BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF001A20

Length=530
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009794044.1|  PREDICTED: 40S ribosomal protein S4-like           210   3e-64   Nicotiana sylvestris
ref|XP_009597091.1|  PREDICTED: 40S ribosomal protein S4-like           209   4e-64   Nicotiana tomentosiformis
ref|XP_009595443.1|  PREDICTED: 40S ribosomal protein S4-like           209   5e-64   Nicotiana tomentosiformis
ref|XP_009784493.1|  PREDICTED: 40S ribosomal protein S4-like           209   5e-64   Nicotiana sylvestris
ref|XP_004148191.1|  PREDICTED: 40S ribosomal protein S4-like           207   5e-64   
ref|XP_011097305.1|  PREDICTED: 40S ribosomal protein S4-like           209   6e-64   Sesamum indicum [beniseed]
ref|XP_011084586.1|  PREDICTED: 40S ribosomal protein S4                209   7e-64   Sesamum indicum [beniseed]
ref|XP_009609731.1|  PREDICTED: 40S ribosomal protein S4-like           208   1e-63   Nicotiana tomentosiformis
gb|KHN10552.1|  40S ribosomal protein S4                                206   1e-63   Glycine soja [wild soybean]
ref|XP_009600336.1|  PREDICTED: 40S ribosomal protein S4                207   2e-63   Nicotiana tomentosiformis
ref|XP_009766580.1|  PREDICTED: 40S ribosomal protein S4                207   3e-63   Nicotiana sylvestris
emb|CBI25428.3|  unnamed protein product                                206   3e-63   Vitis vinifera
gb|KHN03095.1|  40S ribosomal protein S4                                206   4e-63   Glycine soja [wild soybean]
ref|XP_004163526.1|  PREDICTED: 40S ribosomal protein S4-like           207   4e-63   
ref|XP_006576177.1|  PREDICTED: uncharacterized protein LOC100500...    206   4e-63   Glycine max [soybeans]
ref|XP_008454823.1|  PREDICTED: 40S ribosomal protein S4-3              207   4e-63   Cucumis melo [Oriental melon]
ref|XP_002276986.1|  PREDICTED: 40S ribosomal protein S4-1              207   4e-63   Vitis vinifera
emb|CDP06439.1|  unnamed protein product                                206   6e-63   Coffea canephora [robusta coffee]
ref|XP_003516980.1|  PREDICTED: 40S ribosomal protein S4                206   9e-63   Glycine max [soybeans]
ref|XP_006576176.1|  PREDICTED: uncharacterized protein LOC100500...    206   9e-63   
ref|XP_008461463.1|  PREDICTED: 40S ribosomal protein S4-3-like         206   1e-62   Cucumis melo [Oriental melon]
gb|ACU24295.1|  unknown                                                 206   1e-62   Glycine max [soybeans]
ref|XP_004150395.1|  PREDICTED: 40S ribosomal protein S4-like           206   1e-62   
ref|XP_003544057.1|  PREDICTED: 40S ribosomal protein S4-1              206   1e-62   Glycine max [soybeans]
ref|XP_004150397.1|  PREDICTED: 40S ribosomal protein S4-like           206   1e-62   Cucumis sativus [cucumbers]
ref|XP_010087529.1|  40S ribosomal protein S4                           207   2e-62   
ref|XP_002268192.1|  PREDICTED: 40S ribosomal protein S4-3-like         205   3e-62   Vitis vinifera
gb|KCW60005.1|  hypothetical protein EUGRSUZ_H02737                     202   3e-62   Eucalyptus grandis [rose gum]
ref|XP_004233134.1|  PREDICTED: 40S ribosomal protein S4-like           204   3e-62   Solanum lycopersicum
ref|XP_010316939.1|  PREDICTED: 40S ribosomal protein S4-like           204   3e-62   Solanum lycopersicum
ref|XP_008233807.1|  PREDICTED: 40S ribosomal protein S4-1              204   3e-62   Prunus mume [ume]
emb|CBI15899.3|  unnamed protein product                                204   4e-62   Vitis vinifera
gb|KCW49428.1|  hypothetical protein EUGRSUZ_K02962                     202   5e-62   Eucalyptus grandis [rose gum]
ref|NP_001275093.1|  40S ribosomal protein S4-like                      204   5e-62   Solanum tuberosum [potatoes]
ref|XP_008461503.1|  PREDICTED: 40S ribosomal protein S4-3-like         204   5e-62   Cucumis melo [Oriental melon]
gb|KGN44410.1|  hypothetical protein Csa_7G281390                       204   6e-62   Cucumis sativus [cucumbers]
gb|KHN48586.1|  40S ribosomal protein S4-2                              204   6e-62   Glycine soja [wild soybean]
ref|XP_002275063.1|  PREDICTED: 40S ribosomal protein S4                204   7e-62   Vitis vinifera
ref|XP_007218753.1|  hypothetical protein PRUPE_ppa009337mg             204   8e-62   
ref|XP_004240421.1|  PREDICTED: 40S ribosomal protein S4                204   8e-62   Solanum lycopersicum
ref|XP_008778562.1|  PREDICTED: 40S ribosomal protein S4-3-like         203   8e-62   Phoenix dactylifera
ref|XP_004233133.1|  PREDICTED: 40S ribosomal protein S4-like           203   1e-61   Solanum lycopersicum
ref|XP_006352980.1|  PREDICTED: 40S ribosomal protein S4-like           203   2e-61   Solanum tuberosum [potatoes]
ref|XP_003547932.1|  PREDICTED: 40S ribosomal protein S4-1              203   2e-61   Glycine max [soybeans]
ref|XP_010553232.1|  PREDICTED: 40S ribosomal protein S4-3 isofor...    203   2e-61   Tarenaya hassleriana [spider flower]
ref|XP_010553233.1|  PREDICTED: 40S ribosomal protein S4-3 isofor...    202   2e-61   Tarenaya hassleriana [spider flower]
gb|ACU24626.1|  unknown                                                 202   2e-61   Glycine max [soybeans]
ref|XP_010529053.1|  PREDICTED: 40S ribosomal protein S4-3-like         202   3e-61   Tarenaya hassleriana [spider flower]
ref|XP_009368564.1|  PREDICTED: 40S ribosomal protein S4-3-like         202   3e-61   Pyrus x bretschneideri [bai li]
ref|XP_008809054.1|  PREDICTED: 40S ribosomal protein S4-like           200   3e-61   Phoenix dactylifera
ref|XP_010037684.1|  PREDICTED: 40S ribosomal protein S4-3-like         202   4e-61   Eucalyptus grandis [rose gum]
ref|XP_006344073.1|  PREDICTED: 40S ribosomal protein S4-like           202   4e-61   
ref|NP_001275148.1|  40S ribosomal protein S4                           202   4e-61   Solanum tuberosum [potatoes]
ref|XP_009781828.1|  PREDICTED: 40S ribosomal protein S4-like           201   5e-61   Nicotiana sylvestris
ref|NP_001235826.1|  40S ribosomal S4 protein                           201   5e-61   Glycine max [soybeans]
gb|KHN38535.1|  40S ribosomal protein S4-1                              201   5e-61   Glycine soja [wild soybean]
dbj|BAE20168.1|  ribosomal protein S4                                   201   6e-61   Panax ginseng [Asiatic ginseng]
ref|XP_011046821.1|  PREDICTED: 40S ribosomal protein S4-3              201   7e-61   Populus euphratica
ref|XP_006352979.1|  PREDICTED: 40S ribosomal protein S4-like           201   7e-61   Solanum tuberosum [potatoes]
ref|XP_006374217.1|  40S ribosomal protein S4                           201   8e-61   Populus trichocarpa [western balsam poplar]
ref|XP_010023674.1|  PREDICTED: 40S ribosomal protein S4-3              201   1e-60   Eucalyptus grandis [rose gum]
ref|XP_011035547.1|  PREDICTED: 40S ribosomal protein S4-1              200   2e-60   Populus euphratica
ref|XP_002515668.1|  40S ribosomal protein S4, putative                 200   2e-60   Ricinus communis
ref|XP_002323021.2|  hypothetical protein POPTR_0016s13210g             200   3e-60   Populus trichocarpa [western balsam poplar]
ref|NP_001242281.1|  uncharacterized protein LOC100812132               199   3e-60   Glycine max [soybeans]
ref|XP_010036744.1|  PREDICTED: 40S ribosomal protein S4-3-like         199   3e-60   Eucalyptus grandis [rose gum]
ref|XP_010529903.1|  PREDICTED: 40S ribosomal protein S4-3-like         199   4e-60   Tarenaya hassleriana [spider flower]
ref|XP_007156131.1|  hypothetical protein PHAVU_003G261200g             197   4e-60   Phaseolus vulgaris [French bean]
ref|XP_002318967.2|  hypothetical protein POPTR_0013s01230g             199   5e-60   Populus trichocarpa [western balsam poplar]
gb|KDP30648.1|  hypothetical protein JCGZ_16213                         199   5e-60   Jatropha curcas
ref|XP_010509192.1|  PREDICTED: 40S ribosomal protein S4-3-like         198   5e-60   Camelina sativa [gold-of-pleasure]
ref|XP_004294780.1|  PREDICTED: 40S ribosomal protein S4-3              199   7e-60   Fragaria vesca subsp. vesca
ref|XP_010517120.1|  PREDICTED: 40S ribosomal protein S4-3-like         198   8e-60   Camelina sativa [gold-of-pleasure]
ref|XP_006409322.1|  hypothetical protein EUTSA_v10022813mg             198   8e-60   Eutrema salsugineum [saltwater cress]
ref|XP_006399188.1|  hypothetical protein EUTSA_v10014417mg             198   8e-60   Eutrema salsugineum [saltwater cress]
ref|XP_010934423.1|  PREDICTED: 40S ribosomal protein S4-3-like         198   8e-60   Elaeis guineensis
gb|EYU19705.1|  hypothetical protein MIMGU_mgv1a012053mg                198   9e-60   Erythranthe guttata [common monkey flower]
gb|KHG11751.1|  40S ribosomal S4                                        197   1e-59   Gossypium arboreum [tree cotton]
gb|EYU41945.1|  hypothetical protein MIMGU_mgv1a012043mg                198   1e-59   Erythranthe guttata [common monkey flower]
gb|KJB36905.1|  hypothetical protein B456_006G184600                    197   1e-59   Gossypium raimondii
gb|KHN00473.1|  40S ribosomal protein S4-1                              199   1e-59   Glycine soja [wild soybean]
gb|KJB77064.1|  hypothetical protein B456_012G118500                    197   1e-59   Gossypium raimondii
ref|XP_007050962.1|  Ribosomal protein S4 (RPS4A) family protein        198   1e-59   Theobroma cacao [chocolate]
gb|KJB77063.1|  hypothetical protein B456_012G118500                    197   1e-59   Gossypium raimondii
ref|XP_003604568.1|  40S ribosomal protein S4                           198   1e-59   Medicago truncatula
ref|XP_010443578.1|  PREDICTED: 40S ribosomal protein S4-3-like i...    198   1e-59   
ref|XP_011019071.1|  PREDICTED: 40S ribosomal protein S4-3-like         198   1e-59   Populus euphratica
ref|XP_002884052.1|  40S ribosomal protein S4                           197   2e-59   Arabidopsis lyrata subsp. lyrata
ref|XP_002308235.1|  hypothetical protein POPTR_0006s10460g             197   2e-59   Populus trichocarpa [western balsam poplar]
ref|XP_002512717.1|  40S ribosomal protein S4, putative                 197   2e-59   Ricinus communis
ref|XP_009393217.1|  PREDICTED: 40S ribosomal protein S4-1-like         197   2e-59   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAH57121.1|  AT5G07090                                              195   2e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006411034.1|  hypothetical protein EUTSA_v10017036mg             198   2e-59   
ref|XP_002864574.1|  40S ribosomal protein S4                           197   2e-59   Arabidopsis lyrata subsp. lyrata
gb|KJB71672.1|  hypothetical protein B456_011G136800                    197   2e-59   Gossypium raimondii
ref|XP_009391002.1|  PREDICTED: 40S ribosomal protein S4-3              197   2e-59   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG02126.1|  40S ribosomal S4                                        197   2e-59   Gossypium arboreum [tree cotton]
ref|XP_007026596.1|  Ribosomal protein S4 (RPS4A) family protein        197   2e-59   
ref|XP_010938423.1|  PREDICTED: 40S ribosomal protein S4-3              197   2e-59   Elaeis guineensis
emb|CDX81032.1|  BnaC03g02860D                                          197   2e-59   
gb|KHG30713.1|  40S ribosomal S4                                        197   2e-59   Gossypium arboreum [tree cotton]
ref|XP_002871248.1|  40S ribosomal protein S4                           197   2e-59   Arabidopsis lyrata subsp. lyrata
dbj|BAB10257.1|  ribosomal protein S4                                   196   3e-59   Arabidopsis thaliana [mouse-ear cress]
gb|KJB29916.1|  hypothetical protein B456_005G123400                    196   3e-59   Gossypium raimondii
ref|XP_007156130.1|  hypothetical protein PHAVU_003G261200g             197   3e-59   Phaseolus vulgaris [French bean]
ref|XP_006401084.1|  hypothetical protein EUTSA_v10014163mg             198   4e-59   
gb|KDO67007.1|  hypothetical protein CISIN_1g024108mg                   194   4e-59   Citrus sinensis [apfelsine]
ref|XP_006288484.1|  hypothetical protein CARUB_v10001743mg             197   4e-59   Capsella rubella
gb|AAL49933.1|  AT5g58420/mqj2_10                                       196   4e-59   Arabidopsis thaliana [mouse-ear cress]
gb|KJB38000.1|  hypothetical protein B456_006G231800                    196   4e-59   Gossypium raimondii
gb|KJB29915.1|  hypothetical protein B456_005G123400                    196   4e-59   Gossypium raimondii
ref|XP_011023749.1|  PREDICTED: 40S ribosomal protein S4-2-like         196   4e-59   Populus euphratica
ref|XP_009381027.1|  PREDICTED: 40S ribosomal protein S4-like           196   4e-59   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_200650.1|  40S ribosomal protein S4-3                            196   5e-59   Arabidopsis thaliana [mouse-ear cress]
gb|KJB17111.1|  hypothetical protein B456_002G266000                    194   5e-59   Gossypium raimondii
ref|XP_009385022.1|  PREDICTED: 40S ribosomal protein S4-1-like         196   5e-59   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS63485.1|  hypothetical protein M569_11297                         196   5e-59   Genlisea aurea
gb|KJB37999.1|  hypothetical protein B456_006G231800                    196   6e-59   Gossypium raimondii
gb|KHG02041.1|  40S ribosomal S4                                        196   6e-59   Gossypium arboreum [tree cotton]
ref|XP_009125675.1|  PREDICTED: 40S ribosomal protein S4-1              196   6e-59   Brassica rapa
ref|NP_001031846.1|  40S ribosomal protein S4-2                         196   6e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006280972.1|  hypothetical protein CARUB_v10026972mg             196   7e-59   Capsella rubella
ref|XP_009130977.1|  PREDICTED: 40S ribosomal protein S4-1-like         196   7e-59   
ref|XP_008234249.1|  PREDICTED: 40S ribosomal protein S4                196   8e-59   Prunus mume [ume]
ref|XP_009402521.1|  PREDICTED: 40S ribosomal protein S4-3-like         196   8e-59   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB38001.1|  hypothetical protein B456_006G231800                    193   8e-59   Gossypium raimondii
ref|XP_010515129.1|  PREDICTED: 40S ribosomal protein S4-1              196   8e-59   Camelina sativa [gold-of-pleasure]
sp|O81363.1|RS4_PRUAR  RecName: Full=40S ribosomal protein S4           196   8e-59   Prunus armeniaca
gb|KHG26321.1|  40S ribosomal S4                                        196   8e-59   Gossypium arboreum [tree cotton]
emb|CDY58877.1|  BnaA03g55550D                                          196   8e-59   Brassica napus [oilseed rape]
ref|XP_006298349.1|  hypothetical protein CARUB_v10014418mg             196   9e-59   Capsella rubella
ref|XP_008789926.1|  PREDICTED: 40S ribosomal protein S4-1 isofor...    196   9e-59   
gb|ABK92450.1|  unknown                                                 196   1e-58   Populus trichocarpa [western balsam poplar]
ref|NP_568179.1|  40S ribosomal protein S4-2                            196   1e-58   Arabidopsis thaliana [mouse-ear cress]
ref|NP_565414.1|  40S ribosomal protein S4-1                            195   1e-58   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB11167.1|  40S ribosomal protein S4                               196   1e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011046165.1|  PREDICTED: 40S ribosomal protein S4-2-like         196   1e-58   Populus euphratica
emb|CDY32700.1|  BnaA02g07620D                                          196   1e-58   Brassica napus [oilseed rape]
gb|KFK36724.1|  hypothetical protein AALP_AA4G161500                    195   1e-58   Arabis alpina [alpine rockcress]
gb|EPS70681.1|  hypothetical protein M569_04077                         195   1e-58   Genlisea aurea
gb|KDO67006.1|  hypothetical protein CISIN_1g024108mg                   194   2e-58   Citrus sinensis [apfelsine]
ref|XP_010243101.1|  PREDICTED: 40S ribosomal protein S4-3-like         195   2e-58   Nelumbo nucifera [Indian lotus]
ref|XP_009369212.1|  PREDICTED: 40S ribosomal protein S4-3              195   2e-58   Pyrus x bretschneideri [bai li]
emb|CDY14056.1|  BnaC02g01730D                                          196   2e-58   Brassica napus [oilseed rape]
ref|XP_006488578.1|  PREDICTED: 40S ribosomal protein S4-like           195   2e-58   Citrus sinensis [apfelsine]
emb|CDY02821.1|  BnaC02g10680D                                          195   2e-58   
ref|XP_010453688.1|  PREDICTED: 40S ribosomal protein S4-3-like         195   2e-58   Camelina sativa [gold-of-pleasure]
ref|XP_004307685.1|  PREDICTED: 40S ribosomal protein S4-like           195   2e-58   Fragaria vesca subsp. vesca
ref|XP_002322175.1|  hypothetical protein POPTR_0015s09110g             195   2e-58   Populus trichocarpa [western balsam poplar]
ref|XP_007211867.1|  hypothetical protein PRUPE_ppa010094mg             195   2e-58   Prunus persica
gb|KJB17112.1|  hypothetical protein B456_002G266000                    194   2e-58   Gossypium raimondii
gb|KFK27370.1|  hypothetical protein AALP_AA8G374100                    194   3e-58   Arabis alpina [alpine rockcress]
emb|CDY05015.1|  BnaAnng01970D                                          196   3e-58   
ref|XP_008789925.1|  PREDICTED: 40S ribosomal protein S4-1 isofor...    196   3e-58   Phoenix dactylifera
ref|XP_010423256.1|  PREDICTED: 40S ribosomal protein S4-3-like         194   4e-58   Camelina sativa [gold-of-pleasure]
ref|XP_010907826.1|  PREDICTED: 40S ribosomal protein S4-3-like         194   4e-58   Elaeis guineensis
sp|P46299.1|RS4_GOSHI  RecName: Full=40S ribosomal protein S4           194   4e-58   Gossypium hirsutum [American cotton]
ref|XP_010491309.1|  PREDICTED: 40S ribosomal protein S4-3-like         194   4e-58   Camelina sativa [gold-of-pleasure]
ref|XP_010276734.1|  PREDICTED: 40S ribosomal protein S4-3              194   5e-58   Nelumbo nucifera [Indian lotus]
ref|XP_010243078.1|  PREDICTED: 40S ribosomal protein S4-3-like         194   6e-58   Nelumbo nucifera [Indian lotus]
emb|CDY60025.1|  BnaAnng16450D                                          194   7e-58   Brassica napus [oilseed rape]
ref|XP_004492491.1|  PREDICTED: 40S ribosomal protein S4-2-like         194   7e-58   Cicer arietinum [garbanzo]
ref|XP_004293830.1|  PREDICTED: 40S ribosomal protein S4-3              193   7e-58   Fragaria vesca subsp. vesca
ref|XP_010483440.1|  PREDICTED: 40S ribosomal protein S4-3-like         193   1e-57   Camelina sativa [gold-of-pleasure]
gb|KFK25102.1|  hypothetical protein AALP_AA8G066400                    192   2e-57   Arabis alpina [alpine rockcress]
ref|XP_009126753.1|  PREDICTED: 40S ribosomal protein S4-1-like i...    194   2e-57   
gb|KHG30303.1|  40S ribosomal S4                                        192   2e-57   Gossypium arboreum [tree cotton]
ref|XP_009132054.1|  PREDICTED: 40S ribosomal protein S4-2-like         192   2e-57   Brassica rapa
ref|XP_009354210.1|  PREDICTED: 40S ribosomal protein S4-3-like         192   2e-57   Pyrus x bretschneideri [bai li]
ref|XP_008356229.1|  PREDICTED: 40S ribosomal protein S4-3-like         192   3e-57   
ref|XP_009126752.1|  PREDICTED: 40S ribosomal protein S4-1-like i...    194   3e-57   
ref|XP_009122377.1|  PREDICTED: 40S ribosomal protein S4-1              192   3e-57   Brassica rapa
emb|CDX70008.1|  BnaA10g23570D                                          192   3e-57   
gb|KDP45131.1|  hypothetical protein JCGZ_17463                         191   4e-57   Jatropha curcas
emb|CDX99006.1|  BnaC09g48290D                                          192   4e-57   
emb|CDY69841.1|  BnaAnng31720D                                          192   5e-57   Brassica napus [oilseed rape]
emb|CDY57385.1|  BnaCnng31910D                                          192   7e-57   Brassica napus [oilseed rape]
ref|XP_009369565.1|  PREDICTED: 40S ribosomal protein S4-3-like         190   1e-56   Pyrus x bretschneideri [bai li]
ref|XP_009120350.1|  PREDICTED: 40S ribosomal protein S4-1              190   1e-56   Brassica rapa
emb|CDY32986.1|  BnaA10g11920D                                          191   2e-56   Brassica napus [oilseed rape]
ref|XP_007205728.1|  hypothetical protein PRUPE_ppa010072mg             189   3e-56   Prunus persica
ref|XP_010676809.1|  PREDICTED: 40S ribosomal protein S4-1-like         189   3e-56   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010666843.1|  PREDICTED: 40S ribosomal protein S4-1              188   9e-56   
gb|KDO63243.1|  hypothetical protein CISIN_1g023289mg                   186   9e-56   Citrus sinensis [apfelsine]
gb|KDO67004.1|  hypothetical protein CISIN_1g024108mg                   188   1e-55   Citrus sinensis [apfelsine]
ref|XP_009345329.1|  PREDICTED: 40S ribosomal protein S4                185   1e-55   
gb|ACV70143.1|  putative 40S ribosomal protein S4                       187   1e-55   Jatropha curcas
ref|XP_010685909.1|  PREDICTED: 40S ribosomal protein S4-1              187   1e-55   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008383247.1|  PREDICTED: 40S ribosomal protein S4                187   2e-55   Malus domestica [apple tree]
ref|XP_008374283.1|  PREDICTED: 40S ribosomal protein S4 isoform X2     184   2e-55   
gb|KDO63240.1|  hypothetical protein CISIN_1g023289mg                   187   4e-55   Citrus sinensis [apfelsine]
gb|KDO63241.1|  hypothetical protein CISIN_1g023289mg                   186   4e-55   Citrus sinensis [apfelsine]
gb|KDO63242.1|  hypothetical protein CISIN_1g023289mg                   186   4e-55   Citrus sinensis [apfelsine]
ref|XP_006429477.1|  hypothetical protein CICLE_v10012499mg             186   5e-55   Citrus clementina [clementine]
dbj|BAJ94984.1|  predicted protein                                      186   7e-55   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002463552.1|  hypothetical protein SORBIDRAFT_01g001850          185   9e-55   Sorghum bicolor [broomcorn]
ref|XP_010251772.1|  PREDICTED: 40S ribosomal protein S4-like           183   1e-54   Nelumbo nucifera [Indian lotus]
ref|XP_004491013.1|  PREDICTED: 40S ribosomal protein S4-2-like         185   1e-54   Cicer arietinum [garbanzo]
ref|XP_008374276.1|  PREDICTED: 40S ribosomal protein S4 isoform X1     182   1e-54   
ref|XP_003568916.1|  PREDICTED: 40S ribosomal protein S4                185   2e-54   Brachypodium distachyon [annual false brome]
ref|XP_008343651.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    181   2e-54   
ref|XP_002455614.1|  hypothetical protein SORBIDRAFT_03g014380          184   2e-54   Sorghum bicolor [broomcorn]
ref|XP_004511996.1|  PREDICTED: 40S ribosomal protein S4-1-like         184   2e-54   Cicer arietinum [garbanzo]
ref|NP_001266498.1|  40S ribosomal protein S4                           184   3e-54   Zea mays [maize]
ref|XP_006646768.1|  PREDICTED: 40S ribosomal protein S4-like           184   4e-54   Oryza brachyantha
ref|NP_001043015.1|  Os01g0358400                                       184   4e-54   
ref|XP_003623356.1|  40S ribosomal protein S4                           184   5e-54   Medicago truncatula
ref|NP_001045624.1|  Os02g0105900                                       183   6e-54   
ref|XP_002439678.1|  hypothetical protein SORBIDRAFT_09g018320          183   6e-54   Sorghum bicolor [broomcorn]
ref|XP_004960263.1|  PREDICTED: 40S ribosomal protein S4-like           183   7e-54   Setaria italica
ref|XP_006644163.1|  PREDICTED: 40S ribosomal protein S4-like           182   1e-53   Oryza brachyantha
gb|ACJ84252.1|  unknown                                                 180   1e-53   Medicago truncatula
ref|XP_004962295.1|  PREDICTED: 40S ribosomal protein S4-like           182   1e-53   Setaria italica
ref|XP_006645886.1|  PREDICTED: 40S ribosomal protein S4-like           183   2e-53   
dbj|BAD22763.1|  ribosomal protein                                      181   4e-53   Bromus inermis [awnless brome grass]
ref|XP_006851828.1|  hypothetical protein AMTR_s00041p00058440          181   6e-53   
ref|XP_008801072.1|  PREDICTED: 40S ribosomal protein S4-like           178   8e-53   Phoenix dactylifera
ref|XP_003611879.1|  40S ribosomal protein S4                           181   8e-53   Medicago truncatula
ref|NP_001288485.1|  40S ribosomal protein S4-like                      181   8e-53   Zea mays [maize]
gb|AAT38019.1|  putative 40S ribosomal protein S4                       179   1e-52   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001055342.1|  Os05g0368300                                       180   1e-52   
gb|AAS48726.1|  ribosomal protein S4                                    179   2e-52   Zea mays [maize]
ref|XP_007141735.1|  hypothetical protein PHAVU_008G221000g             179   2e-52   Phaseolus vulgaris [French bean]
gb|EAY97774.1|  hypothetical protein OsI_19685                          179   5e-52   Oryza sativa Indica Group [Indian rice]
gb|EEE63465.1|  hypothetical protein OsJ_18278                          181   2e-51   Oryza sativa Japonica Group [Japonica rice]
gb|AGZ15374.1|  40S ribosomal S4 protein                                175   9e-51   Phaseolus vulgaris [French bean]
gb|ABK21170.1|  unknown                                                 174   3e-50   Picea sitchensis
gb|ABK22322.1|  unknown                                                 173   5e-50   Picea sitchensis
gb|EMT14698.1|  40S ribosomal protein S4                                172   8e-50   
dbj|BAN18311.1|  40S ribosomal protein S4                               166   5e-49   Schiedea jacobii
dbj|BAN18292.1|  40S ribosomal protein S4                               166   6e-49   Schiedea spergulina
dbj|BAN18309.1|  40S ribosomal protein S4                               166   7e-49   Schiedea helleri
dbj|BAN18315.1|  40S ribosomal protein S4                               166   8e-49   Schiedea stellarioides
ref|XP_001759850.1|  predicted protein                                  169   2e-48   
ref|XP_001780588.1|  predicted protein                                  169   2e-48   
gb|ADW09573.1|  putative 40S ribosomal protein S4-like protein          164   4e-48   Schiedea stellarioides
ref|XP_001759591.1|  predicted protein                                  167   1e-47   
ref|XP_001751877.1|  predicted protein                                  167   2e-47   
ref|XP_002984314.1|  hypothetical protein SELMODRAFT_271698             166   2e-47   Selaginella moellendorffii
gb|ADW09574.1|  putative 40S ribosomal protein S4-like protein          162   2e-47   Schiedea stellarioides
gb|ADK97882.1|  40S ribosomal protein S4-like protein                   162   2e-47   Schiedea globosa
ref|XP_002972484.1|  hypothetical protein SELMODRAFT_148442             166   2e-47   Selaginella moellendorffii
gb|ADK97878.1|  40S ribosomal protein S4-like protein                   162   3e-47   Schiedea globosa
gb|ADK97883.1|  40S ribosomal protein S4-like protein                   161   4e-47   Schiedea globosa
ref|XP_001766039.1|  predicted protein                                  166   6e-47   
ref|XP_001785339.1|  predicted protein                                  164   1e-46   
gb|KFK40122.1|  hypothetical protein AALP_AA3G333200                    162   2e-46   Arabis alpina [alpine rockcress]
gb|ABQ18253.1|  ribosomal protein S4e                                   161   2e-45   Lygus lineolaris
gb|ABD98758.1|  putative ribosomal protein S4e                          159   2e-44   Graphocephala atropunctata
ref|XP_004526806.1|  PREDICTED: 40S ribosomal protein S4-like           158   3e-44   Ceratitis capitata [medfly]
ref|XP_011212693.1|  PREDICTED: 40S ribosomal protein S4                158   3e-44   Bactrocera dorsalis [papaya fruit fly]
ref|XP_005189699.1|  PREDICTED: 40S ribosomal protein S4                157   5e-44   Musca domestica
emb|CAF89132.1|  unnamed protein product                                155   6e-44   Tetraodon nigroviridis
emb|CAF89133.1|  unnamed protein product                                155   7e-44   Tetraodon nigroviridis
ref|XP_001985577.1|  GH17143                                            157   9e-44   Drosophila grimshawi
ref|XP_002008552.1|  GI11752                                            156   1e-43   Drosophila mojavensis
ref|XP_002047468.1|  GJ13462                                            156   2e-43   Drosophila virilis
dbj|BAA03786.1|  ribosomal protein S4                                   156   2e-43   Drosophila melanogaster
ref|XP_001972620.1|  GG15623                                            156   2e-43   Drosophila erecta
ref|NP_729871.1|  ribosomal protein S4, isoform A                       156   2e-43   Drosophila melanogaster
ref|XP_002094667.1|  RpS4                                               156   2e-43   Drosophila yakuba
ref|XP_006767373.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    153   3e-43   
emb|CAJ17167.1|  ribosomal protein S4e                                  155   3e-43   Julodis onopordi
ref|XP_005750964.1|  PREDICTED: 40S ribosomal protein S4-like           155   4e-43   Pundamilia nyererei
ref|XP_008433376.1|  PREDICTED: 40S ribosomal protein S4, X isoform     155   5e-43   
ref|XP_003457778.1|  PREDICTED: 40S ribosomal protein S4-like           155   5e-43   Oreochromis niloticus
ref|XP_001353585.1|  GA10883                                            155   6e-43   Drosophila pseudoobscura pseudoobscura
ref|XP_001957453.1|  GF24027                                            155   6e-43   Drosophila ananassae
gb|KDR20779.1|  40S ribosomal protein S4                                155   7e-43   Zootermopsis nevadensis
ref|XP_002062215.1|  GK17425                                            154   7e-43   Drosophila willistoni
ref|XP_008318659.1|  PREDICTED: 40S ribosomal protein S4, X isoform     154   8e-43   
ref|XP_004080003.1|  PREDICTED: 40S ribosomal protein S4, X isoform     154   9e-43   
ref|XP_004573481.1|  PREDICTED: 40S ribosomal protein S4-like           156   9e-43   
gb|ACM41869.1|  40S ribosomal protein S4                                151   1e-42   Epinephelus coioides [estuary cod]
ref|NP_001090472.1|  40S ribosomal protein S4                           154   1e-42   Xenopus laevis [clawed frog]
ref|XP_010010561.1|  PREDICTED: 40S ribosomal protein S4                153   1e-42   Nestor notabilis
ref|XP_008157005.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    154   2e-42   Eptesicus fuscus
gb|AIC59238.1|  RPS4X                                                   152   2e-42   synthetic construct
ref|XP_010189447.1|  PREDICTED: 40S ribosomal protein S4                153   2e-42   Mesitornis unicolor
ref|NP_988912.1|  40S ribosomal protein S4                              154   2e-42   
ref|XP_001365342.1|  PREDICTED: 40S ribosomal protein S4-like           153   2e-42   
emb|CAJ17164.1|  ribosomal protein S4e                                  153   2e-42   
ref|XP_010306572.1|  PREDICTED: 40S ribosomal protein S4                152   2e-42   
ref|XP_005806467.1|  PREDICTED: 40S ribosomal protein S4-like           153   2e-42   
ref|NP_001084941.1|  40S ribosomal protein S4                           153   2e-42   
ref|XP_010747631.1|  PREDICTED: 40S ribosomal protein S4, X isoform     153   2e-42   
dbj|BAN20754.1|  ribosomal protein S4                                   153   2e-42   
ref|XP_009330287.1|  PREDICTED: 40S ribosomal protein S4, X isoform     153   2e-42   
ref|XP_010202370.1|  PREDICTED: 40S ribosomal protein S4                152   2e-42   
ref|XP_006124705.1|  PREDICTED: 40S ribosomal protein S4-like           153   2e-42   
ref|XP_003966899.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    153   3e-42   
ref|XP_003766510.1|  PREDICTED: 40S ribosomal protein S4-like iso...    153   3e-42   
ref|XP_969262.1|  PREDICTED: 40S ribosomal protein S4                   153   3e-42   
ref|XP_005147776.1|  PREDICTED: 40S ribosomal protein S4-like iso...    153   3e-42   
ref|NP_001187069.1|  40S ribosomal protein S4                           153   3e-42   
ref|XP_009480425.1|  PREDICTED: 40S ribosomal protein S4                152   3e-42   
gb|EMP39148.1|  40S ribosomal protein S4                                152   3e-42   
ref|XP_010140642.1|  PREDICTED: 40S ribosomal protein S4                153   3e-42   
ref|XP_009881746.1|  PREDICTED: 40S ribosomal protein S4, X isoform     152   3e-42   
ref|XP_009557978.1|  PREDICTED: 40S ribosomal protein S4, X isoform     152   3e-42   
ref|XP_009074657.1|  PREDICTED: 40S ribosomal protein S4                152   3e-42   
ref|XP_009705067.1|  PREDICTED: 40S ribosomal protein S4                152   3e-42   
ref|XP_004685634.1|  PREDICTED: 40S ribosomal protein S4, X isoform     152   3e-42   
ref|XP_005428838.1|  PREDICTED: 40S ribosomal protein S4-like           152   3e-42   
ref|XP_008919034.1|  PREDICTED: 40S ribosomal protein S4, X isoform     152   3e-42   
ref|XP_008945582.1|  PREDICTED: 40S ribosomal protein S4                152   3e-42   
ref|XP_009644675.1|  PREDICTED: 40S ribosomal protein S4, X isoform     152   3e-42   
ref|XP_007242077.1|  PREDICTED: 40S ribosomal protein S4-like           153   3e-42   
gb|ELK27547.1|  40S ribosomal protein S4                                154   3e-42   
gb|ERE63485.1|  40S ribosomal protein S4                                152   3e-42   
gb|ELK15681.1|  40S ribosomal protein S4                                152   4e-42   
ref|XP_009923536.1|  PREDICTED: 40S ribosomal protein S4                152   4e-42   
ref|XP_008558436.1|  PREDICTED: 40S ribosomal protein S4                152   4e-42   
ref|XP_008498268.1|  PREDICTED: 40S ribosomal protein S4, X isoform     153   4e-42   
gb|EDL12419.1|  mCG124430                                               152   4e-42   
ref|XP_007955750.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    152   4e-42   
ref|XP_008639287.1|  PREDICTED: 40S ribosomal protein S4, X isoform     152   4e-42   
ref|XP_008554239.1|  PREDICTED: 40S ribosomal protein S4 isoform X2     152   4e-42   
ref|XP_002432788.1|  40S ribosomal protein S4, putative                 152   5e-42   
gb|EPY74423.1|  40S ribosomal protein S4                                152   5e-42   
ref|XP_009866762.1|  PREDICTED: 40S ribosomal protein S4                152   5e-42   
ref|XP_009233255.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    152   5e-42   
gb|EOA93329.1|  40S ribosomal protein S4                                152   5e-42   
gb|AAH07308.2|  RPS4X protein                                           152   5e-42   
ref|XP_007185527.1|  PREDICTED: 40S ribosomal protein S4-like           152   5e-42   
ref|NP_001233602.1|  40S ribosomal protein S4                           152   5e-42   
ref|XP_010565368.1|  PREDICTED: 40S ribosomal protein S4, X isoform     152   5e-42   
dbj|BAE22507.1|  unnamed protein product                                152   5e-42   
ref|XP_002749534.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    152   5e-42   
ref|XP_005313893.1|  PREDICTED: 40S ribosomal protein S4 isoform X1     152   5e-42   
sp|Q56FH2.1|RS4_LYSTE  RecName: Full=40S ribosomal protein S4           152   5e-42   
ref|NP_001232240.1|  putative ribosomal protein S4                      152   5e-42   
ref|XP_009902618.1|  PREDICTED: 40S ribosomal protein S4, X isoform     152   5e-42   
ref|XP_010330703.1|  PREDICTED: 40S ribosomal protein S4, X isoform     152   5e-42   
ref|XP_006865002.1|  PREDICTED: 40S ribosomal protein S4-like           152   6e-42   
ref|XP_005313894.1|  PREDICTED: 40S ribosomal protein S4 isoform X2     152   6e-42   
gb|AAA36597.1|  scar protein                                            152   6e-42   
ref|XP_006193300.1|  PREDICTED: 40S ribosomal protein S4, X isoform     152   6e-42   
ref|XP_010216162.1|  PREDICTED: 40S ribosomal protein S4, X isoform     152   6e-42   
ref|XP_010001756.1|  PREDICTED: 40S ribosomal protein S4, X isoform     152   6e-42   
ref|XP_009282877.1|  PREDICTED: 40S ribosomal protein S4, X isoform     153   6e-42   
ref|XP_007433627.1|  PREDICTED: 40S ribosomal protein S4-like           152   6e-42   
ref|XP_006873465.1|  PREDICTED: 40S ribosomal protein S4, X isoform     152   6e-42   
ref|XP_002708125.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    152   6e-42   
ref|XP_010078274.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    150   6e-42   
ref|XP_006025231.1|  PREDICTED: 40S ribosomal protein S4-like           153   7e-42   
ref|XP_006908610.1|  PREDICTED: 40S ribosomal protein S4-like           152   7e-42   
ref|XP_009463285.1|  PREDICTED: 40S ribosomal protein S4, X isoform     153   7e-42   
ref|XP_008300595.1|  PREDICTED: 40S ribosomal protein S4 isoform X2     152   7e-42   
ref|XP_008554238.1|  PREDICTED: 40S ribosomal protein S4 isoform X1     152   7e-42   
ref|XP_011380547.1|  PREDICTED: 40S ribosomal protein S4-like           152   7e-42   
ref|XP_009682020.1|  PREDICTED: 40S ribosomal protein S4, X isoform     152   8e-42   
ref|XP_010149384.1|  PREDICTED: 40S ribosomal protein S4                150   8e-42   
ref|XP_006885447.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    151   8e-42   
ref|XP_010989591.1|  PREDICTED: 40S ribosomal protein S4, X isoform     152   8e-42   
ref|NP_990439.1|  40S ribosomal protein S4                              152   8e-42   
ref|XP_005974427.1|  PREDICTED: 40S ribosomal protein S4-like           152   8e-42   
ref|XP_004396498.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    152   9e-42   
ref|XP_006910196.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    152   9e-42   
ref|XP_003803397.1|  PREDICTED: 40S ribosomal protein S4, X isoform     152   9e-42   
ref|XP_009002753.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    152   9e-42   
ref|XP_003228681.1|  PREDICTED: 40S ribosomal protein S4                152   9e-42   
gb|ETE69702.1|  40S ribosomal protein S4                                152   9e-42   
dbj|BAB29207.1|  unnamed protein product                                152   9e-42   
gb|ELW69939.1|  40S ribosomal protein S4                                151   9e-42   
ref|XP_004887479.1|  PREDICTED: 40S ribosomal protein S4-like iso...    152   9e-42   
gb|ELU11454.1|  hypothetical protein CAPTEDRAFT_152725                  152   9e-42   
gb|EFB14527.1|  hypothetical protein PANDA_015068                       152   9e-42   
ref|NP_001075891.1|  40S ribosomal protein S4                           152   9e-42   
ref|XP_006888343.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    152   9e-42   
ref|NP_000998.1|  40S ribosomal protein S4, X isoform X isoform         152   9e-42   
ref|XP_005030976.1|  PREDICTED: 40S ribosomal protein S4-like           152   9e-42   
ref|XP_010372927.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    152   9e-42   
ref|XP_004394286.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    152   9e-42   
ref|XP_004887478.1|  PREDICTED: 40S ribosomal protein S4-like iso...    152   1e-41   
ref|XP_008069053.1|  PREDICTED: 40S ribosomal protein S4, X isoform     152   1e-41   
ref|XP_005403497.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    152   1e-41   
gb|AAB01670.1|  ribosomal protein S4                                    152   1e-41   
ref|XP_004660965.1|  PREDICTED: 40S ribosomal protein S4, X isoform     151   1e-41   
ref|XP_003472052.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    152   1e-41   
dbj|BAD96199.1|  ribosomal protein S4, X-linked X isoform variant       152   1e-41   
ref|XP_002752965.2|  PREDICTED: 40S ribosomal protein S4, X isofo...    152   1e-41   
ref|XP_007169373.1|  PREDICTED: 40S ribosomal protein S4-like           152   1e-41   
ref|XP_006082927.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    152   1e-41   
gb|AFM90857.1|  40S ribosomal protein S4                                152   1e-41   
ref|XP_005435883.1|  PREDICTED: 40S ribosomal protein S4-like           153   1e-41   
ref|XP_008300594.1|  PREDICTED: 40S ribosomal protein S4 isoform X1     152   1e-41   
ref|XP_007528658.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    152   1e-41   
ref|XP_008054194.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    151   1e-41   
gb|EDL27273.1|  mCG127176                                               151   1e-41   
ref|NP_001028159.1|  40S ribosomal protein S4, X isoform                151   1e-41   
dbj|BAF45892.1|  ribosomal protein S4                                   151   1e-41   
ref|XP_004887477.1|  PREDICTED: 40S ribosomal protein S4-like iso...    152   1e-41   
emb|CAM34499.1|  putative ribosomal protein S4                          151   1e-41   
ref|XP_003764080.1|  PREDICTED: 40S ribosomal protein S4, Y isofo...    151   1e-41   
emb|CAJ17169.1|  ribosomal protein S4e                                  151   1e-41   
ref|XP_006923115.1|  PREDICTED: 40S ribosomal protein S4-like iso...    151   1e-41   
ref|NP_001005589.1|  40S ribosomal protein S4, X isoform                151   1e-41   
gb|KFO21995.1|  40S ribosomal protein S4                                150   1e-41   
ref|XP_005992934.1|  PREDICTED: 40S ribosomal protein S4-like           151   2e-41   
gb|AFM86071.1|  40S ribosomal protein S4                                151   2e-41   
ref|XP_010078273.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    150   2e-41   
ref|XP_004327034.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    151   2e-41   
gb|AFM87151.1|  40S ribosomal protein S4                                151   2e-41   
ref|XP_006926381.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    151   2e-41   
ref|XP_009930575.1|  PREDICTED: 40S ribosomal protein S4, X isoform     150   2e-41   
ref|XP_005885533.1|  PREDICTED: 40S ribosomal protein S4, X isoform     151   2e-41   
gb|AFM86034.1|  40S ribosomal protein S4                                151   2e-41   
sp|Q95V34.1|RS4_SPOFR  RecName: Full=40S ribosomal protein S4           151   2e-41   
gb|AER42698.1|  40S ribosomal protein S4                                151   2e-41   
ref|XP_007173623.1|  PREDICTED: 40S ribosomal protein S4-like           148   2e-41   
gb|AFM89946.1|  40S ribosomal protein S4                                151   2e-41   
gb|AFM87393.1|  40S ribosomal protein S4                                151   2e-41   
sp|Q4GXU6.1|RS4_CARGR  RecName: Full=40S ribosomal protein S4           151   2e-41   
gb|AFM86794.1|  40S ribosomal protein S4                                151   2e-41   
gb|AFM88708.1|  40S ribosomal protein S4                                151   2e-41   
ref|XP_009204777.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    151   2e-41   
ref|XP_003898985.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    151   2e-41   
ref|XP_004715961.1|  PREDICTED: 40S ribosomal protein S4, X isoform     152   2e-41   
gb|EGW14036.1|  40S ribosomal protein S4                                152   2e-41   
ref|XP_006877763.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    151   2e-41   
gb|AFM89018.1|  40S ribosomal protein S4                                151   2e-41   
ref|XP_004605913.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    151   2e-41   
ref|XP_007889271.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    151   2e-41   
ref|XP_006632866.1|  PREDICTED: 40S ribosomal protein S4-like           151   2e-41   
ref|XP_002175438.1|  40S ribosomal protein S4                           150   2e-41   
gb|AFM85695.1|  40S ribosomal protein S4                                150   2e-41   
gb|AFM87833.1|  40S ribosomal protein S4                                150   2e-41   
gb|EFN89201.1|  40S ribosomal protein S4                                149   2e-41   
ref|XP_006806979.1|  PREDICTED: 40S ribosomal protein S4-like           150   2e-41   
ref|XP_011153375.1|  PREDICTED: 40S ribosomal protein S4                150   3e-41   
ref|XP_004679117.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    150   3e-41   
ref|XP_004668818.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    148   3e-41   
dbj|BAM17680.1|  ribosomal protein S4                                   150   3e-41   
ref|XP_003775056.1|  PREDICTED: 40S ribosomal protein S4, X isoform     151   3e-41   
gb|AFM90738.1|  40S ribosomal protein S4                                150   3e-41   
ref|XP_010606265.1|  PREDICTED: 40S ribosomal protein S4, X isoform     150   3e-41   
emb|CAF90008.1|  unnamed protein product                                150   3e-41   
ref|XP_003471039.1|  PREDICTED: 40S ribosomal protein S4, X isoform     150   3e-41   
gb|EHJ69651.1|  40S ribosomal protein S4                                150   3e-41   
gb|ADT80676.1|  ribosomal protein S4                                    150   4e-41   
tpg|DAA26280.1|  TPA: ribosomal protein S4, X-linked X-like             150   4e-41   
ref|XP_011503007.1|  PREDICTED: 40S ribosomal protein S4                150   4e-41   
gb|ACY71283.1|  ribosomal protein S4                                    150   4e-41   
ref|XP_006199437.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    150   4e-41   
ref|XP_005898249.1|  PREDICTED: 40S ribosomal protein S4-like           150   4e-41   
ref|XP_004758473.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    150   4e-41   
ref|XP_001094914.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    150   4e-41   
gb|AFM89445.1|  40S ribosomal protein S4                                150   4e-41   
tpg|DAA27762.1|  TPA: ribosomal protein S4, X-linked X-like             150   4e-41   
gb|ADG29131.1|  40S ribosomal protein S4                                150   4e-41   
gb|AFM90740.1|  40S ribosomal protein S4                                150   4e-41   
ref|XP_005199960.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    150   4e-41   
ref|XP_010798474.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    150   5e-41   
ref|XP_005228099.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    150   5e-41   
ref|XP_010854947.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    150   5e-41   
ref|NP_001037257.1|  40S ribosomal protein S4                           150   5e-41   
ref|XP_006275921.1|  PREDICTED: 40S ribosomal protein S4-like           152   6e-41   
ref|NP_001028160.1|  40S ribosomal protein S4, Y isoform 1              150   6e-41   
ref|XP_004798077.1|  PREDICTED: 40S ribosomal protein S4-like           150   6e-41   
gb|AFM87450.1|  40S ribosomal protein S4                                149   6e-41   
gb|EHB08523.1|  40S ribosomal protein S4                                149   6e-41   
ref|XP_005701142.1|  PREDICTED: 40S ribosomal protein S4-like           149   7e-41   
gb|AFM90836.1|  40S ribosomal protein S4                                149   7e-41   
gb|EHH60989.1|  Single copy abundant mRNA protein                       149   7e-41   
ref|XP_008999395.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    149   7e-41   
ref|XP_005700707.1|  PREDICTED: 40S ribosomal protein S4-like           149   7e-41   
gb|AFM90173.1|  40S ribosomal protein S4                                149   7e-41   
gb|AFM88094.1|  40S ribosomal protein S4                                149   7e-41   
ref|XP_002714210.1|  PREDICTED: 40S ribosomal protein S4-like           149   8e-41   
ref|XP_010840576.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    150   8e-41   
ref|XP_006899825.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    149   9e-41   
gb|EKC32468.1|  40S ribosomal protein S4, X isoform                     149   9e-41   
ref|XP_005964326.1|  PREDICTED: 40S ribosomal protein S4-like iso...    149   9e-41   
ref|XP_005561444.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    149   9e-41   
ref|XP_004581137.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    149   9e-41   
prf||1617101C  ribosomal protein S4                                     149   9e-41
ref|XP_009251197.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    149   9e-41   
ref|XP_005236846.1|  PREDICTED: 40S ribosomal protein S4-like           151   1e-40   
emb|CAJ17168.1|  ribosomal protein S4e                                  149   1e-40   
ref|XP_010360955.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    149   1e-40   
gb|EAW71815.1|  ribosomal protein S4, X-linked, isoform CRA_a           152   1e-40   
ref|XP_011433431.1|  PREDICTED: 40S ribosomal protein S4-like           149   1e-40   
ref|XP_011330723.1|  PREDICTED: 40S ribosomal protein S4                149   1e-40   
ref|XP_005889381.1|  PREDICTED: 40S ribosomal protein S4-like           149   1e-40   
gb|ACY95325.1|  ribosomal protein S4                                    149   1e-40   
ref|XP_004643498.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    149   1e-40   
ref|XP_005900947.1|  PREDICTED: 40S ribosomal protein S4-like           149   1e-40   
ref|XP_009439348.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    151   1e-40   
gb|ELR61037.1|  hypothetical protein M91_01196                          149   1e-40   
ref|XP_003204899.1|  PREDICTED: 40S ribosomal protein S4-like           149   1e-40   
ref|XP_005512238.1|  PREDICTED: uncharacterized protein LOC102091224    153   1e-40   
ref|XP_005965959.1|  PREDICTED: 40S ribosomal protein S4-like           149   1e-40   
gb|EMS68941.1|  40S ribosomal protein S4                                149   1e-40   
ref|XP_006876642.1|  PREDICTED: 40S ribosomal protein S4-like           149   1e-40   
ref|XP_010843737.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    149   1e-40   
ref|XP_011144347.1|  PREDICTED: 40S ribosomal protein S4-like           149   1e-40   
ref|XP_005894604.1|  PREDICTED: 40S ribosomal protein S4-like           149   1e-40   
ref|XP_004777312.1|  PREDICTED: 40S ribosomal protein S4-like           149   1e-40   
ref|XP_004893287.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    149   2e-40   



>ref|XP_009794044.1| PREDICTED: 40S ribosomal protein S4-like [Nicotiana sylvestris]
Length=264

 Score =   210 bits (534),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRDEE KFKLCKVRS QFG KGIP++ TYDGRTIRYPDPLIK ND +KLDLESNK+VDFI
Sbjct  114  IRDEEAKFKLCKVRSIQFGSKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE VHIQDA GHE  TRLGN F +GKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETVHIQDALGHEFATRLGNVFTLGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQXXTTA  76
              V  PKGKGIKLSI EEA+KRLAAQ  TTA
Sbjct  234  PWVSLPKGKGIKLSIIEEARKRLAAQSATTA  264



>ref|XP_009597091.1| PREDICTED: 40S ribosomal protein S4-like [Nicotiana tomentosiformis]
Length=264

 Score =   209 bits (533),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            +RDEE KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLESNK+VDFI
Sbjct  114  VRDEEAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE VHIQDA GHE  TRLGN F +GKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETVHIQDALGHEFATRLGNVFTLGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQXXTTA  76
              V  PKGKGIKLSI EEA+KRLAAQ  TTA
Sbjct  234  PWVSLPKGKGIKLSIIEEARKRLAAQSATTA  264



>ref|XP_009595443.1| PREDICTED: 40S ribosomal protein S4-like [Nicotiana tomentosiformis]
Length=264

 Score =   209 bits (533),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRDEE KFKLCKVRS QFG KGIP++ TYDGRTIRYPDPLIK ND +KLDLESNK+VDFI
Sbjct  114  IRDEEAKFKLCKVRSIQFGTKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE VHIQDA GHE  TRLGN F +GKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETVHIQDALGHEFATRLGNVFTLGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQXXTTA  76
              V  PKGKGIKLSI EEA+KRLAAQ  TTA
Sbjct  234  PWVSLPKGKGIKLSIIEEARKRLAAQSATTA  264



>ref|XP_009784493.1| PREDICTED: 40S ribosomal protein S4-like [Nicotiana sylvestris]
Length=264

 Score =   209 bits (532),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            +RDEE KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLESNK+VDFI
Sbjct  114  VRDEEAKFKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE VHIQDA GHE  TRLGN F +GKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETVHIQDALGHEFATRLGNVFTLGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQXXTTA  76
              V  PKGKGIKLSI EEA+KRLAAQ  TTA
Sbjct  234  PWVSLPKGKGIKLSIIEEARKRLAAQSATTA  264



>ref|XP_004148191.1| PREDICTED: 40S ribosomal protein S4-like [Cucumis sativus]
Length=216

 Score =   207 bits (528),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRDEE KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLESNK+ DFI
Sbjct  66   IRDEEAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIADFI  125

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +HIQDATGHE  TRLGN F IGKG K
Sbjct  126  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDATGHEFATRLGNVFTIGKGTK  185

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQXXTTA  76
              V  PKGKGIKL+I EEA+KRLA+Q   TA
Sbjct  186  PWVSLPKGKGIKLTIIEEARKRLASQSAVTA  216



>ref|XP_011097305.1| PREDICTED: 40S ribosomal protein S4-like [Sesamum indicum]
Length=263

 Score =   209 bits (532),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 122/150 (81%), Positives = 128/150 (85%), Gaps = 0/150 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRDEE KFKLCKVRS QFGKKGIP++ TYDGRTIRYPDPLIK ND +KLDLESNK+VDFI
Sbjct  114  IRDEEAKFKLCKVRSVQFGKKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +HIQDATGHE  TRLGN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDATGHEFATRLGNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQXXTT  79
              V  PKGKGIKLSI EEA+KRLAAQ  T 
Sbjct  234  PWVSLPKGKGIKLSIIEEARKRLAAQSATA  263



>ref|XP_011084586.1| PREDICTED: 40S ribosomal protein S4 [Sesamum indicum]
 ref|XP_011095064.1| PREDICTED: 40S ribosomal protein S4 [Sesamum indicum]
Length=263

 Score =   209 bits (531),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 122/150 (81%), Positives = 128/150 (85%), Gaps = 0/150 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRDEE KFKLCKVRS QFGKKGIP++ TYDGRTIRYPDPLIK ND +KLDLESNK+VDFI
Sbjct  114  IRDEEAKFKLCKVRSVQFGKKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +HIQDATGHE  TRLGN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDATGHEFATRLGNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQXXTT  79
              V  PKGKGIKLSI EEA+KRLAAQ  T 
Sbjct  234  PWVSLPKGKGIKLSIIEEARKRLAAQSATA  263



>ref|XP_009609731.1| PREDICTED: 40S ribosomal protein S4-like [Nicotiana tomentosiformis]
 ref|XP_009764136.1| PREDICTED: 40S ribosomal protein S4-like [Nicotiana sylvestris]
Length=264

 Score =   208 bits (530),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            +RDEE KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLE+NK+VDFI
Sbjct  114  VRDEEAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLENNKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE VHIQDA GHE  TRLGN F +GKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETVHIQDAQGHEFATRLGNVFTLGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQXXTTA  76
              V  PKGKGIKLSI EEA+KRLAAQ  TTA
Sbjct  234  PWVSLPKGKGIKLSIIEEARKRLAAQSATTA  264



>gb|KHN10552.1| 40S ribosomal protein S4 [Glycine soja]
Length=199

 Score =   206 bits (524),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            +RDEE KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLESNK+ DFI
Sbjct  49   VRDEESKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKITDFI  108

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +H+QDATGHE  TR+GN F IGKG K
Sbjct  109  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHVQDATGHEFATRMGNVFIIGKGTK  168

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQXXTTA  76
              V  PKGKGIKLSI EEA+KRLAAQ  T A
Sbjct  169  PWVSLPKGKGIKLSIIEEARKRLAAQNETVA  199



>ref|XP_009600336.1| PREDICTED: 40S ribosomal protein S4 [Nicotiana tomentosiformis]
Length=264

 Score =   207 bits (528),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            +RDEE KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLESNK+VDFI
Sbjct  114  LRDEEAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE VHIQDA GHE  TRLGN F +GKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETVHIQDALGHEFATRLGNVFTLGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQXXTTA  76
              V  PKGKGIKLSI EEA+KRLAAQ  T A
Sbjct  234  PWVSLPKGKGIKLSIIEEARKRLAAQSATAA  264



>ref|XP_009766580.1| PREDICTED: 40S ribosomal protein S4 [Nicotiana sylvestris]
Length=264

 Score =   207 bits (527),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            +RDEE KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLESNK+VDFI
Sbjct  114  LRDEEAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE VHIQDA GHE  TRLGN F +GKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETVHIQDALGHEFATRLGNVFTLGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQXXTTA  76
              V  PKGKGIKLSI EEA+KRLAAQ  T A
Sbjct  234  PWVSLPKGKGIKLSIIEEARKRLAAQSATAA  264



>emb|CBI25428.3| unnamed protein product [Vitis vinifera]
Length=246

 Score =   206 bits (525),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            +RDEE KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLESNK+ DFI
Sbjct  96   VRDEEAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKITDFI  155

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKG+FE +HIQDATGHE  TRLGN F IGKG K
Sbjct  156  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGTFETIHIQDATGHEFATRLGNVFIIGKGTK  215

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQXXTTA  76
              V  PKGKGIKLSI EEAKKRLAAQ  ++A
Sbjct  216  PWVSLPKGKGIKLSIIEEAKKRLAAQAASSA  246



>gb|KHN03095.1| 40S ribosomal protein S4 [Glycine soja]
Length=246

 Score =   206 bits (525),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            +RDEE KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND VKLDLESNK+ DFI
Sbjct  96   VRDEESKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTVKLDLESNKITDFI  155

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +H+QDATGHE  TR+GN F IGKG K
Sbjct  156  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHVQDATGHEFATRMGNVFIIGKGTK  215

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQXXTTA  76
              V  PKGKGIKLSI EEA+KRLAAQ  T A
Sbjct  216  PWVSLPKGKGIKLSIIEEARKRLAAQKETVA  246



>ref|XP_004163526.1| PREDICTED: 40S ribosomal protein S4-like [Cucumis sativus]
 gb|KGN50688.1| hypothetical protein Csa_5G212590 [Cucumis sativus]
 gb|KGN50692.1| hypothetical protein Csa_5G215120 [Cucumis sativus]
Length=264

 Score =   207 bits (526),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRDEE KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLESNK+ DFI
Sbjct  114  IRDEEAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIADFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +HIQDATGHE  TRLGN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDATGHEFATRLGNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQXXTTA  76
              V  PKGKGIKL+I EEA+KRLA+Q   TA
Sbjct  234  PWVSLPKGKGIKLTIIEEARKRLASQSAVTA  264



>ref|XP_006576177.1| PREDICTED: uncharacterized protein LOC100500000 isoform X2 [Glycine 
max]
Length=248

 Score =   206 bits (525),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            +RDEE KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLESNK+ DFI
Sbjct  98   VRDEESKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKITDFI  157

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +H+QDATGHE  TR+GN F IGKG K
Sbjct  158  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHVQDATGHEFATRMGNVFIIGKGTK  217

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQXXTTA  76
              V  PKGKGIKLSI EEA+KRLAAQ  T A
Sbjct  218  PWVSLPKGKGIKLSIIEEARKRLAAQKETVA  248



>ref|XP_008454823.1| PREDICTED: 40S ribosomal protein S4-3 [Cucumis melo]
 ref|XP_008454824.1| PREDICTED: 40S ribosomal protein S4-3 [Cucumis melo]
Length=264

 Score =   207 bits (526),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRDEE KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLESNK+ DFI
Sbjct  114  IRDEEAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIADFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +HIQDATGHE  TRLGN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDATGHEFATRLGNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQXXTTA  76
              V  PKGKGIKL+I EEA+KRLA+Q   TA
Sbjct  234  PWVSLPKGKGIKLTIIEEARKRLASQAAVTA  264



>ref|XP_002276986.1| PREDICTED: 40S ribosomal protein S4-1 [Vitis vinifera]
Length=264

 Score =   207 bits (526),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            +RDEE KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLESNK+ DFI
Sbjct  114  VRDEEAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKITDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKG+FE +HIQDATGHE  TRLGN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGTFETIHIQDATGHEFATRLGNVFIIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQXXTTA  76
              V  PKGKGIKLSI EEAKKRLAAQ  ++A
Sbjct  234  PWVSLPKGKGIKLSIIEEAKKRLAAQAASSA  264



>emb|CDP06439.1| unnamed protein product [Coffea canephora]
Length=246

 Score =   206 bits (524),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRDEE KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLESNK+ DFI
Sbjct  96   IRDEEAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKITDFI  155

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +H+QDATGHE  TRLGN F IGKG K
Sbjct  156  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHVQDATGHEFATRLGNVFIIGKGAK  215

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQXXTTA  76
              V  PKGKGIKLS+ EE +KR+AAQ  TTA
Sbjct  216  PWVSLPKGKGIKLSVIEEQRKRIAAQAATTA  246



>ref|XP_003516980.1| PREDICTED: 40S ribosomal protein S4 [Glycine max]
Length=264

 Score =   206 bits (524),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            +RDEE KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLESNK+ DFI
Sbjct  114  VRDEESKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKITDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +H+QDATGHE  TR+GN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHVQDATGHEFATRMGNVFIIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQXXTTA  76
              V  PKGKGIKLSI EEA+KRLAAQ  T A
Sbjct  234  PWVSLPKGKGIKLSIIEEARKRLAAQNETVA  264



>ref|XP_006576176.1| PREDICTED: uncharacterized protein LOC100500000 isoform X1 [Glycine 
max]
Length=264

 Score =   206 bits (524),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            +RDEE KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLESNK+ DFI
Sbjct  114  VRDEESKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKITDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +H+QDATGHE  TR+GN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHVQDATGHEFATRMGNVFIIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQXXTTA  76
              V  PKGKGIKLSI EEA+KRLAAQ  T A
Sbjct  234  PWVSLPKGKGIKLSIIEEARKRLAAQKETVA  264



>ref|XP_008461463.1| PREDICTED: 40S ribosomal protein S4-3-like [Cucumis melo]
Length=264

 Score =   206 bits (524),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            +RDEE K+KLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLESNK+ DFI
Sbjct  114  VRDEEAKYKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIADFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +HIQDATGHE  TRLGN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDATGHEFATRLGNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQXXTTA  76
              V  PKGKGIKLSI EEA+KRLA+Q   TA
Sbjct  234  PWVSVPKGKGIKLSIIEEARKRLASQAAVTA  264



>gb|ACU24295.1| unknown [Glycine max]
Length=264

 Score =   206 bits (523),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRD+E KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLI+ ND VKLDLE NK+VDFI
Sbjct  114  IRDDEAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIRANDTVKLDLEENKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +H+QDATGHE  TR+GN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHVQDATGHEFATRMGNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQXXTTA  76
              +  PKGKGIKLSI EEA+KR+AAQ  TTA
Sbjct  234  PWISLPKGKGIKLSIIEEARKRIAAQQATTA  264



>ref|XP_004150395.1| PREDICTED: 40S ribosomal protein S4-like [Cucumis sativus]
 ref|XP_004160252.1| PREDICTED: 40S ribosomal protein S4-like [Cucumis sativus]
Length=264

 Score =   206 bits (523),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            +RDEE K+KLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLESNK+ DFI
Sbjct  114  VRDEEAKYKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIADFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +HIQDATGHE  TRLGN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDATGHEFATRLGNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQXXTTA  76
              V  PKGKGIKLSI EEA+KRLA+Q   TA
Sbjct  234  PWVSLPKGKGIKLSIIEEARKRLASQATVTA  264



>ref|XP_003544057.1| PREDICTED: 40S ribosomal protein S4-1 [Glycine max]
Length=264

 Score =   206 bits (523),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRD+E KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLI+ ND VKLDLE NK+VDFI
Sbjct  114  IRDDEAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIRANDTVKLDLEENKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +H+QDATGHE  TR+GN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHVQDATGHEFATRMGNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQXXTTA  76
              +  PKGKGIKLSI EEA+KR+AAQ  TTA
Sbjct  234  PWISLPKGKGIKLSIIEEARKRIAAQQATTA  264



>ref|XP_004150397.1| PREDICTED: 40S ribosomal protein S4-like [Cucumis sativus]
 ref|XP_004160251.1| PREDICTED: 40S ribosomal protein S4-like [Cucumis sativus]
 gb|KGN44413.1| hypothetical protein Csa_7G282410 [Cucumis sativus]
Length=264

 Score =   206 bits (523),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            +RDEE K+KLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLESNK+ DFI
Sbjct  114  VRDEEAKYKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIADFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +HIQDATGHE  TRLGN F +GKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDATGHEFATRLGNVFTVGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQXXTTA  76
              V  PKGKGIKLSI EEA+KRLA+Q   TA
Sbjct  234  PWVSLPKGKGIKLSIIEEARKRLASQAAVTA  264



>ref|XP_010087529.1| 40S ribosomal protein S4 [Morus notabilis]
 gb|EXB29260.1| 40S ribosomal protein S4 [Morus notabilis]
Length=318

 Score =   207 bits (526),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRD+E KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLESNK+ DFI
Sbjct  168  IRDDEAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKITDFI  227

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKG+FE +H+QDATGHE  TRLGN F IGKG K
Sbjct  228  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGTFETIHVQDATGHEFATRLGNVFTIGKGTK  287

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQXXTTA  76
              +  PKGKGIKLSI EEAKKRLAAQ  +TA
Sbjct  288  PWLSLPKGKGIKLSIIEEAKKRLAAQAASTA  318



>ref|XP_002268192.1| PREDICTED: 40S ribosomal protein S4-3-like [Vitis vinifera]
Length=264

 Score =   205 bits (521),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRDEE KFKLCKV+  QFG+KGIP++ TYDGRTIRYPDPLIK ND VKLDLESNK+VDFI
Sbjct  114  IRDEEAKFKLCKVKGVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTVKLDLESNKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIK+REKHKG+FE +H+QDATGHE  TRLGN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKSREKHKGTFETIHVQDATGHEFATRLGNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQXXTTA  76
              V  PKGKGIKLSI EEAKKRLAAQ   TA
Sbjct  234  PWVTLPKGKGIKLSIIEEAKKRLAAQASATA  264



>gb|KCW60005.1| hypothetical protein EUGRSUZ_H02737 [Eucalyptus grandis]
Length=197

 Score =   202 bits (515),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 127/151 (84%), Gaps = 0/151 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRD+E KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND VKLDLE+NK+ DFI
Sbjct  47   IRDDEAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTVKLDLETNKITDFI  106

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKG+FE +H+QD+ GHE  TRLGN + IGKG K
Sbjct  107  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGTFETIHVQDSQGHEFATRLGNVYMIGKGTK  166

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQXXTTA  76
              V  PKGKGIKLSI EEA+KRLAAQ   TA
Sbjct  167  PWVSLPKGKGIKLSIIEEARKRLAAQASATA  197



>ref|XP_004233134.1| PREDICTED: 40S ribosomal protein S4-like [Solanum lycopersicum]
 ref|XP_004233136.1| PREDICTED: 40S ribosomal protein S4-like [Solanum lycopersicum]
 ref|XP_004233137.1| PREDICTED: 40S ribosomal protein S4 [Solanum lycopersicum]
Length=264

 Score =   204 bits (520),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            +RDEE KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDL+SNK+VDFI
Sbjct  114  LRDEEAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLDSNKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVG++KNREKHKGSFE VHIQD+ GHE  TRLGN F +GKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGILKNREKHKGSFETVHIQDSLGHEFATRLGNVFTLGKGSK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQXXTTA  76
              V  PKGKGIKLSI EEA+KR+AAQ  TTA
Sbjct  234  PWVSLPKGKGIKLSIIEEARKRMAAQSATTA  264



>ref|XP_010316939.1| PREDICTED: 40S ribosomal protein S4-like [Solanum lycopersicum]
Length=264

 Score =   204 bits (520),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            +RDEE KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDL+SNK+VDFI
Sbjct  114  LRDEEAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLDSNKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVG++KNREKHKGSFE VHIQD+ GHE  TRLGN F +GKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGILKNREKHKGSFETVHIQDSLGHEFATRLGNVFTLGKGSK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQXXTTA  76
              V  PKGKGIKLSI EEA+KR+AAQ  TTA
Sbjct  234  PWVSLPKGKGIKLSIIEEARKRMAAQSATTA  264



>ref|XP_008233807.1| PREDICTED: 40S ribosomal protein S4-1 [Prunus mume]
Length=264

 Score =   204 bits (520),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 127/151 (84%), Gaps = 0/151 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRDEE KFKLCKVRS QFG+KGIP+I TYDGRTIRYPDPLIK ND +KLDLESNK+ DFI
Sbjct  114  IRDEEAKFKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLESNKITDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +H+QDATGHE  TRL N F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHVQDATGHEFATRLANVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQXXTTA  76
              V  PKGKGIKL+I EEAKKR AAQ  +TA
Sbjct  234  PWVSLPKGKGIKLTIIEEAKKRQAAQQASTA  264



>emb|CBI15899.3| unnamed protein product [Vitis vinifera]
Length=246

 Score =   204 bits (518),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRDEE KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLESNK+ DFI
Sbjct  96   IRDEEAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKITDFI  155

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREK KGSFE +H+QDATGHE  TRLGN F IGKG K
Sbjct  156  KFDVGNVVMVTGGRNRGRVGVIKNREKRKGSFETIHVQDATGHEFATRLGNVFIIGKGTK  215

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQXXTTA  76
              V  PKGKGIKLSI EEA+KRLAAQ  ++A
Sbjct  216  PWVTLPKGKGIKLSIIEEAQKRLAAQAASSA  246



>gb|KCW49428.1| hypothetical protein EUGRSUZ_K02962 [Eucalyptus grandis]
Length=187

 Score =   202 bits (513),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 127/151 (84%), Gaps = 0/151 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRD+E KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDP+IK ND VKLDLE+NK+ DFI
Sbjct  37   IRDDEAKFKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPVIKANDTVKLDLEANKITDFI  96

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKG+FE +HIQDA GHE  TRLGN F IGKG K
Sbjct  97   KFDVGNVVMVTGGRNRGRVGVIKNREKHKGTFETIHIQDAQGHEFATRLGNVFIIGKGTK  156

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQXXTTA  76
              V  PKGKGIKLSI EEA+KRLAAQ   TA
Sbjct  157  PWVSLPKGKGIKLSIIEEARKRLAAQASATA  187



>ref|NP_001275093.1| 40S ribosomal protein S4-like [Solanum tuberosum]
 gb|ABB72798.1| 40S ribosomal protein S4-like protein [Solanum tuberosum]
Length=264

 Score =   204 bits (519),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            +RDEE KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLESNK+VDFI
Sbjct  114  LRDEESKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +HIQD+ GHE  TRLGN F +GKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETLHIQDSQGHEFATRLGNVFTLGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQXXTTA  76
              V  PKGKGIKL+I EEAKKRLAAQ  T A
Sbjct  234  PWVSLPKGKGIKLTIIEEAKKRLAAQSATPA  264



>ref|XP_008461503.1| PREDICTED: 40S ribosomal protein S4-3-like [Cucumis melo]
Length=264

 Score =   204 bits (519),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            +RDEE K+KLCKVRS QFG+KGIP++ T+DGRTIRYPDPLIK ND +KLDLESNK+ DFI
Sbjct  114  VRDEEAKYKLCKVRSVQFGQKGIPYLNTFDGRTIRYPDPLIKANDTIKLDLESNKIADFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +HIQDATGHE  TRLGN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDATGHEFATRLGNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQXXTTA  76
              V  PKGKGIKLSI EEA+KRLA+Q   TA
Sbjct  234  PWVSLPKGKGIKLSIIEEARKRLASQAAVTA  264



>gb|KGN44410.1| hypothetical protein Csa_7G281390 [Cucumis sativus]
Length=264

 Score =   204 bits (519),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 127/151 (84%), Gaps = 0/151 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            +RDEE K+KLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLESNK+ DFI
Sbjct  114  VRDEEAKYKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIADFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKH GSFE +HIQDATGHE  TRLGN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHTGSFETIHIQDATGHEFATRLGNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQXXTTA  76
              V  PKGKGIKLSI EEA+KRLA+Q   TA
Sbjct  234  PWVSLPKGKGIKLSIIEEARKRLASQATVTA  264



>gb|KHN48586.1| 40S ribosomal protein S4-2 [Glycine soja]
Length=264

 Score =   204 bits (518),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRD+E KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLI+ ND VKLDLE N +VDFI
Sbjct  114  IRDDEAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIRANDTVKLDLEENNIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +H+QDATGHE  TR+GN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHVQDATGHEFATRMGNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQXXTTA  76
              +  PKGKGIKLSI EEA+KR+AAQ  TTA
Sbjct  234  PWISLPKGKGIKLSIIEEARKRIAAQQATTA  264



>ref|XP_002275063.1| PREDICTED: 40S ribosomal protein S4 [Vitis vinifera]
Length=264

 Score =   204 bits (518),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRDEE KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLESNK+ DFI
Sbjct  114  IRDEEAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKITDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREK KGSFE +H+QDATGHE  TRLGN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKRKGSFETIHVQDATGHEFATRLGNVFIIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQXXTTA  76
              V  PKGKGIKLSI EEA+KRLAAQ  ++A
Sbjct  234  PWVTLPKGKGIKLSIIEEAQKRLAAQAASSA  264



>ref|XP_007218753.1| hypothetical protein PRUPE_ppa009337mg [Prunus persica]
 gb|EMJ19952.1| hypothetical protein PRUPE_ppa009337mg [Prunus persica]
Length=296

 Score =   204 bits (520),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 127/151 (84%), Gaps = 0/151 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRDEE KFKLCKVRS QFG+KGIP+I TYDGRTIRYPDPLIK ND +KLDLESNK+ DFI
Sbjct  146  IRDEEAKFKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLESNKITDFI  205

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +H+QDATGHE  TRL N F IGKG K
Sbjct  206  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHVQDATGHEFATRLANVFTIGKGTK  265

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQXXTTA  76
              V  PKGKGIKL+I EEAKKR AAQ  +TA
Sbjct  266  PWVSLPKGKGIKLTIIEEAKKRQAAQQASTA  296



>ref|XP_004240421.1| PREDICTED: 40S ribosomal protein S4 [Solanum lycopersicum]
Length=264

 Score =   204 bits (518),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            +RDEE KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLESNK+VDFI
Sbjct  114  VRDEESKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +HIQD+ GHE  TRLGN F +GKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETLHIQDSQGHEFATRLGNVFTLGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQXXTTA  76
              V  PKGKGIKL+I EEA+KRLAAQ  T A
Sbjct  234  PWVSLPKGKGIKLTIIEEARKRLAAQSATPA  264



>ref|XP_008778562.1| PREDICTED: 40S ribosomal protein S4-3-like [Phoenix dactylifera]
Length=247

 Score =   203 bits (516),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 126/146 (86%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRDEE KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLE+NK+VDFI
Sbjct  96   IRDEEAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLETNKIVDFI  155

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +H+QDATGHE  TRLGN F IGKG K
Sbjct  156  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHLQDATGHEFATRLGNVFTIGKGTK  215

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              V  PKGKGIKLSI EEA+KRLAA 
Sbjct  216  AWVSLPKGKGIKLSIIEEARKRLAAS  241



>ref|XP_004233133.1| PREDICTED: 40S ribosomal protein S4-like [Solanum lycopersicum]
Length=264

 Score =   203 bits (517),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            +RDEE KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDL+SNK+VDFI
Sbjct  114  LRDEEAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLDSNKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVG++KNREKHKGSFE VHIQD+ GHE  TRLGN F +GKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGILKNREKHKGSFETVHIQDSLGHEFATRLGNVFTLGKGSK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQXXTTA  76
              V  PKGKGIKLSI EEA+KR+AAQ  T A
Sbjct  234  PWVSLPKGKGIKLSIIEEARKRMAAQSATAA  264



>ref|XP_006352980.1| PREDICTED: 40S ribosomal protein S4-like [Solanum tuberosum]
Length=264

 Score =   203 bits (516),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            +RDEE KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDL+SNK+VDFI
Sbjct  114  LRDEEAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLDSNKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVG++KNREKHKGSFE VHIQD+ GHE  TRLGN F +GKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGILKNREKHKGSFETVHIQDSLGHEFATRLGNVFTLGKGSK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQXXTTA  76
              V  PKGKGIKLSI EEA+KR+A Q  TTA
Sbjct  234  PWVSLPKGKGIKLSIIEEARKRMATQSATTA  264



>ref|XP_003547932.1| PREDICTED: 40S ribosomal protein S4-1 [Glycine max]
 gb|KHN01598.1| 40S ribosomal protein S4-1 [Glycine soja]
Length=264

 Score =   203 bits (516),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            +RD+E KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLI+ ND +KLDLE NK+VDFI
Sbjct  114  VRDDEAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIRANDTIKLDLEENKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +H+QDATGHE  TR+GN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHVQDATGHEFATRMGNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQXXTTA  76
              +  PKGKGIKLSI EEA+KR+AAQ  T A
Sbjct  234  PWISLPKGKGIKLSIIEEARKRIAAQQATAA  264



>ref|XP_010553232.1| PREDICTED: 40S ribosomal protein S4-3 isoform X1 [Tarenaya hassleriana]
Length=263

 Score =   203 bits (516),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRDEE KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLESNK+VDFI
Sbjct  115  IRDEEAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFI  174

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSF+ +HIQDATGHE  TR+GN F IGKG K
Sbjct  175  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFDTIHIQDATGHEFATRMGNVFTIGKGTK  234

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              V  PKGKGIKLSI EEA+KRLA+Q
Sbjct  235  PWVSLPKGKGIKLSIIEEARKRLASQ  260



>ref|XP_010553233.1| PREDICTED: 40S ribosomal protein S4-3 isoform X2 [Tarenaya hassleriana]
Length=262

 Score =   202 bits (515),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRDEE KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLESNK+VDFI
Sbjct  114  IRDEEAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSF+ +HIQDATGHE  TR+GN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFDTIHIQDATGHEFATRMGNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              V  PKGKGIKLSI EEA+KRLA+Q
Sbjct  234  PWVSLPKGKGIKLSIIEEARKRLASQ  259



>gb|ACU24626.1| unknown [Glycine max]
Length=264

 Score =   202 bits (515),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            +RD+E KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLI+ ND +KLDLE NK+VDFI
Sbjct  114  VRDDEAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIRANDTIKLDLEENKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +H+QDATGHE  TR+GN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHVQDATGHEFATRMGNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQXXTTA  76
              +  PKGKGIKLSI EEA+KR+AAQ  T A
Sbjct  234  PWISLPKGKGIKLSIIEEARKRIAAQQATAA  264



>ref|XP_010529053.1| PREDICTED: 40S ribosomal protein S4-3-like [Tarenaya hassleriana]
Length=262

 Score =   202 bits (514),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRDEE KFKLC+VRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLE+NK+VDFI
Sbjct  114  IRDEEAKFKLCRVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLETNKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSF+ +HIQDATGHE  TR+GN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFDTIHIQDATGHEFATRMGNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              V  PKGKGIKLSI EEA+KRLAAQ
Sbjct  234  PWVSLPKGKGIKLSIIEEARKRLAAQ  259



>ref|XP_009368564.1| PREDICTED: 40S ribosomal protein S4-3-like [Pyrus x bretschneideri]
Length=264

 Score =   202 bits (513),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 126/151 (83%), Gaps = 0/151 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRDEE KFKLCKVRS QFG+KGIP+I TYDGRTIRYPDPLIK ND +KLDLE+NK+ DFI
Sbjct  114  IRDEEAKFKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKITDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +H+QDA+GHE  TRLGN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHVQDASGHEFATRLGNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQXXTTA  76
              +  PKGKGIKL+I EEAKKR A Q   TA
Sbjct  234  PWISLPKGKGIKLTIIEEAKKRAAGQATATA  264



>ref|XP_008809054.1| PREDICTED: 40S ribosomal protein S4-like [Phoenix dactylifera]
Length=200

 Score =   200 bits (508),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 125/146 (86%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRDEE KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLE+NK+VDFI
Sbjct  49   IRDEEAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLETNKIVDFI  108

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +H+QDATGHE  TRL N F IGKG K
Sbjct  109  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHLQDATGHEFATRLANVFTIGKGTK  168

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              V  PKGKGIKLSI EEA+KRLAA 
Sbjct  169  PWVSLPKGKGIKLSIIEEARKRLAAS  194



>ref|XP_010037684.1| PREDICTED: 40S ribosomal protein S4-3-like [Eucalyptus grandis]
 gb|KCW49427.1| hypothetical protein EUGRSUZ_K02962 [Eucalyptus grandis]
Length=264

 Score =   202 bits (513),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 127/151 (84%), Gaps = 0/151 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRD+E KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDP+IK ND VKLDLE+NK+ DFI
Sbjct  114  IRDDEAKFKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPVIKANDTVKLDLEANKITDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKG+FE +HIQDA GHE  TRLGN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGTFETIHIQDAQGHEFATRLGNVFIIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQXXTTA  76
              V  PKGKGIKLSI EEA+KRLAAQ   TA
Sbjct  234  PWVSLPKGKGIKLSIIEEARKRLAAQASATA  264



>ref|XP_006344073.1| PREDICTED: 40S ribosomal protein S4-like [Solanum tuberosum]
Length=264

 Score =   202 bits (513),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            +RDEE KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLESNK+VDFI
Sbjct  114  LRDEESKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +HIQD+ GHE  TRLGN F +GKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETLHIQDSQGHEFATRLGNVFTLGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQXXTTA  76
              V  PKGKGIKL+I EEA+K+LAAQ  T A
Sbjct  234  PWVSLPKGKGIKLTIIEEARKKLAAQSATPA  264



>ref|NP_001275148.1| 40S ribosomal protein S4 [Solanum tuberosum]
 sp|P46300.1|RS4_SOLTU RecName: Full=40S ribosomal protein S4 [Solanum tuberosum]
 emb|CAA54095.1| ribosomal protein S4 [Solanum tuberosum]
Length=264

 Score =   202 bits (513),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            +RDEE KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLESNK+VDFI
Sbjct  114  LRDEESKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +HIQD+ GHE  TRLGN F +GKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETLHIQDSQGHEFATRLGNVFTLGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQXXTTA  76
              V  PKGKGIKL+I E+A+KRLAAQ  T A
Sbjct  234  PWVSLPKGKGIKLTIIEDARKRLAAQSATPA  264



>ref|XP_009781828.1| PREDICTED: 40S ribosomal protein S4-like [Nicotiana sylvestris]
Length=259

 Score =   201 bits (512),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 125/150 (83%), Gaps = 0/150 (0%)
 Frame = -3

Query  525  RDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFIK  346
            R    KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLESNK+VDFIK
Sbjct  110  RLHSAKFKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIK  169

Query  345  XDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXKX  166
             DVGNVVMV GGR RGRVGVIKNREKHKGSFE VHIQDA GHE  TRLGN F +GKG K 
Sbjct  170  FDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETVHIQDALGHEFATRLGNVFTLGKGTKP  229

Query  165  XVXXPKGKGIKLSIXEEAKKRLAAQXXTTA  76
             V  PKGKGIKLSI EEA+KRLAAQ  TTA
Sbjct  230  WVSLPKGKGIKLSINEEARKRLAAQSATTA  259



>ref|NP_001235826.1| 40S ribosomal S4 protein [Glycine max]
 gb|AAM93434.1| 40S ribosomal S4 protein [Glycine max]
 gb|ACU21252.1| unknown [Glycine max]
Length=264

 Score =   201 bits (512),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            +RD+E KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLI+ ND +KLDLE NK+VDFI
Sbjct  114  VRDDEAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIRANDTIKLDLEENKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +H+QD+TGHE  TR+GN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHVQDSTGHEFATRMGNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQXXTTA  76
              +  PKGKGIKLSI EEA+KR+AAQ  T A
Sbjct  234  PWISLPKGKGIKLSIIEEARKRIAAQQATAA  264



>gb|KHN38535.1| 40S ribosomal protein S4-1 [Glycine soja]
Length=264

 Score =   201 bits (512),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            +RD+E KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLI+ ND +KLDLE NK+VDFI
Sbjct  114  VRDDEAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIRANDTIKLDLEENKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +H+QD+TGHE  TR+GN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHVQDSTGHEFATRMGNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQXXTTA  76
              +  PKGKGIKLSI EEA+KR+AAQ  T A
Sbjct  234  PWISLPKGKGIKLSIIEEARKRIAAQQATAA  264



>dbj|BAE20168.1| ribosomal protein S4 [Panax ginseng]
Length=264

 Score =   201 bits (512),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 125/151 (83%), Gaps = 0/151 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            +RDEE KFKLCKVRS QFG+KGIP+I TYDGRTIRYPDPLIK ND +KLDLE+NK+ DFI
Sbjct  114  VRDEEAKFKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLEANKIADFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR  GRVGVIKNREKHKGSFE VHIQD+ GHE  TRLGN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNTGRVGVIKNREKHKGSFETVHIQDSLGHEFATRLGNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQXXTTA  76
              V  PKGKGIKL+I EEA+KR  AQ  TTA
Sbjct  234  PWVSLPKGKGIKLTIIEEARKRNVAQSATTA  264



>ref|XP_011046821.1| PREDICTED: 40S ribosomal protein S4-3 [Populus euphratica]
Length=263

 Score =   201 bits (511),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 126/146 (86%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            +RD+E KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLESNK+VDFI
Sbjct  114  LRDDEAKFKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +H+QDATGHE  TRLGN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHVQDATGHEFATRLGNVFTIGKGSK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              +  PKGKGIKLSI EEAKKRLAA 
Sbjct  234  PWISLPKGKGIKLSIIEEAKKRLAAS  259



>ref|XP_006352979.1| PREDICTED: 40S ribosomal protein S4-like [Solanum tuberosum]
Length=264

 Score =   201 bits (511),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 127/151 (84%), Gaps = 0/151 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            +RDEE K KLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDL+SNK+VDFI
Sbjct  114  LRDEEAKLKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLDSNKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVG++KNREKHKGSFE VHIQD+ GHE  TRLGN F +GKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGILKNREKHKGSFETVHIQDSLGHEFATRLGNVFTLGKGSK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQXXTTA  76
              V  PKGKGIKLSI EEA+KR+A Q  TTA
Sbjct  234  PWVSLPKGKGIKLSIIEEARKRMATQSATTA  264



>ref|XP_006374217.1| 40S ribosomal protein S4 [Populus trichocarpa]
 gb|ERP52014.1| 40S ribosomal protein S4 [Populus trichocarpa]
Length=263

 Score =   201 bits (511),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 127/150 (85%), Gaps = 0/150 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            +RD+E KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLE+NK+VDFI
Sbjct  114  LRDDEAKFKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLENNKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +H+QDATGHE  TRLGN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHVQDATGHEFATRLGNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQXXTT  79
              +  PKGKGIKLSI EEA+KRLAA   T 
Sbjct  234  PWISLPKGKGIKLSIIEEARKRLAASQATA  263



>ref|XP_010023674.1| PREDICTED: 40S ribosomal protein S4-3 [Eucalyptus grandis]
 gb|KCW60003.1| hypothetical protein EUGRSUZ_H02737 [Eucalyptus grandis]
Length=264

 Score =   201 bits (510),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 127/151 (84%), Gaps = 0/151 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRD+E KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND VKLDLE+NK+ DFI
Sbjct  114  IRDDEAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTVKLDLETNKITDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKG+FE +H+QD+ GHE  TRLGN + IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGTFETIHVQDSQGHEFATRLGNVYMIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQXXTTA  76
              V  PKGKGIKLSI EEA+KRLAAQ   TA
Sbjct  234  PWVSLPKGKGIKLSIIEEARKRLAAQASATA  264



>ref|XP_011035547.1| PREDICTED: 40S ribosomal protein S4-1 [Populus euphratica]
Length=263

 Score =   200 bits (508),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 127/150 (85%), Gaps = 0/150 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            +RD+E KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLE+NK+VDFI
Sbjct  114  LRDDEAKFKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLENNKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKG+FE +H+QDATGHE  TRLGN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGTFETIHVQDATGHEFATRLGNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQXXTT  79
              +  PKGKGIKLSI EEA+KRLAA   T 
Sbjct  234  PWISLPKGKGIKLSIIEEARKRLAASQATA  263



>ref|XP_002515668.1| 40S ribosomal protein S4, putative [Ricinus communis]
 gb|EEF46720.1| 40S ribosomal protein S4, putative [Ricinus communis]
Length=263

 Score =   200 bits (508),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 115/145 (79%), Positives = 125/145 (86%), Gaps = 0/145 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRD+E KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLESNK+ DFI
Sbjct  114  IRDDEAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKITDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +H+QDATGHE  TR+GN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHVQDATGHEFATRMGNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAA  94
              V  PKGKGIKLSI EEA+KRLAA
Sbjct  234  PWVSLPKGKGIKLSIIEEARKRLAA  258



>ref|XP_002323021.2| hypothetical protein POPTR_0016s13210g [Populus trichocarpa]
 gb|EEF04782.2| hypothetical protein POPTR_0016s13210g [Populus trichocarpa]
Length=263

 Score =   200 bits (508),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 126/146 (86%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            +R++E KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLESNK+VDFI
Sbjct  114  LREDEAKFKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +H+QDATGHE  TRLGN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHVQDATGHEFATRLGNVFTIGKGSK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              +  PKGKGIKLSI EEAKKRLAA 
Sbjct  234  PWISLPKGKGIKLSIIEEAKKRLAAS  259



>ref|NP_001242281.1| uncharacterized protein LOC100812132 [Glycine max]
 gb|ACU23059.1| unknown [Glycine max]
Length=264

 Score =   199 bits (507),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 113/149 (76%), Positives = 126/149 (85%), Gaps = 0/149 (0%)
 Frame = -3

Query  522  DEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFIKX  343
            D+E KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLI+ ND +KLDLE NK+VDFIK 
Sbjct  116  DDEAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIRANDTIKLDLEENKIVDFIKF  175

Query  342  DvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXKXX  163
            DVGNVVMV GGR RGRVGVIKNREKHKGSFE +H+QDATGHE  TR+GN F IGKG K  
Sbjct  176  DVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHVQDATGHEFATRMGNVFTIGKGTKPW  235

Query  162  VXXPKGKGIKLSIXEEAKKRLAAQXXTTA  76
            +  PKGKGIKLSI EEA+KR+AAQ  T A
Sbjct  236  ISLPKGKGIKLSIIEEARKRIAAQQATAA  264



>ref|XP_010036744.1| PREDICTED: 40S ribosomal protein S4-3-like [Eucalyptus grandis]
 gb|KCW88215.1| hypothetical protein EUGRSUZ_A00608 [Eucalyptus grandis]
Length=264

 Score =   199 bits (507),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 127/151 (84%), Gaps = 0/151 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRD+E KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLE+NK+ DFI
Sbjct  114  IRDDEAKFKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLETNKITDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVG+IKNREKHKG+FE +H+QD+ GHE  TRLGN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGIIKNREKHKGTFETIHVQDSLGHEFATRLGNVFIIGKGSK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQXXTTA  76
              +  PKGKGIKLSI EEA+KRLAAQ   TA
Sbjct  234  PWLSLPKGKGIKLSIIEEARKRLAAQASATA  264



>ref|XP_010529903.1| PREDICTED: 40S ribosomal protein S4-3-like [Tarenaya hassleriana]
Length=262

 Score =   199 bits (507),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 125/146 (86%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRDEE K KLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLE+NK+VDFI
Sbjct  114  IRDEEAKLKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLETNKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSF+ +HIQDATGHE  TR+GN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFDTIHIQDATGHEFATRMGNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              V  PKGKGIKLSI EEA+KRL AQ
Sbjct  234  PWVSLPKGKGIKLSIIEEARKRLVAQ  259



>ref|XP_007156131.1| hypothetical protein PHAVU_003G261200g [Phaseolus vulgaris]
 gb|ESW28125.1| hypothetical protein PHAVU_003G261200g [Phaseolus vulgaris]
Length=199

 Score =   197 bits (500),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            +RDEE KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLE NK+V+FI
Sbjct  49   VRDEEAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLEENKIVEFI  108

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIK+R+K+KGSFE +H+QDATGHE  TRLGN F IGKG K
Sbjct  109  KFDVGNVVMVTGGRNRGRVGVIKSRDKNKGSFETIHVQDATGHEFATRLGNVFTIGKGTK  168

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQXXTTA  76
              V  PKGKGIKLSI EEA+KR++AQ  T A
Sbjct  169  PWVSLPKGKGIKLSIIEEARKRISAQQSTAA  199



>ref|XP_002318967.2| hypothetical protein POPTR_0013s01230g [Populus trichocarpa]
 gb|ABK94293.1| unknown [Populus trichocarpa]
 gb|EEE94890.2| hypothetical protein POPTR_0013s01230g [Populus trichocarpa]
Length=263

 Score =   199 bits (506),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 126/146 (86%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            +RD+E KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLE+NK+VDFI
Sbjct  114  LRDDEAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLENNKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKG+FE +H+QDATGHE  TRLGN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGTFETIHVQDATGHEFATRLGNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              +  PKGKGIKLSI EEAKKRLAA 
Sbjct  234  PWISLPKGKGIKLSIIEEAKKRLAAS  259



>gb|KDP30648.1| hypothetical protein JCGZ_16213 [Jatropha curcas]
Length=263

 Score =   199 bits (506),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 124/145 (86%), Gaps = 0/145 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRD+E KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLESNK+ DFI
Sbjct  114  IRDDEAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKITDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +HIQDATGHE  TRLGN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDATGHEFATRLGNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAA  94
              V  PKGKGIKLSI EEA+KRLA 
Sbjct  234  PWVSLPKGKGIKLSIIEEARKRLAT  258



>ref|XP_010509192.1| PREDICTED: 40S ribosomal protein S4-3-like [Camelina sativa]
Length=244

 Score =   198 bits (504),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRDEE KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLE+NK+V+FI
Sbjct  96   IRDEEAKFKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEANKIVEFI  155

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +HIQD+TGHE  TRLGN F +GKG K
Sbjct  156  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTLGKGTK  215

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              V  PKGKGIKL+I EEA+KRL+AQ
Sbjct  216  PWVSLPKGKGIKLTIIEEARKRLSAQ  241



>ref|XP_004294780.1| PREDICTED: 40S ribosomal protein S4-3 [Fragaria vesca subsp. 
vesca]
Length=264

 Score =   199 bits (505),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 125/151 (83%), Gaps = 0/151 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRDEE KFKLCKVRS QFG+K IP+I TYDGRTIRYPDPLIK ND +KLDLE+NKV+DFI
Sbjct  114  IRDEEAKFKLCKVRSVQFGQKNIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKVIDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +H+QDA GHE  TRLGN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHVQDAAGHEFATRLGNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQXXTTA  76
              V  PKGKGIKL+I EEA+KR AA    TA
Sbjct  234  PWVSLPKGKGIKLTIIEEARKRQAALQTATA  264



>ref|XP_010517120.1| PREDICTED: 40S ribosomal protein S4-3-like [Camelina sativa]
Length=262

 Score =   198 bits (504),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRDEE KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLE+NK+V+FI
Sbjct  114  IRDEEAKFKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEANKIVEFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +HIQD+TGHE  TRLGN F +GKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTLGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              V  PKGKGIKL+I EEA+KRL+AQ
Sbjct  234  PWVSLPKGKGIKLTIIEEARKRLSAQ  259



>ref|XP_006409322.1| hypothetical protein EUTSA_v10022813mg [Eutrema salsugineum]
 ref|XP_006411040.1| hypothetical protein EUTSA_v10017108mg [Eutrema salsugineum]
 gb|ESQ50775.1| hypothetical protein EUTSA_v10022813mg [Eutrema salsugineum]
 gb|ESQ52493.1| hypothetical protein EUTSA_v10017108mg [Eutrema salsugineum]
Length=262

 Score =   198 bits (504),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 126/146 (86%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRDEE KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLE NK+V+FI
Sbjct  114  IRDEEAKFKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVEFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +HIQD+TGHE  TRLGN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              V  PKGKGIKL+I EEA+KRL+AQ
Sbjct  234  PWVSLPKGKGIKLTIIEEARKRLSAQ  259



>ref|XP_006399188.1| hypothetical protein EUTSA_v10014417mg [Eutrema salsugineum]
 gb|ESQ40641.1| hypothetical protein EUTSA_v10014417mg [Eutrema salsugineum]
Length=262

 Score =   198 bits (504),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 126/146 (86%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRDEE KFKLCKVR+ QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLE NK+V+FI
Sbjct  114  IRDEEAKFKLCKVRTIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVEFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +HIQD+TGHE  TRLGN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              V  PKGKGIKLSI EEA+KRL+AQ
Sbjct  234  PWVSLPKGKGIKLSIIEEARKRLSAQ  259



>ref|XP_010934423.1| PREDICTED: 40S ribosomal protein S4-3-like [Elaeis guineensis]
Length=265

 Score =   198 bits (504),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 124/146 (85%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRDEE KFKLCKVRS QFG KGIP++ TYDGRTIRYPDPLIK ND +KLDLE+ K+VDFI
Sbjct  114  IRDEEAKFKLCKVRSVQFGHKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLETYKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +H+QDATGHE  TRLGN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHLQDATGHEFATRLGNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              V  PKGKGIKLSI EEA+KRLAA 
Sbjct  234  PWVSLPKGKGIKLSIIEEARKRLAAS  259



>gb|EYU19705.1| hypothetical protein MIMGU_mgv1a012053mg [Erythranthe guttata]
Length=263

 Score =   198 bits (504),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 113/150 (75%), Positives = 126/150 (84%), Gaps = 0/150 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRDEE KFKLCKVRS QFGKKGIP++ TYDGRTIRYPDPLIK ND +KLDLE+NK+ DFI
Sbjct  114  IRDEEAKFKLCKVRSIQFGKKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLETNKIADFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVG++KNREKHKGSFE VHIQD+TGHE  TRLGN + IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGILKNREKHKGSFETVHIQDSTGHEFATRLGNVYTIGKGSK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQXXTT  79
              V  PKGKGIKL+I EEA+KR+ +Q  T 
Sbjct  234  PWVSLPKGKGIKLTIIEEARKRITSQSATA  263



>gb|KHG11751.1| 40S ribosomal S4 [Gossypium arboreum]
Length=244

 Score =   197 bits (502),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 124/146 (85%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            I  +E KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLESNK+VDFI
Sbjct  96   ITGDESKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFI  155

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +H+QDA GHE  TRLGN F IGKG K
Sbjct  156  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHVQDAAGHEFATRLGNVFTIGKGTK  215

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              V  PKGKGIKLSI EEA+KRLAAQ
Sbjct  216  LWVLLPKGKGIKLSIIEEARKRLAAQ  241



>gb|EYU41945.1| hypothetical protein MIMGU_mgv1a012043mg [Erythranthe guttata]
Length=263

 Score =   198 bits (504),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 126/150 (84%), Gaps = 0/150 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRDEE KFKLCKVRS QFGKKGIP+I TYDGRTIRYPDPLIK ND +KLDL+SNK+VDFI
Sbjct  114  IRDEEAKFKLCKVRSVQFGKKGIPYINTYDGRTIRYPDPLIKANDTIKLDLDSNKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVG++KNREKHKGSFE VHIQD+TG+E  TRL N + IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGILKNREKHKGSFETVHIQDSTGNEFATRLSNVYTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQXXTT  79
              V  PKGKGIK +I EEA+KRLAAQ  T 
Sbjct  234  PWVSLPKGKGIKFTIIEEARKRLAAQSATA  263



>gb|KJB36905.1| hypothetical protein B456_006G184600 [Gossypium raimondii]
Length=237

 Score =   197 bits (501),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 124/146 (85%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            I  +E KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLESNK+VDFI
Sbjct  89   ITGDETKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFI  148

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +H+QDA GHE  TRLGN F IGKG K
Sbjct  149  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHVQDAAGHEFATRLGNVFTIGKGTK  208

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              V  PKGKGIKLSI EEA+KRLAAQ
Sbjct  209  PWVSLPKGKGIKLSIIEEARKRLAAQ  234



>gb|KHN00473.1| 40S ribosomal protein S4-1 [Glycine soja]
Length=296

 Score =   199 bits (506),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 113/149 (76%), Positives = 126/149 (85%), Gaps = 0/149 (0%)
 Frame = -3

Query  522  DEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFIKX  343
            D+E KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLI+ ND +KLDLE NK+VDFIK 
Sbjct  148  DDEAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIRANDTIKLDLEENKIVDFIKF  207

Query  342  DvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXKXX  163
            DVGNVVMV GGR RGRVGVIKNREKHKGSFE +H+QDATGHE  TR+GN F IGKG K  
Sbjct  208  DVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHVQDATGHEFATRMGNVFTIGKGTKPW  267

Query  162  VXXPKGKGIKLSIXEEAKKRLAAQXXTTA  76
            +  PKGKGIKLSI EEA+KR+AAQ  T A
Sbjct  268  ISLPKGKGIKLSIIEEARKRIAAQQATAA  296



>gb|KJB77064.1| hypothetical protein B456_012G118500 [Gossypium raimondii]
Length=244

 Score =   197 bits (501),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 124/146 (85%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            I  +E KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLESNK+VDFI
Sbjct  96   ITGDETKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFI  155

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +H+QDA GHE  TRLGN F IGKG K
Sbjct  156  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHVQDAAGHEFATRLGNVFTIGKGTK  215

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              V  PKGKGIKLSI EEA+KRLAAQ
Sbjct  216  PWVSLPKGKGIKLSIIEEARKRLAAQ  241



>ref|XP_007050962.1| Ribosomal protein S4 (RPS4A) family protein [Theobroma cacao]
 gb|EOX95119.1| Ribosomal protein S4 (RPS4A) family protein [Theobroma cacao]
Length=262

 Score =   198 bits (503),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 124/146 (85%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            I  +E KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLESNK+VDFI
Sbjct  114  ITGDETKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +HIQDA GHE  TRLGN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDAAGHEFATRLGNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              V  PKGKGIKLSI EEA+KRLAAQ
Sbjct  234  PWVSLPKGKGIKLSIIEEARKRLAAQ  259



>gb|KJB77063.1| hypothetical protein B456_012G118500 [Gossypium raimondii]
Length=251

 Score =   197 bits (502),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 124/146 (85%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            I  +E KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLESNK+VDFI
Sbjct  103  ITGDETKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFI  162

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +H+QDA GHE  TRLGN F IGKG K
Sbjct  163  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHVQDAAGHEFATRLGNVFTIGKGTK  222

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              V  PKGKGIKLSI EEA+KRLAAQ
Sbjct  223  PWVSLPKGKGIKLSIIEEARKRLAAQ  248



>ref|XP_003604568.1| 40S ribosomal protein S4 [Medicago truncatula]
 gb|AES86765.1| 40S ribosomal S4-like protein [Medicago truncatula]
Length=264

 Score =   198 bits (503),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 112/151 (74%), Positives = 127/151 (84%), Gaps = 0/151 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            +RD+E KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLE+NK+ DFI
Sbjct  114  VRDDEAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLENNKITDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKG+FE +H+QDA+GHE  TRLGN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGTFETIHVQDASGHEFATRLGNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQXXTTA  76
              V  PKGKGIKL++ EEA+KR AAQ  T A
Sbjct  234  PWVSLPKGKGIKLTVIEEARKRQAAQNVTAA  264



>ref|XP_010443578.1| PREDICTED: 40S ribosomal protein S4-3-like isoform X1 [Camelina 
sativa]
 ref|XP_010443579.1| PREDICTED: 40S ribosomal protein S4-3-like isoform X2 [Camelina 
sativa]
Length=262

 Score =   198 bits (503),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 126/146 (86%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRDEE KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLE+NK+V+FI
Sbjct  114  IRDEEAKFKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEANKIVEFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +HIQD+TGHE  TRLGN F +GKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTLGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              V  PKGKGIKL+I EEA+KRLA Q
Sbjct  234  PWVSLPKGKGIKLTIIEEARKRLAGQ  259



>ref|XP_011019071.1| PREDICTED: 40S ribosomal protein S4-3-like [Populus euphratica]
Length=263

 Score =   198 bits (503),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 125/146 (86%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            +RD+E KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLESNK+VDFI
Sbjct  114  LRDDEAKFKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +H+QDATGHE  TRLGN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHVQDATGHEFATRLGNVFTIGKGSK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              +  PKGKGIKLSI EEA+KR AA 
Sbjct  234  PWISLPKGKGIKLSIIEEARKRQAAS  259



>ref|XP_002884052.1| 40S ribosomal protein S4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60311.1| 40S ribosomal protein S4 [Arabidopsis lyrata subsp. lyrata]
Length=261

 Score =   197 bits (502),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 126/146 (86%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            I+DEE KFKLCKVRS QFG+KGIPF+ TYDGRTIRYPDPLIK ND +KLDLE NK+V+FI
Sbjct  114  IKDEEAKFKLCKVRSIQFGQKGIPFLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVEFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +HIQD+TGHE  TRLGN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              V  PKGKGIKL+I EEA+KRL+AQ
Sbjct  234  PWVSLPKGKGIKLTIIEEARKRLSAQ  259



>ref|XP_002308235.1| hypothetical protein POPTR_0006s10460g [Populus trichocarpa]
 gb|EEE91758.1| hypothetical protein POPTR_0006s10460g [Populus trichocarpa]
Length=263

 Score =   197 bits (502),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 125/146 (86%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            +RD+E KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLESNK+VDFI
Sbjct  114  LRDDEAKFKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +H+QDATGHE  TRLGN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHVQDATGHEFATRLGNVFTIGKGSK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              +  PKGKGIKLSI EEA+KR AA 
Sbjct  234  PWISLPKGKGIKLSIIEEARKRQAAS  259



>ref|XP_002512717.1| 40S ribosomal protein S4, putative [Ricinus communis]
 gb|EEF50169.1| 40S ribosomal protein S4, putative [Ricinus communis]
Length=263

 Score =   197 bits (502),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 125/146 (86%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRD+E KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLESNK+ +FI
Sbjct  114  IRDDEAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKITEFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +HIQD+TGHE  TR+GN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRMGNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              V  PKGKGIKLSI EEA+KRLAA 
Sbjct  234  PWVSLPKGKGIKLSIIEEARKRLAAS  259



>ref|XP_009393217.1| PREDICTED: 40S ribosomal protein S4-1-like [Musa acuminata subsp. 
malaccensis]
Length=265

 Score =   197 bits (502),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRDEE KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLE+NK+VDFI
Sbjct  114  IRDEEAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLETNKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR  GRVGVIKNREKHKGSFE +HIQDATGHE  TRLGN F IGK  K
Sbjct  174  KFDVGNVVMVTGGRNTGRVGVIKNREKHKGSFETIHIQDATGHEFATRLGNVFTIGKATK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRL  100
              V  PKGKGIKLSI EEA+KRL
Sbjct  234  PWVSLPKGKGIKLSIIEEARKRL  256



>dbj|BAH57121.1| AT5G07090 [Arabidopsis thaliana]
Length=197

 Score =   195 bits (496),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 126/146 (86%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            I+DEE KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLE NK+V+FI
Sbjct  49   IKDEEAKFKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVEFI  108

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +HIQD+TGHE  TRLGN + IGKG K
Sbjct  109  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVYTIGKGTK  168

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              V  PKGKGIKL+I EEA+KRLA+Q
Sbjct  169  PWVSLPKGKGIKLTIIEEARKRLASQ  194



>ref|XP_006411034.1| hypothetical protein EUTSA_v10017036mg [Eutrema salsugineum]
 gb|ESQ52487.1| hypothetical protein EUTSA_v10017036mg [Eutrema salsugineum]
Length=288

 Score =   198 bits (504),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 126/146 (86%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRDEE KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLE NK+V+FI
Sbjct  140  IRDEEAKFKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVEFI  199

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +HIQD+TGHE  TRLGN F IGKG K
Sbjct  200  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTIGKGTK  259

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              V  PKGKGIKL+I EEA+KRL+AQ
Sbjct  260  PWVSLPKGKGIKLTIIEEARKRLSAQ  285



>ref|XP_002864574.1| 40S ribosomal protein S4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40833.1| 40S ribosomal protein S4 [Arabidopsis lyrata subsp. lyrata]
Length=262

 Score =   197 bits (502),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 126/146 (86%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRDEE +FKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLE+NK+V+FI
Sbjct  114  IRDEEAQFKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEANKIVEFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +HIQD+TGHE  TRLGN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              V  PKGKGIKL+I EEA+KRLA Q
Sbjct  234  PWVSLPKGKGIKLTIIEEARKRLAGQ  259



>gb|KJB71672.1| hypothetical protein B456_011G136800 [Gossypium raimondii]
Length=262

 Score =   197 bits (502),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 124/146 (85%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            I  +E KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLESNK+VDFI
Sbjct  114  ITGDETKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +H+QDA GHE  TRLGN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHVQDAAGHEFATRLGNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              V  PKGKGIKLSI EEA+KRLAAQ
Sbjct  234  PWVSLPKGKGIKLSIIEEARKRLAAQ  259



>ref|XP_009391002.1| PREDICTED: 40S ribosomal protein S4-3 [Musa acuminata subsp. 
malaccensis]
Length=265

 Score =   197 bits (502),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            +RDEE KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLE+NK+VDFI
Sbjct  114  VRDEEAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLETNKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR  GRVGVIKNREKHKGSFE +HIQD+TGHE  TRLGN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNTGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRL  100
              V  PKGKGIKLSI EEA+KRL
Sbjct  234  PWVSLPKGKGIKLSIIEEARKRL  256



>gb|KHG02126.1| 40S ribosomal S4 [Gossypium arboreum]
 gb|KJB36904.1| hypothetical protein B456_006G184600 [Gossypium raimondii]
 gb|KJB77062.1| hypothetical protein B456_012G118500 [Gossypium raimondii]
Length=262

 Score =   197 bits (501),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 124/146 (85%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            I  +E KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLESNK+VDFI
Sbjct  114  ITGDETKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +H+QDA GHE  TRLGN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHVQDAAGHEFATRLGNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              V  PKGKGIKLSI EEA+KRLAAQ
Sbjct  234  PWVSLPKGKGIKLSIIEEARKRLAAQ  259



>ref|XP_007026596.1| Ribosomal protein S4 (RPS4A) family protein [Theobroma cacao]
 gb|EOY07098.1| Ribosomal protein S4 (RPS4A) family protein [Theobroma cacao]
Length=262

 Score =   197 bits (501),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 124/146 (85%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            I  +E KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLESNK+VDFI
Sbjct  114  ITGDETKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +HIQDA GHE  TRLGN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDAAGHEFATRLGNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              V  PKGKGIKLS+ EEA+KRLAAQ
Sbjct  234  PWVSLPKGKGIKLSVIEEARKRLAAQ  259



>ref|XP_010938423.1| PREDICTED: 40S ribosomal protein S4-3 [Elaeis guineensis]
Length=265

 Score =   197 bits (501),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 125/146 (86%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRDEE KFKLCKVRS QFG+KGIP++ T+DGRTIRYPDPLIK ND +KLDLE+NK+VDFI
Sbjct  114  IRDEEAKFKLCKVRSVQFGQKGIPYLNTFDGRTIRYPDPLIKANDTIKLDLEANKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +H+QDA GHE  TR+GN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHLQDALGHEFATRIGNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              V  PKGKGIKLSI EEA+KRLAA 
Sbjct  234  PWVSLPKGKGIKLSIIEEARKRLAAS  259



>emb|CDX81032.1| BnaC03g02860D [Brassica napus]
Length=279

 Score =   197 bits (502),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 125/146 (86%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRDEE KFKLCKVR+ Q G+KGIPF+ TYDGRTIRYPDPLIK ND +KLDLE NKVVDFI
Sbjct  131  IRDEEAKFKLCKVRTIQLGQKGIPFLNTYDGRTIRYPDPLIKPNDTIKLDLEENKVVDFI  190

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +HIQD+TGHE  TRLGN F +GKG K
Sbjct  191  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTLGKGTK  250

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              V  PKGKGIKL+I EEA+KRL+AQ
Sbjct  251  PWVSLPKGKGIKLTIIEEARKRLSAQ  276



>gb|KHG30713.1| 40S ribosomal S4 [Gossypium arboreum]
Length=268

 Score =   197 bits (501),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 124/146 (85%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            I  +E KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLESNK+VDFI
Sbjct  120  ISGDETKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFI  179

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +H+QDA GHE  TRLGN F IGKG K
Sbjct  180  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHVQDAAGHEFATRLGNVFTIGKGTK  239

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              V  PKGKGIKLSI EEA+KRLAAQ
Sbjct  240  PWVSLPKGKGIKLSIIEEARKRLAAQ  265



>ref|XP_002871248.1| 40S ribosomal protein S4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47507.1| 40S ribosomal protein S4 [Arabidopsis lyrata subsp. lyrata]
Length=262

 Score =   197 bits (501),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 126/146 (86%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            I+DEE KFKLCKVRS QFG+KGIPF+ TYDGRTIRYPDPLIK ND VKLDLE NK+V+FI
Sbjct  114  IKDEEAKFKLCKVRSIQFGQKGIPFLNTYDGRTIRYPDPLIKPNDTVKLDLEENKIVEFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +HIQD+TGHE  TRLGN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              +  PKGKGIKL+I EEA+KRLA+Q
Sbjct  234  PWMSLPKGKGIKLTIIEEARKRLASQ  259



>dbj|BAB10257.1| ribosomal protein S4 [Arabidopsis thaliana]
Length=244

 Score =   196 bits (499),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            I+DEE KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLE+NK+V+FI
Sbjct  96   IKDEEAKFKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEANKIVEFI  155

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +HIQD+TGHE  TRLGN + IGKG K
Sbjct  156  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVYTIGKGTK  215

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              V  PKGKGIKL+I EEA+KRLA+Q
Sbjct  216  PWVSLPKGKGIKLTIIEEARKRLASQ  241



>gb|KJB29916.1| hypothetical protein B456_005G123400 [Gossypium raimondii]
Length=244

 Score =   196 bits (499),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 124/146 (85%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            I  +E KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLE+NK+VDFI
Sbjct  96   ITSDETKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLENNKIVDFI  155

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +H+QDA GHE  TRLGN F IGKG K
Sbjct  156  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHVQDAAGHEFATRLGNVFTIGKGTK  215

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              V  PKGKGIKLSI EEA+KRLAAQ
Sbjct  216  PWVSLPKGKGIKLSIIEEARKRLAAQ  241



>ref|XP_007156130.1| hypothetical protein PHAVU_003G261200g [Phaseolus vulgaris]
 gb|ESW28124.1| hypothetical protein PHAVU_003G261200g [Phaseolus vulgaris]
Length=264

 Score =   197 bits (501),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            +RDEE KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLE NK+V+FI
Sbjct  114  VRDEEAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLEENKIVEFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIK+R+K+KGSFE +H+QDATGHE  TRLGN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKSRDKNKGSFETIHVQDATGHEFATRLGNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQXXTTA  76
              V  PKGKGIKLSI EEA+KR++AQ  T A
Sbjct  234  PWVSLPKGKGIKLSIIEEARKRISAQQSTAA  264



>ref|XP_006401084.1| hypothetical protein EUTSA_v10014163mg [Eutrema salsugineum]
 gb|ESQ42537.1| hypothetical protein EUTSA_v10014163mg [Eutrema salsugineum]
Length=312

 Score =   198 bits (504),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRDEE K+KLCKVR+ QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLE+NK+V+FI
Sbjct  164  IRDEEAKYKLCKVRTIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEANKIVEFI  223

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +HIQD+TGHE  TRLGN F IGKG K
Sbjct  224  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTIGKGTK  283

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              V  PKGKGIKL+I EEA+KRLAAQ
Sbjct  284  PWVSLPKGKGIKLTIIEEARKRLAAQ  309



>gb|KDO67007.1| hypothetical protein CISIN_1g024108mg [Citrus sinensis]
 gb|KDO67008.1| hypothetical protein CISIN_1g024108mg [Citrus sinensis]
Length=200

 Score =   194 bits (494),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 123/151 (81%), Gaps = 0/151 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRDEE KFKLCKVRS QFG+KGIP+I TYDGRTIRYPDPLIK ND +KLDLE+NK+ +FI
Sbjct  49   IRDEEAKFKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKITEFI  108

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVG+IKNREKHKGSFE +HIQDA GHE  TRLGN F IGKG K
Sbjct  109  KFDVGNVVMVTGGRNRGRVGIIKNREKHKGSFETIHIQDALGHEFATRLGNVFTIGKGTK  168

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQXXTTA  76
              V  PKGKGIKLSI EEA+KR A      A
Sbjct  169  PWVSLPKGKGIKLSIIEEARKRQALATSAAA  199



>ref|XP_006288484.1| hypothetical protein CARUB_v10001743mg [Capsella rubella]
 ref|XP_010452659.1| PREDICTED: 40S ribosomal protein S4-3 [Camelina sativa]
 gb|EOA21382.1| hypothetical protein CARUB_v10001743mg [Capsella rubella]
Length=262

 Score =   197 bits (500),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            I+DEE KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLE+NK+V+FI
Sbjct  114  IKDEEAKFKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEANKIVEFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +HIQD+TGHE  TRLGN F +GKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTLGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              V  PKGKGIKL+I EEA+KRLA+Q
Sbjct  234  PWVSLPKGKGIKLTIIEEARKRLASQ  259



>gb|AAL49933.1| AT5g58420/mqj2_10 [Arabidopsis thaliana]
 gb|AAN28773.1| At5g58420/mqj2_10 [Arabidopsis thaliana]
Length=262

 Score =   196 bits (499),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            I+DEE KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLE+NK+V+FI
Sbjct  114  IKDEEAKFKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEANKIVEFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +HIQD+TGHE  TRLGN + IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVYTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              V  PKGKGIKL+I EEA+KRLA+Q
Sbjct  234  PWVSLPKGKGIKLTIIEEARKRLASQ  259



>gb|KJB38000.1| hypothetical protein B456_006G231800 [Gossypium raimondii]
Length=244

 Score =   196 bits (498),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 123/146 (84%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            I  +E KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +K DLESNK+VDFI
Sbjct  96   ITGDESKFKLCKVRSVQFGRKGIPYLNTYDGRTIRYPDPLIKANDTIKFDLESNKIVDFI  155

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +H+QDA GHE  TRLGN F IGKG K
Sbjct  156  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHVQDAAGHEFATRLGNVFTIGKGTK  215

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              V  PKGKGIKLSI EEA+KRLAAQ
Sbjct  216  PWVSLPKGKGIKLSIIEEARKRLAAQ  241



>gb|KJB29915.1| hypothetical protein B456_005G123400 [Gossypium raimondii]
Length=262

 Score =   196 bits (499),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 124/146 (85%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            I  +E KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLE+NK+VDFI
Sbjct  114  ITSDETKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLENNKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +H+QDA GHE  TRLGN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHVQDAAGHEFATRLGNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              V  PKGKGIKLSI EEA+KRLAAQ
Sbjct  234  PWVSLPKGKGIKLSIIEEARKRLAAQ  259



>ref|XP_011023749.1| PREDICTED: 40S ribosomal protein S4-2-like [Populus euphratica]
Length=263

 Score =   196 bits (499),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 126/146 (86%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            +R++E KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLE+NK+VDFI
Sbjct  114  LREDEAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLENNKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKG+FE +H+QDATGHE  TRLGN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGTFETIHVQDATGHEFATRLGNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              +  PKGKGIKLSI EEA+KRLAA 
Sbjct  234  PWISLPKGKGIKLSIIEEARKRLAAS  259



>ref|XP_009381027.1| PREDICTED: 40S ribosomal protein S4-like [Musa acuminata subsp. 
malaccensis]
Length=265

 Score =   196 bits (499),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRDEE KFKLCKVRS QFG+KGIP++ T+DGRTIRYPDPLIK ND +KLDLE+NK+VDFI
Sbjct  114  IRDEESKFKLCKVRSVQFGQKGIPYLNTFDGRTIRYPDPLIKANDTIKLDLETNKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGN+VMV GGR  GRVGVIKNREKHKGSFE +H+QDATGHE  TR+GN F IGKG K
Sbjct  174  KFDVGNIVMVTGGRNTGRVGVIKNREKHKGSFETIHVQDATGHEFATRMGNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRL  100
              V  PKGKGIKLSI EEA+KRL
Sbjct  234  PWVSLPKGKGIKLSIIEEARKRL  256



>ref|NP_200650.1| 40S ribosomal protein S4-3 [Arabidopsis thaliana]
 sp|Q8VYK6.2|RS43_ARATH RecName: Full=40S ribosomal protein S4-3 [Arabidopsis thaliana]
 gb|AAL16117.1|AF428285_1 AT5g58420/mqj2_10 [Arabidopsis thaliana]
 gb|AAM64284.1| ribosomal protein S4-like [Arabidopsis thaliana]
 gb|AED97051.1| 40S ribosomal protein S4-3 [Arabidopsis thaliana]
Length=262

 Score =   196 bits (499),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            I+DEE KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLE+NK+V+FI
Sbjct  114  IKDEEAKFKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEANKIVEFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +HIQD+TGHE  TRLGN + IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVYTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              V  PKGKGIKL+I EEA+KRLA+Q
Sbjct  234  PWVSLPKGKGIKLTIIEEARKRLASQ  259



>gb|KJB17111.1| hypothetical protein B456_002G266000 [Gossypium raimondii]
Length=191

 Score =   194 bits (493),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 123/146 (84%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            I  +E KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLESNK+VDFI
Sbjct  43   ITGDETKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFI  102

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +H+QDA GHE  TRLGN F IGKG K
Sbjct  103  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHVQDAAGHEFATRLGNVFTIGKGTK  162

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              V  PK KGIKLSI EEA+KRLAAQ
Sbjct  163  PWVSLPKRKGIKLSIIEEARKRLAAQ  188



>ref|XP_009385022.1| PREDICTED: 40S ribosomal protein S4-1-like [Musa acuminata subsp. 
malaccensis]
Length=265

 Score =   196 bits (499),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            +RDEE KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLE+NK+VDFI
Sbjct  114  VRDEEAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLETNKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR  GRVGVIKNREKHKGSF+ +H+QDATGHE  TR+GN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNTGRVGVIKNREKHKGSFDTIHVQDATGHEFATRMGNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRL  100
              V  PKGKGIKLSI EEA+KRL
Sbjct  234  PWVSLPKGKGIKLSIIEEARKRL  256



>gb|EPS63485.1| hypothetical protein M569_11297, partial [Genlisea aurea]
Length=262

 Score =   196 bits (499),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 113/150 (75%), Positives = 125/150 (83%), Gaps = 0/150 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRDEE KFKLCKVRS QFGKKGIP++ TYDGRTIRYPDPLIK ND +KLDLE NK+ DFI
Sbjct  113  IRDEEAKFKLCKVRSVQFGKKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLEENKIADFI  172

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNV+MV GGR RGRVGVIK+REKHKG+FE +H+QDATGHE  TRLGN F IGKG K
Sbjct  173  KFDVGNVIMVTGGRNRGRVGVIKSREKHKGTFETIHVQDATGHEFATRLGNVFIIGKGTK  232

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQXXTT  79
              V  PKGKGIKLSI EEA+KR+AA   + 
Sbjct  233  PWVSLPKGKGIKLSIIEEARKRIAAPSASA  262



>gb|KJB37999.1| hypothetical protein B456_006G231800 [Gossypium raimondii]
Length=262

 Score =   196 bits (499),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 123/146 (84%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            I  +E KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +K DLESNK+VDFI
Sbjct  114  ITGDESKFKLCKVRSVQFGRKGIPYLNTYDGRTIRYPDPLIKANDTIKFDLESNKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +H+QDA GHE  TRLGN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHVQDAAGHEFATRLGNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              V  PKGKGIKLSI EEA+KRLAAQ
Sbjct  234  PWVSLPKGKGIKLSIIEEARKRLAAQ  259



>gb|KHG02041.1| 40S ribosomal S4 [Gossypium arboreum]
Length=262

 Score =   196 bits (498),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 123/146 (84%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            I  +E KFKLCKVRS QFG KGIP++ TYDGRTIRYPDPLIK ND +KLDLESNK+VDFI
Sbjct  114  ITGDETKFKLCKVRSVQFGLKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +H+QDA GHE  TRLGN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHVQDAAGHEFATRLGNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              V  PKGKGIKLSI EEA+KRLAAQ
Sbjct  234  PWVSLPKGKGIKLSIIEEARKRLAAQ  259



>ref|XP_009125675.1| PREDICTED: 40S ribosomal protein S4-1 [Brassica rapa]
Length=262

 Score =   196 bits (498),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 126/146 (86%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRDEE KFKLCKVR+ QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLE NK+V+FI
Sbjct  114  IRDEEAKFKLCKVRTIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVEFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +HIQD+TGHE  TRLGN F +GKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTLGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              V  PKGKGIKL+I EEA+KRL+AQ
Sbjct  234  PWVSLPKGKGIKLTIIEEARKRLSAQ  259



>ref|NP_001031846.1| 40S ribosomal protein S4-2 [Arabidopsis thaliana]
 gb|AED91108.1| 40S ribosomal protein S4-2 [Arabidopsis thaliana]
Length=244

 Score =   196 bits (497),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 126/146 (86%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            I+DEE KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLE NK+V+FI
Sbjct  96   IKDEEAKFKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVEFI  155

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +HIQD+TGHE  TRLGN + IGKG K
Sbjct  156  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVYTIGKGTK  215

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              V  PKGKGIKL+I EEA+KRLA+Q
Sbjct  216  PWVSLPKGKGIKLTIIEEARKRLASQ  241



>ref|XP_006280972.1| hypothetical protein CARUB_v10026972mg [Capsella rubella]
 gb|EOA13870.1| hypothetical protein CARUB_v10026972mg [Capsella rubella]
Length=262

 Score =   196 bits (498),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 126/146 (86%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            I+DEE KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLE+NK+V+FI
Sbjct  114  IKDEEAKFKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEANKIVEFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +HIQD+TGHE  TRLGN F +GKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTLGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              V  PKGKGIKL+I EEA+KRLA Q
Sbjct  234  PWVSLPKGKGIKLTIIEEARKRLAGQ  259



>ref|XP_009130977.1| PREDICTED: 40S ribosomal protein S4-1-like [Brassica rapa]
Length=262

 Score =   196 bits (498),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 125/146 (86%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            +RDEE KFKLCKVR+ Q G+KGIP++ TYDGRTIRYPDPLIK ND +KLDLE NKVVDFI
Sbjct  114  VRDEEAKFKLCKVRTIQLGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKVVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +HIQD+TGHE  TRLGN F +GKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTLGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              V  PKGKGIKL+I EEA+KRL+AQ
Sbjct  234  PWVSLPKGKGIKLTIIEEARKRLSAQ  259



>ref|XP_008234249.1| PREDICTED: 40S ribosomal protein S4 [Prunus mume]
Length=265

 Score =   196 bits (498),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRDEE KFKLCKVRS QFG+KGIP+I TYDGRTIRYPDPLIK ND +KLDLE+NK+ DFI
Sbjct  114  IRDEESKFKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKITDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +H+QDATGHE  TRLGN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHVQDATGHEFATRLGNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKR  103
              V  PKGKGIKL+I EEAKKR
Sbjct  234  PWVSLPKGKGIKLTILEEAKKR  255



>ref|XP_009402521.1| PREDICTED: 40S ribosomal protein S4-3-like [Musa acuminata subsp. 
malaccensis]
Length=265

 Score =   196 bits (498),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            +RDEE KFKLCKVRS +FG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLE+NK+VDFI
Sbjct  114  VRDEEAKFKLCKVRSVRFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLEANKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR  GRVGVIKNREKHKGSFE +H+QDATGHE  TR+GN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNTGRVGVIKNREKHKGSFETIHVQDATGHEFATRMGNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRL  100
              V  PKGKGIKLSI EEA+KRL
Sbjct  234  PWVSLPKGKGIKLSIIEEARKRL  256



>gb|KJB38001.1| hypothetical protein B456_006G231800 [Gossypium raimondii]
Length=191

 Score =   193 bits (491),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 111/139 (80%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = -3

Query  507  FKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFIKXDvgnv  328
            FKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +K DLESNK+VDFIK DVGNV
Sbjct  50   FKLCKVRSVQFGRKGIPYLNTYDGRTIRYPDPLIKANDTIKFDLESNKIVDFIKFDVGNV  109

Query  327  vmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXKXXVXXPK  148
            VMV GGR RGRVGVIKNREKHKGSFE +H+QDA GHE  TRLGN F IGKG K  V  PK
Sbjct  110  VMVTGGRNRGRVGVIKNREKHKGSFETIHVQDAAGHEFATRLGNVFTIGKGTKPWVSLPK  169

Query  147  GKGIKLSIXEEAKKRLAAQ  91
            GKGIKLSI EEA+KRLAAQ
Sbjct  170  GKGIKLSIIEEARKRLAAQ  188



>ref|XP_010515129.1| PREDICTED: 40S ribosomal protein S4-1 [Camelina sativa]
 ref|XP_010467507.1| PREDICTED: 40S ribosomal protein S4-1 [Camelina sativa]
 ref|XP_010489362.1| PREDICTED: 40S ribosomal protein S4-1 [Camelina sativa]
Length=262

 Score =   196 bits (497),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 126/146 (86%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            I+DEE KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLE NK+V+FI
Sbjct  114  IKDEEAKFKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVEFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +HIQD+TGHE  TRLGN F +GKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTLGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              V  PKGKGIKL+I EEA+KRL+AQ
Sbjct  234  PWVSLPKGKGIKLTIIEEARKRLSAQ  259



>sp|O81363.1|RS4_PRUAR RecName: Full=40S ribosomal protein S4 [Prunus armeniaca]
 gb|AAC24585.1| 40S ribosomal protein S4 [Prunus armeniaca]
Length=261

 Score =   196 bits (497),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRDEE KFKLCKVRS QFG+KGIP+I TYDGRTIRYPDPLIK ND +KLDLE+NK+ DFI
Sbjct  110  IRDEESKFKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKITDFI  169

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +H+QDATGHE  TRLGN F IGKG K
Sbjct  170  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHVQDATGHEFATRLGNVFTIGKGTK  229

Query  168  XXVXXPKGKGIKLSIXEEAKKR  103
              V  PKGKGIKL+I EEAKKR
Sbjct  230  PWVSLPKGKGIKLTILEEAKKR  251



>gb|KHG26321.1| 40S ribosomal S4 [Gossypium arboreum]
Length=262

 Score =   196 bits (497),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 124/146 (85%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            I  +E KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLESNK+V+FI
Sbjct  114  ITGDETKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVNFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +H+QDA GHE  TRLGN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHVQDAAGHEFATRLGNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              V  PKGKGIKLSI EEA+KRLAAQ
Sbjct  234  PWVSLPKGKGIKLSIIEEARKRLAAQ  259



>emb|CDY58877.1| BnaA03g55550D [Brassica napus]
Length=279

 Score =   196 bits (499),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 125/146 (86%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            +RDEE KFKLCKVR+ Q G+KGIP++ TYDGRTIRYPDPLIK ND +KLDLE NKVVDFI
Sbjct  131  VRDEEAKFKLCKVRTIQLGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKVVDFI  190

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +HIQD+TGHE  TRLGN F +GKG K
Sbjct  191  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTLGKGTK  250

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              V  PKGKGIKL+I EEA+KRL+AQ
Sbjct  251  PWVSLPKGKGIKLTIIEEARKRLSAQ  276



>ref|XP_006298349.1| hypothetical protein CARUB_v10014418mg [Capsella rubella]
 gb|EOA31247.1| hypothetical protein CARUB_v10014418mg [Capsella rubella]
Length=262

 Score =   196 bits (497),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 126/146 (86%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            I+DEE KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLE NK+V+FI
Sbjct  114  IKDEEAKFKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVEFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +HIQD+TGHE  TRLGN F +GKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTLGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              V  PKGKGIKL+I EEA+KRL+AQ
Sbjct  234  PWVSLPKGKGIKLTIIEEARKRLSAQ  259



>ref|XP_008789926.1| PREDICTED: 40S ribosomal protein S4-1 isoform X2 [Phoenix dactylifera]
Length=263

 Score =   196 bits (497),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 124/146 (85%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            +RDEE KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLE+NK+ DFI
Sbjct  114  VRDEEAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKSNDTIKLDLETNKIADFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +H+QDA GHE  TR+GN F +GKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHLQDALGHEFATRIGNVFTVGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              V  PKGKGIKLSI EEA+KRLAA 
Sbjct  234  PWVSLPKGKGIKLSIIEEARKRLAAS  259



>gb|ABK92450.1| unknown [Populus trichocarpa]
Length=263

 Score =   196 bits (497),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 125/146 (86%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            +R++E KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLESNK+VDFI
Sbjct  114  LREDEAKFKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K  VGNVVMV GGR RGRVGVIKNREKHKGSFE +H+QDATGHE  TRLGN F IGKG K
Sbjct  174  KFGVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHVQDATGHEFATRLGNVFTIGKGSK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              +  PKGKGIKLSI EEAK+RLAA 
Sbjct  234  PWISLPKGKGIKLSIIEEAKERLAAS  259



>ref|NP_568179.1| 40S ribosomal protein S4-2 [Arabidopsis thaliana]
 sp|P49204.4|RS42_ARATH RecName: Full=40S ribosomal protein S4-2 [Arabidopsis thaliana]
 emb|CAB87265.1| ribosomal protein S4 [Arabidopsis thaliana]
 gb|AAK93610.1| putative 40S ribosomal protein S4 [Arabidopsis thaliana]
 gb|AAL50106.1| AT5g07090/T28J14_30 [Arabidopsis thaliana]
 gb|AAL85148.1| putative 40S ribosomal protein S4 [Arabidopsis thaliana]
 gb|AAM10339.1| AT5g07090/T28J14_30 [Arabidopsis thaliana]
 gb|AAM61755.1| 40S ribosomal protein S4 [Arabidopsis thaliana]
 gb|AED91107.1| 40S ribosomal protein S4-2 [Arabidopsis thaliana]
Length=262

 Score =   196 bits (497),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 126/146 (86%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            I+DEE KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLE NK+V+FI
Sbjct  114  IKDEEAKFKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVEFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +HIQD+TGHE  TRLGN + IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVYTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              V  PKGKGIKL+I EEA+KRLA+Q
Sbjct  234  PWVSLPKGKGIKLTIIEEARKRLASQ  259



>ref|NP_565414.1| 40S ribosomal protein S4-1 [Arabidopsis thaliana]
 sp|Q93VH9.1|RS41_ARATH RecName: Full=40S ribosomal protein S4-1 [Arabidopsis thaliana]
 gb|AAK43846.1|AF370469_1 Unknown protein [Arabidopsis thaliana]
 gb|AAK59636.1| putative ribosomal protein S4 [Arabidopsis thaliana]
 gb|AAL34157.1| putative ribosomal protein S4 [Arabidopsis thaliana]
 gb|AAL47338.1| unknown protein [Arabidopsis thaliana]
 gb|AAM60830.1| putative ribosomal protein S4 [Arabidopsis thaliana]
 gb|AEC06616.1| 40S ribosomal protein S4-1 [Arabidopsis thaliana]
Length=261

 Score =   195 bits (496),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 126/146 (86%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            I+DEE KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLE NK+V+FI
Sbjct  114  IKDEEAKFKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVEFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +HIQD+TGHE  TRLGN + IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVYTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              V  PKGKGIKL+I EEA+KRL+AQ
Sbjct  234  PWVSLPKGKGIKLTIIEEARKRLSAQ  259



>dbj|BAB11167.1| 40S ribosomal protein S4 [Arabidopsis thaliana]
Length=263

 Score =   196 bits (497),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 126/146 (86%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            I+DEE KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLE NK+V+FI
Sbjct  115  IKDEEAKFKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVEFI  174

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +HIQD+TGHE  TRLGN + IGKG K
Sbjct  175  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVYTIGKGTK  234

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              V  PKGKGIKL+I EEA+KRLA+Q
Sbjct  235  PWVSLPKGKGIKLTIIEEARKRLASQ  260



>ref|XP_011046165.1| PREDICTED: 40S ribosomal protein S4-2-like [Populus euphratica]
Length=263

 Score =   196 bits (497),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 125/146 (86%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            +R++E KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLE+ K+VDFI
Sbjct  114  LREDEAKFKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLENYKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +HIQDATGHE  TRLGN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDATGHEFATRLGNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              V  PKGKGIKLSI EEA+KRLAA 
Sbjct  234  PWVSLPKGKGIKLSIIEEARKRLAAS  259



>emb|CDY32700.1| BnaA02g07620D [Brassica napus]
Length=301

 Score =   196 bits (499),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 125/146 (86%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            I+DEE KFKLCKVR+  FG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLE NKVV+FI
Sbjct  156  IKDEEAKFKLCKVRTISFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKVVEFI  215

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +HIQDATGHE  TRLGN F +GKG K
Sbjct  216  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDATGHEFATRLGNVFTLGKGTK  275

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              V  PKGKGIKL+I EEA+KRLAAQ
Sbjct  276  PWVSLPKGKGIKLTIIEEARKRLAAQ  301



>gb|KFK36724.1| hypothetical protein AALP_AA4G161500 [Arabis alpina]
Length=262

 Score =   195 bits (496),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 125/146 (86%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            I DEE KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDP IK ND +KLDLE+NK+V+FI
Sbjct  114  ISDEEAKFKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPFIKPNDTIKLDLEANKIVEFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +HIQD+TGHE  TRLGN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              V  PKGKGIKL+I EEA+KRL+AQ
Sbjct  234  PWVSLPKGKGIKLTIIEEARKRLSAQ  259



>gb|EPS70681.1| hypothetical protein M569_04077, partial [Genlisea aurea]
Length=256

 Score =   195 bits (496),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 123/144 (85%), Gaps = 0/144 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRDEE KFKLCKVRS QFGKKGIP++ TYDGRTIRYPDPLIK ND +KLDLE NK+VDFI
Sbjct  113  IRDEESKFKLCKVRSVQFGKKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLEENKIVDFI  172

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVG+IKNREKHKG+FE +H+QDA GHE  TRLGN F IGKG K
Sbjct  173  KFDVGNVVMVTGGRNRGRVGIIKNREKHKGTFETIHVQDAAGHEFATRLGNVFIIGKGTK  232

Query  168  XXVXXPKGKGIKLSIXEEAKKRLA  97
              V  PKGKGIKLSI EEA+KR+A
Sbjct  233  PWVSLPKGKGIKLSIIEEARKRVA  256



>gb|KDO67006.1| hypothetical protein CISIN_1g024108mg [Citrus sinensis]
Length=247

 Score =   194 bits (494),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 123/151 (81%), Gaps = 0/151 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRDEE KFKLCKVRS QFG+KGIP+I TYDGRTIRYPDPLIK ND +KLDLE+NK+ +FI
Sbjct  96   IRDEEAKFKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKITEFI  155

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVG+IKNREKHKGSFE +HIQDA GHE  TRLGN F IGKG K
Sbjct  156  KFDVGNVVMVTGGRNRGRVGIIKNREKHKGSFETIHIQDALGHEFATRLGNVFTIGKGTK  215

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQXXTTA  76
              V  PKGKGIKLSI EEA+KR A      A
Sbjct  216  PWVSLPKGKGIKLSIIEEARKRQALATSAAA  246



>ref|XP_010243101.1| PREDICTED: 40S ribosomal protein S4-3-like [Nelumbo nucifera]
Length=264

 Score =   195 bits (496),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 127/151 (84%), Gaps = 0/151 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            I+DEE KFKLCKVRS QFG KGIP++ TYDGRTIRYPDPLI+ ND +K+DLE+NK+ DFI
Sbjct  114  IKDEEAKFKLCKVRSVQFGDKGIPYLNTYDGRTIRYPDPLIRANDTIKIDLEANKITDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVG+IKNREKHKGSFE +HIQDATGHE  TRLGN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGIIKNREKHKGSFETIHIQDATGHEFATRLGNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQXXTTA  76
              V  PKGKGIKLSI EEA+KR+AA   +TA
Sbjct  234  PWVSLPKGKGIKLSIIEEARKRIAAAAASTA  264



>ref|XP_009369212.1| PREDICTED: 40S ribosomal protein S4-3 [Pyrus x bretschneideri]
Length=264

 Score =   195 bits (495),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRDEE KFKLCKVRS QFG+KGIP+I TYDGRTIRYPDPLIK ND +KLDLE+NK+ DFI
Sbjct  114  IRDEEAKFKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLEANKITDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +H+QDATGHE  TRLGN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHVQDATGHEFATRLGNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKR  103
              V  PKG+GIKL+I EEAKKR
Sbjct  234  PWVSLPKGRGIKLTIIEEAKKR  255



>emb|CDY14056.1| BnaC02g01730D [Brassica napus]
Length=291

 Score =   196 bits (497),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 126/146 (86%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            +RDEE KFKLCKVR+ QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLE NK+V+FI
Sbjct  143  LRDEEAKFKLCKVRTIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVEFI  202

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +HIQD+TGHE  TRLGN F +GKG K
Sbjct  203  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTLGKGTK  262

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              V  PKGKGIKL+I EEA+KRL+AQ
Sbjct  263  PWVSLPKGKGIKLTIIEEARKRLSAQ  288



>ref|XP_006488578.1| PREDICTED: 40S ribosomal protein S4-like [Citrus sinensis]
 gb|KDO67005.1| hypothetical protein CISIN_1g024108mg [Citrus sinensis]
Length=265

 Score =   195 bits (495),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 123/151 (81%), Gaps = 0/151 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRDEE KFKLCKVRS QFG+KGIP+I TYDGRTIRYPDPLIK ND +KLDLE+NK+ +FI
Sbjct  114  IRDEEAKFKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKITEFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVG+IKNREKHKGSFE +HIQDA GHE  TRLGN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGIIKNREKHKGSFETIHIQDALGHEFATRLGNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQXXTTA  76
              V  PKGKGIKLSI EEA+KR A      A
Sbjct  234  PWVSLPKGKGIKLSIIEEARKRQALATSAAA  264



>emb|CDY02821.1| BnaC02g10680D [Brassica napus]
Length=275

 Score =   195 bits (496),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 125/146 (86%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            I+DEE KFKLCKVR+  FG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLE NKVV+FI
Sbjct  130  IKDEEAKFKLCKVRTISFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKVVEFI  189

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +HIQDATGHE  TRLGN F +GKG K
Sbjct  190  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDATGHEFATRLGNVFTLGKGTK  249

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              V  PKGKGIKL+I EEA+KRLAAQ
Sbjct  250  PWVSLPKGKGIKLTIIEEARKRLAAQ  275



>ref|XP_010453688.1| PREDICTED: 40S ribosomal protein S4-3-like [Camelina sativa]
Length=262

 Score =   195 bits (495),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 125/146 (86%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRDEE KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLE+NK+V+FI
Sbjct  114  IRDEEAKFKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEANKIVEFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +HIQD+TGHE  TRLGN F +GKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTLGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              V  PKGKGIKL+I EEA+KRL  Q
Sbjct  234  PWVSLPKGKGIKLTIIEEARKRLGDQ  259



>ref|XP_004307685.1| PREDICTED: 40S ribosomal protein S4-like [Fragaria vesca subsp. 
vesca]
Length=264

 Score =   195 bits (495),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 125/151 (83%), Gaps = 0/151 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRDEE KFKLCKVRS QFG+K IP+I TYDGRTIRYPDPLIK ND +KLDLE+NK+ DFI
Sbjct  114  IRDEESKFKLCKVRSVQFGQKNIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKITDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIK+REKHKGSFE +H+QD+TGHE  TRLGN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKSREKHKGSFETIHVQDSTGHEFATRLGNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQXXTTA  76
              V  PKG+GIKLSI EEA+KR AA   + A
Sbjct  234  PWVSLPKGRGIKLSIIEEARKRQAALQASAA  264



>ref|XP_002322175.1| hypothetical protein POPTR_0015s09110g [Populus trichocarpa]
 gb|EEF06302.1| hypothetical protein POPTR_0015s09110g [Populus trichocarpa]
Length=263

 Score =   195 bits (495),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 125/146 (86%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            +R++E KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLE+ K+VD+I
Sbjct  114  LREDEAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLENYKIVDYI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +H+QDATGHE  TRLGN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHVQDATGHEFATRLGNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              V  PKGKGIKLSI EEAKKRLAA 
Sbjct  234  PWVSLPKGKGIKLSIIEEAKKRLAAS  259



>ref|XP_007211867.1| hypothetical protein PRUPE_ppa010094mg [Prunus persica]
 ref|XP_008225941.1| PREDICTED: 40S ribosomal protein S4-like [Prunus mume]
 gb|EMJ13066.1| hypothetical protein PRUPE_ppa010094mg [Prunus persica]
Length=264

 Score =   195 bits (495),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRDEE KFKLCKVRS QFG+KGIP+I TYDGRTIRYPDPLIK ND +KLDLE+NK+ DFI
Sbjct  114  IRDEEAKFKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKITDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +H+QDA+GHE  TRLGN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHVQDASGHEFATRLGNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKR  103
              V  PKGKGIKL+I EEAKKR
Sbjct  234  PWVSLPKGKGIKLTIIEEAKKR  255



>gb|KJB17112.1| hypothetical protein B456_002G266000 [Gossypium raimondii]
Length=237

 Score =   194 bits (492),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 123/146 (84%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            I  +E KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLESNK+VDFI
Sbjct  89   ITGDETKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFI  148

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +H+QDA GHE  TRLGN F IGKG K
Sbjct  149  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHVQDAAGHEFATRLGNVFTIGKGTK  208

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              V  PK KGIKLSI EEA+KRLAAQ
Sbjct  209  PWVSLPKRKGIKLSIIEEARKRLAAQ  234



>gb|KFK27370.1| hypothetical protein AALP_AA8G374100 [Arabis alpina]
Length=262

 Score =   194 bits (494),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 125/146 (86%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            I D E KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLE+NK+V+FI
Sbjct  114  ISDVEAKFKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEANKIVEFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +HIQD+TGHE  TRLGN F +GKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTLGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              V  PKGKGIKL+I EEA+KRLAAQ
Sbjct  234  PWVSLPKGKGIKLTIIEEARKRLAAQ  259



>emb|CDY05015.1| BnaAnng01970D [Brassica napus]
Length=305

 Score =   196 bits (497),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 125/146 (86%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRDEE KFKLCKVR+ QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLE NK+V+FI
Sbjct  157  IRDEEAKFKLCKVRTIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVEFI  216

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +HIQD+TGHE  TRLGN F +GKG K
Sbjct  217  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTLGKGTK  276

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              V  PKGKGIKL+I EEA KRL+AQ
Sbjct  277  PWVSLPKGKGIKLTIIEEAWKRLSAQ  302



>ref|XP_008789925.1| PREDICTED: 40S ribosomal protein S4-1 isoform X1 [Phoenix dactylifera]
Length=319

 Score =   196 bits (498),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 124/146 (85%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            +RDEE KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLE+NK+ DFI
Sbjct  114  VRDEEAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKSNDTIKLDLETNKIADFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +H+QDA GHE  TR+GN F +GKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHLQDALGHEFATRIGNVFTVGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              V  PKGKGIKLSI EEA+KRLAA 
Sbjct  234  PWVSLPKGKGIKLSIIEEARKRLAAS  259



>ref|XP_010423256.1| PREDICTED: 40S ribosomal protein S4-3-like [Camelina sativa]
Length=258

 Score =   194 bits (493),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 112/145 (77%), Positives = 126/145 (87%), Gaps = 0/145 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            I+DEE KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLE+NK+V+FI
Sbjct  114  IKDEEAKFKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEANKIVEFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +HIQD+TGHE  TRLGN F +GKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTLGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAA  94
              V  PKGKGIKL+I EEA+KRLA+
Sbjct  234  PWVSLPKGKGIKLTIIEEARKRLAS  258



>ref|XP_010907826.1| PREDICTED: 40S ribosomal protein S4-3-like [Elaeis guineensis]
Length=265

 Score =   194 bits (493),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRDEE KFKLCKVRS QFG KGIP++ TYDGRTIRYPDPLIK ND +KLDLE+ K+VDFI
Sbjct  114  IRDEEAKFKLCKVRSVQFGHKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLETYKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +H+QDATGHE  TRLGN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHLQDATGHEFATRLGNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRL  100
              V  PKGKGIKLSI EEA+KRL
Sbjct  234  PWVSLPKGKGIKLSIIEEARKRL  256



>sp|P46299.1|RS4_GOSHI RecName: Full=40S ribosomal protein S4 [Gossypium hirsutum]
 emb|CAA55882.1| ribosomal protein, small subunit 4e (RS4e) [Gossypium hirsutum]
 gb|KJB17110.1| hypothetical protein B456_002G266000 [Gossypium raimondii]
Length=262

 Score =   194 bits (493),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 123/146 (84%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            I  +E KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLESNK+VDFI
Sbjct  114  ITGDETKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +H+QDA GHE  TRLGN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHVQDAAGHEFATRLGNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              V  PK KGIKLSI EEA+KRLAAQ
Sbjct  234  PWVSLPKRKGIKLSIIEEARKRLAAQ  259



>ref|XP_010491309.1| PREDICTED: 40S ribosomal protein S4-3-like [Camelina sativa]
Length=262

 Score =   194 bits (493),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 126/146 (86%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            I+DEE KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLE+ K+V+FI
Sbjct  114  IKDEEAKFKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEAKKIVEFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +HIQD+TGHE  TRLGN F +GKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTLGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              V  PKGKGIKL+I EEA+KRLA+Q
Sbjct  234  PWVSLPKGKGIKLTIIEEARKRLASQ  259



>ref|XP_010276734.1| PREDICTED: 40S ribosomal protein S4-3 [Nelumbo nucifera]
Length=267

 Score =   194 bits (493),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            I+DEE KFKLCKVRS QFG KGIP++ TYDGRTIRYPDPLI+ ND +KLDLE+NK++DFI
Sbjct  114  IKDEEAKFKLCKVRSVQFGDKGIPYLNTYDGRTIRYPDPLIRANDTIKLDLETNKIIDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +H+QDATGHE  TRLGN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHVQDATGHEFATRLGNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRL  100
              V  PKGKGIKLSI EEA+KR+
Sbjct  234  PWVSLPKGKGIKLSIIEEARKRI  256



>ref|XP_010243078.1| PREDICTED: 40S ribosomal protein S4-3-like [Nelumbo nucifera]
Length=265

 Score =   194 bits (492),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            I+DEE KFKLCKVRS QFG KGIP+I TYDGRTIRYPDPLI+ ND +KLDLE+NK+ DFI
Sbjct  114  IKDEEAKFKLCKVRSVQFGDKGIPYINTYDGRTIRYPDPLIRANDTIKLDLETNKIADFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +HIQDATGHE  TRLGN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDATGHEFATRLGNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRL  100
              V  PKGKGIKLSI EEA+KR+
Sbjct  234  PWVSLPKGKGIKLSIIEEARKRI  256



>emb|CDY60025.1| BnaAnng16450D [Brassica napus]
Length=285

 Score =   194 bits (493),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 124/146 (85%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRDEE KFKLCKVR+ Q G+KGIP++ TYDGRTIRYPDPLIK ND +KLDLE NK+V+FI
Sbjct  137  IRDEEAKFKLCKVRTIQVGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVEFI  196

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +HIQD+TGHE  TRLGN F +GKG K
Sbjct  197  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTLGKGTK  256

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              V  PKGKGIKL+I EEAKKRLA Q
Sbjct  257  PWVSLPKGKGIKLTIIEEAKKRLAGQ  282



>ref|XP_004492491.1| PREDICTED: 40S ribosomal protein S4-2-like [Cicer arietinum]
Length=264

 Score =   194 bits (492),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 110/151 (73%), Positives = 125/151 (83%), Gaps = 0/151 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            +RD+E KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLE NK+ DFI
Sbjct  114  VRDDEAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLEQNKIADFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKG+FE VH+QDATG+E  TRL N F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGTFETVHVQDATGNEFATRLSNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQXXTTA  76
              V  PKG+GIKL++ EEA+KR+AAQ    A
Sbjct  234  PWVSLPKGRGIKLTVIEEARKRIAAQQVAAA  264



>ref|XP_004293830.1| PREDICTED: 40S ribosomal protein S4-3 [Fragaria vesca subsp. 
vesca]
Length=264

 Score =   193 bits (491),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRDEE KFKLCKVRS QFG+K IP+I TYDGRTIRYPDPLIK ND +KLDLE+NK+VDFI
Sbjct  114  IRDEEAKFKLCKVRSVQFGQKNIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIK+REKHKGSFE +H+QDATGHE  TRLGN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKSREKHKGSFETIHVQDATGHEFATRLGNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKR  103
              V  PKGKGIKL+I EEAKKR
Sbjct  234  PWVSLPKGKGIKLTIIEEAKKR  255



>ref|XP_010483440.1| PREDICTED: 40S ribosomal protein S4-3-like [Camelina sativa]
Length=262

 Score =   193 bits (490),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 124/146 (85%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRDEE K KLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLE+NK+V+FI
Sbjct  114  IRDEEAKLKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEANKIVEFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +HIQD+TGHE  TRLGN F +GKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTLGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              V  PKGKGIKL+I EEA+KRL  Q
Sbjct  234  PWVSLPKGKGIKLTIIEEARKRLGDQ  259



>gb|KFK25102.1| hypothetical protein AALP_AA8G066400 [Arabis alpina]
Length=262

 Score =   192 bits (489),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 124/146 (85%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            I D E KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLE NK+V+FI
Sbjct  114  ISDVEAKFKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVEFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +HIQD+TGHE  TRLGN F +GKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTLGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              V  PKGKGIKL+I EEA+KRL+AQ
Sbjct  234  PWVSLPKGKGIKLTIIEEARKRLSAQ  259



>ref|XP_009126753.1| PREDICTED: 40S ribosomal protein S4-1-like isoform X2 [Brassica 
rapa]
Length=319

 Score =   194 bits (493),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 124/146 (85%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            I+DEE KFKLCKVR+  FG+KGIP++ TYDGR IRYPDPLIK ND +KLDLE NKVV+FI
Sbjct  174  IKDEEAKFKLCKVRTISFGQKGIPYLNTYDGRPIRYPDPLIKPNDTIKLDLEENKVVEFI  233

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +HIQDATGHE  TRLGN F +GKG K
Sbjct  234  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDATGHEFATRLGNVFTLGKGTK  293

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              V  PKGKGIKL+I EEA+KRLAAQ
Sbjct  294  PWVSLPKGKGIKLTIIEEARKRLAAQ  319



>gb|KHG30303.1| 40S ribosomal S4 [Gossypium arboreum]
Length=262

 Score =   192 bits (488),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 122/146 (84%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            I  +E KFKLCKVRS QFG+K IP++ TYDGRTIRYPDPLIK ND +KLDLESNK+VDFI
Sbjct  114  ITGDETKFKLCKVRSVQFGQKSIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIK REKHKGSFE +H+QDA GHE  TRLGN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKKREKHKGSFETIHVQDAAGHEFATRLGNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              V  PKGKGIKLSI EEA+KRLAAQ
Sbjct  234  PWVSLPKGKGIKLSIIEEARKRLAAQ  259



>ref|XP_009132054.1| PREDICTED: 40S ribosomal protein S4-2-like [Brassica rapa]
Length=262

 Score =   192 bits (488),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 123/146 (84%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRDEE KFKLCKVR+ Q G+KGIP++ TYDGRTIRYPDP IK ND +KLDLE NK+V+FI
Sbjct  114  IRDEEAKFKLCKVRTIQVGQKGIPYLNTYDGRTIRYPDPFIKPNDTIKLDLEENKIVEFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +HIQD+TGHE  TRLGN F +GKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTLGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              V  PKGKGIKL+I EEAKKRLA Q
Sbjct  234  PWVSLPKGKGIKLTIIEEAKKRLAGQ  259



>ref|XP_009354210.1| PREDICTED: 40S ribosomal protein S4-3-like [Pyrus x bretschneideri]
Length=265

 Score =   192 bits (488),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 121/142 (85%), Gaps = 0/142 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRDEE KFKLCKVRS QFG+KGIP++ T+DGRTIRYPDPLIK ND +KLDLE+NK+ DFI
Sbjct  114  IRDEEAKFKLCKVRSVQFGQKGIPYLNTFDGRTIRYPDPLIKANDTIKLDLEANKITDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +H+QDA GHE  TRLGN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHVQDALGHEFATRLGNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKR  103
              V  PKGKGIKLSI EEAKKR
Sbjct  234  PWVSLPKGKGIKLSIIEEAKKR  255



>ref|XP_008356229.1| PREDICTED: 40S ribosomal protein S4-3-like [Malus domestica]
Length=269

 Score =   192 bits (488),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 121/142 (85%), Gaps = 0/142 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRDEE KFKLCKVRS QFG+KGIP++ T+DGRTIRYPDPLIK ND +KLDLE+NK+ DFI
Sbjct  118  IRDEEAKFKLCKVRSVQFGQKGIPYLNTFDGRTIRYPDPLIKANDTIKLDLEANKITDFI  177

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +H+QDA GHE  TRLGN F IGKG K
Sbjct  178  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHVQDALGHEFATRLGNVFTIGKGTK  237

Query  168  XXVXXPKGKGIKLSIXEEAKKR  103
              V  PKGKGIKLSI EEAKKR
Sbjct  238  PWVSLPKGKGIKLSIIEEAKKR  259



>ref|XP_009126752.1| PREDICTED: 40S ribosomal protein S4-1-like isoform X1 [Brassica 
rapa]
Length=348

 Score =   194 bits (494),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 124/146 (85%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            I+DEE KFKLCKVR+  FG+KGIP++ TYDGR IRYPDPLIK ND +KLDLE NKVV+FI
Sbjct  203  IKDEEAKFKLCKVRTISFGQKGIPYLNTYDGRPIRYPDPLIKPNDTIKLDLEENKVVEFI  262

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +HIQDATGHE  TRLGN F +GKG K
Sbjct  263  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDATGHEFATRLGNVFTLGKGTK  322

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              V  PKGKGIKL+I EEA+KRLAAQ
Sbjct  323  PWVSLPKGKGIKLTIIEEARKRLAAQ  348



>ref|XP_009122377.1| PREDICTED: 40S ribosomal protein S4-1 [Brassica rapa]
Length=262

 Score =   192 bits (487),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 124/146 (85%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRDEE KFKLCKVR+ Q G+KGIP++ TYDGRTIRYPDPLIK ND +KLDLE NK+VD I
Sbjct  114  IRDEEAKFKLCKVRTIQVGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVDSI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +HIQD+TGHE  TRLGN F +GKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTLGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              V  PKGKGIKL+I EEA+KRL+AQ
Sbjct  234  PWVSLPKGKGIKLTIIEEARKRLSAQ  259



>emb|CDX70008.1| BnaA10g23570D [Brassica napus]
Length=269

 Score =   192 bits (487),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 124/146 (85%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRDEE KFKLCKVR+ Q G+KGIP++ TYDGRTIRYPDPLIK ND +KLDLE NK+VD I
Sbjct  121  IRDEEAKFKLCKVRTIQVGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVDSI  180

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +HIQD+TGHE  TRLGN F +GKG K
Sbjct  181  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTLGKGTK  240

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              V  PKGKGIKL+I EEA+KRL+AQ
Sbjct  241  PWVSLPKGKGIKLTIIEEARKRLSAQ  266



>gb|KDP45131.1| hypothetical protein JCGZ_17463 [Jatropha curcas]
Length=264

 Score =   191 bits (486),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 126/151 (83%), Gaps = 0/151 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            +RDEE KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLESNK+ DFI
Sbjct  114  VRDEEAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKITDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +HIQDATGHE  TRLGN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDATGHEFATRLGNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQXXTTA  76
              V  PKGKGIKLSI EEA+KR AA   T A
Sbjct  234  PWVSLPKGKGIKLSIIEEARKRQAAAAQTVA  264



>emb|CDX99006.1| BnaC09g48290D [Brassica napus]
Length=288

 Score =   192 bits (488),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 124/146 (85%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRDEE KFKLCKVR+ Q G+KGIP++ TYDGRTIRYPDPLIK ND +KLDLE NK+VD I
Sbjct  140  IRDEEAKFKLCKVRTIQVGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVDSI  199

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +HIQD+TGHE  TRLGN F +GKG K
Sbjct  200  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTLGKGTK  259

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              V  PKGKGIKL+I EEA+KRL+AQ
Sbjct  260  PWVSLPKGKGIKLTIIEEARKRLSAQ  285



>emb|CDY69841.1| BnaAnng31720D [Brassica napus]
Length=311

 Score =   192 bits (489),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 123/146 (84%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRDEE KFKLCKVR+ Q G+KGIP++ TYDGRTIRYPDP IK ND +KLDLE NK+V+FI
Sbjct  163  IRDEEAKFKLCKVRTIQVGQKGIPYLNTYDGRTIRYPDPFIKPNDTIKLDLEENKIVEFI  222

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +HIQD+TGHE  TRLGN F +GKG K
Sbjct  223  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTLGKGTK  282

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              V  PKGKGIKL+I EEAKKRLA Q
Sbjct  283  PWVSLPKGKGIKLTIIEEAKKRLAGQ  308



>emb|CDY57385.1| BnaCnng31910D [Brassica napus]
Length=298

 Score =   192 bits (487),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 123/146 (84%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRDEE KFKLCKVR+ Q G+KGIP++ TYDGRTIRYPDPLIK ND +KLDLE NK+VD I
Sbjct  150  IRDEEAKFKLCKVRTIQVGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVDSI  209

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +HIQD+TGHE  TRLGN F +GKG K
Sbjct  210  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTLGKGTK  269

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              V  PKGKGIKL+I EEA+KRLA Q
Sbjct  270  PWVSLPKGKGIKLTIIEEARKRLAGQ  295



>ref|XP_009369565.1| PREDICTED: 40S ribosomal protein S4-3-like [Pyrus x bretschneideri]
Length=264

 Score =   190 bits (483),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 121/142 (85%), Gaps = 0/142 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRDEE KFKLCKVRS QFG+KGIP++ T+DGRTIRYPDPLIK ND +KLDLE++K+ DFI
Sbjct  114  IRDEEAKFKLCKVRSVQFGQKGIPYLNTFDGRTIRYPDPLIKANDTIKLDLETSKITDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +H+QDA GHE  TRLGN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHVQDALGHEFATRLGNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKR  103
              V  PKGKGIKLSI EEAKKR
Sbjct  234  PWVSLPKGKGIKLSIIEEAKKR  255



>ref|XP_009120350.1| PREDICTED: 40S ribosomal protein S4-1 [Brassica rapa]
Length=262

 Score =   190 bits (483),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 111/146 (76%), Positives = 123/146 (84%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRDEE KFKLCKVR+ Q G+KGIP++ TYDGRTIRYPDPLIK ND +KLDLE NK+VD I
Sbjct  114  IRDEEAKFKLCKVRTIQVGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVDSI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +HIQD+TGHE  TRLGN F +GKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTLGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              V  PKGKGIKL+I EEA+KRL+ Q
Sbjct  234  PWVSLPKGKGIKLTIIEEARKRLSGQ  259



>emb|CDY32986.1| BnaA10g11920D [Brassica napus]
Length=288

 Score =   191 bits (484),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 111/146 (76%), Positives = 123/146 (84%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRDEE KFKLCKVR+ Q G+KGIP++ TYDGRTIRYPDPLIK ND +KLDLE NK+VD I
Sbjct  140  IRDEEAKFKLCKVRTIQVGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVDSI  199

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +HIQD+TGHE  TRLGN F +GKG K
Sbjct  200  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTLGKGTK  259

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              V  PKGKGIKL+I EEA+KRL+ Q
Sbjct  260  PWVSLPKGKGIKLTIIEEARKRLSGQ  285



>ref|XP_007205728.1| hypothetical protein PRUPE_ppa010072mg [Prunus persica]
 gb|EMJ06927.1| hypothetical protein PRUPE_ppa010072mg [Prunus persica]
Length=265

 Score =   189 bits (481),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRDEE KFKLCKVRS QFG+KGIP+I TYDGRTIRYPDPLIK ND +KLDLE+NK+ DFI
Sbjct  114  IRDEESKFKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKITDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +H+QDATGHE  TRLGN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHVQDATGHEFATRLGNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEE  115
              V  PKGKGIKL+I EE
Sbjct  234  PWVSLPKGKGIKLTILEE  251



>ref|XP_010676809.1| PREDICTED: 40S ribosomal protein S4-1-like [Beta vulgaris subsp. 
vulgaris]
Length=263

 Score =   189 bits (480),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 123/150 (82%), Gaps = 0/150 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            +RDEE K+KLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLESNK+VDFI
Sbjct  114  VRDEEAKYKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVG++KNREKHKGSFE +HI+DA GHE  TR GN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGILKNREKHKGSFETIHIEDAAGHEFATRQGNVFIIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQXXTT  79
              V  PKGKGIKL+I EEA+KR   +  T 
Sbjct  234  PWVSVPKGKGIKLTIIEEARKRQQKEATTA  263



>ref|XP_010666843.1| PREDICTED: 40S ribosomal protein S4-1 [Beta vulgaris subsp. vulgaris]
Length=262

 Score =   188 bits (477),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 112/151 (74%), Positives = 124/151 (82%), Gaps = 2/151 (1%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRDEE KFKLCKVR+ QFG KGIP++ TYDGRTIRYPDPLI+ ND +KLDLE NK+VDFI
Sbjct  114  IRDEEAKFKLCKVRNVQFGTKGIPYLNTYDGRTIRYPDPLIRANDTIKLDLEENKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +HIQD+ GHE  TR+GN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSQGHEFATRMGNVFIIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQXXTTA  76
              V  PKGKGIKL+I EEA+KR  A+   TA
Sbjct  234  PWVSLPKGKGIKLTIIEEARKR--AEKTATA  262



>gb|KDO63243.1| hypothetical protein CISIN_1g023289mg [Citrus sinensis]
Length=187

 Score =   186 bits (471),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            +RDEE KFKLCKVRS QFG+KGIP+I TYDGRTIRYPDPLIK ND +KLDLE NK+ DFI
Sbjct  39   LRDEEAKFKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLEENKITDFI  98

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGN+VMV GGR RGRVG+IKNREKHKGSFE +HIQDA GHE  TRLGN F IGKG K
Sbjct  99   KFDVGNIVMVTGGRNRGRVGIIKNREKHKGSFETIHIQDALGHEFATRLGNVFTIGKGSK  158

Query  168  XXVXXPKGKGIKLSIXEE  115
              V  PKGKGIKLSI EE
Sbjct  159  PWVSLPKGKGIKLSIIEE  176



>gb|KDO67004.1| hypothetical protein CISIN_1g024108mg [Citrus sinensis]
Length=272

 Score =   188 bits (478),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 123/158 (78%), Gaps = 7/158 (4%)
 Frame = -3

Query  528  IRDEEXK-------FKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLES  370
            IRDEE K       FKLCKVRS QFG+KGIP+I TYDGRTIRYPDPLIK ND +KLDLE+
Sbjct  114  IRDEEAKALILLFQFKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLET  173

Query  369  NKVVDFIKXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXF  190
            NK+ +FIK DVGNVVMV GGR RGRVG+IKNREKHKGSFE +HIQDA GHE  TRLGN F
Sbjct  174  NKITEFIKFDVGNVVMVTGGRNRGRVGIIKNREKHKGSFETIHIQDALGHEFATRLGNVF  233

Query  189  XIGKGXKXXVXXPKGKGIKLSIXEEAKKRLAAQXXTTA  76
             IGKG K  V  PKGKGIKLSI EEA+KR A      A
Sbjct  234  TIGKGTKPWVSLPKGKGIKLSIIEEARKRQALATSAAA  271



>ref|XP_009345329.1| PREDICTED: 40S ribosomal protein S4 [Pyrus x bretschneideri]
Length=171

 Score =   185 bits (469),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 118/144 (82%), Gaps = 0/144 (0%)
 Frame = -3

Query  507  FKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFIKXDvgnv  328
            FKLCKVRS QFG++GIP+I TYDGRTIRYP+PLIK ND +KLDL +NK+ +FIK DVGNV
Sbjct  28   FKLCKVRSVQFGQRGIPYINTYDGRTIRYPNPLIKANDTIKLDLGTNKITNFIKFDVGNV  87

Query  327  vmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXKXXVXXPK  148
            VMV GGR RG VGVIKNREKHKGSFE +H+QDATGHE  TRLGN F IGKG K  V  PK
Sbjct  88   VMVTGGRNRGHVGVIKNREKHKGSFETIHVQDATGHEFATRLGNVFTIGKGTKPWVSLPK  147

Query  147  GKGIKLSIXEEAKKRLAAQXXTTA  76
            GKGIKL+I EEAKKR AA    TA
Sbjct  148  GKGIKLTIIEEAKKRQAALQAATA  171



>gb|ACV70143.1| putative 40S ribosomal protein S4 [Jatropha curcas]
Length=264

 Score =   187 bits (476),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 125/151 (83%), Gaps = 0/151 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            +RDEE KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLESNK+ DFI
Sbjct  114  VRDEEAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKITDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +HIQDATG E  TRLGN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDATGPEFATRLGNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQXXTTA  76
              V  PKGKGIKLSI EEA+KR AA   T A
Sbjct  234  PWVSFPKGKGIKLSIIEEARKRQAAAAQTVA  264



>ref|XP_010685909.1| PREDICTED: 40S ribosomal protein S4-1 [Beta vulgaris subsp. vulgaris]
Length=262

 Score =   187 bits (476),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 111/151 (74%), Positives = 124/151 (82%), Gaps = 2/151 (1%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            +RDEE KFKLCKVR+ QFG KGIP++ TYDGRTIRYPDPLI+ ND +KLDLE NK+VDFI
Sbjct  114  VRDEEAKFKLCKVRNVQFGTKGIPYLNTYDGRTIRYPDPLIRANDTIKLDLEENKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +HIQD+ GHE  TR+GN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSQGHEFATRMGNVFIIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQXXTTA  76
              V  PKGKGIKL+I EEA+KR  A+   TA
Sbjct  234  PWVSLPKGKGIKLTIIEEARKR--AEKTATA  262



>ref|XP_008383247.1| PREDICTED: 40S ribosomal protein S4 [Malus domestica]
 ref|XP_008364235.1| PREDICTED: 40S ribosomal protein S4 [Malus domestica]
 ref|XP_009363280.1| PREDICTED: 40S ribosomal protein S4 [Pyrus x bretschneideri]
Length=264

 Score =   187 bits (476),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRDEE KFKLCKVRS QFG+KGIP+I TYDGRTIRYPDPLIK ND +KLDLE+NK+ DFI
Sbjct  114  IRDEEAKFKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKITDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +H+QDA+GHE  TRLGN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHVQDASGHEFATRLGNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEE  115
              +  PKGKGIKL+I EE
Sbjct  234  PWISLPKGKGIKLTIIEE  251



>ref|XP_008374283.1| PREDICTED: 40S ribosomal protein S4 isoform X2 [Malus domestica]
 ref|XP_008374289.1| PREDICTED: 40S ribosomal protein S4 isoform X2 [Malus domestica]
 ref|XP_008374295.1| PREDICTED: 40S ribosomal protein S4 isoform X2 [Malus domestica]
Length=159

 Score =   184 bits (466),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = -3

Query  516  EXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFIKXDv  337
            + +FKLCKVRS QFG+KGIP+I TYDGRTIRYPDPLIK ND +KLDLE+N + DFIK DV
Sbjct  13   QRQFKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLETNNITDFIKFDV  72

Query  336  gnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXKXXVX  157
            GNVVMV  GR RGRVGVIKNREKHKGSFE +H+QDATGHE  TRLGN F IGKGXK  V 
Sbjct  73   GNVVMVTSGRNRGRVGVIKNREKHKGSFETIHVQDATGHEFATRLGNVFTIGKGXKPWVS  132

Query  156  XPKGKGIKLSIXEEAKKR  103
             PKG GIKL+I EEAKKR
Sbjct  133  LPKGXGIKLTIIEEAKKR  150



>gb|KDO63240.1| hypothetical protein CISIN_1g023289mg [Citrus sinensis]
Length=284

 Score =   187 bits (475),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            +RDEE KFKLCKVRS QFG+KGIP+I TYDGRTIRYPDPLIK ND +KLDLE NK+ DFI
Sbjct  136  LRDEEAKFKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLEENKITDFI  195

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGN+VMV GGR RGRVG+IKNREKHKGSFE +HIQDA GHE  TRLGN F IGKG K
Sbjct  196  KFDVGNIVMVTGGRNRGRVGIIKNREKHKGSFETIHIQDALGHEFATRLGNVFTIGKGSK  255

Query  168  XXVXXPKGKGIKLSIXEE  115
              V  PKGKGIKLSI EE
Sbjct  256  PWVSLPKGKGIKLSIIEE  273



>gb|KDO63241.1| hypothetical protein CISIN_1g023289mg [Citrus sinensis]
Length=254

 Score =   186 bits (472),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            +RDEE KFKLCKVRS QFG+KGIP+I TYDGRTIRYPDPLIK ND +KLDLE NK+ DFI
Sbjct  106  LRDEEAKFKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLEENKITDFI  165

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGN+VMV GGR RGRVG+IKNREKHKGSFE +HIQDA GHE  TRLGN F IGKG K
Sbjct  166  KFDVGNIVMVTGGRNRGRVGIIKNREKHKGSFETIHIQDALGHEFATRLGNVFTIGKGSK  225

Query  168  XXVXXPKGKGIKLSIXEE  115
              V  PKGKGIKLSI EE
Sbjct  226  PWVSLPKGKGIKLSIIEE  243



>gb|KDO63242.1| hypothetical protein CISIN_1g023289mg [Citrus sinensis]
Length=244

 Score =   186 bits (471),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            +RDEE KFKLCKVRS QFG+KGIP+I TYDGRTIRYPDPLIK ND +KLDLE NK+ DFI
Sbjct  96   LRDEEAKFKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLEENKITDFI  155

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGN+VMV GGR RGRVG+IKNREKHKGSFE +HIQDA GHE  TRLGN F IGKG K
Sbjct  156  KFDVGNIVMVTGGRNRGRVGIIKNREKHKGSFETIHIQDALGHEFATRLGNVFTIGKGSK  215

Query  168  XXVXXPKGKGIKLSIXEE  115
              V  PKGKGIKLSI EE
Sbjct  216  PWVSLPKGKGIKLSIIEE  233



>ref|XP_006429477.1| hypothetical protein CICLE_v10012499mg [Citrus clementina]
 ref|XP_006481102.1| PREDICTED: 40S ribosomal protein S4-2-like [Citrus sinensis]
 gb|ESR42717.1| hypothetical protein CICLE_v10012499mg [Citrus clementina]
 gb|KDO63239.1| hypothetical protein CISIN_1g023289mg [Citrus sinensis]
Length=262

 Score =   186 bits (472),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            +RDEE KFKLCKVRS QFG+KGIP+I TYDGRTIRYPDPLIK ND +KLDLE NK+ DFI
Sbjct  114  LRDEEAKFKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLEENKITDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGN+VMV GGR RGRVG+IKNREKHKGSFE +HIQDA GHE  TRLGN F IGKG K
Sbjct  174  KFDVGNIVMVTGGRNRGRVGIIKNREKHKGSFETIHIQDALGHEFATRLGNVFTIGKGSK  233

Query  168  XXVXXPKGKGIKLSIXEE  115
              V  PKGKGIKLSI EE
Sbjct  234  PWVSLPKGKGIKLSIIEE  251



>dbj|BAJ94984.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMS49926.1| 40S ribosomal protein S4 [Triticum urartu]
 gb|EMT30796.1| 40S ribosomal protein S4 [Aegilops tauschii]
Length=265

 Score =   186 bits (471),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            +RDE+ KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLE+NK+VDFI
Sbjct  114  VRDEDAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLETNKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR  GRVGVIKNREKHKG+FE +H++DA GH+  TRLGN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNTGRVGVIKNREKHKGTFETIHVEDAQGHQFATRLGNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKR  103
              V  PKGKGIKL+I EE +KR
Sbjct  234  PWVSLPKGKGIKLTIIEEQRKR  255



>ref|XP_002463552.1| hypothetical protein SORBIDRAFT_01g001850 [Sorghum bicolor]
 gb|EER90550.1| hypothetical protein SORBIDRAFT_01g001850 [Sorghum bicolor]
Length=264

 Score =   185 bits (470),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRDE+ KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +K+DLE+NK+VDFI
Sbjct  114  IRDEDAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKIDLETNKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR  GRVGVIKNREKHKGSFE +H++D+ GH+  TR+GN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNTGRVGVIKNREKHKGSFETIHVEDSLGHQFATRMGNVFTIGKGNK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKR  103
              V  PKGKGIKLSI EE +KR
Sbjct  234  PWVSLPKGKGIKLSIIEEQRKR  255



>ref|XP_010251772.1| PREDICTED: 40S ribosomal protein S4-like [Nelumbo nucifera]
Length=200

 Score =   183 bits (465),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 105/151 (70%), Positives = 120/151 (79%), Gaps = 0/151 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            I+DEE KFKL KVR  QFG KGIP++ TYDGRTI YPDPLI+ ND +K+DLE+NK+ +FI
Sbjct  50   IKDEEAKFKLGKVRPMQFGDKGIPYLNTYDGRTIHYPDPLIRANDTIKIDLETNKITNFI  109

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DV NVVMV GGR RG VG+IKNREKHKGSFE + IQDATGHE  TRLGN F +GKG K
Sbjct  110  KFDVENVVMVTGGRNRGHVGIIKNREKHKGSFETILIQDATGHEFATRLGNVFTMGKGTK  169

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQXXTTA  76
              V  PKGKGIKLSI EEA+KR+ A   +TA
Sbjct  170  PWVSLPKGKGIKLSIIEEARKRITATAASTA  200



>ref|XP_004491013.1| PREDICTED: 40S ribosomal protein S4-2-like [Cicer arietinum]
Length=265

 Score =   185 bits (470),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            +RD+E KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLE NK+VDFI
Sbjct  114  VRDDEAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLEENKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKG+FE +H+QDATGHE  TRLGN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGTFETIHVQDATGHEFATRLGNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEE  115
              V  PKGKGIKL++ EE
Sbjct  234  PWVSLPKGKGIKLTVIEE  251



>ref|XP_008374276.1| PREDICTED: 40S ribosomal protein S4 isoform X1 [Malus domestica]
Length=171

 Score =   182 bits (462),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 106/135 (79%), Positives = 114/135 (84%), Gaps = 0/135 (0%)
 Frame = -3

Query  507  FKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFIKXDvgnv  328
            FKLCKVRS QFG+KGIP+I TYDGRTIRYPDPLIK ND +KLDLE+N + DFIK DVGNV
Sbjct  28   FKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLETNNITDFIKFDVGNV  87

Query  327  vmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXKXXVXXPK  148
            VMV  GR RGRVGVIKNREKHKGSFE +H+QDATGHE  TRLGN F IGKGXK  V  PK
Sbjct  88   VMVTSGRNRGRVGVIKNREKHKGSFETIHVQDATGHEFATRLGNVFTIGKGXKPWVSLPK  147

Query  147  GKGIKLSIXEEAKKR  103
            G GIKL+I EEAKKR
Sbjct  148  GXGIKLTIIEEAKKR  162



>ref|XP_003568916.1| PREDICTED: 40S ribosomal protein S4 [Brachypodium distachyon]
Length=265

 Score =   185 bits (469),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            +RDE+ KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +K+DLE+NK+VDFI
Sbjct  114  VRDEDSKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKIDLETNKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR  GRVGVIKNREKHKG+FE +H++DA GH+  TRLGN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNTGRVGVIKNREKHKGTFETIHVEDAQGHQFATRLGNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKR  103
              V  PKGKGIKL+I EE +KR
Sbjct  234  PWVSLPKGKGIKLTIIEEQRKR  255



>ref|XP_008343651.1| PREDICTED: LOW QUALITY PROTEIN: 40S ribosomal protein S4-like, 
partial [Malus domestica]
Length=152

 Score =   181 bits (459),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 105/136 (77%), Positives = 114/136 (84%), Gaps = 0/136 (0%)
 Frame = -3

Query  510  KFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFIKXDvgn  331
            +FKLCKVRS QFG+KGIP+I TYD RTIRYPDPLIK ND +KLDLE+N + DFIK DVGN
Sbjct  8    QFKLCKVRSVQFGQKGIPYINTYDXRTIRYPDPLIKANDTIKLDLETNNITDFIKFDVGN  67

Query  330  vvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXKXXVXXP  151
            VVMV  GR RGRVGVIKNREKHKGSFE +H+QDATGHE  TRLGN F IGKG K  V  P
Sbjct  68   VVMVTSGRNRGRVGVIKNREKHKGSFETIHVQDATGHEFATRLGNVFTIGKGGKPWVSLP  127

Query  150  KGKGIKLSIXEEAKKR  103
            KGKGIKL+I EEAKKR
Sbjct  128  KGKGIKLTIIEEAKKR  143



>ref|XP_002455614.1| hypothetical protein SORBIDRAFT_03g014380 [Sorghum bicolor]
 gb|EES00734.1| hypothetical protein SORBIDRAFT_03g014380 [Sorghum bicolor]
Length=265

 Score =   184 bits (468),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 119/142 (84%), Gaps = 0/142 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            +RDE+ KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +K+DLE+NK+VDFI
Sbjct  114  VRDEDAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKIDLETNKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR  GRVGVIKNREKHKGSFE +H++DA GH   TR+GN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNTGRVGVIKNREKHKGSFETIHVEDALGHAFATRMGNVFTIGKGNK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKR  103
              V  PKGKGIKLSI EE +KR
Sbjct  234  PWVSLPKGKGIKLSIIEEQRKR  255



>ref|XP_004511996.1| PREDICTED: 40S ribosomal protein S4-1-like [Cicer arietinum]
Length=264

 Score =   184 bits (468),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            +RD+E KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDP+IK ND +KLDLE NK+VDFI
Sbjct  114  VRDDEAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPVIKANDTIKLDLEENKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKG+FE +H+QDATGHE  TRLGN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGTFETIHVQDATGHEFATRLGNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEE  115
              V  PKGKGIKL++ EE
Sbjct  234  PWVSLPKGKGIKLTVIEE  251



>ref|NP_001266498.1| 40S ribosomal protein S4 [Zea mays]
 sp|O22424.1|RS4_MAIZE RecName: Full=40S ribosomal protein S4 [Zea mays]
 gb|AAB66899.1| ribosomal protein S4 type I [Zea mays]
 gb|ACF83328.1| unknown [Zea mays]
 gb|ACG30922.1| 40S ribosomal protein S4 [Zea mays]
 gb|ACG34655.1| 40S ribosomal protein S4 [Zea mays]
 gb|AFW67028.1| putative ribosomal protein S4 (RPS4A) family protein [Zea mays]
Length=265

 Score =   184 bits (468),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRDE+ KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +K+DLE+NK+VDFI
Sbjct  114  IRDEDAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKIDLETNKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR  GRVGVIKNREKHKGSFE +H++D+ GH+  TR+GN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNTGRVGVIKNREKHKGSFETIHVEDSLGHQFATRMGNVFTIGKGNK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKR  103
              V  PKGKGIKLSI EE +KR
Sbjct  234  PWVSLPKGKGIKLSIIEEQRKR  255



>ref|XP_006646768.1| PREDICTED: 40S ribosomal protein S4-like [Oryza brachyantha]
Length=265

 Score =   184 bits (467),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            I+DE+ KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDP+IK ND +K+DLE+NK+VDFI
Sbjct  114  IKDEDAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPIIKANDTIKIDLETNKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR  GRVGVIKNREKHKGSFE +H++DA GH+  TRLGN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNTGRVGVIKNREKHKGSFETIHVEDAQGHQFATRLGNVFTIGKGNK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKR  103
              V  PKGKGIKLSI EE +KR
Sbjct  234  PWVSLPKGKGIKLSIIEEQRKR  255



>ref|NP_001043015.1| Os01g0358400 [Oryza sativa Japonica Group]
 dbj|BAD52963.1| putative 40S ribosomal protein S4 [Oryza sativa Japonica Group]
 dbj|BAF04929.1| Os01g0358400 [Oryza sativa Japonica Group]
 gb|EAY74000.1| hypothetical protein OsI_01884 [Oryza sativa Indica Group]
 gb|EAZ11863.1| hypothetical protein OsJ_01737 [Oryza sativa Japonica Group]
 gb|ABR25672.1| 40S ribosomal protein S4 [Oryza sativa Indica Group]
 dbj|BAG88133.1| unnamed protein product [Oryza sativa Japonica Group]
Length=265

 Score =   184 bits (466),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 119/142 (84%), Gaps = 0/142 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            ++DE+ KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +K+DLE+NK+VDFI
Sbjct  114  VKDEDAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKIDLETNKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR  GRVGVIKNREKHKGSFE +H++DA GH   TRLGN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNTGRVGVIKNREKHKGSFETIHVEDALGHAFATRLGNVFTIGKGNK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKR  103
              V  PKGKGIKLSI EE +KR
Sbjct  234  PWVSLPKGKGIKLSIIEEQRKR  255



>ref|XP_003623356.1| 40S ribosomal protein S4 [Medicago truncatula]
 gb|AES79574.1| 40S ribosomal S4-like protein [Medicago truncatula]
 gb|AFK36229.1| unknown [Medicago truncatula]
Length=265

 Score =   184 bits (466),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 119/143 (83%), Gaps = 0/143 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            +RD+E KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLE NK+ DFI
Sbjct  114  VRDDEAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLEQNKITDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVG IKNR+KH G+FE +H+QDA GHE  TRLGN F IG+G K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGFIKNRKKHMGTFETIHVQDAAGHEFATRLGNVFTIGRGPK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRL  100
              V  PKG+GIKL++ EEA+KR+
Sbjct  234  PWVSLPKGRGIKLTVIEEARKRM  256



>ref|NP_001045624.1| Os02g0105900 [Oryza sativa Japonica Group]
 sp|P49398.3|RS4_ORYSJ RecName: Full=40S ribosomal protein S4; AltName: Full=SCAR protein 
SS620 [Oryza sativa Japonica Group]
 pdb|3J60|E Chain E, Localization Of The Small Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 dbj|BAD28085.1| putative ribosomal protein S4 [Oryza sativa Japonica Group]
 dbj|BAF07538.1| Os02g0105900 [Oryza sativa Japonica Group]
 gb|EAY84111.1| hypothetical protein OsI_05494 [Oryza sativa Indica Group]
 gb|EAZ21423.1| hypothetical protein OsJ_05027 [Oryza sativa Japonica Group]
 gb|ACA50490.1| 40S ribosomal protein S4 [Oryza sativa Japonica Group]
 dbj|BAG96339.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG95549.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ADM86872.1| 40S ribosomal protein S4 [Oryza sativa Japonica Group]
Length=265

 Score =   183 bits (465),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            ++DE+ KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDP+IK ND +K+DLE+NK+VDFI
Sbjct  114  VKDEDAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPIIKANDTIKIDLETNKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR  GRVGVIKNREKHKGSFE +H++DA GH+  TRLGN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNTGRVGVIKNREKHKGSFETIHVEDALGHQFATRLGNVFTIGKGNK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKR  103
              V  PKGKGIKLSI EE +KR
Sbjct  234  PWVSLPKGKGIKLSIIEEQRKR  255



>ref|XP_002439678.1| hypothetical protein SORBIDRAFT_09g018320 [Sorghum bicolor]
 gb|EES18108.1| hypothetical protein SORBIDRAFT_09g018320 [Sorghum bicolor]
Length=263

 Score =   183 bits (465),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRD+E KFK+CKVRS QFG+KGIPF+ TYDGRTIRYPDPLIK ND +K+DLE+NK+VDFI
Sbjct  114  IRDDEAKFKMCKVRSVQFGQKGIPFLNTYDGRTIRYPDPLIKANDTIKIDLETNKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR  GRVGVIK+REKHKGSFE +H++D+ GH+  TR+GN F IGK  K
Sbjct  174  KFDVGNVVMVTGGRNTGRVGVIKSREKHKGSFETIHVEDSLGHQFATRMGNVFTIGKDKK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLA  97
              V  PKGKGIKLSI EEA+KR A
Sbjct  234  PWVSLPKGKGIKLSIIEEARKRNA  257



>ref|XP_004960263.1| PREDICTED: 40S ribosomal protein S4-like [Setaria italica]
Length=265

 Score =   183 bits (465),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 119/142 (84%), Gaps = 0/142 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRDE+ K KLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +K+DLE+NK+VDFI
Sbjct  114  IRDEDAKTKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKIDLETNKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR  GRVGVIKNREKHKGSFE +H++DA GH+  TRLGN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNTGRVGVIKNREKHKGSFETIHVEDALGHQFATRLGNVFTIGKGNK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKR  103
              V  PKGKGIKLSI EE +KR
Sbjct  234  PWVSLPKGKGIKLSIIEEQRKR  255



>ref|XP_006644163.1| PREDICTED: 40S ribosomal protein S4-like [Oryza brachyantha]
Length=265

 Score =   182 bits (463),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 119/142 (84%), Gaps = 0/142 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            ++DE+ KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +K+DLE+NK+VDFI
Sbjct  114  VKDEDAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKIDLETNKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR  GRVGVIKNREKHKGSFE +H++D+ GH   TRLGN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNTGRVGVIKNREKHKGSFETIHVEDSLGHAFATRLGNVFTIGKGNK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKR  103
              V  PKGKGIKLSI EE +KR
Sbjct  234  PWVSLPKGKGIKLSIIEEQRKR  255



>gb|ACJ84252.1| unknown [Medicago truncatula]
Length=196

 Score =   180 bits (457),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 117/141 (83%), Gaps = 0/141 (0%)
 Frame = -3

Query  498  CKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFIKXDvgnvvmv  319
             +VRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLE+NK+ DFIK DVGNVVMV
Sbjct  56   ARVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLENNKITDFIKFDVGNVVMV  115

Query  318  iggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXKXXVXXPKGKG  139
             GGR RGRVGVIKNREKHKG+FE +H+QDA+GHE  TRLGN F IGKG K  V  PKGKG
Sbjct  116  TGGRNRGRVGVIKNREKHKGTFETIHVQDASGHEFATRLGNAFTIGKGTKPWVSLPKGKG  175

Query  138  IKLSIXEEAKKRLAAQXXTTA  76
            IKL++ EEA+KR AAQ  T A
Sbjct  176  IKLTVIEEARKRQAAQNVTAA  196



>ref|XP_004962295.1| PREDICTED: 40S ribosomal protein S4-like [Setaria italica]
Length=262

 Score =   182 bits (462),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRD+E KFKLCKVRS QFG+KGIPF+ TYDGRTIRYPDPLIK ND +K+DL++NK+VDFI
Sbjct  114  IRDDEAKFKLCKVRSVQFGQKGIPFLNTYDGRTIRYPDPLIKANDTIKIDLDTNKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR  GRVGVIK+REKHKGSFE +H++D+ GH+  TR+GN F IGK  K
Sbjct  174  KFDVGNVVMVTGGRNTGRVGVIKSREKHKGSFETIHVEDSLGHQFATRMGNVFTIGKDKK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLA  97
              V  PKGKGIKLSI EEA+KR A
Sbjct  234  PWVSLPKGKGIKLSIIEEARKRNA  257



>ref|XP_006645886.1| PREDICTED: 40S ribosomal protein S4-like [Oryza brachyantha]
Length=285

 Score =   183 bits (464),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 119/142 (84%), Gaps = 0/142 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            ++DE+ KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +K+DLE+NK+VDFI
Sbjct  134  VKDEDAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKIDLETNKIVDFI  193

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR  GRVGVIKNREKHKGSFE +H++D+ GH   TRLGN F IGKG K
Sbjct  194  KFDVGNVVMVTGGRNTGRVGVIKNREKHKGSFETIHVEDSLGHAFATRLGNVFTIGKGNK  253

Query  168  XXVXXPKGKGIKLSIXEEAKKR  103
              V  PKGKGIKLSI EE +KR
Sbjct  254  PWVSLPKGKGIKLSIIEEQRKR  275



>dbj|BAD22763.1| ribosomal protein [Bromus inermis]
Length=265

 Score =   181 bits (460),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 119/142 (84%), Gaps = 0/142 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            +RDE+ K+KLCKVRS QFG+KGIP++ T DGRTIRYPDPLIK ND +KLDLE+NK+VDFI
Sbjct  114  VRDEDAKYKLCKVRSVQFGQKGIPYLNTNDGRTIRYPDPLIKANDTIKLDLETNKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR  GRVGVIKNREKHKG+FE +H++DA GH+  TRLGN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNTGRVGVIKNREKHKGTFETIHVEDAQGHQFATRLGNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKR  103
              V  PKGKGIKL+I EE +KR
Sbjct  234  PWVTLPKGKGIKLTIIEEQRKR  255



>ref|XP_006851828.1| hypothetical protein AMTR_s00041p00058440 [Amborella trichopoda]
 gb|ERN13295.1| hypothetical protein AMTR_s00041p00058440 [Amborella trichopoda]
Length=268

 Score =   181 bits (459),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 119/142 (84%), Gaps = 0/142 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            ++DEE KFKLCKVRS QFG+K IP++ TYDGRTIRYPDPLIK ND +KLDLE+NK+VDFI
Sbjct  118  VKDEEAKFKLCKVRSVQFGQKSIPYLNTYDGRTIRYPDPLIKANDTIKLDLETNKIVDFI  177

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVG+IK+RE+HKGSF+ +HI+DA  HE  TRLGN F IGK  K
Sbjct  178  KFDVGNVVMVTGGRNRGRVGLIKSRERHKGSFDIIHIEDAAKHEFATRLGNVFTIGKASK  237

Query  168  XXVXXPKGKGIKLSIXEEAKKR  103
              V  PKGKGIKLSI EEA+KR
Sbjct  238  PWVSLPKGKGIKLSIIEEARKR  259



>ref|XP_008801072.1| PREDICTED: 40S ribosomal protein S4-like [Phoenix dactylifera]
Length=195

 Score =   178 bits (452),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 108/146 (74%), Positives = 119/146 (82%), Gaps = 2/146 (1%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            I+DEE K  LCKVRS QFG+KGIP + TYDG TIRYPDPLI+ ND +KLDLE+NK+VDFI
Sbjct  46   IKDEEAK--LCKVRSVQFGQKGIPHLNTYDGHTIRYPDPLIRANDTIKLDLETNKIVDFI  103

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +H+QDA GHE  T LGN F IGKG K
Sbjct  104  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHLQDALGHEFATCLGNVFTIGKGTK  163

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              V  PKGK IKLSI EEA+K+LAA 
Sbjct  164  PWVSLPKGKCIKLSIIEEARKQLAAS  189



>ref|XP_003611879.1| 40S ribosomal protein S4 [Medicago truncatula]
 ref|XP_003628299.1| 40S ribosomal protein S4 [Medicago truncatula]
 gb|ACJ85463.1| unknown [Medicago truncatula]
 gb|AES94837.1| 40S ribosomal S4-like protein [Medicago truncatula]
 gb|AET02775.1| 40S ribosomal S4-like protein [Medicago truncatula]
 gb|AFK34966.1| unknown [Medicago truncatula]
 gb|AFK42812.1| unknown [Medicago truncatula]
 gb|KEH27546.1| 40S ribosomal S4-like protein [Medicago truncatula]
Length=265

 Score =   181 bits (458),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 102/138 (74%), Positives = 117/138 (85%), Gaps = 0/138 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            +RD+E KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDP+I+ ND +KLDLE NK+VDFI
Sbjct  114  VRDDEAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPVIRANDTIKLDLEENKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GG+ RGRVGVIKNREKHKG+FE +H+QDATGHE  TRL N F IGKG K
Sbjct  174  KFDVGNVVMVTGGKNRGRVGVIKNREKHKGTFETIHVQDATGHEFATRLVNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEE  115
              V  PKGKGIKL++ EE
Sbjct  234  PWVSLPKGKGIKLTVIEE  251



>ref|NP_001288485.1| 40S ribosomal protein S4-like [Zea mays]
 gb|AAB67831.1| ribsomal protein S4 [Zea mays]
 gb|ACF87994.1| unknown [Zea mays]
 gb|ACG25377.1| 40S ribosomal protein S4 [Zea mays]
 gb|ACG45984.1| 40S ribosomal protein S4 [Zea mays]
 tpg|DAA52405.1| TPA: ribosomal protein S4 [Zea mays]
Length=265

 Score =   181 bits (458),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 119/142 (84%), Gaps = 0/142 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRDE+ KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +K+DLE+NK++DFI
Sbjct  114  IRDEDAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKIDLETNKIMDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR  GRVGVIKNREKHKG F+ +H++D+ GH+  TR+GN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNTGRVGVIKNREKHKGGFDTIHVEDSMGHQFATRMGNVFTIGKGNK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKR  103
              V  PKGKGIKLSI EE ++R
Sbjct  234  PWVSLPKGKGIKLSIIEEQRRR  255



>gb|AAT38019.1| putative 40S ribosomal protein S4 [Oryza sativa Japonica Group]
Length=245

 Score =   179 bits (455),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 120/144 (83%), Gaps = 0/144 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            I+DE+ KFKLCKVRS QFG+KGIPF+ T DGRTIRYPDPLIK ND +K+DLE+NK+VDFI
Sbjct  96   IKDEDAKFKLCKVRSVQFGQKGIPFLNTNDGRTIRYPDPLIKANDTIKIDLETNKIVDFI  155

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGN+VMV GGR  GRVGVIK+REKHKGSFE +H++DA GH+  TR+GN F IGK  K
Sbjct  156  KFDVGNIVMVTGGRNTGRVGVIKSREKHKGSFETIHVEDALGHQFATRMGNVFTIGKERK  215

Query  168  XXVXXPKGKGIKLSIXEEAKKRLA  97
              V  PKGKGIKLSI EEA+KR A
Sbjct  216  PWVSLPKGKGIKLSIIEEARKRNA  239



>ref|NP_001055342.1| Os05g0368300 [Oryza sativa Japonica Group]
 dbj|BAF17256.1| Os05g0368300 [Oryza sativa Japonica Group]
Length=263

 Score =   180 bits (456),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 120/144 (83%), Gaps = 0/144 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            I+DE+ KFKLCKVRS QFG+KGIPF+ T DGRTIRYPDPLIK ND +K+DLE+NK+VDFI
Sbjct  114  IKDEDAKFKLCKVRSVQFGQKGIPFLNTNDGRTIRYPDPLIKANDTIKIDLETNKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGN+VMV GGR  GRVGVIK+REKHKGSFE +H++DA GH+  TR+GN F IGK  K
Sbjct  174  KFDVGNIVMVTGGRNTGRVGVIKSREKHKGSFETIHVEDALGHQFATRMGNVFTIGKERK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLA  97
              V  PKGKGIKLSI EEA+KR A
Sbjct  234  PWVSLPKGKGIKLSIIEEARKRNA  257



>gb|AAS48726.1| ribosomal protein S4 [Zea mays]
Length=265

 Score =   179 bits (455),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            IRDE+ KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDP IK ND +K+DLE+NK+VDFI
Sbjct  114  IRDEDAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPPIKANDTIKIDLETNKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR  GRVGVIKNREKHKGS E +H++D+ GH+  TR+GN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNTGRVGVIKNREKHKGSLETIHVEDSLGHQFATRMGNVFTIGKGNK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKR  103
              V  PKGKGIKLSI EE +KR
Sbjct  234  PWVSLPKGKGIKLSIIEEQRKR  255



>ref|XP_007141735.1| hypothetical protein PHAVU_008G221000g [Phaseolus vulgaris]
 ref|XP_007141738.1| hypothetical protein PHAVU_008G221300g [Phaseolus vulgaris]
 gb|ESW13729.1| hypothetical protein PHAVU_008G221000g [Phaseolus vulgaris]
 gb|ESW13732.1| hypothetical protein PHAVU_008G221300g [Phaseolus vulgaris]
Length=264

 Score =   179 bits (455),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            +RD+E KFKLCKV+S QFG+KGIP++ T+DGRTIRYPDP+I+ ND +KLDLE NK+VDFI
Sbjct  114  VRDDEAKFKLCKVKSVQFGQKGIPYLNTFDGRTIRYPDPVIRANDTIKLDLEENKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIK+RE+ KGSF+ +H+QDATGHE  TRL N F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKSRERQKGSFDTIHVQDATGHEFATRLANVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKR  103
              +  PKGKGIKLSI EEA+KR
Sbjct  234  PLISLPKGKGIKLSIIEEARKR  255



>gb|EAY97774.1| hypothetical protein OsI_19685 [Oryza sativa Indica Group]
Length=279

 Score =   179 bits (453),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 120/144 (83%), Gaps = 0/144 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            I+DE+ KFKLCKVRS QFG+KGIPF+ T DGRTIRYPDPLIK ND +K+DLE+NK++DFI
Sbjct  130  IKDEDAKFKLCKVRSVQFGQKGIPFLNTNDGRTIRYPDPLIKANDTIKIDLETNKIMDFI  189

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR  GRVGVIK+REKHKGSFE +H++DA GH+  TR+GN F IGK  K
Sbjct  190  KFDVGNVVMVTGGRNTGRVGVIKSREKHKGSFETIHVEDALGHQFATRMGNVFTIGKERK  249

Query  168  XXVXXPKGKGIKLSIXEEAKKRLA  97
              V  PKGKGIKLSI EEA+KR A
Sbjct  250  PWVSLPKGKGIKLSIIEEARKRNA  273



>gb|EEE63465.1| hypothetical protein OsJ_18278 [Oryza sativa Japonica Group]
Length=398

 Score =   181 bits (458),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 120/144 (83%), Gaps = 0/144 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            I+DE+ KFKLCKVRS QFG+KGIPF+ T DGRTIRYPDPLIK ND +K+DLE+NK+VDFI
Sbjct  249  IKDEDAKFKLCKVRSVQFGQKGIPFLNTNDGRTIRYPDPLIKANDTIKIDLETNKIVDFI  308

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGN+VMV GGR  GRVGVIK+REKHKGSFE +H++DA GH+  TR+GN F IGK  K
Sbjct  309  KFDVGNIVMVTGGRNTGRVGVIKSREKHKGSFETIHVEDALGHQFATRMGNVFTIGKERK  368

Query  168  XXVXXPKGKGIKLSIXEEAKKRLA  97
              V  PKGKGIKLSI EEA+KR A
Sbjct  369  PWVSLPKGKGIKLSIIEEARKRNA  392



>gb|AGZ15374.1| 40S ribosomal S4 protein [Phaseolus vulgaris]
Length=264

 Score =   175 bits (444),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 105/151 (70%), Positives = 120/151 (79%), Gaps = 0/151 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            +RDEE KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLE NK+V+FI
Sbjct  114  VRDEEAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLEENKIVEFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGV K+R K+KGSFE +H+Q+ATGHE  T LGN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVFKSRNKNKGSFETIHVQEATGHEIATCLGNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQXXTTA  76
              V   KGKGIKLSI  E +K ++ Q  T A
Sbjct  234  PWVFFSKGKGIKLSIIGEGRKGISPQQGTGA  264



>gb|ABK21170.1| unknown [Picea sitchensis]
 gb|ABK22318.1| unknown [Picea sitchensis]
 gb|ABR17884.1| unknown [Picea sitchensis]
Length=263

 Score =   174 bits (440),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            I+DEE K+KLCKVRS QFG KGIP++ TYDGRTIRYPDPL+K ND +K+DLE+ K+ +FI
Sbjct  114  IKDEEAKYKLCKVRSVQFGDKGIPYLNTYDGRTIRYPDPLVKANDTIKIDLETGKIKEFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIK+REKHKGSFE +H+QDA G E  TR GN F IGKG K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGVIKHREKHKGSFEIIHVQDAAGQEFATRQGNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKR  103
              V  PKGKG+KLSI EEA+KR
Sbjct  234  PWVSLPKGKGVKLSIIEEARKR  255



>gb|ABK22322.1| unknown [Picea sitchensis]
 gb|ABK22679.1| unknown [Picea sitchensis]
 gb|ACN39835.1| unknown [Picea sitchensis]
 gb|ACN40504.1| unknown [Picea sitchensis]
 gb|ACN40833.1| unknown [Picea sitchensis]
Length=263

 Score =   173 bits (439),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            I+DEE K+KLCKVRS QFG KGIP++ TYDGRTIRYPDPL+K ND +K+DLE+ K+ +FI
Sbjct  114  IKDEEAKYKLCKVRSVQFGDKGIPYLNTYDGRTIRYPDPLVKANDTIKVDLETGKIKEFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNV+MV GGR RGRVGVIK+REKHKGSFE +H+QDA G E  TR GN F IGKG K
Sbjct  174  KFDVGNVIMVTGGRNRGRVGVIKHREKHKGSFEIIHVQDAAGQEFATRQGNVFTIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKR  103
              V  PKGKG+KLSI EEA+KR
Sbjct  234  PWVSLPKGKGVKLSIIEEARKR  255



>gb|EMT14698.1| 40S ribosomal protein S4 [Aegilops tauschii]
Length=259

 Score =   172 bits (437),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 97/145 (67%), Positives = 118/145 (81%), Gaps = 0/145 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            I+DEE KFKLCKVR+ Q G+KG+P + TYDGRTIRYPDP IK ND +K+DLE+NK+VDFI
Sbjct  114  IKDEEAKFKLCKVRTVQCGQKGVPSLNTYDGRTIRYPDPAIKPNDTIKIDLETNKIVDFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K +VGN VMV GGR  GR+GVIK+RE+H+GSFE +H++DA GH+  TRL N F IGK  K
Sbjct  174  KFEVGNFVMVTGGRNTGRIGVIKSRERHEGSFETIHVEDALGHQFATRLANVFSIGKDRK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAA  94
              V  PKGKGIKL+I EEA+KR+AA
Sbjct  234  SWVSLPKGKGIKLTIIEEARKRIAA  258



>dbj|BAN18311.1| 40S ribosomal protein S4, partial [Schiedea jacobii]
 dbj|BAN18312.1| 40S ribosomal protein S4, partial [Schiedea nuttallii]
 dbj|BAN18313.1| 40S ribosomal protein S4, partial [Schiedea pentandra]
 dbj|BAN18314.1| 40S ribosomal protein S4, partial [Schiedea kauaiensis]
 dbj|BAN18316.1| 40S ribosomal protein S4, partial [Schiedea perlmanii]
 dbj|BAN18317.1| 40S ribosomal protein S4, partial [Schiedea kaalae]
 dbj|BAN18318.1| 40S ribosomal protein S4, partial [Schiedea laui]
Length=135

 Score =   166 bits (421),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 97/135 (72%), Positives = 113/135 (84%), Gaps = 0/135 (0%)
 Frame = -3

Query  507  FKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFIKXDvgnv  328
            +KLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KL+L++ K+ DF+K DVGNV
Sbjct  1    YKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLNLDTQKIEDFVKFDVGNV  60

Query  327  vmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXKXXVXXPK  148
            VMV GGR RGRVGVIKNREKHKGSFE +HI+DA GHE  TR GN F +GKG +  V  PK
Sbjct  61   VMVTGGRNRGRVGVIKNREKHKGSFETIHIEDAAGHEFATRQGNVFIVGKGSRPWVSLPK  120

Query  147  GKGIKLSIXEEAKKR  103
            GKGIKL+I EEA+KR
Sbjct  121  GKGIKLTIIEEARKR  135



>dbj|BAN18292.1| 40S ribosomal protein S4, partial [Schiedea spergulina]
 dbj|BAN18293.1| 40S ribosomal protein S4, partial [Schiedea kealiae]
 dbj|BAN18294.1| 40S ribosomal protein S4, partial [Schiedea mannii]
 dbj|BAN18295.1| 40S ribosomal protein S4, partial [Schiedea adamantis]
 dbj|BAN18296.1| 40S ribosomal protein S4, partial [Schiedea menziesii]
 dbj|BAN18297.1| 40S ribosomal protein S4, partial [Schiedea hookeri]
 dbj|BAN18298.1| 40S ribosomal protein S4, partial [Schiedea sarmentosa]
 dbj|BAN18299.1| 40S ribosomal protein S4, partial [Schiedea lydgatei]
 dbj|BAN18300.1| 40S ribosomal protein S4, partial [Schiedea haleakalensis]
 dbj|BAN18301.1| 40S ribosomal protein S4, partial [Schiedea ligustrina]
 dbj|BAN18302.1| 40S ribosomal protein S4, partial [Schiedea salicaria]
 dbj|BAN18303.1| 40S ribosomal protein S4, partial [Schiedea globosa]
 dbj|BAN18304.1| 40S ribosomal protein S4, partial [Schiedea verticillata]
 dbj|BAN18305.1| 40S ribosomal protein S4, partial [Schiedea viscosa]
 dbj|BAN18306.1| 40S ribosomal protein S4, partial [Schiedea trinervis]
 dbj|BAN18307.1| 40S ribosomal protein S4, partial [Schiedea obovata]
 dbj|BAN18308.1| 40S ribosomal protein S4, partial [Schiedea membranacea]
 dbj|BAN18310.1| 40S ribosomal protein S4, partial [Schiedea apokremnos]
Length=135

 Score =   166 bits (421),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 97/135 (72%), Positives = 113/135 (84%), Gaps = 0/135 (0%)
 Frame = -3

Query  507  FKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFIKXDvgnv  328
            +KLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KL+L++ K+ DF+K DVGNV
Sbjct  1    YKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLNLDTQKIEDFVKFDVGNV  60

Query  327  vmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXKXXVXXPK  148
            VMV GGR RGRVGVIKNREKHKGSFE +HI+DA GHE  TR GN F +GKG +  V  PK
Sbjct  61   VMVTGGRNRGRVGVIKNREKHKGSFETIHIEDAAGHEFATRQGNVFIVGKGTRPWVSLPK  120

Query  147  GKGIKLSIXEEAKKR  103
            GKGIKL+I EEA+KR
Sbjct  121  GKGIKLTIIEEARKR  135



>dbj|BAN18309.1| 40S ribosomal protein S4, partial [Schiedea helleri]
Length=135

 Score =   166 bits (421),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 96/135 (71%), Positives = 113/135 (84%), Gaps = 0/135 (0%)
 Frame = -3

Query  507  FKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFIKXDvgnv  328
            +KLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KL+L++ K+ DF+K DVGNV
Sbjct  1    YKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLNLDTQKIEDFVKFDVGNV  60

Query  327  vmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXKXXVXXPK  148
            VMV GGR RGRVG+IKNREKHKGSFE +HI+DA GHE  TR GN F +GKG +  V  PK
Sbjct  61   VMVTGGRNRGRVGIIKNREKHKGSFETIHIEDAAGHEFATRQGNVFIVGKGTRPWVSLPK  120

Query  147  GKGIKLSIXEEAKKR  103
            GKGIKL+I EEA+KR
Sbjct  121  GKGIKLTIIEEARKR  135



>dbj|BAN18315.1| 40S ribosomal protein S4, partial [Schiedea stellarioides]
Length=135

 Score =   166 bits (420),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 97/135 (72%), Positives = 113/135 (84%), Gaps = 0/135 (0%)
 Frame = -3

Query  507  FKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFIKXDvgnv  328
            +KLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KL+L++ K+ DF+K DVGNV
Sbjct  1    YKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLNLDTQKIEDFVKFDVGNV  60

Query  327  vmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXKXXVXXPK  148
            VMV GGR RGRVGVIKNREKHKGSFE +HI+DA GHE  TR GN F +GKG +  V  PK
Sbjct  61   VMVTGGRNRGRVGVIKNREKHKGSFETIHIEDAXGHEFATRQGNVFIVGKGSRPWVSLPK  120

Query  147  GKGIKLSIXEEAKKR  103
            GKGIKL+I EEA+KR
Sbjct  121  GKGIKLTIIEEARKR  135



>ref|XP_001759850.1| predicted protein [Physcomitrella patens]
 gb|EDQ75354.1| predicted protein [Physcomitrella patens]
Length=263

 Score =   169 bits (428),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 118/145 (81%), Gaps = 0/145 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            I  EE K+KLCKVRS QFG KG+P+I T+DGRTIRYPDPLIK ND VK++LE+ KVV+FI
Sbjct  114  ISAEEAKYKLCKVRSAQFGDKGVPYITTFDGRTIRYPDPLIKANDTVKINLETGKVVEFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K D+GN+VMV GGR RGR+GVI++REKHKGSF+ +H+ D+TG +  TR+GN F +G+G K
Sbjct  174  KFDIGNIVMVTGGRNRGRIGVIQHREKHKGSFDIIHVTDSTGQQFATRMGNVFTVGQGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAA  94
              +  P+GKGIKLSI EEAKKR  A
Sbjct  234  PWITLPRGKGIKLSIVEEAKKRTQA  258



>ref|XP_001780588.1| predicted protein [Physcomitrella patens]
 gb|EDQ54571.1| predicted protein [Physcomitrella patens]
Length=263

 Score =   169 bits (427),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 119/145 (82%), Gaps = 0/145 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            I  EE K+KLCKVRS QFG KG+P+I T+DGRTIRYPDPLIK ND VK++LE+ KVV+FI
Sbjct  114  ISAEEAKYKLCKVRSAQFGDKGVPYITTFDGRTIRYPDPLIKANDTVKINLETGKVVEFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K D+GN+VMV GGR RGR+GVI++REKHKGSF+ +H+ D+TG++  TR+GN F IG+G K
Sbjct  174  KFDIGNIVMVTGGRNRGRIGVIQHREKHKGSFDIIHVTDSTGNQFATRMGNVFTIGQGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAA  94
              +  P+GKGIKLSI EEAKKR A 
Sbjct  234  PWITLPRGKGIKLSIVEEAKKRKAV  258



>gb|ADW09573.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
stellarioides]
Length=132

 Score =   164 bits (415),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 96/132 (73%), Positives = 111/132 (84%), Gaps = 0/132 (0%)
 Frame = -3

Query  507  FKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFIKXDvgnv  328
            +KLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KL+L++ K+ DF+K DVGNV
Sbjct  1    YKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLNLDTQKIEDFVKFDVGNV  60

Query  327  vmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXKXXVXXPK  148
            VMV GGR RGRVGVIKNREKHKGSFE +HI+DATGHE  TR GN F +GKG +  V  PK
Sbjct  61   VMVTGGRNRGRVGVIKNREKHKGSFETIHIEDATGHEFATRQGNVFIVGKGSRPWVSLPK  120

Query  147  GKGIKLSIXEEA  112
            GKGIKL+I EEA
Sbjct  121  GKGIKLTIIEEA  132



>ref|XP_001759591.1| predicted protein [Physcomitrella patens]
 gb|EDQ75503.1| predicted protein [Physcomitrella patens]
Length=263

 Score =   167 bits (423),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 117/145 (81%), Gaps = 0/145 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            I  EE K+KLCKVRS QFG KG+P I T+DGRTIRYPDPLIK ND VK++LE+ KVV+FI
Sbjct  114  ISAEEAKYKLCKVRSAQFGDKGVPHITTFDGRTIRYPDPLIKANDTVKINLETGKVVEFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K D+GN+VMV GGR RGR+GVI++REKHKGSF+ +H+ D+TG +  TR+GN F +G+G K
Sbjct  174  KFDIGNIVMVTGGRNRGRIGVIQHREKHKGSFDIIHVTDSTGQQFATRMGNVFTVGQGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAA  94
              +  P+GKGIKLSI EEAKKR  A
Sbjct  234  PWITLPRGKGIKLSIVEEAKKRTQA  258



>ref|XP_001751877.1| predicted protein [Physcomitrella patens]
 gb|EDQ83312.1| predicted protein [Physcomitrella patens]
Length=263

 Score =   167 bits (422),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            I  EE K+KLCKVRS QFG KG+P I T+DGRTIRYPDPLIK ND VK++LE+ KVV+FI
Sbjct  114  ISAEEAKYKLCKVRSAQFGDKGVPHITTFDGRTIRYPDPLIKANDTVKINLETGKVVEFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K D+GN+VMV GGR RGR+GVI++REKHKGSF+ +H+ DATG +  TR+GN F +G+G K
Sbjct  174  KFDIGNIVMVTGGRNRGRIGVIQHREKHKGSFDIIHVTDATGQQFATRMGNVFTVGQGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKR  103
              +  P+GKGIKLSI EEAKKR
Sbjct  234  PWITLPRGKGIKLSIVEEAKKR  255



>ref|XP_002984314.1| hypothetical protein SELMODRAFT_271698 [Selaginella moellendorffii]
 gb|EFJ14824.1| hypothetical protein SELMODRAFT_271698 [Selaginella moellendorffii]
Length=258

 Score =   166 bits (421),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 116/143 (81%), Gaps = 0/143 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            I  EE KFKLCKVR+ +FG KGIPF+ TYDGRTIRYPDPLIK ND +K+DLE+ K+ +FI
Sbjct  114  INSEEAKFKLCKVRAVRFGAKGIPFLTTYDGRTIRYPDPLIKANDTIKIDLETGKIKEFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGN+VMV GGR RGRVG I++REKHKGSF+ +HI+D+ G +  TR+GN F IG+G K
Sbjct  174  KFDVGNLVMVTGGRNRGRVGTIQHREKHKGSFDIIHIKDSVGQDFATRMGNVFTIGQGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRL  100
              V  PKGKGIKLSI EEA+KR+
Sbjct  234  PWVSLPKGKGIKLSIVEEARKRV  256



>gb|ADW09574.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
stellarioides]
Length=132

 Score =   162 bits (411),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 110/132 (83%), Gaps = 0/132 (0%)
 Frame = -3

Query  507  FKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFIKXDvgnv  328
            +KLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KL+L++ K+ DF+K DVGNV
Sbjct  1    YKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLNLDTQKIEDFVKFDVGNV  60

Query  327  vmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXKXXVXXPK  148
            VMV GGR RGRVGVIKNREKHKGSFE +HI+DA GHE  TR GN F +GKG +  V  PK
Sbjct  61   VMVTGGRNRGRVGVIKNREKHKGSFETIHIEDAAGHEFATRQGNVFIVGKGSRPWVSLPK  120

Query  147  GKGIKLSIXEEA  112
            GKGIKL+I EEA
Sbjct  121  GKGIKLTIIEEA  132



>gb|ADK97882.1| 40S ribosomal protein S4-like protein, partial [Schiedea globosa]
 gb|ADK97885.1| 40S ribosomal protein S4-like protein, partial [Schiedea globosa]
 gb|ADK97886.1| 40S ribosomal protein S4-like protein, partial [Schiedea globosa]
 gb|ADK97887.1| 40S ribosomal protein S4-like protein, partial [Schiedea globosa]
 gb|ADK97888.1| 40S ribosomal protein S4-like protein, partial [Schiedea globosa]
 gb|ADK97889.1| 40S ribosomal protein S4-like protein, partial [Schiedea globosa]
 gb|ADK97893.1| 40S ribosomal protein S4-like protein, partial [Schiedea globosa]
 gb|ADK97894.1| 40S ribosomal protein S4-like protein, partial [Schiedea globosa]
 gb|ADK97895.1| 40S ribosomal protein S4-like protein, partial [Schiedea globosa]
 gb|ADK97898.1| 40S ribosomal protein S4-like protein, partial [Schiedea globosa]
 gb|ADW09575.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
adamantis]
 gb|ADW09576.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
adamantis]
 gb|ADW09577.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
membranacea]
 gb|ADW09578.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
membranacea]
 gb|ADW09579.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09581.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09583.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09585.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09587.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09588.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09593.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09594.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09595.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09596.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09597.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09598.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09599.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09600.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09601.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09602.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09603.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09604.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09605.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09606.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09607.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09608.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09609.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09610.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09611.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09613.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09615.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09625.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
Length=132

 Score =   162 bits (410),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 110/132 (83%), Gaps = 0/132 (0%)
 Frame = -3

Query  507  FKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFIKXDvgnv  328
            +KLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KL+L++ K+ DF+K DVGNV
Sbjct  1    YKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLNLDTQKIEDFVKFDVGNV  60

Query  327  vmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXKXXVXXPK  148
            VMV GGR RGRVGVIKNREKHKGSFE +HI+DA GHE  TR GN F +GKG +  V  PK
Sbjct  61   VMVTGGRNRGRVGVIKNREKHKGSFETIHIEDAAGHEFATRQGNVFIVGKGTRPWVSLPK  120

Query  147  GKGIKLSIXEEA  112
            GKGIKL+I EEA
Sbjct  121  GKGIKLTIIEEA  132



>ref|XP_002972484.1| hypothetical protein SELMODRAFT_148442 [Selaginella moellendorffii]
 gb|EFJ26570.1| hypothetical protein SELMODRAFT_148442 [Selaginella moellendorffii]
Length=258

 Score =   166 bits (421),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 116/143 (81%), Gaps = 0/143 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            I  EE KFKLCKVR+ +FG KGIPF+ TYDGRTIRYPDPLIK ND +K+DLE+ K+ +FI
Sbjct  114  INAEEAKFKLCKVRAVRFGAKGIPFLTTYDGRTIRYPDPLIKANDTIKIDLETGKIKEFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVG I++REKHKGSF+ +HI+D+ G +  TR+GN F IG+G K
Sbjct  174  KFDVGNVVMVTGGRNRGRVGTIQHREKHKGSFDIIHIKDSVGQDFATRMGNVFTIGQGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRL  100
              V  PKGKGIKLSI EEA+KR+
Sbjct  234  PWVSLPKGKGIKLSIVEEARKRV  256



>gb|ADK97878.1| 40S ribosomal protein S4-like protein, partial [Schiedea globosa]
 gb|ADK97879.1| 40S ribosomal protein S4-like protein, partial [Schiedea globosa]
 gb|ADK97880.1| 40S ribosomal protein S4-like protein, partial [Schiedea globosa]
 gb|ADK97881.1| 40S ribosomal protein S4-like protein, partial [Schiedea globosa]
 gb|ADK97890.1| 40S ribosomal protein S4-like protein, partial [Schiedea globosa]
 gb|ADK97891.1| 40S ribosomal protein S4-like protein, partial [Schiedea globosa]
 gb|ADK97892.1| 40S ribosomal protein S4-like protein, partial [Schiedea globosa]
 gb|ADK97901.1| 40S ribosomal protein S4-like protein, partial [Schiedea globosa]
 gb|ADK97902.1| 40S ribosomal protein S4-like protein, partial [Schiedea adamantis]
Length=132

 Score =   162 bits (409),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 109/132 (83%), Gaps = 0/132 (0%)
 Frame = -3

Query  507  FKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFIKXDvgnv  328
            +KLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KL+L + K+ DF+K DVGNV
Sbjct  1    YKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLNLXTQKIEDFVKFDVGNV  60

Query  327  vmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXKXXVXXPK  148
            VMV GGR RGRVGVIKNREKHKGSFE +HI+DA GHE  TR GN F +GKG +  V  PK
Sbjct  61   VMVTGGRNRGRVGVIKNREKHKGSFETIHIEDAAGHEFATRQGNVFIVGKGTRPWVSLPK  120

Query  147  GKGIKLSIXEEA  112
            GKGIKL+I EEA
Sbjct  121  GKGIKLTIIEEA  132



>gb|ADK97883.1| 40S ribosomal protein S4-like protein, partial [Schiedea globosa]
 gb|ADK97884.1| 40S ribosomal protein S4-like protein, partial [Schiedea globosa]
 gb|ADK97896.1| 40S ribosomal protein S4-like protein, partial [Schiedea globosa]
 gb|ADK97897.1| 40S ribosomal protein S4-like protein, partial [Schiedea globosa]
 gb|ADK97899.1| 40S ribosomal protein S4-like protein, partial [Schiedea globosa]
 gb|ADK97900.1| 40S ribosomal protein S4-like protein, partial [Schiedea globosa]
 gb|ADW09580.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09582.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09584.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09586.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09589.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09590.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09591.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09592.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09612.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09614.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09616.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09617.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09618.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09619.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09620.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09621.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09622.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09623.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09624.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
 gb|ADW09626.1| putative 40S ribosomal protein S4-like protein, partial [Schiedea 
globosa]
Length=132

 Score =   161 bits (408),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 109/132 (83%), Gaps = 0/132 (0%)
 Frame = -3

Query  507  FKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFIKXDvgnv  328
            +KLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KL+L + K+ DF+K DVGNV
Sbjct  1    YKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLNLYTQKIEDFVKFDVGNV  60

Query  327  vmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXKXXVXXPK  148
            VMV GGR RGRVGVIKNREKHKGSFE +HI+DA GHE  TR GN F +GKG +  V  PK
Sbjct  61   VMVTGGRNRGRVGVIKNREKHKGSFETIHIEDAAGHEFATRQGNVFIVGKGTRPWVSLPK  120

Query  147  GKGIKLSIXEEA  112
            GKGIKL+I EEA
Sbjct  121  GKGIKLTIIEEA  132



>ref|XP_001766039.1| predicted protein [Physcomitrella patens]
 gb|EDQ69098.1| predicted protein [Physcomitrella patens]
Length=308

 Score =   166 bits (421),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 97/145 (67%), Positives = 117/145 (81%), Gaps = 0/145 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            I  EE K+KLCKVRS QFG KG+P I T+DGRTIRYPDPLIK ND VK++LE+ KVV+FI
Sbjct  114  ISAEEAKYKLCKVRSAQFGDKGVPHITTFDGRTIRYPDPLIKANDTVKINLETGKVVEFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGN+VMV GGR RGR+GVI +REKHKGSF+ +H+ DATG++  TR+GN + IG+G K
Sbjct  174  KFDVGNIVMVTGGRNRGRIGVIHHREKHKGSFDIIHVTDATGNQFATRMGNVYTIGQGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAA  94
              +  P+GKGIKLSI EEAKKR A 
Sbjct  234  PWITLPRGKGIKLSIVEEAKKRKAT  258



>ref|XP_001785339.1| predicted protein [Physcomitrella patens]
 gb|EDQ49851.1| predicted protein [Physcomitrella patens]
Length=263

 Score =   164 bits (416),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 117/146 (80%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            I  EE K+KLCKVR+ QFG KG+P + T+DGRTIRYPDPLIK ND VK++LE+ KVV+FI
Sbjct  114  ISAEEAKYKLCKVRAAQFGDKGVPHVTTFDGRTIRYPDPLIKANDTVKINLETGKVVEFI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K D+GN+VMV GGR RGR+GVI +REKHKGSF+ +H+ DA G++  TR+GN F IG+G K
Sbjct  174  KFDIGNIVMVTGGRNRGRIGVIHHREKHKGSFDIIHVTDAIGNQFATRMGNVFTIGQGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              +  P+GKGIKLSI EEAKKR A +
Sbjct  234  PWITLPRGKGIKLSIVEEAKKRKATE  259



>gb|KFK40122.1| hypothetical protein AALP_AA3G333200 [Arabis alpina]
Length=216

 Score =   162 bits (411),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 96/120 (80%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            +RDEE KFKLCKVRS QFG+KGIP++ TYDGRTIRYPDPLIK ND +KLDLE+NK+V+FI
Sbjct  96   LRDEEAKFKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEANKIVEFI  155

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K DVGNVVMV GGR RGRVGVIKNREKHKGSFE +HIQD+TGHE  TRLGN F IGKG K
Sbjct  156  KFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTIGKGTK  215



>gb|ABQ18253.1| ribosomal protein S4e [Lygus lineolaris]
Length=263

 Score =   161 bits (408),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 89/149 (60%), Positives = 110/149 (74%), Gaps = 0/149 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            I  +E K+KLCKVR  Q G KGIPF+ T+DGRTIRYPDPL K ND ++LD+ +NK++D I
Sbjct  114  ITADEAKYKLCKVRKVQTGPKGIPFLVTHDGRTIRYPDPLAKVNDTIQLDIATNKIIDII  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            + D GN+ M+ GGR  GRVG + NRE+H GSF+ VH++DATGH   TRL N F IGKG K
Sbjct  174  RMDSGNLCMITGGRNLGRVGTVVNRERHPGSFDIVHVKDATGHTFATRLNNVFIIGKGSK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQXXT  82
              V  PKGKGIKLSI EE  +RLAA+  +
Sbjct  234  AYVSIPKGKGIKLSIAEERDRRLAAKAAS  262



>gb|ABD98758.1| putative ribosomal protein S4e [Graphocephala atropunctata]
Length=263

 Score =   159 bits (401),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 89/149 (60%), Positives = 110/149 (74%), Gaps = 0/149 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            I +EE K+KLCKV+  Q G KGIPF+ T+DGRTIRYPDPLIK ND ++LD+ S+K+ D+I
Sbjct  114  ITEEEAKYKLCKVKRVQTGPKGIPFLVTHDGRTIRYPDPLIKVNDTIQLDIASSKITDYI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            + D GN+ M+ GGR  GRVG + NRE+H GSF+ VHI+D  GH   TRL N F IGKG K
Sbjct  174  RFDSGNLCMITGGRNLGRVGTVVNRERHPGSFDIVHIKDTNGHTFATRLVNVFIIGKGTK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQXXT  82
              V  PKGKG+KLSI EE  KRLAA+  +
Sbjct  234  PYVSLPKGKGVKLSIAEERDKRLAAKAAS  262



>ref|XP_004526806.1| PREDICTED: 40S ribosomal protein S4-like [Ceratitis capitata]
 ref|XP_011183473.1| PREDICTED: 40S ribosomal protein S4 [Bactrocera cucurbitae]
Length=261

 Score =   158 bits (399),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 87/146 (60%), Positives = 108/146 (74%), Gaps = 0/146 (0%)
 Frame = -3

Query  528  IRDEEXKFKLCKVRSXQFGKKGIPFIXTYDGRTIRYPDPLIKXNDXVKLDLESNKVVDFI  349
            I  EE K+KLCKVR  Q G KG+PF+ T+DGRTIRYPDPLIK ND V++D+ + K+ D+I
Sbjct  114  ISAEEAKYKLCKVRKTQLGAKGVPFVVTHDGRTIRYPDPLIKANDTVQVDIATGKITDYI  173

Query  348  KXDvgnvvmviggrxrgrvgVIKNREKHKGSFEXVHIQDATGHEXXTRLGNXFXIGKGXK  169
            K D GN+ M+ GGR  GRVG + NRE+H GSF+ VH++D+ GH   TRL N F IGKG K
Sbjct  174  KFDSGNLCMITGGRNLGRVGTVVNRERHPGSFDIVHVKDSQGHVFATRLTNVFIIGKGNK  233

Query  168  XXVXXPKGKGIKLSIXEEAKKRLAAQ  91
              +  PKGKG+KLSI EE  KRLAA+
Sbjct  234  PYISLPKGKGVKLSIAEERDKRLAAK  259



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559039970400