRRNTSVGNQSSSSTDMVDHTKATVTVVKNPSGN  354
            P+T   + G A   +P+ E   S +  + +TS   QSSS  DM   TKATVTVV+NPS N
Sbjct  507  PDTSVSSLGRAFDRSPSTEETVSTSCAQTDTSASTQSSSDADMSGSTKATVTVVRNPSNN  566

Query  353  IMDGLMRRWDLSFFKN  306
            IMDGLMRRWDL+FF+N
Sbjct  567  IMDGLMRRWDLNFFRN  582



>gb|KHG30285.1| putative yqkD [Gossypium arboreum]
Length=528

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 49/76 (64%), Gaps = 0/76 (0%)
 Frame = -1

Query  533  PETKPRAAGIANGHNPAKEPESSKASPRRNTSVGNQSSSSTDMVDHTKATVTVVKNPSGN  354
            P+T   + G A    P+ E   S +  R ++S   QSS   DM   TKATVTVV+NPS N
Sbjct  451  PDTSVSSLGRAFDRPPSTEETVSTSCARTDSSASTQSSYDADMSGSTKATVTVVRNPSNN  510

Query  353  IMDGLMRRWDLSFFKN  306
            IMDGLMRRWDL+FF+N
Sbjct  511  IMDGLMRRWDLNFFRN  526



>emb|CDO98976.1| unnamed protein product [Coffea canephora]
Length=572

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 70/120 (58%), Gaps = 7/120 (6%)
 Frame = -1

Query  644  PDPFPKNIL-DSSTSKQCVPMNKLPAAGLANG--HTPAKEPETKPRAAGIANGHNPAKEP  474
            P+P  KN L D ST+ +  P+ +  A  L     H   + P T  R             P
Sbjct  454  PEPSQKNDLQDPSTAAKSEPLTEESATTLEANPPHVAPQIPLTDARNESSGTPATTVLGP  513

Query  473  ESSKA---SPRRNTSVGNQSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFKNR  303
            +++++   SP  +  V NQSSS +D+V  TKATVTVVKNPS NIMDGL+RRWDL+FF+N+
Sbjct  514  QAAESNGPSPSSDARVSNQSSSDSDVVG-TKATVTVVKNPSSNIMDGLLRRWDLNFFRNK  572



>gb|KDO74882.1| hypothetical protein CISIN_1g007812mg [Citrus sinensis]
Length=399

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 54/80 (68%), Gaps = 3/80 (4%)
 Frame = -1

Query  533  PETKPRAAGIANGHNPAK-EPESSKASPRRNTSV--GNQSSSSTDMVDHTKATVTVVKNP  363
            P+T   + G A    P+  E  S+  S R +TS     QSS+  D+  +TKATVTVVKNP
Sbjct  320  PDTSVSSVGDAFDTPPSSVESASTGTSARTDTSATASTQSSADADVSSNTKATVTVVKNP  379

Query  362  SGNIMDGLMRRWDLSFFKNR  303
            +G++M+GLMRRWDL+FF+NR
Sbjct  380  AGHVMEGLMRRWDLNFFRNR  399



>ref|XP_004154381.1| PREDICTED: uncharacterized protein LOC101218432 [Cucumis sativus]
 ref|XP_004166999.1| PREDICTED: uncharacterized protein LOC101225095 [Cucumis sativus]
 gb|KGN46163.1| hypothetical protein Csa_6G061740 [Cucumis sativus]
Length=595

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = -1

Query  473  ESSKASPRRNTSVGNQSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFKN  306
            ES+ AS   NT   +QSS+  D+  +TKATVTVV+NP+G+IMDGL+RRWDL+FF+N
Sbjct  536  ESAGASSCTNTPANSQSSTEADLSANTKATVTVVRNPAGHIMDGLIRRWDLNFFRN  591



>gb|KDO74881.1| hypothetical protein CISIN_1g007812mg [Citrus sinensis]
Length=450

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 54/80 (68%), Gaps = 3/80 (4%)
 Frame = -1

Query  533  PETKPRAAGIANGHNPAK-EPESSKASPRRNTSV--GNQSSSSTDMVDHTKATVTVVKNP  363
            P+T   + G A    P+  E  S+  S R +TS     QSS+  D+  +TKATVTVVKNP
Sbjct  371  PDTSVSSVGDAFDTPPSSVESASTGTSARTDTSATASTQSSADADVSSNTKATVTVVKNP  430

Query  362  SGNIMDGLMRRWDLSFFKNR  303
            +G++M+GLMRRWDL+FF+NR
Sbjct  431  AGHVMEGLMRRWDLNFFRNR  450



>ref|XP_004145038.1| PREDICTED: uncharacterized protein LOC101215845 [Cucumis sativus]
Length=586

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = -1

Query  473  ESSKASPRRNTSVGNQSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFKN  306
            ES+ AS   NT   +QSS+  D+  +TKATVTVV+NP+G+IMDGL+RRWDL+FF+N
Sbjct  527  ESAGASSCTNTPANSQSSTEADLSANTKATVTVVRNPAGHIMDGLIRRWDLNFFRN  582



>ref|XP_006489238.1| PREDICTED: uncharacterized protein LOC102610023 [Citrus sinensis]
Length=588

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 54/80 (68%), Gaps = 3/80 (4%)
 Frame = -1

Query  533  PETKPRAAGIANGHNPAK-EPESSKASPRRNTSV--GNQSSSSTDMVDHTKATVTVVKNP  363
            P+T   + G A    P+  E  S+  S R +TS     QSS+  D+  +TKATVTVVKNP
Sbjct  509  PDTSVSSVGDAFDTPPSSVESASTGTSARTDTSATASTQSSADADVSSNTKATVTVVKNP  568

Query  362  SGNIMDGLMRRWDLSFFKNR  303
            +G++M+GLMRRWDL+FF+NR
Sbjct  569  AGHVMEGLMRRWDLNFFRNR  588



>ref|XP_006419777.1| hypothetical protein CICLE_v10004606mg [Citrus clementina]
 gb|ESR33017.1| hypothetical protein CICLE_v10004606mg [Citrus clementina]
Length=588

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 54/80 (68%), Gaps = 3/80 (4%)
 Frame = -1

Query  533  PETKPRAAGIANGHNPAK-EPESSKASPRRNTSV--GNQSSSSTDMVDHTKATVTVVKNP  363
            P+T   + G A    P+  E  S+  S R +TS     QSS+  D+  +TKATVTVVKNP
Sbjct  509  PDTSVSSVGDAFDTPPSSVESASTGTSARTDTSATASTQSSADADVSSNTKATVTVVKNP  568

Query  362  SGNIMDGLMRRWDLSFFKNR  303
            +G++M+GLMRRWDL+FF+NR
Sbjct  569  AGHVMEGLMRRWDLNFFRNR  588



>gb|KDO74878.1| hypothetical protein CISIN_1g007812mg [Citrus sinensis]
Length=588

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 54/80 (68%), Gaps = 3/80 (4%)
 Frame = -1

Query  533  PETKPRAAGIANGHNPAK-EPESSKASPRRNTSV--GNQSSSSTDMVDHTKATVTVVKNP  363
            P+T   + G A    P+  E  S+  S R +TS     QSS+  D+  +TKATVTVVKNP
Sbjct  509  PDTSVSSVGDAFDTPPSSVESASTGTSARTDTSATASTQSSADADVSSNTKATVTVVKNP  568

Query  362  SGNIMDGLMRRWDLSFFKNR  303
            +G++M+GLMRRWDL+FF+NR
Sbjct  569  AGHVMEGLMRRWDLNFFRNR  588



>gb|KDO74880.1| hypothetical protein CISIN_1g007812mg [Citrus sinensis]
Length=585

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 54/80 (68%), Gaps = 3/80 (4%)
 Frame = -1

Query  533  PETKPRAAGIANGHNPAK-EPESSKASPRRNTSV--GNQSSSSTDMVDHTKATVTVVKNP  363
            P+T   + G A    P+  E  S+  S R +TS     QSS+  D+  +TKATVTVVKNP
Sbjct  506  PDTSVSSVGDAFDTPPSSVESASTGTSARTDTSATASTQSSADADVSSNTKATVTVVKNP  565

Query  362  SGNIMDGLMRRWDLSFFKNR  303
            +G++M+GLMRRWDL+FF+NR
Sbjct  566  AGHVMEGLMRRWDLNFFRNR  585



>gb|KDO74879.1| hypothetical protein CISIN_1g007812mg [Citrus sinensis]
Length=585

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 54/80 (68%), Gaps = 3/80 (4%)
 Frame = -1

Query  533  PETKPRAAGIANGHNPAK-EPESSKASPRRNTSV--GNQSSSSTDMVDHTKATVTVVKNP  363
            P+T   + G A    P+  E  S+  S R +TS     QSS+  D+  +TKATVTVVKNP
Sbjct  506  PDTSVSSVGDAFDTPPSSVESASTGTSARTDTSATASTQSSADADVSSNTKATVTVVKNP  565

Query  362  SGNIMDGLMRRWDLSFFKNR  303
            +G++M+GLMRRWDL+FF+NR
Sbjct  566  AGHVMEGLMRRWDLNFFRNR  585



>ref|XP_010649852.1| PREDICTED: uncharacterized protein LOC100257995 [Vitis vinifera]
Length=599

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 59/106 (56%), Gaps = 4/106 (4%)
 Frame = -1

Query  611  STSKQCVPMNKLPAAGLANGHTPAKEPETKPRAAGIANGHNPAKE---PESSKA-SPRRN  444
            ST++QC      P +   + +    +P      + +    +  K     ES++  S + +
Sbjct  492  STTEQCGSSKSQPTSATTDHNLAVDQPSPDTSVSSVEPAFDTPKSFIGSESTRTTSAQSD  551

Query  443  TSVGNQSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFKN  306
             S   QSSS  D+  +TKATVTVVKNP+ +IMDGLMRRWD +FF+N
Sbjct  552  DSTSIQSSSDADVAGNTKATVTVVKNPASHIMDGLMRRWDFNFFRN  597



>emb|CBI26166.3| unnamed protein product [Vitis vinifera]
Length=601

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 59/106 (56%), Gaps = 4/106 (4%)
 Frame = -1

Query  611  STSKQCVPMNKLPAAGLANGHTPAKEPETKPRAAGIANGHNPAKE---PESSKA-SPRRN  444
            ST++QC      P +   + +    +P      + +    +  K     ES++  S + +
Sbjct  494  STTEQCGSSKSQPTSATTDHNLAVDQPSPDTSVSSVEPAFDTPKSFIGSESTRTTSAQSD  553

Query  443  TSVGNQSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFKN  306
             S   QSSS  D+  +TKATVTVVKNP+ +IMDGLMRRWD +FF+N
Sbjct  554  DSTSIQSSSDADVAGNTKATVTVVKNPASHIMDGLMRRWDFNFFRN  599



>ref|XP_008390806.1| PREDICTED: uncharacterized protein LOC103453051 [Malus domestica]
Length=588

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 51/85 (60%), Gaps = 11/85 (13%)
 Frame = -1

Query  551  HTPAKEPETKPRA---AGIANGHNPAKEPESSKASPRRNTSVGNQSSSSTDMVDHTKATV  381
             TP + P T+P +     I +G        S+ AS + +TS   Q +S  D+   T ATV
Sbjct  508  QTPTRVPTTEPASQTPLSIMDG--------SAGASSQSDTSESIQRTSDXDLSAKTTATV  559

Query  380  TVVKNPSGNIMDGLMRRWDLSFFKN  306
            TVVKNP+ N+MDGL+RRWD +FF+N
Sbjct  560  TVVKNPASNVMDGLIRRWDFNFFRN  584



>gb|KHN03032.1| Hypothetical protein glysoja_009898 [Glycine soja]
Length=584

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = -1

Query  479  EPESSKASPRRNTSVGNQSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFKNR  303
            E  ++  S R ++S   QSSS TD+  +TKATVTVV+NP+G++MDGLMRRWD +FFKN+
Sbjct  526  ESSNTSGSARSDSSASLQSSSETDVSHNTKATVTVVRNPAGHVMDGLMRRWDFNFFKNK  584



>ref|XP_006584055.1| PREDICTED: uncharacterized protein LOC100798920 isoform X2 [Glycine 
max]
Length=609

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = -1

Query  479  EPESSKASPRRNTSVGNQSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFKNR  303
            E  ++  S R ++S   QSSS TD+  +TKATVTVV+NP+G++MDGLMRRWD +FFKN+
Sbjct  551  ESSNTSGSARSDSSASLQSSSETDVSHNTKATVTVVRNPAGHVMDGLMRRWDFNFFKNK  609



>ref|XP_009339931.1| PREDICTED: uncharacterized protein LOC103932104 [Pyrus x bretschneideri]
Length=589

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 48/81 (59%), Gaps = 8/81 (10%)
 Frame = -1

Query  548  TPAKEPETKPRAAGIANGHNPAKEPESSKASPRRNTSVGNQSSSSTDMVDHTKATVTVVK  369
             P+ EP  +   + + NG        S+  S R + S   QSSS  D+   T ATVTVVK
Sbjct  513  VPSTEPALQTPLSIMENG--------SAGPSSRSDASESIQSSSDGDLSAKTTATVTVVK  564

Query  368  NPSGNIMDGLMRRWDLSFFKN  306
            NP+ N+MDGL+RRWD +FF+N
Sbjct  565  NPASNVMDGLIRRWDFNFFRN  585



>ref|XP_003529600.1| PREDICTED: uncharacterized protein LOC100798920 isoform X1 [Glycine 
max]
Length=607

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = -1

Query  479  EPESSKASPRRNTSVGNQSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFKNR  303
            E  ++  S R ++S   QSSS TD+  +TKATVTVV+NP+G++MDGLMRRWD +FFKN+
Sbjct  549  ESSNTSGSARSDSSASLQSSSETDVSHNTKATVTVVRNPAGHVMDGLMRRWDFNFFKNK  607



>ref|XP_006584056.1| PREDICTED: uncharacterized protein LOC100798920 isoform X3 [Glycine 
max]
Length=608

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = -1

Query  479  EPESSKASPRRNTSVGNQSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFKNR  303
            E  ++  S R ++S   QSSS TD+  +TKATVTVV+NP+G++MDGLMRRWD +FFKN+
Sbjct  550  ESSNTSGSARSDSSASLQSSSETDVSHNTKATVTVVRNPAGHVMDGLMRRWDFNFFKNK  608



>gb|AFK48377.1| unknown [Lotus japonicus]
Length=170

 Score = 62.0 bits (149),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -1

Query  395  TKATVTVVKNPSGNIMDGLMRRWDLSFFKN  306
            TKATVTVVKNP+ N+MDGLMRRWD +FF+N
Sbjct  137  TKATVTVVKNPASNVMDGLMRRWDFNFFRN  166



>ref|XP_006600321.1| PREDICTED: uncharacterized protein LOC100807823 isoform X1 [Glycine 
max]
Length=608

 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -1

Query  413  TDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFKNR  303
            TD+  +TKATVTVV+NP+G++MDGLMRRWD +FFKN+
Sbjct  572  TDVSHNTKATVTVVRNPAGHVMDGLMRRWDFNFFKNK  608



>ref|XP_006600322.1| PREDICTED: uncharacterized protein LOC100807823 isoform X2 [Glycine 
max]
Length=606

 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -1

Query  413  TDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFKNR  303
            TD+  +TKATVTVV+NP+G++MDGLMRRWD +FFKN+
Sbjct  570  TDVSHNTKATVTVVRNPAGHVMDGLMRRWDFNFFKNK  606



>gb|KHN03427.1| Hypothetical protein glysoja_004453 [Glycine soja]
Length=612

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -1

Query  413  TDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFKNR  303
            TD+  +TKATVTVV+NP+G++MDGLMRRWD +FFKN+
Sbjct  576  TDVSHNTKATVTVVRNPAGHVMDGLMRRWDFNFFKNK  612



>ref|XP_011014506.1| PREDICTED: uncharacterized protein LOC105118291 [Populus euphratica]
Length=583

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = -1

Query  473  ESSKASPRRNTSVGNQSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFKN  306
            ES+  S R +TS    SS+ +D+  +TKAT+TV +NP+G+IMDGL+RRWD + F+N
Sbjct  526  ESTATSSRSDTSGSVHSSTDSDLSGNTKATLTVERNPAGHIMDGLLRRWDFNLFRN  581



>ref|XP_008340898.1| PREDICTED: uncharacterized protein LOC103403829 [Malus domestica]
Length=589

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 49/81 (60%), Gaps = 8/81 (10%)
 Frame = -1

Query  548  TPAKEPETKPRAAGIANGHNPAKEPESSKASPRRNTSVGNQSSSSTDMVDHTKATVTVVK  369
             P+ EP  +   + + NG        S+  S + +TS   QS+S  D+   T ATVTVVK
Sbjct  513  VPSTEPALQTPLSIMENG--------SAGPSSQSDTSESIQSTSDGDLSAKTTATVTVVK  564

Query  368  NPSGNIMDGLMRRWDLSFFKN  306
            NP+ N+MDGL+RRWD +FF+N
Sbjct  565  NPASNVMDGLIRRWDFNFFRN  585



>ref|XP_004296971.1| PREDICTED: uncharacterized protein LOC101299950 [Fragaria vesca 
subsp. vesca]
 ref|XP_011462782.1| PREDICTED: uncharacterized protein LOC101299950 [Fragaria vesca 
subsp. vesca]
 ref|XP_011462783.1| PREDICTED: uncharacterized protein LOC101299950 [Fragaria vesca 
subsp. vesca]
Length=591

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -1

Query  428  QSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFKN  306
            QS+  TDM  +T ATVTVVKNPS ++MDGLMRRWD +FF+N
Sbjct  547  QSTLDTDMSANTTATVTVVKNPSSHVMDGLMRRWDFNFFRN  587



>gb|EYU45603.1| hypothetical protein MIMGU_mgv1a0037051mg, partial [Erythranthe 
guttata]
Length=529

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 40/62 (65%), Gaps = 2/62 (3%)
 Frame = -1

Query  482  KEPESSK--ASPRRNTSVGNQSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFK  309
            KE E ++   S   +  + N  SS  DM D TK T+ V K P+ NIMDGL+RRWDL+FF+
Sbjct  468  KEEEKAREVTSSYSDAPLANGGSSEADMADRTKVTLEVEKTPTNNIMDGLLRRWDLNFFR  527

Query  308  NR  303
            NR
Sbjct  528  NR  529



>ref|XP_008458538.1| PREDICTED: uncharacterized protein LOC103497914 isoform X2 [Cucumis 
melo]
Length=595

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = -1

Query  473  ESSKASPRRNTSVGNQSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFKN  306
            ES+ A    +T   +Q+S+  D+  +TKATVTVV+NP+ +IMDGL+RRWDL+FF+N
Sbjct  536  ESAGAPSCTSTPANSQNSAEADLSANTKATVTVVRNPASHIMDGLIRRWDLNFFRN  591



>ref|XP_008458537.1| PREDICTED: uncharacterized protein LOC103497914 isoform X1 [Cucumis 
melo]
Length=597

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = -1

Query  473  ESSKASPRRNTSVGNQSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFKN  306
            ES+ A    +T   +Q+S+  D+  +TKATVTVV+NP+ +IMDGL+RRWDL+FF+N
Sbjct  538  ESAGAPSCTSTPANSQNSAEADLSANTKATVTVVRNPASHIMDGLIRRWDLNFFRN  593



>ref|XP_008223032.1| PREDICTED: uncharacterized protein LOC103322864 [Prunus mume]
Length=582

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  428  QSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFKN  306
            QS+S +DM  +T ATVTVVKNP+ N+MDGL+RRWD +FF+N
Sbjct  538  QSTSDSDMSANTTATVTVVKNPASNVMDGLIRRWDFNFFRN  578



>ref|XP_007222369.1| hypothetical protein PRUPE_ppa003420mg [Prunus persica]
 gb|EMJ23568.1| hypothetical protein PRUPE_ppa003420mg [Prunus persica]
Length=576

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  428  QSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFKN  306
            QS+S +DM  +T ATVTVVKNP+ N+MDGL+RRWD +FF+N
Sbjct  532  QSTSDSDMSANTTATVTVVKNPASNVMDGLIRRWDFNFFRN  572



>ref|XP_004508352.1| PREDICTED: uncharacterized protein LOC101492469 isoform X1 [Cicer 
arietinum]
Length=603

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = -1

Query  479  EPESSKASPRRNTSVGNQSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFKN  306
            E  ++  S R ++S   QSSS+TD+  +T+ATVTVV+NP+G++MDGLMRRWD +FFKN
Sbjct  542  ESSNTSGSARSDSSASLQSSSNTDISHNTRATVTVVRNPAGHVMDGLMRRWDFNFFKN  599



>ref|XP_004508353.1| PREDICTED: uncharacterized protein LOC101492469 isoform X2 [Cicer 
arietinum]
Length=601

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = -1

Query  479  EPESSKASPRRNTSVGNQSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFKN  306
            E  ++  S R ++S   QSSS+TD+  +T+ATVTVV+NP+G++MDGLMRRWD +FFKN
Sbjct  540  ESSNTSGSARSDSSASLQSSSNTDISHNTRATVTVVRNPAGHVMDGLMRRWDFNFFKN  597



>gb|KEH32227.1| alpha/beta-hydrolase superfamily protein [Medicago truncatula]
Length=594

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = -1

Query  479  EPESSKASPRRNTSVGNQSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFKN  306
            E  ++  S R ++S   QSSS TD+  +T ATVTVV+NP+G+IMDGLMRRWD +FFKN
Sbjct  533  ESSNTSGSARSDSSASLQSSSDTDISHNTTATVTVVRNPAGHIMDGLMRRWDFNFFKN  590



>ref|XP_007154170.1| hypothetical protein PHAVU_003G096200g [Phaseolus vulgaris]
 gb|ESW26164.1| hypothetical protein PHAVU_003G096200g [Phaseolus vulgaris]
Length=610

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -1

Query  413  TDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFKNR  303
            TD+  +TKATVTVV+NP+G+ MDGLMRRWD +FFKN+
Sbjct  574  TDISHNTKATVTVVRNPAGHAMDGLMRRWDFNFFKNK  610



>ref|XP_007154171.1| hypothetical protein PHAVU_003G096200g [Phaseolus vulgaris]
 gb|ESW26165.1| hypothetical protein PHAVU_003G096200g [Phaseolus vulgaris]
Length=611

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -1

Query  413  TDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFKNR  303
            TD+  +TKATVTVV+NP+G+ MDGLMRRWD +FFKN+
Sbjct  575  TDISHNTKATVTVVRNPAGHAMDGLMRRWDFNFFKNK  611



>ref|XP_009365782.1| PREDICTED: uncharacterized protein LOC103955607 [Pyrus x bretschneideri]
Length=588

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 50/85 (59%), Gaps = 11/85 (13%)
 Frame = -1

Query  551  HTPAKEPETKPRA---AGIANGHNPAKEPESSKASPRRNTSVGNQSSSSTDMVDHTKATV  381
             TP + P  +P +     I +G        S+  S + +TS   Q +S +D+   T ATV
Sbjct  508  QTPTRVPTAEPASQTPLSIMDG--------SAGPSSQSDTSESIQRTSDSDLSAKTTATV  559

Query  380  TVVKNPSGNIMDGLMRRWDLSFFKN  306
            TVVKNP+ N+MDGL+RRWD +FF+N
Sbjct  560  TVVKNPASNVMDGLIRRWDFNFFRN  584



>ref|XP_007147794.1| hypothetical protein PHAVU_006G155700g [Phaseolus vulgaris]
 gb|ESW19788.1| hypothetical protein PHAVU_006G155700g [Phaseolus vulgaris]
Length=591

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -1

Query  413  TDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFKNR  303
            TD+  +TKATVTV+KNP+G++++GLMRRWD +FF+NR
Sbjct  552  TDISHNTKATVTVIKNPTGHVLNGLMRRWDFNFFRNR  588



>ref|XP_007147795.1| hypothetical protein PHAVU_006G155700g [Phaseolus vulgaris]
 gb|ESW19789.1| hypothetical protein PHAVU_006G155700g [Phaseolus vulgaris]
Length=590

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -1

Query  413  TDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFKNR  303
            TD+  +TKATVTV+KNP+G++++GLMRRWD +FF+NR
Sbjct  551  TDISHNTKATVTVIKNPTGHVLNGLMRRWDFNFFRNR  587



>ref|XP_011071522.1| PREDICTED: uncharacterized protein LOC105156947 [Sesamum indicum]
Length=605

 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 50/79 (63%), Gaps = 11/79 (14%)
 Frame = -1

Query  506  IANGHNPAKEPESSKASPRRNTSV-----------GNQSSSSTDMVDHTKATVTVVKNPS  360
            +++  N +KEP +   +P  N +V           G+QSSS  DM D TK TV VVK P+
Sbjct  527  VSDADNHSKEPSTVVKNPTSNDAVSDGMSHNGTPSGDQSSSEVDMADRTKVTVKVVKTPT  586

Query  359  GNIMDGLMRRWDLSFFKNR  303
             NIMDGL+RRWDL+FF+NR
Sbjct  587  NNIMDGLLRRWDLNFFRNR  605



>gb|KCW84318.1| hypothetical protein EUGRSUZ_B01162 [Eucalyptus grandis]
Length=394

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 42/68 (62%), Gaps = 6/68 (9%)
 Frame = -1

Query  491  NPAKEPESSKASPRRNTSVGN------QSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRR  330
            +P +  + ++    + +SVG       QS   TDM  +T+AT+TVV+NPS NIMDG MRR
Sbjct  325  SPLENAQRAEVGVEKASSVGTEGPTSIQSPLDTDMSGNTRATLTVVRNPSNNIMDGFMRR  384

Query  329  WDLSFFKN  306
            WD   F+N
Sbjct  385  WDFGLFRN  392



>ref|XP_010035879.1| PREDICTED: uncharacterized protein LOC104425011 isoform X1 [Eucalyptus 
grandis]
 gb|KCW84317.1| hypothetical protein EUGRSUZ_B01162 [Eucalyptus grandis]
Length=590

 Score = 62.0 bits (149),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 42/68 (62%), Gaps = 6/68 (9%)
 Frame = -1

Query  491  NPAKEPESSKASPRRNTSVGN------QSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRR  330
            +P +  + ++    + +SVG       QS   TDM  +T+AT+TVV+NPS NIMDG MRR
Sbjct  521  SPLENAQRAEVGVEKASSVGTEGPTSIQSPLDTDMSGNTRATLTVVRNPSNNIMDGFMRR  580

Query  329  WDLSFFKN  306
            WD   F+N
Sbjct  581  WDFGLFRN  588



>ref|XP_010035885.1| PREDICTED: uncharacterized protein LOC104425011 isoform X2 [Eucalyptus 
grandis]
Length=588

 Score = 61.6 bits (148),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 42/68 (62%), Gaps = 6/68 (9%)
 Frame = -1

Query  491  NPAKEPESSKASPRRNTSVGN------QSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRR  330
            +P +  + ++    + +SVG       QS   TDM  +T+AT+TVV+NPS NIMDG MRR
Sbjct  519  SPLENAQRAEVGVEKASSVGTEGPTSIQSPLDTDMSGNTRATLTVVRNPSNNIMDGFMRR  578

Query  329  WDLSFFKN  306
            WD   F+N
Sbjct  579  WDFGLFRN  586



>ref|XP_007034567.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY05493.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=587

 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -1

Query  395  TKATVTVVKNPSGNIMDGLMRRWDLSFFKN  306
            TKATVTV++NPS NIMDGLMRRWDL+FF+N
Sbjct  556  TKATVTVIRNPSTNIMDGLMRRWDLNFFRN  585



>gb|ABK94721.1| unknown [Populus trichocarpa]
Length=59

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 39/58 (67%), Gaps = 2/58 (3%)
 Frame = -1

Query  479  EPESSKASPRRNTSVGNQSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFKN  306
            E ES  AS   +TS     S  TD+  +TKAT+TV +NP+ +IMDGL+RRWDL  F+N
Sbjct  2    ESESITASSSNDTSGSIHGSIDTDLSGNTKATLTVERNPANHIMDGLLRRWDL--FRN  57



>ref|XP_010278885.1| PREDICTED: uncharacterized protein LOC104612914 isoform X2 [Nelumbo 
nucifera]
Length=510

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 60/120 (50%), Gaps = 15/120 (13%)
 Frame = -1

Query  626  NILDSSTSKQCVPMNKLPAAGLANGHTPAKEPETKPRAAGIANGHNPAKEP------ESS  465
            NI  SSTSK C P+ K+  +  +   +   + E     A +++     K P      ES 
Sbjct  390  NIEASSTSKNCRPL-KMDESSTSATDSHGSDYERHGPDASVSSSGTKYKTPPSSINIESI  448

Query  464  KASPRRNTSVGNQSSS--------STDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFK  309
              S  R TS   Q  S        + DM D T+AT+TV KNP+ +IMDGLM RW L+FFK
Sbjct  449  GTSACRETSASVQCPSEGDRSQQDAADMSDGTRATLTVQKNPNNHIMDGLMHRWGLNFFK  508



>ref|XP_010278880.1| PREDICTED: uncharacterized protein LOC104612914 isoform X1 [Nelumbo 
nucifera]
Length=584

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 60/120 (50%), Gaps = 15/120 (13%)
 Frame = -1

Query  626  NILDSSTSKQCVPMNKLPAAGLANGHTPAKEPETKPRAAGIANGHNPAKEP------ESS  465
            NI  SSTSK C P+ K+  +  +   +   + E     A +++     K P      ES 
Sbjct  464  NIEASSTSKNCRPL-KMDESSTSATDSHGSDYERHGPDASVSSSGTKYKTPPSSINIESI  522

Query  464  KASPRRNTSVGNQSSS--------STDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFK  309
              S  R TS   Q  S        + DM D T+AT+TV KNP+ +IMDGLM RW L+FFK
Sbjct  523  GTSACRETSASVQCPSEGDRSQQDAADMSDGTRATLTVQKNPNNHIMDGLMHRWGLNFFK  582



>gb|KDP40084.1| hypothetical protein JCGZ_02082 [Jatropha curcas]
Length=575

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -1

Query  428  QSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFKN  306
            Q+S+ TD+  +TKAT+TV +NP+ +IMDGLMRRWD + F+N
Sbjct  533  QTSTDTDLSSNTKATLTVERNPANHIMDGLMRRWDFNLFRN  573



>ref|XP_002315536.2| hypothetical protein POPTR_0010s03020g [Populus trichocarpa]
 gb|EEF01707.2| hypothetical protein POPTR_0010s03020g [Populus trichocarpa]
Length=563

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -1

Query  428  QSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFKN  306
             SS+ +D+  +TKAT+TV +NP+G+IMDGL+RRWD + F+N
Sbjct  521  HSSTDSDLSGNTKATLTVERNPAGHIMDGLLRRWDFNLFRN  561



>ref|XP_010440498.1| PREDICTED: uncharacterized protein LOC104723789 [Camelina sativa]
Length=140

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 42/71 (59%), Gaps = 13/71 (18%)
 Frame = -1

Query  509  GIANGHNPAKEPESSKASPRRNTSVGNQSSSSTDMVDHTKATVTVV--KNPSGNIMDGLM  336
            G  NG  P   P+ S+            ++ + D+   TKATVTVV   + SGN++DGL+
Sbjct  81   GPVNGFVPGASPKMSQ-----------NTNDAIDLSSRTKATVTVVGRSSTSGNVLDGLL  129

Query  335  RRWDLSFFKNR  303
            RRWDL+FFK+R
Sbjct  130  RRWDLNFFKSR  140



>ref|XP_006595393.1| PREDICTED: uncharacterized protein LOC100815597 [Glycine max]
Length=592

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -1

Query  413  TDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFKN  306
            TD+  +TKAT+TV+KNP+G++++GL+RRWD  FF+N
Sbjct  553  TDISHNTKATLTVIKNPTGHVLNGLLRRWDFKFFRN  588



>gb|KHN37552.1| Hypothetical protein glysoja_007255 [Glycine soja]
Length=597

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -1

Query  413  TDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFKN  306
            TD+  +TKAT+TV+KNP+G++++GL+RRWD  FF+N
Sbjct  558  TDISHNTKATLTVIKNPTGHVLNGLLRRWDFKFFRN  593



>ref|XP_010105703.1| hypothetical protein L484_011315 [Morus notabilis]
 gb|EXC05734.1| hypothetical protein L484_011315 [Morus notabilis]
Length=569

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  410  DMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFKN  306
            D+  +TKAT+TV +NP+ NIMDGL+RRWD SFF+N
Sbjct  531  DLSANTKATLTVERNPTSNIMDGLIRRWDFSFFRN  565



>ref|XP_006597567.1| PREDICTED: uncharacterized protein LOC100781610 isoform X1 [Glycine 
max]
Length=582

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -1

Query  446  NTSVGNQSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFKN  306
            + S   QSSS TD+  +TKAT+TV+KNP+G++++ L+ RWD +FF+N
Sbjct  532  DNSASLQSSSDTDISHNTKATLTVIKNPAGHVLNCLLGRWDFNFFRN  578



>ref|XP_006597568.1| PREDICTED: uncharacterized protein LOC100781610 isoform X2 [Glycine 
max]
Length=580

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -1

Query  446  NTSVGNQSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFKN  306
            + S   QSSS TD+  +TKAT+TV+KNP+G++++ L+ RWD +FF+N
Sbjct  530  DNSASLQSSSDTDISHNTKATLTVIKNPAGHVLNCLLGRWDFNFFRN  576



>ref|XP_011009031.1| PREDICTED: uncharacterized protein LOC105114237 isoform X2 [Populus 
euphratica]
Length=534

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -1

Query  479  EPESSKASPRRNTSVGNQSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFKN  306
            E +S  AS   + S   + S+ TD+  +TKAT+TV +NP+ +IMDGL+RRWD + F+N
Sbjct  475  ESKSITASSSNDASGSIRGSTDTDLSGNTKATLTVERNPANHIMDGLLRRWDFNLFRN  532



>ref|XP_011009029.1| PREDICTED: uncharacterized protein LOC105114237 isoform X1 [Populus 
euphratica]
 ref|XP_011009030.1| PREDICTED: uncharacterized protein LOC105114237 isoform X1 [Populus 
euphratica]
Length=588

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -1

Query  479  EPESSKASPRRNTSVGNQSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFKN  306
            E +S  AS   + S   + S+ TD+  +TKAT+TV +NP+ +IMDGL+RRWD + F+N
Sbjct  529  ESKSITASSSNDASGSIRGSTDTDLSGNTKATLTVERNPANHIMDGLLRRWDFNLFRN  586



>ref|XP_011009032.1| PREDICTED: uncharacterized protein LOC105114237 isoform X3 [Populus 
euphratica]
Length=573

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -1

Query  479  EPESSKASPRRNTSVGNQSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFKN  306
            E +S  AS   + S   + S+ TD+  +TKAT+TV +NP+ +IMDGL+RRWD + F+N
Sbjct  514  ESKSITASSSNDASGSIRGSTDTDLSGNTKATLTVERNPANHIMDGLLRRWDFNLFRN  571



>ref|XP_006283452.1| hypothetical protein CARUB_v10004497mg [Capsella rubella]
 gb|EOA16350.1| hypothetical protein CARUB_v10004497mg [Capsella rubella]
Length=558

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 42/71 (59%), Gaps = 13/71 (18%)
 Frame = -1

Query  509  GIANGHNPAKEPESSKASPRRNTSVGNQSSSSTDMVDHTKATVTVV--KNPSGNIMDGLM  336
            G  NG  P   P+ S             ++ + D+  HTKATVTVV   + SGN++DGL+
Sbjct  499  GPINGFVPGASPQMSL-----------DTNEAIDLSAHTKATVTVVGRSSTSGNVLDGLL  547

Query  335  RRWDLSFFKNR  303
            RRWDL+FFK+R
Sbjct  548  RRWDLNFFKSR  558



>ref|XP_006283451.1| hypothetical protein CARUB_v10004497mg [Capsella rubella]
 gb|EOA16349.1| hypothetical protein CARUB_v10004497mg [Capsella rubella]
Length=556

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 42/71 (59%), Gaps = 13/71 (18%)
 Frame = -1

Query  509  GIANGHNPAKEPESSKASPRRNTSVGNQSSSSTDMVDHTKATVTVV--KNPSGNIMDGLM  336
            G  NG  P   P+ S             ++ + D+  HTKATVTVV   + SGN++DGL+
Sbjct  497  GPINGFVPGASPQMSL-----------DTNEAIDLSAHTKATVTVVGRSSTSGNVLDGLL  545

Query  335  RRWDLSFFKNR  303
            RRWDL+FFK+R
Sbjct  546  RRWDLNFFKSR  556



>ref|XP_010669834.1| PREDICTED: uncharacterized protein LOC104886965 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010669835.1| PREDICTED: uncharacterized protein LOC104886965 [Beta vulgaris 
subsp. vulgaris]
Length=556

 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -1

Query  422  SSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFKN  306
            SS T+  D TKAT+TVVKN SG+IMDG  RRWD  FFK+
Sbjct  516  SSGTESSDGTKATLTVVKNSSGHIMDGFFRRWDRGFFKS  554



>ref|XP_002311822.2| hypothetical protein POPTR_0008s20480g [Populus trichocarpa]
 gb|EEE89189.2| hypothetical protein POPTR_0008s20480g [Populus trichocarpa]
Length=591

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 39/58 (67%), Gaps = 2/58 (3%)
 Frame = -1

Query  479  EPESSKASPRRNTSVGNQSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFKN  306
            E ES  AS   +TS     S  TD+  +TKAT+TV +NP+ +IMDGL+RRWDL  F+N
Sbjct  534  ESESITASSSNDTSGSIHGSIDTDLSGNTKATLTVERNPANHIMDGLLRRWDL--FRN  589



>ref|XP_009139529.1| PREDICTED: uncharacterized protein LOC103863543 isoform X2 [Brassica 
rapa]
Length=548

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 53/87 (61%), Gaps = 9/87 (10%)
 Frame = -1

Query  536  EPETKPRAAGIANGHNPAKE--PESSKASPRRNTSVG--NQSSSSTDMVD---HTKATVT  378
            EPE+       A G  P+    P SS+A+   ++  G  N S  + D++D    TKATVT
Sbjct  462  EPESAHPETFSAFGPTPSNHDAPLSSEANATSDSLPGPVNGSQDTDDLIDLSSRTKATVT  521

Query  377  VV--KNPSGNIMDGLMRRWDLSFFKNR  303
            VV   + SGN++DGL+RRWDL+FFK+R
Sbjct  522  VVGRSSTSGNVLDGLLRRWDLNFFKSR  548



>ref|XP_009139528.1| PREDICTED: uncharacterized protein LOC103863543 isoform X1 [Brassica 
rapa]
Length=550

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 53/87 (61%), Gaps = 9/87 (10%)
 Frame = -1

Query  536  EPETKPRAAGIANGHNPAKE--PESSKASPRRNTSVG--NQSSSSTDMVD---HTKATVT  378
            EPE+       A G  P+    P SS+A+   ++  G  N S  + D++D    TKATVT
Sbjct  464  EPESAHPETFSAFGPTPSNHDAPLSSEANATSDSLPGPVNGSQDTDDLIDLSSRTKATVT  523

Query  377  VV--KNPSGNIMDGLMRRWDLSFFKNR  303
            VV   + SGN++DGL+RRWDL+FFK+R
Sbjct  524  VVGRSSTSGNVLDGLLRRWDLNFFKSR  550



>ref|XP_009139530.1| PREDICTED: uncharacterized protein LOC103863543 isoform X3 [Brassica 
rapa]
Length=546

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 53/87 (61%), Gaps = 9/87 (10%)
 Frame = -1

Query  536  EPETKPRAAGIANGHNPAKE--PESSKASPRRNTSVG--NQSSSSTDMVD---HTKATVT  378
            EPE+       A G  P+    P SS+A+   ++  G  N S  + D++D    TKATVT
Sbjct  460  EPESAHPETFSAFGPTPSNHDAPLSSEANATSDSLPGPVNGSQDTDDLIDLSSRTKATVT  519

Query  377  VV--KNPSGNIMDGLMRRWDLSFFKNR  303
            VV   + SGN++DGL+RRWDL+FFK+R
Sbjct  520  VVGRSSTSGNVLDGLLRRWDLNFFKSR  546



>emb|CDY49406.1| BnaCnng17160D [Brassica napus]
Length=505

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 36/48 (75%), Gaps = 5/48 (10%)
 Frame = -1

Query  431  NQSSSSTDMVD---HTKATVTVV--KNPSGNIMDGLMRRWDLSFFKNR  303
            N S  + D++D    TKATVTVV   + SGN++DGL+RRWDL+FFK+R
Sbjct  458  NGSQDTDDLIDLSSRTKATVTVVGRSSTSGNVLDGLLRRWDLNFFKSR  505



>ref|XP_010532690.1| PREDICTED: uncharacterized protein LOC104808656 isoform X1 [Tarenaya 
hassleriana]
Length=539

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 40/64 (63%), Gaps = 1/64 (2%)
 Frame = -1

Query  491  NPAKEPESSKASPRRNTSVGNQSSSSTDMVDHTKATVTVVK-NPSGNIMDGLMRRWDLSF  315
            N A E  +S + P       +  + STDM   TKATVTV + N   N++DGL+RRWDL+F
Sbjct  476  NAACETSASASLPEPVPPADSSLTDSTDMSARTKATVTVERSNAPSNVLDGLIRRWDLNF  535

Query  314  FKNR  303
            FKNR
Sbjct  536  FKNR  539



>ref|XP_010532691.1| PREDICTED: uncharacterized protein LOC104808656 isoform X2 [Tarenaya 
hassleriana]
Length=537

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 40/64 (63%), Gaps = 1/64 (2%)
 Frame = -1

Query  491  NPAKEPESSKASPRRNTSVGNQSSSSTDMVDHTKATVTVVK-NPSGNIMDGLMRRWDLSF  315
            N A E  +S + P       +  + STDM   TKATVTV + N   N++DGL+RRWDL+F
Sbjct  474  NAACETSASASLPEPVPPADSSLTDSTDMSARTKATVTVERSNAPSNVLDGLIRRWDLNF  533

Query  314  FKNR  303
            FKNR
Sbjct  534  FKNR  537



>ref|XP_010440497.1| PREDICTED: uncharacterized protein LOC104723788 [Camelina sativa]
Length=559

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 39/55 (71%), Gaps = 6/55 (11%)
 Frame = -1

Query  461  ASPRRNTSVGNQSSSSTDMVDHTKATVTVV--KNPSGNIMDGLMRRWDLSFFKNR  303
            ASP+    +   ++ + D+   TKATVTVV   + SGN++DGL+RRWDL+FFK+R
Sbjct  509  ASPK----ISQNTNDAIDLSSRTKATVTVVGRSSTSGNVLDGLLRRWDLNFFKSR  559



>ref|XP_010488423.1| PREDICTED: uncharacterized protein LOC104766268 [Camelina sativa]
Length=146

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 39/67 (58%), Gaps = 5/67 (7%)
 Frame = -1

Query  491  NPAKEPESSKASPRRNTSVGNQSSSST---DMVDHTKATVTVVKNPS--GNIMDGLMRRW  327
            NP  E  +S A P      G+ S   T   DM   TKATVTV ++ S  G + DGL+RRW
Sbjct  78   NPLSETSTSLARPINAFGPGSLSQKETETGDMSGVTKATVTVERSSSAPGKVFDGLIRRW  137

Query  326  DLSFFKN  306
            DL+FFKN
Sbjct  138  DLNFFKN  144



>ref|XP_006414745.1| hypothetical protein EUTSA_v10024836mg [Eutrema salsugineum]
 gb|ESQ56198.1| hypothetical protein EUTSA_v10024836mg [Eutrema salsugineum]
Length=550

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 51/93 (55%), Gaps = 18/93 (19%)
 Frame = -1

Query  575  PAAGLANGHTPAKEPETKPRAAGIANGHNPAKEPESSKASPRRNTSVGNQSSSSTDMVDH  396
            P++  ANG  P K   T    +G  NG  P   P  S+            +S + D+   
Sbjct  474  PSSSEANG--PCK---TSDSLSGPVNGLVPGSSPRMSQ-----------NTSDAIDLSAR  517

Query  395  TKATVTVV--KNPSGNIMDGLMRRWDLSFFKNR  303
            TKATVTVV   + SGN+++GL+RRWDL+FFK+R
Sbjct  518  TKATVTVVARSSTSGNVLEGLLRRWDLNFFKSR  550



>ref|XP_010435157.1| PREDICTED: uncharacterized protein LOC104719022 isoform X1 [Camelina 
sativa]
Length=559

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 42/71 (59%), Gaps = 13/71 (18%)
 Frame = -1

Query  509  GIANGHNPAKEPESSKASPRRNTSVGNQSSSSTDMVDHTKATVTVV--KNPSGNIMDGLM  336
            G  NG  P   P+ S+            ++ + D+   TKATVTVV   + SGN++DGL+
Sbjct  500  GPVNGFVPGASPKMSQ-----------NTNDAIDLSSRTKATVTVVGRSSTSGNVLDGLL  548

Query  335  RRWDLSFFKNR  303
            RRWDL+FFK+R
Sbjct  549  RRWDLNFFKSR  559



>ref|XP_010435158.1| PREDICTED: uncharacterized protein LOC104719022 isoform X2 [Camelina 
sativa]
Length=557

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 42/71 (59%), Gaps = 13/71 (18%)
 Frame = -1

Query  509  GIANGHNPAKEPESSKASPRRNTSVGNQSSSSTDMVDHTKATVTVV--KNPSGNIMDGLM  336
            G  NG  P   P+ S+            ++ + D+   TKATVTVV   + SGN++DGL+
Sbjct  498  GPVNGFVPGASPKMSQ-----------NTNDAIDLSSRTKATVTVVGRSSTSGNVLDGLL  546

Query  335  RRWDLSFFKNR  303
            RRWDL+FFK+R
Sbjct  547  RRWDLNFFKSR  557



>ref|XP_010450069.1| PREDICTED: uncharacterized protein LOC104732228 [Camelina sativa]
Length=556

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 42/71 (59%), Gaps = 13/71 (18%)
 Frame = -1

Query  509  GIANGHNPAKEPESSKASPRRNTSVGNQSSSSTDMVDHTKATVTVV--KNPSGNIMDGLM  336
            G  NG  P   P+ S+            ++ + D+   TKATVTVV   + SGN++DGL+
Sbjct  497  GPVNGFVPGASPKMSQ-----------NTNDAIDLSSRTKATVTVVGRSSTSGNVLDGLL  545

Query  335  RRWDLSFFKNR  303
            RRWDL+FFK+R
Sbjct  546  RRWDLNFFKSR  556



>emb|CDY12752.1| BnaC04g28890D [Brassica napus]
Length=506

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 43/71 (61%), Gaps = 3/71 (4%)
 Frame = -1

Query  506  IANGHNPAKEPESSKASPRRNTSVGNQSSS-STDMVDHTKATVTVV--KNPSGNIMDGLM  336
            I     P+K  ++     +     G+Q +  + D+   TKATVTVV   + SGN++DGL+
Sbjct  436  IHQNKEPSKTTDTENTVEKEGPVNGSQDTDDAIDLSSRTKATVTVVGRSSTSGNVLDGLL  495

Query  335  RRWDLSFFKNR  303
            RRWDL+FFK+R
Sbjct  496  RRWDLNFFKSR  506



>ref|XP_011090819.1| PREDICTED: uncharacterized protein LOC105171411 isoform X4 [Sesamum 
indicum]
Length=600

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 38/62 (61%), Gaps = 1/62 (2%)
 Frame = -1

Query  488  PAKEPESSKASPRRNTSVGNQSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFK  309
            P +E  S   S +  +S   + SS  DMVD T  TV V KN + N++DG +RRW+L FF+
Sbjct  540  PTQEETSRLTSHKDASSATPRPSSEVDMVDSTTVTVKVEKNTTSNVIDGWLRRWEL-FFR  598

Query  308  NR  303
            NR
Sbjct  599  NR  600



>ref|XP_011090820.1| PREDICTED: uncharacterized protein LOC105171411 isoform X5 [Sesamum 
indicum]
Length=599

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 38/62 (61%), Gaps = 1/62 (2%)
 Frame = -1

Query  488  PAKEPESSKASPRRNTSVGNQSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFK  309
            P +E  S   S +  +S   + SS  DMVD T  TV V KN + N++DG +RRW+L FF+
Sbjct  539  PTQEETSRLTSHKDASSATPRPSSEVDMVDSTTVTVKVEKNTTSNVIDGWLRRWEL-FFR  597

Query  308  NR  303
            NR
Sbjct  598  NR  599



>ref|XP_011090822.1| PREDICTED: uncharacterized protein LOC105171411 isoform X7 [Sesamum 
indicum]
Length=561

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 38/62 (61%), Gaps = 1/62 (2%)
 Frame = -1

Query  488  PAKEPESSKASPRRNTSVGNQSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFK  309
            P +E  S   S +  +S   + SS  DMVD T  TV V KN + N++DG +RRW+L FF+
Sbjct  501  PTQEETSRLTSHKDASSATPRPSSEVDMVDSTTVTVKVEKNTTSNVIDGWLRRWEL-FFR  559

Query  308  NR  303
            NR
Sbjct  560  NR  561



>ref|XP_011090821.1| PREDICTED: uncharacterized protein LOC105171411 isoform X6 [Sesamum 
indicum]
Length=588

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 38/62 (61%), Gaps = 1/62 (2%)
 Frame = -1

Query  488  PAKEPESSKASPRRNTSVGNQSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFK  309
            P +E  S   S +  +S   + SS  DMVD T  TV V KN + N++DG +RRW+L FF+
Sbjct  528  PTQEETSRLTSHKDASSATPRPSSEVDMVDSTTVTVKVEKNTTSNVIDGWLRRWEL-FFR  586

Query  308  NR  303
            NR
Sbjct  587  NR  588



>ref|XP_011090817.1| PREDICTED: uncharacterized protein LOC105171411 isoform X2 [Sesamum 
indicum]
Length=614

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 38/62 (61%), Gaps = 1/62 (2%)
 Frame = -1

Query  488  PAKEPESSKASPRRNTSVGNQSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFK  309
            P +E  S   S +  +S   + SS  DMVD T  TV V KN + N++DG +RRW+L FF+
Sbjct  554  PTQEETSRLTSHKDASSATPRPSSEVDMVDSTTVTVKVEKNTTSNVIDGWLRRWEL-FFR  612

Query  308  NR  303
            NR
Sbjct  613  NR  614



>ref|XP_011090818.1| PREDICTED: uncharacterized protein LOC105171411 isoform X3 [Sesamum 
indicum]
Length=614

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 38/62 (61%), Gaps = 1/62 (2%)
 Frame = -1

Query  488  PAKEPESSKASPRRNTSVGNQSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFK  309
            P +E  S   S +  +S   + SS  DMVD T  TV V KN + N++DG +RRW+L FF+
Sbjct  554  PTQEETSRLTSHKDASSATPRPSSEVDMVDSTTVTVKVEKNTTSNVIDGWLRRWEL-FFR  612

Query  308  NR  303
            NR
Sbjct  613  NR  614



>ref|XP_011090816.1| PREDICTED: uncharacterized protein LOC105171411 isoform X1 [Sesamum 
indicum]
Length=615

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 38/62 (61%), Gaps = 1/62 (2%)
 Frame = -1

Query  488  PAKEPESSKASPRRNTSVGNQSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFK  309
            P +E  S   S +  +S   + SS  DMVD T  TV V KN + N++DG +RRW+L FF+
Sbjct  555  PTQEETSRLTSHKDASSATPRPSSEVDMVDSTTVTVKVEKNTTSNVIDGWLRRWEL-FFR  613

Query  308  NR  303
            NR
Sbjct  614  NR  615



>ref|XP_003594093.1| hypothetical protein MTR_2g021260 [Medicago truncatula]
Length=485

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -1

Query  413  TDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFKN  306
             D+   TKAT+TV +NP+G++M+GLMRRWD +F +N
Sbjct  393  IDISHKTKATLTVTRNPAGHVMNGLMRRWDFNFLRN  428



>gb|AES64344.2| alpha/beta hydrolase family protein [Medicago truncatula]
Length=535

 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -1

Query  413  TDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFKN  306
             D+   TKAT+TV +NP+G++M+GLMRRWD +F +N
Sbjct  494  IDISHKTKATLTVTRNPAGHVMNGLMRRWDFNFLRN  529



>ref|NP_193165.7| alpha/beta-hydrolase family protein [Arabidopsis thaliana]
 gb|AEE83410.1| alpha/beta-hydrolase family protein [Arabidopsis thaliana]
Length=558

 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 47/84 (56%), Gaps = 16/84 (19%)
 Frame = -1

Query  548  TPAKEPETKPRAAGIANGHNPAKEPESSKASPRRNTSVGNQSSSSTDMVDHTKATVTVV-  372
             P+K  ++ P   G  NG  P   P   K S  +N  +        D+   TKATVTVV 
Sbjct  489  VPSKTSDSLP---GPVNGFVPGASP---KTSQNKNDVI--------DLSARTKATVTVVG  534

Query  371  -KNPSGNIMDGLMRRWDLSFFKNR  303
              + SGN+++GL+RRWDL+FFK+R
Sbjct  535  RSSTSGNVLEGLLRRWDLNFFKSR  558



>ref|XP_002868296.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44555.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=557

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 2/39 (5%)
 Frame = -1

Query  413  TDMVDHTKATVTVV--KNPSGNIMDGLMRRWDLSFFKNR  303
             D+   TKATVTVV   + SGN++DGL+RRWDL+FFK R
Sbjct  519  IDLSARTKATVTVVGRSSTSGNVLDGLLRRWDLNFFKGR  557



>ref|XP_010488424.1| PREDICTED: uncharacterized protein LOC104766269 isoform X1 [Camelina 
sativa]
 ref|XP_010488425.1| PREDICTED: uncharacterized protein LOC104766269 isoform X2 [Camelina 
sativa]
Length=561

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 39/67 (58%), Gaps = 5/67 (7%)
 Frame = -1

Query  491  NPAKEPESSKASPRRNTSVGNQSSSST---DMVDHTKATVTVVKNPS--GNIMDGLMRRW  327
            NP  E  +S A P      G+ S   T   DM   TKATVTV ++ S  G + DGL+RRW
Sbjct  493  NPLSETSTSLARPINAFGPGSLSQKETETGDMSGVTKATVTVERSSSAPGKVFDGLIRRW  552

Query  326  DLSFFKN  306
            DL+FFKN
Sbjct  553  DLNFFKN  559



>ref|XP_006299834.1| hypothetical protein CARUB_v10016036mg [Capsella rubella]
 gb|EOA32732.1| hypothetical protein CARUB_v10016036mg [Capsella rubella]
Length=564

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 34/47 (72%), Gaps = 2/47 (4%)
 Frame = -1

Query  440  SVGNQSSSSTDMVDHTKATVTVVKNPS--GNIMDGLMRRWDLSFFKN  306
            S+  + S + DM   TKATVTV ++ S  G ++DGL+RRWDL+FFKN
Sbjct  516  SLSQKESETRDMSGVTKATVTVERSSSAPGKVLDGLIRRWDLNFFKN  562



>ref|XP_010512570.1| PREDICTED: uncharacterized protein LOC104788495 [Camelina sativa]
Length=561

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 35/47 (74%), Gaps = 2/47 (4%)
 Frame = -1

Query  440  SVGNQSSSSTDMVDHTKATVTVVKNPS--GNIMDGLMRRWDLSFFKN  306
            S+  + + ++DM   TKATVTV ++ S  G ++DGL+RRWDL+FFKN
Sbjct  513  SLSQKETENSDMSGVTKATVTVERSSSAPGKVLDGLIRRWDLNFFKN  559



>ref|XP_010466700.1| PREDICTED: uncharacterized protein LOC104746856 [Camelina sativa]
Length=561

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 34/47 (72%), Gaps = 2/47 (4%)
 Frame = -1

Query  440  SVGNQSSSSTDMVDHTKATVTVVKNPS--GNIMDGLMRRWDLSFFKN  306
            S+  + + + DM   TKATVTV ++ S  G ++DGL+RRWDL+FFKN
Sbjct  513  SLSQKETETGDMSGVTKATVTVERSSSAPGKVLDGLIRRWDLNFFKN  559



>ref|XP_008797057.1| PREDICTED: uncharacterized protein LOC103712341 [Phoenix dactylifera]
Length=591

 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 37/67 (55%), Gaps = 8/67 (12%)
 Frame = -1

Query  485  AKEPESSKASPRRNTSVGNQSSSS--------TDMVDHTKATVTVVKNPSGNIMDGLMRR  330
            A EP S+K S   +T  G   +S+         DM   T+AT+ V KNP+ +IMDGL  R
Sbjct  522  AMEPTSAKNSSSSDTVSGTACTSADGSSSIQDADMAAGTRATLIVQKNPASHIMDGLAHR  581

Query  329  WDLSFFK  309
            W L FF+
Sbjct  582  WGLKFFR  588



>ref|XP_002883434.1| hypothetical protein ARALYDRAFT_898866 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59693.1| hypothetical protein ARALYDRAFT_898866 [Arabidopsis lyrata subsp. 
lyrata]
Length=565

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 34/47 (72%), Gaps = 2/47 (4%)
 Frame = -1

Query  440  SVGNQSSSSTDMVDHTKATVTVVKNPS--GNIMDGLMRRWDLSFFKN  306
            S+  + S + DM   TKATVTV ++ S  G ++DGL+R+WDL+FFKN
Sbjct  517  SLSQKESETGDMSGVTKATVTVERSSSAPGKVLDGLIRKWDLNFFKN  563



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1023687230320