BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF001A19

Length=617
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011083506.1|  PREDICTED: uncharacterized protein LOC105166016    223   3e-67   Sesamum indicum [beniseed]
ref|XP_009598077.1|  PREDICTED: uncharacterized protein LOC104093936    220   6e-66   Nicotiana tomentosiformis
gb|EYU38830.1|  hypothetical protein MIMGU_mgv1a007054mg                218   4e-65   Erythranthe guttata [common monkey flower]
ref|XP_009803492.1|  PREDICTED: uncharacterized protein LOC104248856    217   8e-65   Nicotiana sylvestris
ref|XP_004250146.1|  PREDICTED: uncharacterized protein LOC101246201    216   2e-64   Solanum lycopersicum
emb|CDP07421.1|  unnamed protein product                                216   3e-64   Coffea canephora [robusta coffee]
ref|XP_011074653.1|  PREDICTED: uncharacterized protein LOC105159331    216   3e-64   Sesamum indicum [beniseed]
ref|XP_006353174.1|  PREDICTED: uncharacterized protein LOC102605433    216   3e-64   Solanum tuberosum [potatoes]
gb|AAK84481.1|  unknown                                                 211   2e-63   Solanum lycopersicum
gb|KJB14424.1|  hypothetical protein B456_002G124500                    210   4e-62   Gossypium raimondii
ref|XP_006473627.1|  PREDICTED: uncharacterized protein LOC102620145    210   5e-62   Citrus sinensis [apfelsine]
gb|KDP36948.1|  hypothetical protein JCGZ_08239                         209   9e-62   Jatropha curcas
ref|XP_004136545.1|  PREDICTED: uncharacterized protein LOC101215265    209   1e-61   Cucumis sativus [cucumbers]
ref|XP_010692715.1|  PREDICTED: uncharacterized protein LOC104905778    209   2e-61   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008442993.1|  PREDICTED: uncharacterized protein LOC103486724    209   2e-61   Cucumis melo [Oriental melon]
ref|XP_007017750.1|  S-adenosyl-L-methionine-dependent methyltran...    208   3e-61   
ref|XP_006435145.1|  hypothetical protein CICLE_v10001297mg             207   5e-61   Citrus clementina [clementine]
ref|XP_003550415.1|  PREDICTED: uncharacterized protein LOC100812467    207   7e-61   Glycine max [soybeans]
ref|XP_007160685.1|  hypothetical protein PHAVU_001G008400g             205   4e-60   Phaseolus vulgaris [French bean]
ref|XP_003545042.1|  PREDICTED: uncharacterized protein LOC100786...    205   4e-60   Glycine max [soybeans]
ref|XP_011028977.1|  PREDICTED: uncharacterized protein LOC105128842    205   5e-60   Populus euphratica
ref|XP_010095168.1|  putative methyltransferase PMT28                   205   8e-60   Morus notabilis
ref|XP_011045126.1|  PREDICTED: uncharacterized protein LOC105140124    204   8e-60   Populus euphratica
ref|XP_008357136.1|  PREDICTED: uncharacterized protein LOC103420870    204   9e-60   Malus domestica [apple tree]
ref|XP_004499234.1|  PREDICTED: uncharacterized protein LOC101508990    204   1e-59   Cicer arietinum [garbanzo]
emb|CBI19830.3|  unnamed protein product                                204   2e-59   Vitis vinifera
ref|XP_002277626.1|  PREDICTED: uncharacterized protein LOC100259190    202   3e-59   Vitis vinifera
ref|XP_010557488.1|  PREDICTED: uncharacterized protein LOC104826476    202   5e-59   Tarenaya hassleriana [spider flower]
ref|XP_002301989.1|  hypothetical protein POPTR_0002s02640g             202   8e-59   
ref|XP_009337662.1|  PREDICTED: uncharacterized protein LOC103930096    201   9e-59   Pyrus x bretschneideri [bai li]
ref|XP_008221299.1|  PREDICTED: uncharacterized protein LOC103321276    201   9e-59   Prunus mume [ume]
ref|XP_002306913.1|  hypothetical protein POPTR_0005s25790g             201   1e-58   Populus trichocarpa [western balsam poplar]
ref|XP_010061033.1|  PREDICTED: uncharacterized protein LOC104448821    201   2e-58   Eucalyptus grandis [rose gum]
gb|AAO14627.1|AF467900_4  hypothetical protein                          200   3e-58   Prunus persica
ref|XP_006395469.1|  hypothetical protein EUTSA_v10004321mg             199   4e-58   Eutrema salsugineum [saltwater cress]
gb|KEH40211.1|  ATRAD3-like protein                                     200   4e-58   Medicago truncatula
ref|XP_009335275.1|  PREDICTED: uncharacterized protein LOC103927...    200   4e-58   Pyrus x bretschneideri [bai li]
ref|XP_009350044.1|  PREDICTED: uncharacterized protein LOC103941557    199   5e-58   Pyrus x bretschneideri [bai li]
ref|XP_009335270.1|  PREDICTED: uncharacterized protein LOC103927...    199   5e-58   
ref|XP_008387957.1|  PREDICTED: uncharacterized protein LOC103450397    198   2e-57   Malus domestica [apple tree]
ref|XP_010514415.1|  PREDICTED: uncharacterized protein LOC104790374    197   3e-57   Camelina sativa [gold-of-pleasure]
gb|KJB63557.1|  hypothetical protein B456_010G005600                    196   5e-57   Gossypium raimondii
ref|XP_006291222.1|  hypothetical protein CARUB_v10017354mg             195   3e-56   Capsella rubella
ref|XP_010271414.1|  PREDICTED: uncharacterized protein LOC104607476    194   5e-56   Nelumbo nucifera [Indian lotus]
emb|CDY00165.1|  BnaC09g01360D                                          191   2e-55   
emb|CDY20059.1|  BnaA09g01920D                                          191   2e-55   Brassica napus [oilseed rape]
ref|XP_003523577.1|  PREDICTED: uncharacterized protein LOC100798510    192   3e-55   Glycine max [soybeans]
ref|XP_002875365.1|  hypothetical protein ARALYDRAFT_904944             192   3e-55   Arabidopsis lyrata subsp. lyrata
ref|XP_002510507.1|  ATRAD3, putative                                   194   3e-55   Ricinus communis
ref|NP_566813.1|  S-adenosyl-L-methionine-dependent methyltransfe...    191   1e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009111558.1|  PREDICTED: uncharacterized protein LOC103836982    190   1e-54   Brassica rapa
gb|AAM63602.1|  unknown                                                 188   1e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007136074.1|  hypothetical protein PHAVU_009G015500g             188   1e-53   Phaseolus vulgaris [French bean]
gb|AAL77659.1|  AT3g27230/K17E12_5                                      187   1e-53   Arabidopsis thaliana [mouse-ear cress]
gb|KEH36237.1|  ATRAD3-like protein                                     187   2e-53   Medicago truncatula
ref|XP_004291387.1|  PREDICTED: uncharacterized protein LOC101314531    187   3e-53   Fragaria vesca subsp. vesca
ref|XP_006282947.1|  hypothetical protein CARUB_v10007544mg             187   3e-53   Capsella rubella
dbj|BAH57084.1|  AT5G40830                                              185   5e-53   Arabidopsis thaliana [mouse-ear cress]
ref|NP_198899.1|  S-adenosyl-L-methionine-dependent methyltransfe...    185   2e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010441242.1|  PREDICTED: uncharacterized protein LOC104724...    184   2e-52   Camelina sativa [gold-of-pleasure]
gb|AFK44341.1|  unknown                                                 184   3e-52   Medicago truncatula
ref|XP_002868627.1|  ATRAD3                                             184   4e-52   
ref|XP_010441241.1|  PREDICTED: uncharacterized protein LOC104724...    184   5e-52   Camelina sativa [gold-of-pleasure]
ref|XP_010425464.1|  PREDICTED: uncharacterized protein LOC104710544    183   7e-52   Camelina sativa [gold-of-pleasure]
ref|XP_002868633.1|  ATRAD3                                             181   6e-51   Arabidopsis lyrata subsp. lyrata
ref|XP_010450613.1|  PREDICTED: uncharacterized protein LOC104732...    180   6e-51   Camelina sativa [gold-of-pleasure]
ref|XP_010450612.1|  PREDICTED: uncharacterized protein LOC104732...    180   8e-51   Camelina sativa [gold-of-pleasure]
ref|XP_010450611.1|  PREDICTED: uncharacterized protein LOC104732...    179   2e-50   Camelina sativa [gold-of-pleasure]
ref|XP_008776887.1|  PREDICTED: uncharacterized protein LOC103696936    172   6e-48   Phoenix dactylifera
ref|XP_010934529.1|  PREDICTED: uncharacterized protein LOC105054654    172   5e-47   Elaeis guineensis
ref|XP_003628927.1|  hypothetical protein MTR_8g069200                  174   6e-47   
ref|XP_009399468.1|  PREDICTED: uncharacterized protein LOC103983867    169   3e-46   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009411357.1|  PREDICTED: uncharacterized protein LOC103993126    165   7e-45   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS57421.1|  hypothetical protein M569_17397                         163   4e-44   Genlisea aurea
dbj|BAJ84801.1|  predicted protein                                      161   6e-44   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACR38405.1|  unknown                                                 159   6e-44   Zea mays [maize]
gb|ACF83461.1|  unknown                                                 160   2e-43   Zea mays [maize]
ref|NP_001144838.1|  uncharacterized protein LOC100277923               159   5e-43   
ref|XP_004964486.1|  PREDICTED: uncharacterized protein LOC101778925    158   1e-42   Setaria italica
ref|NP_001174590.1|  Os06g0138500                                       157   5e-42   
ref|XP_006655770.1|  PREDICTED: uncharacterized protein LOC102722126    155   3e-41   Oryza brachyantha
gb|EEE56914.1|  hypothetical protein OsJ_06590                          156   4e-41   Oryza sativa Japonica Group [Japonica rice]
gb|AFW85948.1|  hypothetical protein ZEAMMB73_641421                    150   7e-41   
ref|XP_002437791.1|  hypothetical protein SORBIDRAFT_10g002660          153   9e-41   
gb|AFW85947.1|  hypothetical protein ZEAMMB73_411281                    145   1e-39   
ref|XP_003561200.1|  PREDICTED: uncharacterized protein LOC100825782    150   2e-39   Brachypodium distachyon [annual false brome]
gb|EMT00430.1|  hypothetical protein F775_33158                         139   1e-37   
ref|XP_002990882.1|  hypothetical protein SELMODRAFT_132356             129   3e-32   
ref|XP_002992478.1|  hypothetical protein SELMODRAFT_135385             129   9e-32   
gb|AFW85949.1|  hypothetical protein ZEAMMB73_928110                    128   1e-31   
ref|XP_002974310.1|  hypothetical protein SELMODRAFT_101023             127   2e-31   
ref|XP_007136075.1|  hypothetical protein PHAVU_009G015500g             127   4e-31   Phaseolus vulgaris [French bean]
gb|KCW69423.1|  hypothetical protein EUGRSUZ_F02887                     122   5e-30   Eucalyptus grandis [rose gum]
ref|XP_009390784.1|  PREDICTED: probable methyltransferase PMT19        119   1e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008343074.1|  PREDICTED: uncharacterized protein LOC103405840    122   2e-29   
ref|XP_010062298.1|  PREDICTED: probable methyltransferase PMT19        122   2e-29   Eucalyptus grandis [rose gum]
gb|KDP25822.1|  hypothetical protein JCGZ_22544                         122   2e-29   Jatropha curcas
ref|XP_002263360.1|  PREDICTED: probable methyltransferase PMT12        122   4e-29   Vitis vinifera
ref|XP_006372524.1|  hypothetical protein POPTR_0017s02460g             120   5e-29   
ref|XP_010032737.1|  PREDICTED: probable methyltransferase PMT19        121   6e-29   Eucalyptus grandis [rose gum]
ref|XP_002533472.1|  ATRAD3, putative                                   121   7e-29   Ricinus communis
ref|XP_006840654.1|  hypothetical protein AMTR_s00211p00024570          115   1e-28   
ref|XP_004248708.1|  PREDICTED: probable methyltransferase PMT19        120   2e-28   Solanum lycopersicum
ref|XP_003616242.1|  hypothetical protein MTR_5g077710                  120   2e-28   Medicago truncatula
ref|XP_011038251.1|  PREDICTED: uncharacterized protein LOC105135192    120   2e-28   Populus euphratica
ref|XP_011043910.1|  PREDICTED: uncharacterized protein LOC105139235    119   3e-28   Populus euphratica
ref|XP_004490854.1|  PREDICTED: probable methyltransferase PMT16-...    119   4e-28   Cicer arietinum [garbanzo]
ref|XP_011085904.1|  PREDICTED: probable methyltransferase PMT19        119   4e-28   Sesamum indicum [beniseed]
ref|XP_002305225.1|  hypothetical protein POPTR_0004s08210g             119   5e-28   
ref|XP_002972857.1|  hypothetical protein SELMODRAFT_12874              117   7e-28   
ref|XP_009774313.1|  PREDICTED: probable methyltransferase PMT19        118   7e-28   Nicotiana sylvestris
ref|XP_007217596.1|  hypothetical protein PRUPE_ppa018544mg             118   8e-28   Prunus persica
ref|XP_001767537.1|  predicted protein                                  117   1e-27   
ref|XP_010271214.1|  PREDICTED: uncharacterized protein LOC104607292    117   1e-27   Nelumbo nucifera [Indian lotus]
ref|XP_006494666.1|  PREDICTED: probable methyltransferase PMT19-...    117   1e-27   Citrus sinensis [apfelsine]
ref|XP_004240038.1|  PREDICTED: probable methyltransferase PMT19        117   1e-27   Solanum lycopersicum
ref|XP_006421083.1|  hypothetical protein CICLE_v10006824mg             117   1e-27   Citrus clementina [clementine]
ref|XP_009619701.1|  PREDICTED: uncharacterized protein LOC104111663    117   2e-27   Nicotiana tomentosiformis
ref|XP_002994258.1|  hypothetical protein SELMODRAFT_2228               116   2e-27   
ref|XP_006349637.1|  PREDICTED: probable methyltransferase PMT19-...    117   2e-27   Solanum tuberosum [potatoes]
ref|XP_006850560.1|  hypothetical protein AMTR_s00191p00037430          116   3e-27   Amborella trichopoda
ref|XP_006360379.1|  PREDICTED: uncharacterized protein LOC102594943    116   3e-27   Solanum tuberosum [potatoes]
ref|XP_008790999.1|  PREDICTED: uncharacterized protein LOC103708022    115   4e-27   Phoenix dactylifera
ref|XP_006826614.1|  hypothetical protein AMTR_s00138p00094100          116   5e-27   Amborella trichopoda
ref|XP_009762652.1|  PREDICTED: uncharacterized protein LOC104214650    116   5e-27   Nicotiana sylvestris
ref|XP_004289582.1|  PREDICTED: probable methyltransferase PMT19        115   6e-27   Fragaria vesca subsp. vesca
ref|XP_009609578.1|  PREDICTED: uncharacterized protein LOC104103385    115   8e-27   Nicotiana tomentosiformis
ref|XP_010275732.1|  PREDICTED: uncharacterized protein LOC104610...    115   1e-26   Nelumbo nucifera [Indian lotus]
gb|ABR17484.1|  unknown                                                 115   1e-26   Picea sitchensis
ref|XP_009410726.1|  PREDICTED: uncharacterized protein LOC103992655    115   2e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006355600.1|  PREDICTED: uncharacterized protein LOC102592036    113   3e-26   Solanum tuberosum [potatoes]
ref|XP_011096504.1|  PREDICTED: uncharacterized protein LOC105175673    112   7e-26   Sesamum indicum [beniseed]
ref|XP_004233013.1|  PREDICTED: uncharacterized protein LOC101264173    112   8e-26   Solanum lycopersicum
ref|XP_002519740.1|  conserved hypothetical protein                     112   8e-26   Ricinus communis
ref|XP_010666499.1|  PREDICTED: uncharacterized protein LOC104883647    112   1e-25   
ref|XP_011005850.1|  PREDICTED: uncharacterized protein LOC105112010    111   2e-25   Populus euphratica
ref|XP_006369890.1|  hypothetical protein POPTR_0001s34490g             111   2e-25   
emb|CDP17332.1|  unnamed protein product                                111   2e-25   Coffea canephora [robusta coffee]
ref|XP_010243696.1|  PREDICTED: uncharacterized protein LOC104587687    111   2e-25   Nelumbo nucifera [Indian lotus]
ref|XP_007147539.1|  hypothetical protein PHAVU_006G133100g             111   3e-25   Phaseolus vulgaris [French bean]
ref|XP_006843184.1|  hypothetical protein AMTR_s00146p00079960          110   3e-25   
ref|XP_004293665.1|  PREDICTED: uncharacterized protein LOC101310870    110   3e-25   Fragaria vesca subsp. vesca
ref|XP_006855507.1|  hypothetical protein AMTR_s00057p00202850          111   4e-25   
ref|XP_010936580.1|  PREDICTED: uncharacterized protein LOC105056176    110   7e-25   Elaeis guineensis
ref|XP_002316738.2|  hypothetical protein POPTR_0011s02820g             109   8e-25   
gb|EYU28174.1|  hypothetical protein MIMGU_mgv1a008347mg                109   9e-25   Erythranthe guttata [common monkey flower]
ref|XP_009787217.1|  PREDICTED: uncharacterized protein LOC104235198    109   9e-25   Nicotiana sylvestris
gb|KJB26416.1|  hypothetical protein B456_004G240200                    109   1e-24   Gossypium raimondii
ref|XP_004135617.1|  PREDICTED: uncharacterized protein LOC101207467    110   1e-24   
gb|KJB67513.1|  hypothetical protein B456_010G194500                    109   1e-24   Gossypium raimondii
ref|XP_009392585.1|  PREDICTED: uncharacterized protein LOC103978498    109   1e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008383518.1|  PREDICTED: uncharacterized protein LOC103446217    110   1e-24   
ref|XP_010934108.1|  PREDICTED: uncharacterized protein LOC105054309    108   1e-24   
ref|XP_008644572.1|  PREDICTED: uncharacterized protein LOC103625944    108   2e-24   Zea mays [maize]
ref|XP_008225360.1|  PREDICTED: uncharacterized protein LOC103325018    108   2e-24   Prunus mume [ume]
ref|XP_002519380.1|  ATRAD3, putative                                   109   2e-24   Ricinus communis
emb|CDP15495.1|  unnamed protein product                                109   2e-24   Coffea canephora [robusta coffee]
ref|XP_009360845.1|  PREDICTED: uncharacterized protein LOC103951245    108   2e-24   Pyrus x bretschneideri [bai li]
ref|XP_009382936.1|  PREDICTED: uncharacterized protein LOC103970749    108   2e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011468973.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    111   2e-24   Fragaria vesca subsp. vesca
ref|XP_009353828.1|  PREDICTED: uncharacterized protein LOC103945052    108   2e-24   
gb|KDP21207.1|  hypothetical protein JCGZ_21678                         108   2e-24   Jatropha curcas
ref|XP_008450643.1|  PREDICTED: uncharacterized protein LOC103492170    109   2e-24   Cucumis melo [Oriental melon]
ref|XP_003594435.1|  hypothetical protein MTR_2g028590                  108   2e-24   Medicago truncatula
ref|XP_003574397.1|  PREDICTED: uncharacterized protein LOC100841753    108   3e-24   Brachypodium distachyon [annual false brome]
ref|XP_009396835.1|  PREDICTED: uncharacterized protein LOC103981816    108   3e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004983526.1|  PREDICTED: uncharacterized protein LOC101758913    108   3e-24   Setaria italica
ref|XP_009784071.1|  PREDICTED: uncharacterized protein LOC104232543    108   3e-24   Nicotiana sylvestris
ref|XP_007030960.1|  Methyltransferase, putative                        108   3e-24   
gb|KJB69768.1|  hypothetical protein B456_011G041200                    107   4e-24   Gossypium raimondii
ref|XP_009614046.1|  PREDICTED: uncharacterized protein LOC104107050    107   4e-24   Nicotiana tomentosiformis
ref|XP_010907546.1|  PREDICTED: uncharacterized protein LOC105034191    108   4e-24   
ref|XP_006586814.1|  PREDICTED: uncharacterized protein LOC102664598    108   4e-24   Glycine max [soybeans]
gb|KHN40740.1|  Putative methyltransferase PMT15                        107   5e-24   Glycine soja [wild soybean]
ref|XP_010056869.1|  PREDICTED: uncharacterized protein LOC104444812    107   5e-24   Eucalyptus grandis [rose gum]
ref|XP_006470793.1|  PREDICTED: uncharacterized protein LOC102607511    108   5e-24   Citrus sinensis [apfelsine]
ref|XP_007023112.1|  S-adenosyl-L-methionine-dependent methyltran...    107   5e-24   
ref|XP_006433384.1|  hypothetical protein CICLE_v10003882mg             107   6e-24   Citrus clementina [clementine]
ref|XP_007211455.1|  hypothetical protein PRUPE_ppa007323mg             107   6e-24   Prunus persica
gb|KDP23499.1|  hypothetical protein JCGZ_23332                         107   7e-24   Jatropha curcas
gb|KDO56273.1|  hypothetical protein CISIN_1g012235mg                   107   7e-24   Citrus sinensis [apfelsine]
ref|XP_011045306.1|  PREDICTED: uncharacterized protein LOC105140252    107   7e-24   Populus euphratica
ref|XP_004986277.1|  PREDICTED: uncharacterized protein LOC101771363    107   7e-24   Setaria italica
ref|XP_010546711.1|  PREDICTED: uncharacterized protein LOC104818707    107   7e-24   Tarenaya hassleriana [spider flower]
ref|XP_008784991.1|  PREDICTED: uncharacterized protein LOC103703787    107   7e-24   Phoenix dactylifera
ref|XP_010930345.1|  PREDICTED: uncharacterized protein LOC105051544    107   7e-24   Elaeis guineensis
ref|XP_009628987.1|  PREDICTED: uncharacterized protein LOC104119243    107   8e-24   Nicotiana tomentosiformis
ref|XP_004504712.1|  PREDICTED: uncharacterized protein LOC101498967    107   9e-24   Cicer arietinum [garbanzo]
ref|XP_008781960.1|  PREDICTED: uncharacterized protein LOC103701603    104   9e-24   Phoenix dactylifera
ref|XP_008678318.1|  PREDICTED: uncharacterized protein LOC103653138    107   9e-24   Zea mays [maize]
ref|XP_002884510.1|  hypothetical protein ARALYDRAFT_477828             107   9e-24   
ref|XP_006836952.1|  hypothetical protein AMTR_s00099p00160150          107   1e-23   Amborella trichopoda
ref|XP_004165527.1|  PREDICTED: uncharacterized LOC101208739 isof...    106   1e-23   
ref|XP_007205147.1|  hypothetical protein PRUPE_ppa005305mg             107   1e-23   Prunus persica
gb|KJB66909.1|  hypothetical protein B456_010G164500                    106   1e-23   Gossypium raimondii
ref|XP_003524786.2|  PREDICTED: uncharacterized protein LOC100785300    106   1e-23   
ref|XP_004230216.1|  PREDICTED: uncharacterized protein LOC101247261    107   1e-23   Solanum lycopersicum
ref|XP_008789125.1|  PREDICTED: uncharacterized protein LOC103706698    106   1e-23   Phoenix dactylifera
ref|XP_006344639.1|  PREDICTED: uncharacterized protein LOC102595416    107   1e-23   Solanum tuberosum [potatoes]
ref|XP_006299195.1|  hypothetical protein CARUB_v10015342mg             107   1e-23   Capsella rubella
ref|XP_004147405.1|  PREDICTED: uncharacterized protein LOC101208...    106   1e-23   Cucumis sativus [cucumbers]
ref|XP_011092056.1|  PREDICTED: uncharacterized protein LOC105172364    107   1e-23   Sesamum indicum [beniseed]
gb|KEH31356.1|  S-adenosyl-L-methionine-dependent methyltransferase     106   1e-23   Medicago truncatula
gb|KDP32453.1|  hypothetical protein JCGZ_13378                         106   2e-23   Jatropha curcas
ref|XP_003546232.1|  PREDICTED: uncharacterized protein LOC100794863    106   2e-23   
emb|CDY05163.1|  BnaC05g46400D                                          106   2e-23   
gb|KHN14379.1|  hypothetical protein glysoja_012417                     105   2e-23   Glycine soja [wild soybean]
ref|XP_006585013.1|  PREDICTED: uncharacterized protein LOC100816366    105   2e-23   
ref|XP_008443998.1|  PREDICTED: uncharacterized protein LOC103487447    105   2e-23   Cucumis melo [Oriental melon]
emb|CAN66988.1|  hypothetical protein VITISV_005164                     108   2e-23   Vitis vinifera
ref|NP_187190.1|  uncharacterized protein                               106   2e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007158974.1|  hypothetical protein PHAVU_002G197700g             105   2e-23   Phaseolus vulgaris [French bean]
gb|EPS68166.1|  hypothetical protein M569_06606                         105   2e-23   Genlisea aurea
ref|XP_010426521.1|  PREDICTED: uncharacterized protein LOC104711485    106   2e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010930346.1|  PREDICTED: uncharacterized protein LOC105051545    105   2e-23   Elaeis guineensis
ref|XP_007216965.1|  hypothetical protein PRUPE_ppa015454mg             106   3e-23   Prunus persica
emb|CAN63784.1|  hypothetical protein VITISV_009253                     105   3e-23   Vitis vinifera
ref|XP_011087590.1|  PREDICTED: uncharacterized protein LOC105169030    105   3e-23   Sesamum indicum [beniseed]
ref|XP_004306056.1|  PREDICTED: uncharacterized protein LOC101293034    105   3e-23   Fragaria vesca subsp. vesca
ref|XP_002273992.1|  PREDICTED: uncharacterized protein LOC100250442    105   3e-23   Vitis vinifera
ref|XP_006408083.1|  hypothetical protein EUTSA_v10020681mg             105   3e-23   Eutrema salsugineum [saltwater cress]
ref|XP_008231024.1|  PREDICTED: uncharacterized protein LOC103330263    105   4e-23   Prunus mume [ume]
ref|XP_006431374.1|  hypothetical protein CICLE_v10003316mg             105   4e-23   Citrus clementina [clementine]
gb|KDP24284.1|  hypothetical protein JCGZ_25580                         104   5e-23   Jatropha curcas
ref|XP_004486558.1|  PREDICTED: uncharacterized protein LOC101503433    105   5e-23   
ref|XP_003594437.1|  hypothetical protein MTR_2g028610                  105   5e-23   Medicago truncatula
ref|NP_001132903.1|  hypothetical protein                               104   5e-23   Zea mays [maize]
ref|XP_007135150.1|  hypothetical protein PHAVU_010G105300g             104   5e-23   Phaseolus vulgaris [French bean]
ref|XP_010269453.1|  PREDICTED: uncharacterized protein LOC104606102    105   6e-23   Nelumbo nucifera [Indian lotus]
ref|XP_002965799.1|  hypothetical protein SELMODRAFT_84529              103   6e-23   
ref|XP_006353397.1|  PREDICTED: uncharacterized protein LOC102598299    105   6e-23   Solanum tuberosum [potatoes]
gb|ACG41203.1|  hypothetical protein                                    104   6e-23   Zea mays [maize]
ref|XP_008246399.1|  PREDICTED: uncharacterized protein LOC103344579    105   6e-23   Prunus mume [ume]
ref|XP_009147246.1|  PREDICTED: uncharacterized protein LOC103870827    104   7e-23   Brassica rapa
emb|CDY27772.1|  BnaA05g31810D                                          104   7e-23   Brassica napus [oilseed rape]
ref|XP_006651088.1|  PREDICTED: uncharacterized protein LOC102701157    103   7e-23   
gb|KDO40688.1|  hypothetical protein CISIN_1g043503mg                   104   7e-23   Citrus sinensis [apfelsine]
ref|XP_009380402.1|  PREDICTED: uncharacterized protein LOC103968807    105   8e-23   
ref|XP_011093041.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    106   9e-23   
gb|EMT20494.1|  hypothetical protein F775_33030                         100   1e-22   
ref|XP_007135151.1|  hypothetical protein PHAVU_010G105300g             104   1e-22   Phaseolus vulgaris [French bean]
gb|AAT68360.1|  hypothetical protein At3g05390                          104   1e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010464063.1|  PREDICTED: uncharacterized protein LOC104744673    104   1e-22   Camelina sativa [gold-of-pleasure]
ref|XP_010485980.1|  PREDICTED: uncharacterized protein LOC104764193    104   1e-22   Camelina sativa [gold-of-pleasure]
gb|KJB24637.1|  hypothetical protein B456_004G154700                    104   1e-22   Gossypium raimondii
ref|XP_007025169.1|  S-adenosyl-L-methionine-dependent methyltran...    103   1e-22   Theobroma cacao [chocolate]
ref|XP_006444936.1|  hypothetical protein CICLE_v10024550mg             104   1e-22   Citrus clementina [clementine]
ref|XP_009380075.1|  PREDICTED: uncharacterized protein LOC103968547    103   1e-22   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU45763.1|  hypothetical protein MIMGU_mgv1a020775mg                103   1e-22   Erythranthe guttata [common monkey flower]
ref|XP_011023653.1|  PREDICTED: uncharacterized protein LOC105125062    104   1e-22   Populus euphratica
ref|XP_007051690.1|  S-adenosyl-L-methionine-dependent methyltran...    105   1e-22   
ref|XP_010100989.1|  hypothetical protein L484_010644                   103   1e-22   Morus notabilis
ref|XP_009373793.1|  PREDICTED: uncharacterized protein LOC103962...    104   1e-22   Pyrus x bretschneideri [bai li]
ref|XP_006449631.1|  hypothetical protein CICLE_v10015651mg             103   2e-22   Citrus clementina [clementine]
gb|KHN07742.1|  hypothetical protein glysoja_033127                     102   2e-22   Glycine soja [wild soybean]
ref|XP_009349328.1|  PREDICTED: uncharacterized protein LOC103940868    103   2e-22   Pyrus x bretschneideri [bai li]
ref|XP_009376648.1|  PREDICTED: uncharacterized protein LOC103965332    103   2e-22   Pyrus x bretschneideri [bai li]
ref|XP_002277860.1|  PREDICTED: uncharacterized protein LOC100259964    103   2e-22   Vitis vinifera
ref|XP_003572828.1|  PREDICTED: uncharacterized protein LOC100827692    103   2e-22   Brachypodium distachyon [annual false brome]
ref|XP_010538231.1|  PREDICTED: uncharacterized protein LOC104812658    102   2e-22   Tarenaya hassleriana [spider flower]
ref|XP_003572829.1|  PREDICTED: uncharacterized protein LOC100828000    103   3e-22   Brachypodium distachyon [annual false brome]
ref|XP_004490294.1|  PREDICTED: uncharacterized protein LOC101497349    103   3e-22   Cicer arietinum [garbanzo]
emb|CAN73279.1|  hypothetical protein VITISV_040608                     104   3e-22   Vitis vinifera
ref|XP_008362217.1|  PREDICTED: uncharacterized protein LOC103425897    103   3e-22   
ref|XP_010661826.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    104   4e-22   
ref|XP_008388956.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    103   4e-22   
ref|XP_001777602.1|  predicted protein                                  102   4e-22   
ref|XP_002993215.1|  hypothetical protein SELMODRAFT_431315             102   4e-22   Selaginella moellendorffii
ref|XP_008801541.1|  PREDICTED: uncharacterized protein LOC103715629    102   5e-22   
ref|XP_004234443.2|  PREDICTED: uncharacterized protein LOC101265707    102   5e-22   
ref|XP_009605194.1|  PREDICTED: uncharacterized protein LOC104099794    102   5e-22   Nicotiana tomentosiformis
ref|XP_006415545.1|  hypothetical protein EUTSA_v10010017mg             101   6e-22   Eutrema salsugineum [saltwater cress]
ref|XP_006290179.1|  hypothetical protein CARUB_v10003858mg             104   6e-22   
ref|XP_002305389.2|  hypothetical protein POPTR_0004s11590g             102   6e-22   
ref|XP_011028455.1|  PREDICTED: uncharacterized protein LOC105128...    102   6e-22   Populus euphratica
ref|XP_006467523.1|  PREDICTED: uncharacterized protein LOC102629...    101   6e-22   Citrus sinensis [apfelsine]
ref|XP_002318999.2|  hypothetical protein POPTR_0013s02010g             102   7e-22   Populus trichocarpa [western balsam poplar]
ref|XP_010261406.1|  PREDICTED: uncharacterized protein LOC104600251    102   7e-22   
ref|XP_009338797.1|  PREDICTED: uncharacterized protein LOC103931112    103   7e-22   
ref|XP_009781541.1|  PREDICTED: uncharacterized protein LOC104230427    102   7e-22   
ref|XP_003518817.1|  PREDICTED: uncharacterized protein LOC100782372    102   7e-22   
ref|XP_008375945.1|  PREDICTED: uncharacterized protein LOC103439174    103   7e-22   
ref|NP_192033.1|  putative methyltransferase                            103   7e-22   
ref|XP_003581273.1|  PREDICTED: uncharacterized protein LOC100830081    102   8e-22   
ref|XP_011028454.1|  PREDICTED: uncharacterized protein LOC105128...    101   8e-22   
gb|KHN18827.1|  hypothetical protein glysoja_045347                     101   1e-21   
ref|XP_008370457.1|  PREDICTED: uncharacterized protein LOC103433933    101   1e-21   
gb|KDP28553.1|  hypothetical protein JCGZ_14324                         101   1e-21   
ref|XP_010252251.1|  PREDICTED: uncharacterized protein LOC104593885    101   1e-21   
ref|XP_006305095.1|  hypothetical protein CARUB_v10009462mg             100   1e-21   
ref|XP_010054857.1|  PREDICTED: uncharacterized protein LOC104443218    102   1e-21   
gb|KEH17516.1|  methyltransferase domain protein, putative              101   1e-21   
emb|CDY18775.1|  BnaAnng02400D                                          100   1e-21   
gb|EAY79644.1|  hypothetical protein OsI_34788                          100   1e-21   
ref|XP_009115215.1|  PREDICTED: uncharacterized protein LOC103840459    100   2e-21   
ref|XP_008805645.1|  PREDICTED: uncharacterized protein LOC103718547    101   2e-21   
gb|AAG46168.1|AC018727_20  hypothetical protein                         100   2e-21   
ref|NP_001065501.1|  Os10g0578600                                       100   2e-21   
gb|ABB48033.1|  expressed protein                                       100   2e-21   
gb|EAZ17094.1|  hypothetical protein OsJ_32593                          100   2e-21   
gb|EMT06113.1|  hypothetical protein F775_18222                       99.0    2e-21   
emb|CDX99855.1|  BnaC05g22770D                                        98.6    3e-21   
gb|EYU33234.1|  hypothetical protein MIMGU_mgv1a026970mg                100   3e-21   
ref|XP_010478350.1|  PREDICTED: uncharacterized protein LOC104757316  99.8    3e-21   
ref|XP_010915764.1|  PREDICTED: uncharacterized protein LOC105040777    100   3e-21   
ref|NP_174272.2|  putative methyltransferase domain-containing pr...  99.4    3e-21   
emb|CDX90214.1|  BnaA08g17700D                                        99.4    3e-21   
ref|XP_008648379.1|  PREDICTED: uncharacterized protein LOC103628964    100   3e-21   
emb|CDY71411.1|  BnaC03g76030D                                        99.4    4e-21   
ref|XP_007153540.1|  hypothetical protein PHAVU_003G044100g             100   4e-21   
gb|EMS58667.1|  hypothetical protein TRIUR3_13635                     99.0    4e-21   
ref|XP_008669352.1|  PREDICTED: uncharacterized protein LOC103646401    100   4e-21   
emb|CBI40420.3|  unnamed protein product                              99.4    4e-21   
ref|XP_002974326.1|  hypothetical protein SELMODRAFT_52690            99.0    4e-21   
ref|XP_002990866.1|  hypothetical protein SELMODRAFT_44179            99.0    4e-21   
ref|XP_002890831.1|  hypothetical protein ARALYDRAFT_473184           99.0    4e-21   
ref|XP_009383492.1|  PREDICTED: uncharacterized protein LOC103971243    100   5e-21   
ref|XP_006856423.1|  hypothetical protein AMTR_s00047p00220710          100   6e-21   
ref|XP_009109638.1|  PREDICTED: uncharacterized protein LOC103835255  99.4    6e-21   
gb|EYU32180.1|  hypothetical protein MIMGU_mgv1a024581mg              99.4    7e-21   
ref|XP_010065207.1|  PREDICTED: uncharacterized protein LOC104452439  99.0    8e-21   
ref|XP_002511929.1|  ATRAD3, putative                                   100   9e-21   
gb|EEE65710.1|  hypothetical protein OsJ_21345                        99.0    1e-20   
emb|CAN77378.1|  hypothetical protein VITISV_043863                   99.0    1e-20   
gb|EMT14687.1|  hypothetical protein F775_03340                       97.4    1e-20   
gb|EPS63238.1|  hypothetical protein M569_11547                       97.8    1e-20   
ref|XP_002443752.1|  hypothetical protein SORBIDRAFT_07g001350        99.0    1e-20   
gb|ABE65508.1|  hypothetical protein At4g01240                        98.6    1e-20   
ref|NP_001057631.1|  Os06g0474300                                     98.6    1e-20   
gb|ABK28240.1|  unknown                                               98.6    2e-20   
ref|XP_002284169.1|  PREDICTED: uncharacterized protein LOC100257940  98.6    2e-20   
gb|EAZ00931.1|  hypothetical protein OsI_22961                        98.6    2e-20   
ref|XP_002447909.1|  hypothetical protein SORBIDRAFT_06g017790        98.6    2e-20   
ref|NP_001169099.1|  uncharacterized protein LOC100382943 precursor   98.6    2e-20   
gb|AFW74244.1|  hypothetical protein ZEAMMB73_912598                  98.6    2e-20   
ref|XP_011023264.1|  PREDICTED: uncharacterized protein LOC105124...  97.4    2e-20   
ref|XP_009597584.1|  PREDICTED: uncharacterized protein LOC104093534  98.2    2e-20   
ref|XP_010260532.1|  PREDICTED: uncharacterized protein LOC104599618  98.6    2e-20   
gb|KCW78119.1|  hypothetical protein EUGRSUZ_D02328                   98.2    2e-20   
ref|XP_011023263.1|  PREDICTED: uncharacterized protein LOC105124...  97.4    2e-20   
gb|AAB61017.1|  A_IG002N01.7 gene product                             99.4    2e-20   
ref|XP_009766984.1|  PREDICTED: uncharacterized protein LOC104218235  98.6    2e-20   
ref|XP_002872900.1|  hypothetical protein ARALYDRAFT_912109           98.2    2e-20   
ref|XP_010326696.1|  PREDICTED: uncharacterized protein LOC101265...  97.1    2e-20   
dbj|BAK05115.1|  predicted protein                                    98.2    2e-20   
ref|XP_010088953.1|  hypothetical protein L484_013532                 97.8    3e-20   
ref|XP_001754370.1|  predicted protein                                96.7    3e-20   
ref|XP_011009363.1|  PREDICTED: uncharacterized protein LOC105114505  97.8    3e-20   
ref|XP_002444878.1|  hypothetical protein SORBIDRAFT_07g000800        97.8    3e-20   
ref|XP_004302412.1|  PREDICTED: uncharacterized protein LOC101291062  97.8    3e-20   
ref|XP_004965400.1|  PREDICTED: uncharacterized protein LOC101775804  97.8    3e-20   
gb|KEH18781.1|  methyltransferase domain protein, putative            97.8    3e-20   
ref|XP_010092875.1|  hypothetical protein L484_022470                 97.4    3e-20   
ref|XP_011023262.1|  PREDICTED: uncharacterized protein LOC105124...  97.8    3e-20   
ref|XP_009799568.1|  PREDICTED: uncharacterized protein LOC104245636  97.4    3e-20   
ref|XP_010456225.1|  PREDICTED: uncharacterized protein LOC104737686  97.8    4e-20   
ref|XP_010422784.1|  PREDICTED: uncharacterized protein LOC104708006  97.4    4e-20   
ref|XP_010326694.1|  PREDICTED: uncharacterized protein LOC101265...  97.4    4e-20   
gb|EPS66088.1|  hypothetical protein M569_08692                       95.9    4e-20   
ref|XP_010549468.1|  PREDICTED: uncharacterized protein LOC104820635  96.3    4e-20   
ref|XP_004975730.1|  PREDICTED: uncharacterized protein LOC101762914  97.1    5e-20   
ref|XP_001761229.1|  predicted protein                                97.4    5e-20   
ref|XP_006339639.1|  PREDICTED: uncharacterized protein LOC102587968  97.1    5e-20   
emb|CDY72207.1|  BnaCnng76480D                                        96.7    5e-20   
ref|XP_010544422.1|  PREDICTED: uncharacterized protein LOC104817...  97.1    5e-20   
ref|XP_010544420.1|  PREDICTED: uncharacterized protein LOC104817...  97.1    6e-20   
ref|XP_008233031.1|  PREDICTED: uncharacterized protein LOC103332112  97.1    6e-20   
gb|KJB10578.1|  hypothetical protein B456_001G208400                  97.1    6e-20   
ref|XP_006396286.1|  hypothetical protein EUTSA_v10028611mg           97.1    6e-20   
ref|XP_009128498.1|  PREDICTED: uncharacterized protein LOC103853324  96.7    7e-20   
ref|XP_007032842.1|  S-adenosyl-L-methionine-dependent methyltran...  96.3    8e-20   
emb|CDY53861.1|  BnaA02g36360D                                        96.7    8e-20   
ref|XP_007220933.1|  hypothetical protein PRUPE_ppa023757mg           96.3    9e-20   
ref|XP_010427634.1|  PREDICTED: uncharacterized protein LOC104712426  96.3    1e-19   
ref|XP_003563856.1|  PREDICTED: uncharacterized protein LOC100824970  95.5    2e-19   
ref|XP_008674722.1|  PREDICTED: uncharacterized protein LOC103650909  95.5    2e-19   
ref|XP_002467048.1|  hypothetical protein SORBIDRAFT_01g018790        96.7    3e-19   
gb|KHN24594.1|  hypothetical protein glysoja_046776                   92.8    4e-19   
ref|XP_004972280.1|  PREDICTED: probable methyltransferase PMT2-like  92.4    5e-19   
ref|XP_004973028.1|  PREDICTED: uncharacterized protein LOC101758976  93.6    8e-19   
gb|ABL85035.1|  expressed protein                                     92.8    1e-18   
gb|KCW56311.1|  hypothetical protein EUGRSUZ_I02052                   92.0    1e-18   
gb|EAY94275.1|  hypothetical protein OsI_16044                        92.0    1e-18   
gb|AEW09299.1|  hypothetical protein UMN_2867_01                      87.4    2e-18   
gb|EAZ30862.1|  hypothetical protein OsJ_14934                        92.8    2e-18   
ref|XP_002444913.1|  hypothetical protein SORBIDRAFT_07g001390        92.0    3e-18   
ref|XP_002458886.1|  hypothetical protein SORBIDRAFT_03g042190        92.0    3e-18   
ref|NP_001052895.2|  Os04g0444700                                     91.7    4e-18   
emb|CAD40973.2|  OSJNBa0027P08.5                                      91.7    4e-18   
ref|XP_006656966.1|  PREDICTED: uncharacterized protein LOC102700069  90.5    4e-18   
gb|EMT19927.1|  hypothetical protein F775_33042                       88.2    4e-18   
ref|XP_009595553.1|  PREDICTED: uncharacterized protein LOC104091831  88.6    2e-17   
gb|KCW62552.1|  hypothetical protein EUGRSUZ_G00044                   89.4    2e-17   
ref|XP_004974512.1|  PREDICTED: uncharacterized protein LOC101763033  86.7    5e-17   
gb|AFW77098.1|  hypothetical protein ZEAMMB73_288207                  86.7    6e-17   
ref|XP_010674714.1|  PREDICTED: uncharacterized protein LOC104890814  87.8    9e-17   
ref|XP_008650544.1|  PREDICTED: uncharacterized protein LOC103631404  86.3    1e-16   
gb|AES71148.2|  ATRAD3-like protein                                   84.7    1e-16   
ref|XP_003600897.1|  hypothetical protein MTR_3g070620                84.7    1e-16   
ref|XP_008664334.1|  PREDICTED: uncharacterized protein LOC103642960  85.9    2e-16   
emb|CDO97681.1|  unnamed protein product                              85.9    4e-16   
gb|EEC82806.1|  hypothetical protein OsI_27582                        85.1    7e-16   
gb|EEE67930.1|  hypothetical protein OsJ_25806                        84.3    8e-16   
ref|NP_001060840.1|  Os08g0113400                                     84.7    8e-16   
gb|KCW62553.1|  hypothetical protein EUGRSUZ_G00045                   84.0    1e-15   
gb|KHN25871.1|  hypothetical protein glysoja_018725                   79.7    3e-15   
gb|EMT18502.1|  hypothetical protein F775_00868                       81.6    3e-15   
tpg|DAA61140.1|  TPA: hypothetical protein ZEAMMB73_444374            83.6    3e-15   
gb|KHN39140.1|  hypothetical protein glysoja_027945                   77.4    5e-15   
gb|EMS53307.1|  hypothetical protein TRIUR3_32847                     78.6    9e-15   
ref|XP_006659759.1|  PREDICTED: uncharacterized protein LOC102717363  80.9    1e-14   
ref|XP_010507038.1|  PREDICTED: uncharacterized protein LOC104783598  71.6    2e-11   
ref|XP_010102876.1|  hypothetical protein L484_002004                 67.8    2e-11   
ref|XP_002868635.1|  hypothetical protein ARALYDRAFT_916146           63.2    9e-10   
ref|XP_003600934.1|  hypothetical protein MTR_3g071050                65.9    2e-09   
emb|CBI39481.3|  unnamed protein product                              62.8    3e-08   
gb|AFW56218.1|  hypothetical protein ZEAMMB73_835727                  60.1    1e-07   
gb|KDO78095.1|  hypothetical protein CISIN_1g0178331mg                54.3    1e-05   
ref|XP_006431322.1|  hypothetical protein CICLE_v10013545mg           50.4    1e-04   
gb|EMT14686.1|  hypothetical protein F775_17693                       49.3    7e-04   



>ref|XP_011083506.1| PREDICTED: uncharacterized protein LOC105166016 [Sesamum indicum]
Length=415

 Score =   223 bits (569),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            FN+FIAARGLFPLYFSLD RFPFY NVFDLVH GNGLDV G+PEKLEFLMFD+DRVLRAG
Sbjct  297  FNEFIAARGLFPLYFSLDQRFPFYGNVFDLVHAGNGLDVGGRPEKLEFLMFDIDRVLRAG  356

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVR  263
            GLFWLDNFYCS+DDKK+ALTRLIERFGYKKLKWVVGEK NGSGK E+YLSAVLQKPVR
Sbjct  357  GLFWLDNFYCSTDDKKRALTRLIERFGYKKLKWVVGEKINGSGKSELYLSAVLQKPVR  414



>ref|XP_009598077.1| PREDICTED: uncharacterized protein LOC104093936 [Nicotiana tomentosiformis]
Length=420

 Score =   220 bits (560),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 103/119 (87%), Positives = 111/119 (93%), Gaps = 0/119 (0%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            FN+FIAARGLFPLY SLDHRFPF+DN FDLVH GN LDVNG+PEKLEFLMFD+DRVLRAG
Sbjct  302  FNEFIAARGLFPLYLSLDHRFPFHDNTFDLVHAGNVLDVNGRPEKLEFLMFDIDRVLRAG  361

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVRA  260
            GLFWLDNF C+S+DK+ ALTRLIERFGYKKLKWVVGE+ NGSGK EVYLSAVLQKPVRA
Sbjct  362  GLFWLDNFLCTSEDKRSALTRLIERFGYKKLKWVVGERINGSGKSEVYLSAVLQKPVRA  420



>gb|EYU38830.1| hypothetical protein MIMGU_mgv1a007054mg [Erythranthe guttata]
Length=421

 Score =   218 bits (555),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 103/119 (87%), Positives = 108/119 (91%), Gaps = 0/119 (0%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            FN+FIA+RGLFPLY SLDHRFPF DNVFDLVH  NGLDV G+ EKLEFLMFD+DRVLR G
Sbjct  303  FNEFIASRGLFPLYLSLDHRFPFQDNVFDLVHAANGLDVGGRSEKLEFLMFDIDRVLRTG  362

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVRA  260
            GLFWLDNFYCSSDDKK ALTRLIERFGYKKLKWVVGEK NG+GK EVYLSAVLQKPVR 
Sbjct  363  GLFWLDNFYCSSDDKKSALTRLIERFGYKKLKWVVGEKVNGAGKSEVYLSAVLQKPVRV  421



>ref|XP_009803492.1| PREDICTED: uncharacterized protein LOC104248856 [Nicotiana sylvestris]
Length=420

 Score =   217 bits (553),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            FN+FIAARGLFPLY SLDHRFPF+DN FDLVH GN LD++G+PEKLEFLMFD+DRVLRAG
Sbjct  302  FNEFIAARGLFPLYLSLDHRFPFHDNAFDLVHAGNVLDISGRPEKLEFLMFDIDRVLRAG  361

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVR  263
            GLFWLDNF C+S+DK+ ALTRLIERFGYKKLKWVVGEK NGSGK EVYLSAVLQKPVR
Sbjct  362  GLFWLDNFLCTSEDKRSALTRLIERFGYKKLKWVVGEKINGSGKSEVYLSAVLQKPVR  419



>ref|XP_004250146.1| PREDICTED: uncharacterized protein LOC101246201 [Solanum lycopersicum]
Length=423

 Score =   216 bits (550),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/119 (87%), Positives = 112/119 (94%), Gaps = 0/119 (0%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            FN+FIAARG+FPLY SLDHRFPF+DNVFDLVHVGN LDV+G+PEKLEFL+FD+DRVLRAG
Sbjct  305  FNEFIAARGVFPLYLSLDHRFPFHDNVFDLVHVGNVLDVSGRPEKLEFLVFDIDRVLRAG  364

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVRA  260
            GLFWLDNF CS++DKK ALTRLIERFGYKKLKWVVGEK NGSGK EVYLSAVLQKPVR 
Sbjct  365  GLFWLDNFLCSNEDKKTALTRLIERFGYKKLKWVVGEKINGSGKSEVYLSAVLQKPVRV  423



>emb|CDP07421.1| unnamed protein product [Coffea canephora]
Length=420

 Score =   216 bits (549),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            FN+FIAARGLFP++ SLDHRFPFYDNVFDL+H  N LDV G+PEKLEFLMFD+DR+LRAG
Sbjct  301  FNEFIAARGLFPVFLSLDHRFPFYDNVFDLIHAANKLDVGGRPEKLEFLMFDIDRILRAG  360

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVR  263
            GL WLDNFYCS+DDKK+ALTR+IE+FGYKKLKWVVGEK NGSGK EVYLSAVLQKPVR
Sbjct  361  GLLWLDNFYCSNDDKKRALTRIIEQFGYKKLKWVVGEKINGSGKAEVYLSAVLQKPVR  418



>ref|XP_011074653.1| PREDICTED: uncharacterized protein LOC105159331 [Sesamum indicum]
Length=415

 Score =   216 bits (549),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 100/119 (84%), Positives = 109/119 (92%), Gaps = 0/119 (0%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            F++FIA+RGLFPLY SLD RFPF+DNVFDLVH  NGLDV G+PEKLEFLMFD+DR+LRAG
Sbjct  297  FSEFIASRGLFPLYLSLDQRFPFHDNVFDLVHAANGLDVGGRPEKLEFLMFDIDRILRAG  356

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVRA  260
            GL WLDNFYCS+DDKK ALTRLIERFGYKKLKWVVGE+ NGSGK EVYLS VLQKPVRA
Sbjct  357  GLLWLDNFYCSTDDKKSALTRLIERFGYKKLKWVVGERVNGSGKSEVYLSVVLQKPVRA  415



>ref|XP_006353174.1| PREDICTED: uncharacterized protein LOC102605433 [Solanum tuberosum]
Length=423

 Score =   216 bits (549),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 102/119 (86%), Positives = 112/119 (94%), Gaps = 0/119 (0%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            FN+FIAARG+FPLY SLDHRFPF+DNVFDLVHVGN LDV+G+PEKLEFL+FD+DRVLRAG
Sbjct  305  FNEFIAARGVFPLYLSLDHRFPFHDNVFDLVHVGNVLDVSGRPEKLEFLVFDIDRVLRAG  364

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVRA  260
            GLFWLDNF CS++DKK ALTRLIERFGYKKLKW+VGEK NGSGK EVYLSAVLQKPVR 
Sbjct  365  GLFWLDNFLCSNEDKKTALTRLIERFGYKKLKWIVGEKINGSGKSEVYLSAVLQKPVRV  423



>gb|AAK84481.1| unknown [Solanum lycopersicum]
Length=340

 Score =   211 bits (538),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/117 (87%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            FN+FIAARG+FPLY SLDHRFPF+DNVFDLVHVGN LDV+G+PEKLEFL+FD+DRVLRAG
Sbjct  218  FNEFIAARGVFPLYLSLDHRFPFHDNVFDLVHVGNVLDVSGRPEKLEFLVFDIDRVLRAG  277

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPV  266
            GLFWLDNF CS++DKK ALTRLIERFGYKKLKWVVGEK NGSGK EVYLSAVLQKPV
Sbjct  278  GLFWLDNFLCSNEDKKTALTRLIERFGYKKLKWVVGEKINGSGKSEVYLSAVLQKPV  334



>gb|KJB14424.1| hypothetical protein B456_002G124500 [Gossypium raimondii]
Length=420

 Score =   210 bits (535),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 99/119 (83%), Positives = 109/119 (92%), Gaps = 2/119 (2%)
 Frame = -2

Query  613  NDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAGG  434
            ++FIAARGLFPL+ SLDHRFPFYDNVFDLVH  +GLDV G+PEKLEFLMFD+DR+LR GG
Sbjct  301  SEFIAARGLFPLFLSLDHRFPFYDNVFDLVHATSGLDVEGKPEKLEFLMFDLDRILRVGG  360

Query  433  LFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNN--GSGKPEVYLSAVLQKPVR  263
            LFWLDNFYCS D+KK ALTRLIERFGYKKLKWVVGEK +  GSGKP+VYLSAVLQKPVR
Sbjct  361  LFWLDNFYCSDDEKKSALTRLIERFGYKKLKWVVGEKTDAAGSGKPQVYLSAVLQKPVR  419



>ref|XP_006473627.1| PREDICTED: uncharacterized protein LOC102620145 [Citrus sinensis]
 gb|KDO84792.1| hypothetical protein CISIN_1g037675mg [Citrus sinensis]
Length=418

 Score =   210 bits (534),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 108/118 (92%), Gaps = 1/118 (1%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            +++FIAARGLFPLY SLDHRFPFYDNVFDLVH  +GLDV GQPEKLEFLMFD DR+LRAG
Sbjct  300  YSEFIAARGLFPLYLSLDHRFPFYDNVFDLVHASSGLDVGGQPEKLEFLMFDFDRILRAG  359

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVR  263
            GLFWLDNFYC++D+KK ALTRLIERFGYKKLKWVVGEK   +GK EVYLSAVLQKPVR
Sbjct  360  GLFWLDNFYCANDEKKSALTRLIERFGYKKLKWVVGEKGE-TGKSEVYLSAVLQKPVR  416



>gb|KDP36948.1| hypothetical protein JCGZ_08239 [Jatropha curcas]
Length=420

 Score =   209 bits (532),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 98/120 (82%), Positives = 108/120 (90%), Gaps = 2/120 (2%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            F++FIAARGLFPLY SLDHRFPFYDNVFDLVH  +GLDV G+PEKLEFLMFD+DRV+RAG
Sbjct  300  FSEFIAARGLFPLYLSLDHRFPFYDNVFDLVHASSGLDVGGKPEKLEFLMFDIDRVMRAG  359

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK--NNGSGKPEVYLSAVLQKPVR  263
            GLFWLDNFYC+ D+KK+ LTRLIERFGYKKLKWVVGEK    GSGK E+YLSAVLQKP R
Sbjct  360  GLFWLDNFYCADDEKKRTLTRLIERFGYKKLKWVVGEKVETAGSGKSEIYLSAVLQKPAR  419



>ref|XP_004136545.1| PREDICTED: uncharacterized protein LOC101215265 [Cucumis sativus]
 ref|XP_004161281.1| PREDICTED: uncharacterized LOC101215265 [Cucumis sativus]
 gb|KGN59257.1| hypothetical protein Csa_3G791480 [Cucumis sativus]
Length=417

 Score =   209 bits (531),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 97/119 (82%), Positives = 110/119 (92%), Gaps = 1/119 (1%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            F++FIAARGLFPL+ SLDHRFPFYDNVFDLVH  NGLD+ G+PEKLEFLMFD+DR+LRAG
Sbjct  300  FSEFIAARGLFPLFLSLDHRFPFYDNVFDLVHASNGLDIGGKPEKLEFLMFDIDRILRAG  359

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVRA  260
            GL WLDNFYC++D+KKKALTRLIERFG+KKLKWV+GEK+  SGK EVYLSAVLQKPVR 
Sbjct  360  GLLWLDNFYCANDEKKKALTRLIERFGFKKLKWVIGEKSE-SGKSEVYLSAVLQKPVRV  417



>ref|XP_010692715.1| PREDICTED: uncharacterized protein LOC104905778 [Beta vulgaris 
subsp. vulgaris]
Length=421

 Score =   209 bits (531),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 109/118 (92%), Gaps = 1/118 (1%)
 Frame = -2

Query  613  NDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAGG  434
            NDFIAARGLFPL+ SLDHRFPFYDNVFDLVH G+ LDV G+PEKLEFLMFD+DRVLRAGG
Sbjct  305  NDFIAARGLFPLFMSLDHRFPFYDNVFDLVHAGSALDVGGKPEKLEFLMFDIDRVLRAGG  364

Query  433  LFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVRA  260
            LFWLDNFYC++DDKK+ LTRLIE+FGYKKLKWVVGEK   SGK E+YLSAVL+KPVRA
Sbjct  365  LFWLDNFYCATDDKKRDLTRLIEKFGYKKLKWVVGEKTM-SGKSELYLSAVLEKPVRA  421



>ref|XP_008442993.1| PREDICTED: uncharacterized protein LOC103486724 [Cucumis melo]
Length=417

 Score =   209 bits (531),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 97/119 (82%), Positives = 110/119 (92%), Gaps = 1/119 (1%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            F++FIAARGLFPL+ SLDHRFPFYDNVFDLVH  NGLD+ G+PEKLEFLMFD+DR+LRAG
Sbjct  300  FSEFIAARGLFPLFLSLDHRFPFYDNVFDLVHASNGLDIGGKPEKLEFLMFDIDRILRAG  359

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVRA  260
            GL WLDNFYC++D+KKKALTRLIERFG+KKLKWV+GEK+  SGK EVYLSAVLQKPVR 
Sbjct  360  GLLWLDNFYCANDEKKKALTRLIERFGFKKLKWVIGEKSE-SGKSEVYLSAVLQKPVRV  417



>ref|XP_007017750.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
 gb|EOY14975.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
Length=420

 Score =   208 bits (529),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 98/121 (81%), Positives = 112/121 (93%), Gaps = 2/121 (2%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            +++FIAARGLFPL+ SLDHRFPFYDNVFDLVH  +GLDV G+PEKLEFLMFD+DR+LRAG
Sbjct  300  YSEFIAARGLFPLFLSLDHRFPFYDNVFDLVHATSGLDVGGKPEKLEFLMFDVDRILRAG  359

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNN--GSGKPEVYLSAVLQKPVR  263
            GLFWLDNFYC++D+KK+ALTRLIERFGYKKLKWVVG+K +  GSGKPE YLSAVLQKPVR
Sbjct  360  GLFWLDNFYCANDEKKRALTRLIERFGYKKLKWVVGDKIDAAGSGKPEGYLSAVLQKPVR  419

Query  262  A  260
             
Sbjct  420  T  420



>ref|XP_006435145.1| hypothetical protein CICLE_v10001297mg [Citrus clementina]
 gb|ESR48385.1| hypothetical protein CICLE_v10001297mg [Citrus clementina]
Length=418

 Score =   207 bits (527),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 98/118 (83%), Positives = 106/118 (90%), Gaps = 1/118 (1%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            + +FIAARGLFPLY SLDHRFPFYDNVFDLVH  +GLDV GQPEKLEF MFD DR+LRAG
Sbjct  300  YGEFIAARGLFPLYLSLDHRFPFYDNVFDLVHASSGLDVGGQPEKLEFFMFDFDRILRAG  359

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVR  263
            GLFWLDNFYC++D+KK ALTRLIERFGYKKLKWVVGEK   +GK EVYLSAVLQKPVR
Sbjct  360  GLFWLDNFYCANDEKKSALTRLIERFGYKKLKWVVGEKGE-TGKSEVYLSAVLQKPVR  416



>ref|XP_003550415.1| PREDICTED: uncharacterized protein LOC100812467 [Glycine max]
 gb|KHN12655.1| hypothetical protein glysoja_008618 [Glycine soja]
Length=422

 Score =   207 bits (527),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 99/121 (82%), Positives = 111/121 (92%), Gaps = 2/121 (2%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            F++FIAARGLFPLY SLDHRFPFYDNVFDLVH  +GLDV G+ EKLEFLMFD+DRVLRAG
Sbjct  302  FSEFIAARGLFPLYLSLDHRFPFYDNVFDLVHASSGLDVGGKSEKLEFLMFDIDRVLRAG  361

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK--NNGSGKPEVYLSAVLQKPVR  263
            GLFWLDNF+C++++KK+ LTRLIERFGYKKLKWVVGEK  + GSGKPEV LSAVLQKPVR
Sbjct  362  GLFWLDNFFCANEEKKQTLTRLIERFGYKKLKWVVGEKVDSVGSGKPEVVLSAVLQKPVR  421

Query  262  A  260
            A
Sbjct  422  A  422



>ref|XP_007160685.1| hypothetical protein PHAVU_001G008400g [Phaseolus vulgaris]
 gb|ESW32679.1| hypothetical protein PHAVU_001G008400g [Phaseolus vulgaris]
Length=420

 Score =   205 bits (521),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 98/120 (82%), Positives = 110/120 (92%), Gaps = 2/120 (2%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            F++FIAARGLFPLY SLDHRFPFYDNVFDLVH  +GLDV G+ EKLEFLMFD+DRVLRAG
Sbjct  300  FSEFIAARGLFPLYLSLDHRFPFYDNVFDLVHASSGLDVGGKSEKLEFLMFDIDRVLRAG  359

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK--NNGSGKPEVYLSAVLQKPVR  263
            GLFWLDNF+C++++ K+ALTRLIERFGYKKLKWVVGEK  + GSGKPEV LSAVLQKPVR
Sbjct  360  GLFWLDNFFCANEENKQALTRLIERFGYKKLKWVVGEKIDSVGSGKPEVVLSAVLQKPVR  419



>ref|XP_003545042.1| PREDICTED: uncharacterized protein LOC100786204 isoform 1 [Glycine 
max]
 gb|KHN39440.1| Putative methyltransferase PMT16 [Glycine soja]
Length=421

 Score =   205 bits (521),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 98/121 (81%), Positives = 110/121 (91%), Gaps = 2/121 (2%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            F++FIAARGLFPLY SLDHRFPFYDNVFDLVH  +GLDV G+ EKLEF MFD+DRVLRAG
Sbjct  301  FSEFIAARGLFPLYLSLDHRFPFYDNVFDLVHASSGLDVGGKSEKLEFFMFDIDRVLRAG  360

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK--NNGSGKPEVYLSAVLQKPVR  263
            GLFWLDNF+C++++KK+ LTRLIERFGYKKLKWVVGEK  + GSGKPEV LSAVLQKPVR
Sbjct  361  GLFWLDNFFCANEEKKQVLTRLIERFGYKKLKWVVGEKVDSVGSGKPEVVLSAVLQKPVR  420

Query  262  A  260
            A
Sbjct  421  A  421



>ref|XP_011028977.1| PREDICTED: uncharacterized protein LOC105128842 [Populus euphratica]
 ref|XP_011028978.1| PREDICTED: uncharacterized protein LOC105128842 [Populus euphratica]
 ref|XP_011028979.1| PREDICTED: uncharacterized protein LOC105128842 [Populus euphratica]
 ref|XP_011028980.1| PREDICTED: uncharacterized protein LOC105128842 [Populus euphratica]
Length=420

 Score =   205 bits (521),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 97/120 (81%), Positives = 106/120 (88%), Gaps = 2/120 (2%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            F++FIAARGLFPLY SLDHRFPFYDNVFDL+H  +GLD   +PEKLEFLMFD+DR+LRAG
Sbjct  300  FSEFIAARGLFPLYLSLDHRFPFYDNVFDLIHASSGLDGGDKPEKLEFLMFDIDRILRAG  359

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK--NNGSGKPEVYLSAVLQKPVR  263
            GLFWLDNFYC+ D+KK ALTRLIERFGYKKLKWVVGEK    GSGK EVYLSAVLQKP R
Sbjct  360  GLFWLDNFYCADDEKKTALTRLIERFGYKKLKWVVGEKIDTAGSGKSEVYLSAVLQKPAR  419



>ref|XP_010095168.1| putative methyltransferase PMT28 [Morus notabilis]
 gb|EXB58398.1| putative methyltransferase PMT28 [Morus notabilis]
Length=456

 Score =   205 bits (522),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 96/120 (80%), Positives = 108/120 (90%), Gaps = 2/120 (2%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            F+ FIAARGLFPLY SLDHRFPFYDNVFDLVH G+GLDV G+PEKL+FLMFD+DR++R G
Sbjct  336  FSVFIAARGLFPLYMSLDHRFPFYDNVFDLVHAGSGLDVGGKPEKLDFLMFDIDRIIRPG  395

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK--NNGSGKPEVYLSAVLQKPVR  263
            G FWLDNFYC++D+KK ALTRLIERFGYKKLKWVVGEK   +GS K EVYLSA+LQKPVR
Sbjct  396  GFFWLDNFYCANDEKKNALTRLIERFGYKKLKWVVGEKVDPSGSAKSEVYLSAILQKPVR  455



>ref|XP_011045126.1| PREDICTED: uncharacterized protein LOC105140124 [Populus euphratica]
Length=420

 Score =   204 bits (519),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 97/120 (81%), Positives = 106/120 (88%), Gaps = 2/120 (2%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            F++FIAARGLFPLY SLDHRFPFYDNVFDL+H  +GLD   +PEKLEFLMFD+DR+LRAG
Sbjct  300  FSEFIAARGLFPLYLSLDHRFPFYDNVFDLIHASSGLDGGDKPEKLEFLMFDIDRILRAG  359

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK--NNGSGKPEVYLSAVLQKPVR  263
            GLFWLDNFYC+ D+KK ALTRLIERFGYKKLKWVVGEK    GSGK EVYLSAVLQKP R
Sbjct  360  GLFWLDNFYCADDEKKTALTRLIERFGYKKLKWVVGEKVDTAGSGKSEVYLSAVLQKPAR  419



>ref|XP_008357136.1| PREDICTED: uncharacterized protein LOC103420870 [Malus domestica]
Length=421

 Score =   204 bits (519),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 97/120 (81%), Positives = 107/120 (89%), Gaps = 2/120 (2%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            FN+FIAARGLFPL+ SLDH FPFYDNVFDLVH  +GLDV G+PEK EFLMFD+DR+LRAG
Sbjct  301  FNEFIAARGLFPLFLSLDHTFPFYDNVFDLVHAASGLDVGGKPEKFEFLMFDIDRILRAG  360

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNN--GSGKPEVYLSAVLQKPVR  263
            GL WLDNFYCS D+KK+ LTRLIERFGYKKLKWVVGEK +  GSGK E+YLSAVLQKPVR
Sbjct  361  GLLWLDNFYCSDDEKKRDLTRLIERFGYKKLKWVVGEKADTAGSGKLEIYLSAVLQKPVR  420



>ref|XP_004499234.1| PREDICTED: uncharacterized protein LOC101508990 [Cicer arietinum]
Length=423

 Score =   204 bits (518),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/121 (79%), Positives = 109/121 (90%), Gaps = 2/121 (2%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            F++FIAARGLFP+Y SLDHRFPFYDNVFDL+H  + LDV G+PEKLEFLMFD+DRVLRAG
Sbjct  303  FSEFIAARGLFPIYLSLDHRFPFYDNVFDLIHASSALDVGGKPEKLEFLMFDIDRVLRAG  362

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK--NNGSGKPEVYLSAVLQKPVR  263
            GLFWLDNF+C+S++KK+ LTRLIERFGYKKLKWVVGEK  + GSGK EV LSAVLQKPVR
Sbjct  363  GLFWLDNFFCASEEKKQTLTRLIERFGYKKLKWVVGEKVDSVGSGKSEVVLSAVLQKPVR  422

Query  262  A  260
             
Sbjct  423  G  423



>emb|CBI19830.3| unnamed protein product [Vitis vinifera]
Length=446

 Score =   204 bits (518),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 109/120 (91%), Gaps = 2/120 (2%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
             ++F++ARGLFP+Y SLDHRFPFYDNVFD+VH  +GLDV G+PEKLEFLMFD+DR+LRAG
Sbjct  296  ISEFVSARGLFPVYLSLDHRFPFYDNVFDIVHAASGLDVGGRPEKLEFLMFDIDRILRAG  355

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNN--GSGKPEVYLSAVLQKPVR  263
            GLFWLDNFYC++++KKKALTRLIERFGY+KLKWVVGEK +  G GK EVYLS VLQKPVR
Sbjct  356  GLFWLDNFYCANEEKKKALTRLIERFGYRKLKWVVGEKPDAAGPGKSEVYLSGVLQKPVR  415



>ref|XP_002277626.1| PREDICTED: uncharacterized protein LOC100259190 [Vitis vinifera]
Length=419

 Score =   202 bits (515),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 109/120 (91%), Gaps = 2/120 (2%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
             ++F++ARGLFP+Y SLDHRFPFYDNVFD+VH  +GLDV G+PEKLEFLMFD+DR+LRAG
Sbjct  299  ISEFVSARGLFPVYLSLDHRFPFYDNVFDIVHAASGLDVGGRPEKLEFLMFDIDRILRAG  358

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNN--GSGKPEVYLSAVLQKPVR  263
            GLFWLDNFYC++++KKKALTRLIERFGY+KLKWVVGEK +  G GK EVYLS VLQKPVR
Sbjct  359  GLFWLDNFYCANEEKKKALTRLIERFGYRKLKWVVGEKPDAAGPGKSEVYLSGVLQKPVR  418



>ref|XP_010557488.1| PREDICTED: uncharacterized protein LOC104826476 [Tarenaya hassleriana]
 ref|XP_010557489.1| PREDICTED: uncharacterized protein LOC104826476 [Tarenaya hassleriana]
 ref|XP_010557490.1| PREDICTED: uncharacterized protein LOC104826476 [Tarenaya hassleriana]
Length=419

 Score =   202 bits (514),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 95/120 (79%), Positives = 108/120 (90%), Gaps = 2/120 (2%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            F++FIAARGLFPL+ SLDHRFPFYDNVFDL+H  +GLDV G+PEKLEFLMFD+DR+L+ G
Sbjct  299  FSEFIAARGLFPLFLSLDHRFPFYDNVFDLIHASSGLDVGGKPEKLEFLMFDLDRILKPG  358

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNN--GSGKPEVYLSAVLQKPVR  263
            GLFWLDNFYC+SD+KKK LT LIERFGYKKLKWVVGEK +  GSGK +VYLSAVLQKP R
Sbjct  359  GLFWLDNFYCASDEKKKDLTHLIERFGYKKLKWVVGEKVDAAGSGKSKVYLSAVLQKPTR  418



>ref|XP_002301989.1| hypothetical protein POPTR_0002s02640g [Populus trichocarpa]
 gb|EEE81262.1| hypothetical protein POPTR_0002s02640g [Populus trichocarpa]
Length=420

 Score =   202 bits (513),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 96/120 (80%), Positives = 105/120 (88%), Gaps = 2/120 (2%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            F++FIAARGLFPLY SLDHRFPFYDNVFDL+H  +GLD   +PEKLEFLMFD+DR+LRAG
Sbjct  300  FSEFIAARGLFPLYLSLDHRFPFYDNVFDLIHASSGLDGGDKPEKLEFLMFDIDRILRAG  359

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK--NNGSGKPEVYLSAVLQKPVR  263
            GLFWLDNFYC+ D+KK ALTRLIERF YKKLKWVVGEK    GSGK EVYLSAVLQKP R
Sbjct  360  GLFWLDNFYCADDEKKTALTRLIERFQYKKLKWVVGEKIDTAGSGKSEVYLSAVLQKPAR  419



>ref|XP_009337662.1| PREDICTED: uncharacterized protein LOC103930096 [Pyrus x bretschneideri]
Length=421

 Score =   201 bits (512),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 96/120 (80%), Positives = 107/120 (89%), Gaps = 2/120 (2%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            FN+FIAARGLFPL+ SLDH FPF+DNVFDLVH  +GLDV G+PEK EFLMFD+DR+LRAG
Sbjct  301  FNEFIAARGLFPLFLSLDHTFPFHDNVFDLVHAASGLDVGGKPEKFEFLMFDIDRILRAG  360

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNN--GSGKPEVYLSAVLQKPVR  263
            GLFWLDNFYCS D+KK+ LTRLIERFGYKKLKWVVGEK +  GSGK E+YLSAVLQK VR
Sbjct  361  GLFWLDNFYCSDDEKKRDLTRLIERFGYKKLKWVVGEKADTAGSGKLEIYLSAVLQKSVR  420



>ref|XP_008221299.1| PREDICTED: uncharacterized protein LOC103321276 [Prunus mume]
Length=421

 Score =   201 bits (512),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 95/120 (79%), Positives = 109/120 (91%), Gaps = 2/120 (2%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            F++FIAARGLFPL+ SLDHRFPFYDNVFDLVH  +GLDV G+PEK EF+MFD+DR+LR G
Sbjct  301  FSEFIAARGLFPLFLSLDHRFPFYDNVFDLVHAASGLDVGGKPEKFEFVMFDIDRILRPG  360

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNN--GSGKPEVYLSAVLQKPVR  263
            GLFWLDNFYCS+++KK+ LTRLIERFGYKKLKWVVG+K +  GSGK EVYLSAVLQKPVR
Sbjct  361  GLFWLDNFYCSNEEKKRDLTRLIERFGYKKLKWVVGDKVDAAGSGKSEVYLSAVLQKPVR  420



>ref|XP_002306913.1| hypothetical protein POPTR_0005s25790g [Populus trichocarpa]
 gb|EEE93909.1| hypothetical protein POPTR_0005s25790g [Populus trichocarpa]
Length=420

 Score =   201 bits (512),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/120 (80%), Positives = 106/120 (88%), Gaps = 2/120 (2%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            F++FIAARGLFPLY SLDHRFPFYDNVFDL+H  +GLD   +PE+LEFLMFD+DR+LRAG
Sbjct  300  FSEFIAARGLFPLYLSLDHRFPFYDNVFDLIHASSGLDGGDKPEELEFLMFDIDRILRAG  359

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK--NNGSGKPEVYLSAVLQKPVR  263
            GLFWLDNFYC++D KK ALTRLIERFGYKKLKWVVGEK    GSGK EVYLSAVLQKP R
Sbjct  360  GLFWLDNFYCANDVKKTALTRLIERFGYKKLKWVVGEKVDTAGSGKSEVYLSAVLQKPAR  419



>ref|XP_010061033.1| PREDICTED: uncharacterized protein LOC104448821 [Eucalyptus grandis]
 ref|XP_010061034.1| PREDICTED: uncharacterized protein LOC104448821 [Eucalyptus grandis]
 gb|KCW67935.1| hypothetical protein EUGRSUZ_F01633 [Eucalyptus grandis]
Length=421

 Score =   201 bits (510),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 108/120 (90%), Gaps = 2/120 (2%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            FN+FIAARGLFPL+ SLDHRFPFYDNVFD++   +GLDV G+PEKLEFLMFD+DR+LRAG
Sbjct  301  FNEFIAARGLFPLFLSLDHRFPFYDNVFDIIRASSGLDVGGKPEKLEFLMFDVDRILRAG  360

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKN--NGSGKPEVYLSAVLQKPVR  263
            GL W+DNFYC++++KKK LTR+IERFGYKKLKWVVG+K   +GS K EVYLSAVLQKP+R
Sbjct  361  GLLWVDNFYCATEEKKKTLTRMIERFGYKKLKWVVGDKQDASGSAKSEVYLSAVLQKPLR  420



>gb|AAO14627.1|AF467900_4 hypothetical protein [Prunus persica]
Length=421

 Score =   200 bits (508),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 94/120 (78%), Positives = 108/120 (90%), Gaps = 2/120 (2%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            F++FIAARGLFPL+ SLDHRFPFYDNVFDLVH  +GLDV G+PEK EF+MFD+DR+LR G
Sbjct  301  FSEFIAARGLFPLFLSLDHRFPFYDNVFDLVHAASGLDVGGKPEKFEFVMFDIDRILRPG  360

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNN--GSGKPEVYLSAVLQKPVR  263
            GLFWLDNFYCS+++KK+ LTRLIERFGYKKLKWVVG+K +   SGK EVYLSAVLQKPVR
Sbjct  361  GLFWLDNFYCSNEEKKRDLTRLIERFGYKKLKWVVGDKVDAAASGKSEVYLSAVLQKPVR  420



>ref|XP_006395469.1| hypothetical protein EUTSA_v10004321mg [Eutrema salsugineum]
 ref|XP_006395470.1| hypothetical protein EUTSA_v10004321mg [Eutrema salsugineum]
 gb|ESQ32755.1| hypothetical protein EUTSA_v10004321mg [Eutrema salsugineum]
 gb|ESQ32756.1| hypothetical protein EUTSA_v10004321mg [Eutrema salsugineum]
Length=409

 Score =   199 bits (507),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 92/119 (77%), Positives = 108/119 (91%), Gaps = 4/119 (3%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            F++FIAARG+FPL+ SLDHRFPF+DNVFDL+H  +GLDV G+PEKLEFLMFD+DRVL+ G
Sbjct  295  FSEFIAARGIFPLFLSLDHRFPFHDNVFDLIHASSGLDVEGKPEKLEFLMFDLDRVLKPG  354

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVRA  260
            GLFWLDNFYC+SD+KKK LTRLIERFGYKKLKWV+GEK++     +VYLSAVLQKPVRA
Sbjct  355  GLFWLDNFYCASDEKKKDLTRLIERFGYKKLKWVIGEKSDA----QVYLSAVLQKPVRA  409



>gb|KEH40211.1| ATRAD3-like protein [Medicago truncatula]
Length=426

 Score =   200 bits (508),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 96/121 (79%), Positives = 107/121 (88%), Gaps = 2/121 (2%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            F++FIAARGLFPLY SLDHRFPFYDNVFDL+H  + LDV G+ EKLEFLMFD+DRVLRAG
Sbjct  306  FSEFIAARGLFPLYLSLDHRFPFYDNVFDLIHASSALDVGGKAEKLEFLMFDIDRVLRAG  365

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNN--GSGKPEVYLSAVLQKPVR  263
            GLFWLDNF+C S++KK+ LTRLIERFGYKKLKWVVGEK +  GSGK EV LSAVLQKPVR
Sbjct  366  GLFWLDNFFCFSEEKKQTLTRLIERFGYKKLKWVVGEKVDSFGSGKSEVVLSAVLQKPVR  425

Query  262  A  260
             
Sbjct  426  G  426



>ref|XP_009335275.1| PREDICTED: uncharacterized protein LOC103927992 isoform X2 [Pyrus 
x bretschneideri]
Length=421

 Score =   200 bits (508),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 96/120 (80%), Positives = 106/120 (88%), Gaps = 2/120 (2%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            F++FIAARGLFPL+ SLDHRFPFYDNVFDLVH  +GLDV G+PEK EFLMFD+DR+LR G
Sbjct  301  FSEFIAARGLFPLFLSLDHRFPFYDNVFDLVHAASGLDVAGKPEKFEFLMFDIDRILRPG  360

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNN--GSGKPEVYLSAVLQKPVR  263
            GLFWLDNFY S D+KK+ LTRLIERFGYKKLKWVVGEK    GSGK E+YLSAVLQKPVR
Sbjct  361  GLFWLDNFYGSDDEKKRDLTRLIERFGYKKLKWVVGEKAGAAGSGKSEIYLSAVLQKPVR  420



>ref|XP_009350044.1| PREDICTED: uncharacterized protein LOC103941557 [Pyrus x bretschneideri]
Length=421

 Score =   199 bits (507),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 96/120 (80%), Positives = 106/120 (88%), Gaps = 2/120 (2%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            F++FIAARGLFPL+ SLDHRFPFYDNVFDLVH  +GLDV G+PEK EFLMFD+DR+LR G
Sbjct  301  FSEFIAARGLFPLFLSLDHRFPFYDNVFDLVHAASGLDVAGKPEKFEFLMFDIDRILRPG  360

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNN--GSGKPEVYLSAVLQKPVR  263
            GLFWLDNFY S D+KK+ LTRLIERFGYKKLKWVVGEK    GSGK E+YLSAVLQKPVR
Sbjct  361  GLFWLDNFYGSDDEKKRDLTRLIERFGYKKLKWVVGEKAGAAGSGKSEIYLSAVLQKPVR  420



>ref|XP_009335270.1| PREDICTED: uncharacterized protein LOC103927992 isoform X1 [Pyrus 
x bretschneideri]
Length=421

 Score =   199 bits (507),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 96/120 (80%), Positives = 106/120 (88%), Gaps = 2/120 (2%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            F++FIAARGLFPL+ SLDHRFPFYDNVFDLVH  +GLDV G+PEK EFLMFD+DR+LR G
Sbjct  301  FSEFIAARGLFPLFLSLDHRFPFYDNVFDLVHAASGLDVAGKPEKFEFLMFDIDRILRPG  360

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNN--GSGKPEVYLSAVLQKPVR  263
            GLFWLDNFY S D+KK+ LTRLIERFGYKKLKWVVGEK    GSGK E+YLSAVLQKPVR
Sbjct  361  GLFWLDNFYGSDDEKKRDLTRLIERFGYKKLKWVVGEKAGAAGSGKSEIYLSAVLQKPVR  420



>ref|XP_008387957.1| PREDICTED: uncharacterized protein LOC103450397 [Malus domestica]
Length=421

 Score =   198 bits (503),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/120 (78%), Positives = 105/120 (88%), Gaps = 2/120 (2%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            F++FIAARGLFPL+ SLDHRFPFYDNVFD+VH  +GLDV  +PEK EFLMFD+DR+LR G
Sbjct  301  FSEFIAARGLFPLFLSLDHRFPFYDNVFDMVHAASGLDVAAKPEKFEFLMFDIDRILRPG  360

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNN--GSGKPEVYLSAVLQKPVR  263
            GLFWLDNFY S D+KK+ LTRLIERFGYKKLKWVVGEK    GSGK E+YLSAVLQKPVR
Sbjct  361  GLFWLDNFYGSDDEKKRDLTRLIERFGYKKLKWVVGEKAEAAGSGKSEIYLSAVLQKPVR  420



>ref|XP_010514415.1| PREDICTED: uncharacterized protein LOC104790374 [Camelina sativa]
Length=410

 Score =   197 bits (501),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/119 (77%), Positives = 107/119 (90%), Gaps = 4/119 (3%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            F++FIAARGLFPL+ SLDHRFPF+DNVFDL+H  +GLDV G+PEKLEFLMFD+DRVL+ G
Sbjct  296  FSEFIAARGLFPLFLSLDHRFPFFDNVFDLIHASSGLDVEGKPEKLEFLMFDLDRVLKPG  355

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVRA  260
            GLFWLDNFYC++D+KKK LTRLIERFGYKKLKWV+GEK +     +VYLSAVLQKPVRA
Sbjct  356  GLFWLDNFYCANDEKKKDLTRLIERFGYKKLKWVIGEKADA----QVYLSAVLQKPVRA  410



>gb|KJB63557.1| hypothetical protein B456_010G005600 [Gossypium raimondii]
Length=382

 Score =   196 bits (498),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 105/120 (88%), Gaps = 3/120 (3%)
 Frame = -2

Query  613  NDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAGG  434
            +DFIAARG+FPL+ SLDHRFPFYDNVFDLVHV +GLDV  +PEKLEFLMFD DR+LR GG
Sbjct  262  SDFIAARGVFPLFLSLDHRFPFYDNVFDLVHVTSGLDVGTKPEKLEFLMFDADRILRVGG  321

Query  433  LFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNN---GSGKPEVYLSAVLQKPVR  263
            LFWLDN +C  D+KK+ LTRLIE+FGYKKLKWVVG+K +   GSGK E+YLSAVLQKPVR
Sbjct  322  LFWLDNIHCGDDEKKRTLTRLIEKFGYKKLKWVVGQKMDGAVGSGKHELYLSAVLQKPVR  381



>ref|XP_006291222.1| hypothetical protein CARUB_v10017354mg [Capsella rubella]
 gb|EOA24120.1| hypothetical protein CARUB_v10017354mg [Capsella rubella]
Length=410

 Score =   195 bits (495),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/119 (76%), Positives = 105/119 (88%), Gaps = 4/119 (3%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            F++FIAARGLFPL+ SLDHRFPF DNVFDL+H  +GLDV G+PEK EFLMFD+DRVL+ G
Sbjct  296  FSEFIAARGLFPLFLSLDHRFPFLDNVFDLIHASSGLDVEGKPEKFEFLMFDLDRVLKPG  355

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVRA  260
            GLFWLDNFYC++D+KKK LTRLIERFGYKKLKWV+GEK +     +VYLSAVLQKPVRA
Sbjct  356  GLFWLDNFYCANDEKKKDLTRLIERFGYKKLKWVIGEKADA----QVYLSAVLQKPVRA  410



>ref|XP_010271414.1| PREDICTED: uncharacterized protein LOC104607476 [Nelumbo nucifera]
Length=417

 Score =   194 bits (493),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 106/120 (88%), Gaps = 2/120 (2%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            FN+FIAARGLFPL+ SLD RFPFYDNVFDLVH  NGL   G+ EK+EFLMFD+DR+LRAG
Sbjct  297  FNEFIAARGLFPLFLSLDQRFPFYDNVFDLVHAMNGLGDGGRAEKMEFLMFDIDRILRAG  356

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNN--GSGKPEVYLSAVLQKPVR  263
            GLFWLDNFYC+ +++K+ LTRLIERFGYKKLKWVVGEK +  G+GK +VYLSAVLQKP+R
Sbjct  357  GLFWLDNFYCADEERKRILTRLIERFGYKKLKWVVGEKVDAAGTGKSQVYLSAVLQKPIR  416



>emb|CDY00165.1| BnaC09g01360D [Brassica napus]
Length=359

 Score =   191 bits (485),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/119 (76%), Positives = 105/119 (88%), Gaps = 4/119 (3%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            F++FIAARG+FPL+ SLDHRFPF+DNVFDLVH  +GLDV G+PEK+EFLMFD+DRVL+ G
Sbjct  245  FSEFIAARGVFPLFLSLDHRFPFHDNVFDLVHGSSGLDVEGKPEKMEFLMFDLDRVLKPG  304

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVRA  260
            GLFWLDNFYC+SD KKK LTRLIERFGYKKLKWV+GEK +G    +V LSAVLQKPVR 
Sbjct  305  GLFWLDNFYCASDVKKKELTRLIERFGYKKLKWVIGEKADG----QVNLSAVLQKPVRV  359



>emb|CDY20059.1| BnaA09g01920D [Brassica napus]
Length=371

 Score =   191 bits (486),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/119 (76%), Positives = 105/119 (88%), Gaps = 4/119 (3%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            F++FIAARG+FPL+ SLDHRFPF+DNVFDLVH  +GLDV G+PEK+EFLMFD+DRVL+ G
Sbjct  257  FSEFIAARGVFPLFLSLDHRFPFHDNVFDLVHGSSGLDVEGKPEKMEFLMFDLDRVLKPG  316

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVRA  260
            GLFWLDNFYC+SD KKK LTRLIERFGYKKLKWV+GEK +G    +V LSAVLQKPVR 
Sbjct  317  GLFWLDNFYCASDVKKKELTRLIERFGYKKLKWVIGEKADG----QVNLSAVLQKPVRV  371



>ref|XP_003523577.1| PREDICTED: uncharacterized protein LOC100798510 [Glycine max]
 gb|KHN45912.1| hypothetical protein glysoja_023135 [Glycine soja]
Length=420

 Score =   192 bits (489),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 105/120 (88%), Gaps = 2/120 (2%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            F++FIAARGLFPL+ SLDHRFPFYDN FDLV   +GLD  G+ EKLEFLMFD+DRVLRAG
Sbjct  300  FSEFIAARGLFPLFLSLDHRFPFYDNAFDLVRASSGLDGGGREEKLEFLMFDIDRVLRAG  359

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNN--GSGKPEVYLSAVLQKPVR  263
            GLFWLDNFYC  ++KK+ALTRLIERFGYKKLKWVVGEK +  GSGK +V LSAVL+KPVR
Sbjct  360  GLFWLDNFYCVDEEKKRALTRLIERFGYKKLKWVVGEKADILGSGKSQVVLSAVLEKPVR  419



>ref|XP_002875365.1| hypothetical protein ARALYDRAFT_904944 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51624.1| hypothetical protein ARALYDRAFT_904944 [Arabidopsis lyrata subsp. 
lyrata]
Length=410

 Score =   192 bits (488),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/119 (76%), Positives = 105/119 (88%), Gaps = 4/119 (3%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            F++FIAARGLFPL+ SLDHRFPF DNVFDL+H  +GLDV G+ EKLEF+MFD+DRVL+ G
Sbjct  296  FSEFIAARGLFPLFLSLDHRFPFLDNVFDLIHASSGLDVEGKAEKLEFVMFDLDRVLKPG  355

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVRA  260
            GLFWLDNFYC++D+KKK LTRLIERFGYKKLKWV+GEK +     +VYLSAVLQKPVRA
Sbjct  356  GLFWLDNFYCANDEKKKDLTRLIERFGYKKLKWVIGEKADA----QVYLSAVLQKPVRA  410



>ref|XP_002510507.1| ATRAD3, putative [Ricinus communis]
 gb|EEF52694.1| ATRAD3, putative [Ricinus communis]
Length=490

 Score =   194 bits (492),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 104/120 (87%), Gaps = 3/120 (3%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            F++ IAARGLFP+Y SLDH+FPFYDNVFDLVH    LDV G+PEKLEFLMFD+DR+LRAG
Sbjct  371  FSELIAARGLFPMYLSLDHKFPFYDNVFDLVHASR-LDVGGKPEKLEFLMFDVDRILRAG  429

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK--NNGSGKPEVYLSAVLQKPVR  263
            GLFWLDNF C+ D+KK+ LTRL+ERFGYKKLKWVVGEK    GSGK E+YLSAVLQKP R
Sbjct  430  GLFWLDNFCCADDEKKRTLTRLLERFGYKKLKWVVGEKVDTAGSGKSELYLSAVLQKPAR  489



>ref|NP_566813.1| S-adenosyl-L-methionine-dependent methyltransferase-like protein 
[Arabidopsis thaliana]
 dbj|BAB02118.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAW39023.1| At3g27230 [Arabidopsis thaliana]
 gb|AAY25408.1| At3g27230 [Arabidopsis thaliana]
 gb|AEE77281.1| S-adenosyl-L-methionine-dependent methyltransferase-like protein 
[Arabidopsis thaliana]
Length=410

 Score =   191 bits (484),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 104/119 (87%), Gaps = 4/119 (3%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            F++FIAARGLFPL+ SLDHRFPF DNVFDL+H  +GLDV G+ EKLEFLMFD+DRVL+  
Sbjct  296  FSEFIAARGLFPLFLSLDHRFPFLDNVFDLIHASSGLDVEGKAEKLEFLMFDLDRVLKPR  355

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVRA  260
            GLFWLDNFYC++D+KKK LTR+IERFGYKKLKWV+GEK +     +VYLSAVLQKPVRA
Sbjct  356  GLFWLDNFYCANDEKKKELTRMIERFGYKKLKWVIGEKADA----QVYLSAVLQKPVRA  410



>ref|XP_009111558.1| PREDICTED: uncharacterized protein LOC103836982 [Brassica rapa]
Length=412

 Score =   190 bits (483),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/119 (76%), Positives = 105/119 (88%), Gaps = 4/119 (3%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            F++FIAARG+FPL+ SLDHRFPF+DNVFDLVH  +GLDV G+PEK+EFLMFD+DRVL+ G
Sbjct  298  FSEFIAARGVFPLFLSLDHRFPFHDNVFDLVHGSSGLDVEGKPEKMEFLMFDLDRVLKPG  357

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVRA  260
            GLFWLDNFYC+SD KKK LTRLIERFGYKKLKWV+GEK +G    +V LSAVLQKPVR 
Sbjct  358  GLFWLDNFYCASDVKKKELTRLIERFGYKKLKWVIGEKADG----QVNLSAVLQKPVRV  412



>gb|AAM63602.1| unknown [Arabidopsis thaliana]
Length=410

 Score =   188 bits (477),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 102/119 (86%), Gaps = 4/119 (3%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            F++FIAARGLFPL+ SLDHRFPF DNVFDL+H  +GLDV G  EKLEFLMFD+DRVL+  
Sbjct  296  FSEFIAARGLFPLFLSLDHRFPFLDNVFDLIHASSGLDVEGXAEKLEFLMFDLDRVLKPR  355

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVRA  260
            GLFWLDNFYC++D+KKK LTR+IERFGYK LKWV+GEK +     +VYLSAVLQKPVRA
Sbjct  356  GLFWLDNFYCANDEKKKXLTRMIERFGYKXLKWVIGEKADA----QVYLSAVLQKPVRA  410



>ref|XP_007136074.1| hypothetical protein PHAVU_009G015500g [Phaseolus vulgaris]
 gb|ESW08068.1| hypothetical protein PHAVU_009G015500g [Phaseolus vulgaris]
Length=419

 Score =   188 bits (477),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 91/121 (75%), Positives = 103/121 (85%), Gaps = 2/121 (2%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            F++FIAARGLFPL+ SLDHRFPFYDNVFDLV   +GLD  G+ EKLEFL+FD+DRVLR G
Sbjct  299  FSEFIAARGLFPLFLSLDHRFPFYDNVFDLVRAASGLDGGGRQEKLEFLIFDIDRVLRGG  358

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNN--GSGKPEVYLSAVLQKPVR  263
            GLFWLDNFYC  ++KK+ LTRLIERFGYKKLKWVVGEK +  GSGK +  LSAVLQKPVR
Sbjct  359  GLFWLDNFYCVDEEKKRVLTRLIERFGYKKLKWVVGEKVDSLGSGKSQAVLSAVLQKPVR  418

Query  262  A  260
             
Sbjct  419  V  419



>gb|AAL77659.1| AT3g27230/K17E12_5 [Arabidopsis thaliana]
Length=410

 Score =   187 bits (476),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 103/119 (87%), Gaps = 4/119 (3%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            F++FIAARGLF L+ SLDHRFPF DNVFDL+H  +GLDV G+ EKLEFLMFD+DRVL+  
Sbjct  296  FSEFIAARGLFTLFLSLDHRFPFLDNVFDLIHASSGLDVEGKAEKLEFLMFDLDRVLKPR  355

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVRA  260
            GLFWLDNFYC++D+KKK LTR+IERFGYKKLKWV+GEK +     +VYLSAVLQKPVRA
Sbjct  356  GLFWLDNFYCANDEKKKELTRMIERFGYKKLKWVIGEKADA----QVYLSAVLQKPVRA  410



>gb|KEH36237.1| ATRAD3-like protein [Medicago truncatula]
Length=421

 Score =   187 bits (476),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 105/121 (87%), Gaps = 3/121 (2%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLD--VNGQPEKLEFLMFDMDRVLR  443
            FN+FIAARGLFPL+ SLDHRFPFYDNVFDLV   N LD  V  + EKLEFLMFD DR+LR
Sbjct  302  FNEFIAARGLFPLFLSLDHRFPFYDNVFDLVRATNTLDDDVGKKQEKLEFLMFDADRILR  361

Query  442  AGGLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVR  263
            AGGLFW+DNFYC++++KK ALTRLIERFGY+KLKWVVGEK + SGK +V+LSAVLQKPVR
Sbjct  362  AGGLFWIDNFYCANEEKKIALTRLIERFGYRKLKWVVGEKVD-SGKSQVFLSAVLQKPVR  420

Query  262  A  260
             
Sbjct  421  V  421



>ref|XP_004291387.1| PREDICTED: uncharacterized protein LOC101314531 [Fragaria vesca 
subsp. vesca]
Length=418

 Score =   187 bits (475),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 104/118 (88%), Gaps = 3/118 (3%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            +++FIAARGLFPL+ SLDHRFPFYDNVFDLVH  +GLDV G+PEK EFLMFD+DR+LR G
Sbjct  303  YSEFIAARGLFPLFLSLDHRFPFYDNVFDLVHAASGLDVGGKPEKFEFLMFDIDRILRPG  362

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVR  263
            GLFWLDNF+C+++++KK LTRLIERFGYKKLKWVVG  +  SG   +YLSAVLQKPVR
Sbjct  363  GLFWLDNFHCANEERKKDLTRLIERFGYKKLKWVVGV-DTASG--SIYLSAVLQKPVR  417



>ref|XP_006282947.1| hypothetical protein CARUB_v10007544mg [Capsella rubella]
 gb|EOA15845.1| hypothetical protein CARUB_v10007544mg [Capsella rubella]
Length=414

 Score =   187 bits (474),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 103/120 (86%), Gaps = 6/120 (5%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDV--NGQPEKLEFLMFDMDRVLR  443
            F++F+AARG+FPL+ SLD R PFYDNVFDL+H  NGLD+  + +PEKLEFLMFD+DR+L+
Sbjct  298  FSEFVAARGIFPLFMSLDQRLPFYDNVFDLIHASNGLDLAASSKPEKLEFLMFDLDRILK  357

Query  442  AGGLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVR  263
             GGLFWLDNFYC +D+KK+ LTRLIERFGYKKLKWVVGEKN+     EVYLSAVLQKP R
Sbjct  358  PGGLFWLDNFYCGNDEKKRVLTRLIERFGYKKLKWVVGEKNDA----EVYLSAVLQKPAR  413



>dbj|BAH57084.1| AT5G40830 [Arabidopsis thaliana]
Length=374

 Score =   185 bits (470),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 102/120 (85%), Gaps = 6/120 (5%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLD--VNGQPEKLEFLMFDMDRVLR  443
            F++FIAARG+FPL+ SLD R PFYDNVFDL+H  NGLD  V+ +PEKLEFLMFD+DR+L+
Sbjct  258  FSEFIAARGIFPLFMSLDQRLPFYDNVFDLIHASNGLDLAVSNKPEKLEFLMFDLDRILK  317

Query  442  AGGLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVR  263
             GGLFWLDNFYC +D+KK+ LTRLIERFGYKKLKWVVGEK +     EV+LSAVLQKP R
Sbjct  318  PGGLFWLDNFYCGNDEKKRVLTRLIERFGYKKLKWVVGEKTDA----EVFLSAVLQKPAR  373



>ref|NP_198899.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Arabidopsis thaliana]
 ref|NP_001031989.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Arabidopsis thaliana]
 dbj|BAB11345.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAO00836.1| putative protein [Arabidopsis thaliana]
 gb|AAP37857.1| At5g40830 [Arabidopsis thaliana]
 gb|AED94600.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Arabidopsis thaliana]
 gb|AED94601.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Arabidopsis thaliana]
Length=414

 Score =   185 bits (469),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 102/120 (85%), Gaps = 6/120 (5%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLD--VNGQPEKLEFLMFDMDRVLR  443
            F++FIAARG+FPL+ SLD R PFYDNVFDL+H  NGLD  V+ +PEKLEFLMFD+DR+L+
Sbjct  298  FSEFIAARGIFPLFMSLDQRLPFYDNVFDLIHASNGLDLAVSNKPEKLEFLMFDLDRILK  357

Query  442  AGGLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVR  263
             GGLFWLDNFYC +D+KK+ LTRLIERFGYKKLKWVVGEK +     EV+LSAVLQKP R
Sbjct  358  PGGLFWLDNFYCGNDEKKRVLTRLIERFGYKKLKWVVGEKTDA----EVFLSAVLQKPAR  413



>ref|XP_010441242.1| PREDICTED: uncharacterized protein LOC104724452 isoform X2 [Camelina 
sativa]
Length=376

 Score =   184 bits (466),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 103/120 (86%), Gaps = 5/120 (4%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNG--QPEKLEFLMFDMDRVLR  443
            F++F+AARG+FPL+ SLD R PFYDNVFDL+H  +GLD+ G  +PEKLEFLMFD+DR+L+
Sbjct  259  FSEFVAARGIFPLFMSLDQRLPFYDNVFDLIHASSGLDLAGGSKPEKLEFLMFDLDRILK  318

Query  442  AGGLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVR  263
             GGLFWLDNFYC +++KK+ LTRLIERFGYKKLKWVVGEK + +   EVYLSAVLQKP R
Sbjct  319  PGGLFWLDNFYCGNEEKKRVLTRLIERFGYKKLKWVVGEKTDAA---EVYLSAVLQKPAR  375



>gb|AFK44341.1| unknown [Medicago truncatula]
Length=421

 Score =   184 bits (468),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 91/121 (75%), Positives = 104/121 (86%), Gaps = 3/121 (2%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLD--VNGQPEKLEFLMFDMDRVLR  443
            FN+FIAARGLFPL+ SLDHRFPFYDNVFDLV   N LD  V  + EKLEFLMFD DR+LR
Sbjct  302  FNEFIAARGLFPLFLSLDHRFPFYDNVFDLVRATNTLDDDVGKKQEKLEFLMFDADRILR  361

Query  442  AGGLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVR  263
            AGGLFW+DNFYC++++KK ALTRLIERFGY+KLKWVVGEK + S K +V+LSAVLQKPVR
Sbjct  362  AGGLFWIDNFYCANEEKKIALTRLIERFGYRKLKWVVGEKVD-SDKSQVFLSAVLQKPVR  420

Query  262  A  260
             
Sbjct  421  V  421



>ref|XP_002868627.1| ATRAD3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44886.1| ATRAD3 [Arabidopsis lyrata subsp. lyrata]
Length=414

 Score =   184 bits (467),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 102/120 (85%), Gaps = 6/120 (5%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDV--NGQPEKLEFLMFDMDRVLR  443
            F++FIAARG+FPL+ SLD R PFYDNVFDL+H  NGLD+  + +PEKLEFLMFD+DR+L+
Sbjct  298  FSEFIAARGVFPLFMSLDQRLPFYDNVFDLIHASNGLDLAASNKPEKLEFLMFDLDRILK  357

Query  442  AGGLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVR  263
             GGLFWLDNFYC +D+KK+ LTRLIERFGYKKLKWVVGEK +     EVYLSAVLQKP R
Sbjct  358  PGGLFWLDNFYCGNDEKKRVLTRLIERFGYKKLKWVVGEKTD----VEVYLSAVLQKPAR  413



>ref|XP_010441241.1| PREDICTED: uncharacterized protein LOC104724452 isoform X1 [Camelina 
sativa]
Length=417

 Score =   184 bits (466),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 103/120 (86%), Gaps = 5/120 (4%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNG--QPEKLEFLMFDMDRVLR  443
            F++F+AARG+FPL+ SLD R PFYDNVFDL+H  +GLD+ G  +PEKLEFLMFD+DR+L+
Sbjct  300  FSEFVAARGIFPLFMSLDQRLPFYDNVFDLIHASSGLDLAGGSKPEKLEFLMFDLDRILK  359

Query  442  AGGLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVR  263
             GGLFWLDNFYC +++KK+ LTRLIERFGYKKLKWVVGEK + +   EVYLSAVLQKP R
Sbjct  360  PGGLFWLDNFYCGNEEKKRVLTRLIERFGYKKLKWVVGEKTDAA---EVYLSAVLQKPAR  416



>ref|XP_010425464.1| PREDICTED: uncharacterized protein LOC104710544 [Camelina sativa]
 ref|XP_010425466.1| PREDICTED: uncharacterized protein LOC104710544 [Camelina sativa]
Length=410

 Score =   183 bits (465),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 102/119 (86%), Gaps = 4/119 (3%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            FN+FIAARGLFPL+ SLDHRFPF DNVFDL+H  +GLDV G+ EKLEFLMFD+DRVL+ G
Sbjct  296  FNEFIAARGLFPLFLSLDHRFPFLDNVFDLIHASSGLDVEGKTEKLEFLMFDLDRVLKPG  355

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVRA  260
            GLFWLDNFY ++D+KKK LTRLIERFG KKLKW +GEK +     +VYLSAVLQKPVRA
Sbjct  356  GLFWLDNFYWANDEKKKDLTRLIERFGDKKLKWGIGEKADA----QVYLSAVLQKPVRA  410



>ref|XP_002868633.1| ATRAD3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44892.1| ATRAD3 [Arabidopsis lyrata subsp. lyrata]
Length=414

 Score =   181 bits (458),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 102/120 (85%), Gaps = 6/120 (5%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDV--NGQPEKLEFLMFDMDRVLR  443
            F++FIAARG+FPL+ SLD R PFYDNVFDL+H  NGLD+  + +PEKLEFLMFD+DR+L+
Sbjct  298  FSEFIAARGVFPLFISLDQRLPFYDNVFDLIHGSNGLDLAASNKPEKLEFLMFDLDRILK  357

Query  442  AGGLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVR  263
             GGLFWLDNF+C +D+KK+ LTRLIERFGYKKLKWVVGEK +     EVYLSAVLQKP R
Sbjct  358  PGGLFWLDNFHCGNDEKKRVLTRLIERFGYKKLKWVVGEKTD----VEVYLSAVLQKPAR  413



>ref|XP_010450613.1| PREDICTED: uncharacterized protein LOC104732730 isoform X3 [Camelina 
sativa]
Length=377

 Score =   180 bits (456),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 102/121 (84%), Gaps = 6/121 (5%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNG---QPEKLEFLMFDMDRVL  446
            +++FIAARG+FPL+ SL+ R PFYDNVFDL+   +GLD+ G   +PEKLEFLMFD+DR+L
Sbjct  259  YSEFIAARGVFPLFMSLEQRLPFYDNVFDLIRASSGLDLAGGSNKPEKLEFLMFDLDRIL  318

Query  445  RAGGLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPV  266
            + GGLFWLDNFYC +D+KK+ LTRLIERFGYKKLKWVVGEK + +   EVYLSAVLQKP 
Sbjct  319  KPGGLFWLDNFYCGNDEKKRVLTRLIERFGYKKLKWVVGEKTDAA---EVYLSAVLQKPA  375

Query  265  R  263
            R
Sbjct  376  R  376



>ref|XP_010450612.1| PREDICTED: uncharacterized protein LOC104732730 isoform X2 [Camelina 
sativa]
Length=383

 Score =   180 bits (456),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 102/121 (84%), Gaps = 6/121 (5%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNG---QPEKLEFLMFDMDRVL  446
            +++FIAARG+FPL+ SL+ R PFYDNVFDL+   +GLD+ G   +PEKLEFLMFD+DR+L
Sbjct  265  YSEFIAARGVFPLFMSLEQRLPFYDNVFDLIRASSGLDLAGGSNKPEKLEFLMFDLDRIL  324

Query  445  RAGGLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPV  266
            + GGLFWLDNFYC +D+KK+ LTRLIERFGYKKLKWVVGEK + +   EVYLSAVLQKP 
Sbjct  325  KPGGLFWLDNFYCGNDEKKRVLTRLIERFGYKKLKWVVGEKTDAA---EVYLSAVLQKPA  381

Query  265  R  263
            R
Sbjct  382  R  382



>ref|XP_010450611.1| PREDICTED: uncharacterized protein LOC104732730 isoform X1 [Camelina 
sativa]
Length=418

 Score =   179 bits (455),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 102/121 (84%), Gaps = 6/121 (5%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNG---QPEKLEFLMFDMDRVL  446
            +++FIAARG+FPL+ SL+ R PFYDNVFDL+   +GLD+ G   +PEKLEFLMFD+DR+L
Sbjct  300  YSEFIAARGVFPLFMSLEQRLPFYDNVFDLIRASSGLDLAGGSNKPEKLEFLMFDLDRIL  359

Query  445  RAGGLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPV  266
            + GGLFWLDNFYC +D+KK+ LTRLIERFGYKKLKWVVGEK + +   EVYLSAVLQKP 
Sbjct  360  KPGGLFWLDNFYCGNDEKKRVLTRLIERFGYKKLKWVVGEKTDAA---EVYLSAVLQKPA  416

Query  265  R  263
            R
Sbjct  417  R  417



>ref|XP_008776887.1| PREDICTED: uncharacterized protein LOC103696936 [Phoenix dactylifera]
Length=403

 Score =   172 bits (437),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 84/128 (66%), Positives = 99/128 (77%), Gaps = 10/128 (8%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNG--------QPEKLEFLMFD  461
             N+F+AARGLFPL  S   RFPFYD+VFDLVH+ N LD  G        +PE LEFLMFD
Sbjct  275  MNEFVAARGLFPLLMSPAQRFPFYDSVFDLVHIMNALDEGGAPALGPAGRPEALEFLMFD  334

Query  460  MDRVLRAGGLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNN--GSGKPEVYLS  287
            +DR+LRAGGLFWLDN+ C  D++K+ +TRLIERFG+KKLKWVVGEK +  G GK +VYLS
Sbjct  335  IDRILRAGGLFWLDNYLCVDDERKRTVTRLIERFGFKKLKWVVGEKADAAGIGKTQVYLS  394

Query  286  AVLQKPVR  263
            AVLQKP R
Sbjct  395  AVLQKPAR  402



>ref|XP_010934529.1| PREDICTED: uncharacterized protein LOC105054654 [Elaeis guineensis]
Length=502

 Score =   172 bits (436),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 84/128 (66%), Positives = 97/128 (76%), Gaps = 10/128 (8%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQP--------EKLEFLMFD  461
             N+F+AARGLFPL  S   RFPFYD+VFDLVH  N LD  G P        E +EFLMFD
Sbjct  374  MNEFVAARGLFPLLMSPAQRFPFYDSVFDLVHTMNALDEAGAPALGPSSRLEAVEFLMFD  433

Query  460  MDRVLRAGGLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNN--GSGKPEVYLS  287
            +DR+LRAGGLFWLDN+ C  D++K+ +TRLIERFGYKKLKWVVGEK +  G GK +VYLS
Sbjct  434  IDRILRAGGLFWLDNYLCVDDERKRTVTRLIERFGYKKLKWVVGEKADAAGIGKTQVYLS  493

Query  286  AVLQKPVR  263
            AVLQKP R
Sbjct  494  AVLQKPAR  501



>ref|XP_003628927.1| hypothetical protein MTR_8g069200 [Medicago truncatula]
Length=756

 Score =   174 bits (441),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 98/118 (83%), Gaps = 11/118 (9%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            F++FIAARGLFPLY SLDHRFPFYDNVFDL+H  + L         EFLMFD+DRVLRAG
Sbjct  510  FSEFIAARGLFPLYLSLDHRFPFYDNVFDLIHASSAL---------EFLMFDIDRVLRAG  560

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNN--GSGKPEVYLSAVLQKP  269
            GLFWLDNF+C S++KK+ LTRLIERFGYKKLKWVVGEK +  GSGK EV LSAV+QKP
Sbjct  561  GLFWLDNFFCFSEEKKQTLTRLIERFGYKKLKWVVGEKVDSFGSGKSEVVLSAVIQKP  618



>ref|XP_009399468.1| PREDICTED: uncharacterized protein LOC103983867 [Musa acuminata 
subsp. malaccensis]
Length=420

 Score =   169 bits (427),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 82/128 (64%), Positives = 96/128 (75%), Gaps = 10/128 (8%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQP--------EKLEFLMFD  461
             N+F+AARGLFPL  S   RFPFYD+VFDLVH  N LD  G P        E LEFLMFD
Sbjct  292  MNEFVAARGLFPLLLSPTQRFPFYDSVFDLVHTLNALDEGGAPALGQASRTEALEFLMFD  351

Query  460  MDRVLRAGGLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNG--SGKPEVYLS  287
            +DRVLRAGGL WLDN+ C+ D++K+ +T+LIERFGYKKLKWVVGEK +   + K +VYLS
Sbjct  352  IDRVLRAGGLLWLDNYLCTDDERKRIVTKLIERFGYKKLKWVVGEKADARNTAKTQVYLS  411

Query  286  AVLQKPVR  263
            AVLQKP R
Sbjct  412  AVLQKPAR  419



>ref|XP_009411357.1| PREDICTED: uncharacterized protein LOC103993126 [Musa acuminata 
subsp. malaccensis]
Length=426

 Score =   165 bits (418),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 95/129 (74%), Gaps = 10/129 (8%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQP--------EKLEFLMFD  461
             N+F+AARGLFPL  S   RFPFYD+VFDLVH  N LD  G P        E LEF MFD
Sbjct  288  MNEFVAARGLFPLLLSPAQRFPFYDSVFDLVHAINALDEGGAPSLGQASRTEVLEFFMFD  347

Query  460  MDRVLRAGGLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK--NNGSGKPEVYLS  287
            +DRVLRAGGLFWLDN+ C+ DD+K+ +TRL+ER GYKKLKWVV EK   + SGK ++ LS
Sbjct  348  IDRVLRAGGLFWLDNYLCADDDRKRTVTRLLERLGYKKLKWVVDEKAGASSSGKTQIRLS  407

Query  286  AVLQKPVRA  260
            AVLQKP R+
Sbjct  408  AVLQKPARS  416



>gb|EPS57421.1| hypothetical protein M569_17397 [Genlisea aurea]
Length=422

 Score =   163 bits (412),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 101/120 (84%), Gaps = 2/120 (2%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNG-QPEKLEFLMFDMDRVLRA  440
            F+DFIAARGLFPLYFS + RFPF+DNVFDLVH GNGLD+ G +PE++EFLMFD+DRV+RA
Sbjct  302  FSDFIAARGLFPLYFSPEGRFPFHDNVFDLVHAGNGLDLGGGKPERVEFLMFDVDRVIRA  361

Query  439  GGLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKP-EVYLSAVLQKPVR  263
            GGL WLDN   +S ++K A+T LI+RFGY+KLKWVVGEK  G     EVYLSAVLQKPVR
Sbjct  362  GGLLWLDNLLFTSGERKLAITGLIDRFGYRKLKWVVGEKKGGGAGAVEVYLSAVLQKPVR  421



>dbj|BAJ84801.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=379

 Score =   161 bits (408),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 93/128 (73%), Gaps = 10/128 (8%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGN------GLDVNGQ---PEKLEFLMF  464
             N+F+AARGLFPL  S  HRFPFYD VFDLVHVG       G    GQ   PE LEF MF
Sbjct  253  MNEFVAARGLFPLLLSPAHRFPFYDGVFDLVHVGTAALDEAGAPAMGQAATPEALEFFMF  312

Query  463  DMDRVLRAGGLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSA  284
            D+DRVLRAGGL W+D++ C S+++++ + +LIERFGYKKLKWVVGEK  G+     YLSA
Sbjct  313  DVDRVLRAGGLLWIDSYLCQSEERRRVVAKLIERFGYKKLKWVVGEKAGGAST-STYLSA  371

Query  283  VLQKPVRA  260
            VL+KP R+
Sbjct  372  VLRKPARS  379



>gb|ACR38405.1| unknown [Zea mays]
Length=264

 Score =   159 bits (401),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 91/129 (71%), Gaps = 10/129 (8%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGN---------GLDVNGQPEKLEFLMF  464
             N+F+AARGLFPL  S  HRFPFYD VFDLVHVG           L   G  E LEF MF
Sbjct  136  MNEFVAARGLFPLLLSPAHRFPFYDGVFDLVHVGTTALAEGGSPALGQAGTEEALEFFMF  195

Query  463  DMDRVLRAGGLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK-NNGSGKPEVYLS  287
            D+DRVLRA GL W+D++ C SD++++ L RLI RFGYKKLKWV GEK   GS KP +YLS
Sbjct  196  DVDRVLRARGLLWIDSYVCHSDERRQLLVRLIGRFGYKKLKWVTGEKAGTGSAKPAMYLS  255

Query  286  AVLQKPVRA  260
            AVL+KP R+
Sbjct  256  AVLEKPARS  264



>gb|ACF83461.1| unknown [Zea mays]
 gb|AFW75454.1| hypothetical protein ZEAMMB73_969790 [Zea mays]
Length=382

 Score =   160 bits (404),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 91/129 (71%), Gaps = 10/129 (8%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGN---------GLDVNGQPEKLEFLMF  464
             N+F+AARGLFPL  S  HRFPFYD VFDLVHVG           L   G  E LEF MF
Sbjct  254  MNEFVAARGLFPLLLSPAHRFPFYDGVFDLVHVGTTALAEGGSPALGQAGTEEALEFFMF  313

Query  463  DMDRVLRAGGLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK-NNGSGKPEVYLS  287
            D+DRVLRA GL W+D++ C SD++++ L RLI RFGYKKLKWV GEK   GS KP +YLS
Sbjct  314  DVDRVLRARGLLWIDSYVCHSDERRQLLVRLIGRFGYKKLKWVTGEKAGTGSAKPAMYLS  373

Query  286  AVLQKPVRA  260
            AVL+KP R+
Sbjct  374  AVLEKPARS  382



>ref|NP_001144838.1| uncharacterized protein LOC100277923 [Zea mays]
 gb|ACG43323.1| hypothetical protein [Zea mays]
Length=383

 Score =   159 bits (402),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 91/129 (71%), Gaps = 10/129 (8%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGN---------GLDVNGQPEKLEFLMF  464
             N+F+AARGLFPL  S  HRFPFYD VFDLVHVG           L   G  E LEF MF
Sbjct  255  MNEFVAARGLFPLLLSPAHRFPFYDGVFDLVHVGTTALAEGGSPALGQAGTEEALEFFMF  314

Query  463  DMDRVLRAGGLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK-NNGSGKPEVYLS  287
            D+DRVLRA GL W+D++ C SD++++ L RLI RFGYKKLKWV GEK   GS KP +YLS
Sbjct  315  DVDRVLRARGLLWIDSYVCHSDERRQLLVRLIGRFGYKKLKWVTGEKAGTGSAKPAMYLS  374

Query  286  AVLQKPVRA  260
            AVL+KP R+
Sbjct  375  AVLEKPARS  383



>ref|XP_004964486.1| PREDICTED: uncharacterized protein LOC101778925 [Setaria italica]
Length=385

 Score =   158 bits (400),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 79/128 (62%), Positives = 90/128 (70%), Gaps = 10/128 (8%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGN-GLDVNGQP--------EKLEFLMF  464
             N+F+AARGLFPL  S  HRFPFYD VFDLVHVG   LD  G P        E LEF MF
Sbjct  257  MNEFVAARGLFPLLLSPAHRFPFYDGVFDLVHVGTTALDEGGAPALGQAGTEEALEFFMF  316

Query  463  DMDRVLRAGGLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK-NNGSGKPEVYLS  287
            D+DRVLR GGL W+D++ C S+++ K + RLI RFGYKKLKWV GEK   GS K  +YLS
Sbjct  317  DVDRVLRVGGLLWVDSYMCHSEERMKVVVRLIGRFGYKKLKWVTGEKAGTGSTKTAMYLS  376

Query  286  AVLQKPVR  263
            AVLQKP R
Sbjct  377  AVLQKPAR  384



>ref|NP_001174590.1| Os06g0138500 [Oryza sativa Japonica Group]
 dbj|BAD68661.1| unknown protein [Oryza sativa Japonica Group]
 gb|EAY99580.1| hypothetical protein OsI_21556 [Oryza sativa Indica Group]
 dbj|BAG89993.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG91478.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH93318.1| Os06g0138500 [Oryza sativa Japonica Group]
Length=383

 Score =   157 bits (396),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 93/128 (73%), Gaps = 10/128 (8%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVG-NGLDVNGQP--------EKLEFLMF  464
             N+F+AARGLFPL  S  HRFPFYD VFDLVHVG N LD  G P        E LEF MF
Sbjct  255  MNEFVAARGLFPLLLSPAHRFPFYDGVFDLVHVGTNALDEGGAPSMGNSGTEEALEFFMF  314

Query  463  DMDRVLRAGGLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK-NNGSGKPEVYLS  287
            D+DRVLR GGL W+D++ C S+++++ +  LI+RFGYKKLKW+VGEK   GS K  +YLS
Sbjct  315  DVDRVLRVGGLLWIDSYLCQSEERRQLVVNLIKRFGYKKLKWMVGEKAGTGSAKTALYLS  374

Query  286  AVLQKPVR  263
            A+LQKP R
Sbjct  375  ALLQKPAR  382



>ref|XP_006655770.1| PREDICTED: uncharacterized protein LOC102722126 [Oryza brachyantha]
Length=387

 Score =   155 bits (391),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 92/128 (72%), Gaps = 10/128 (8%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVG-NGLDVNGQP--------EKLEFLMF  464
             N+F+AARGLFPL  S  HR PFYD VFDLVHVG N LD  G P        E LEF MF
Sbjct  259  MNEFVAARGLFPLLLSPAHRLPFYDGVFDLVHVGTNALDEGGAPSMGNSGTEEALEFFMF  318

Query  463  DMDRVLRAGGLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK-NNGSGKPEVYLS  287
            D+DRVLR GGL W+D++ C S+++++ + +LIERF YKKLKW+VGEK +  S K  +YLS
Sbjct  319  DVDRVLRVGGLLWIDSYLCHSEERRRIVVKLIERFAYKKLKWMVGEKASTSSSKTALYLS  378

Query  286  AVLQKPVR  263
            A+LQKP R
Sbjct  379  ALLQKPSR  386



>gb|EEE56914.1| hypothetical protein OsJ_06590 [Oryza sativa Japonica Group]
Length=494

 Score =   156 bits (394),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 93/128 (73%), Gaps = 10/128 (8%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVG-NGLDVNGQP--------EKLEFLMF  464
             N+F+AARGLFPL  S  HRFPFYD VFDLVHVG N LD  G P        E LEF MF
Sbjct  366  MNEFVAARGLFPLLLSPAHRFPFYDGVFDLVHVGTNALDEGGAPSMGNSGTEEALEFFMF  425

Query  463  DMDRVLRAGGLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK-NNGSGKPEVYLS  287
            D+DRVLR GGL W+D++ C S+++++ +  LI+RFGYKKLKW+VGEK   GS K  +YLS
Sbjct  426  DVDRVLRVGGLLWIDSYLCQSEERRQLVVNLIKRFGYKKLKWMVGEKAGTGSAKTALYLS  485

Query  286  AVLQKPVR  263
            A+LQKP R
Sbjct  486  ALLQKPAR  493



>gb|AFW85948.1| hypothetical protein ZEAMMB73_641421 [Zea mays]
Length=258

 Score =   150 bits (380),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 74/128 (58%), Positives = 87/128 (68%), Gaps = 10/128 (8%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHV-GNGLDVNGQP--------EKLEFLMF  464
             N+F+AARGLFPL  S  HRFPFYD VFDLVHV    L   G P        E LEF MF
Sbjct  130  MNEFVAARGLFPLLLSPAHRFPFYDGVFDLVHVRATALAEGGSPALGQAGTEEALEFFMF  189

Query  463  DMDRVLRAGGLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK-NNGSGKPEVYLS  287
            D+DRVLRAGGL W+D+  C +D++++ L RLI R+GYKKL+W  GEK   GS K  +YL 
Sbjct  190  DVDRVLRAGGLLWIDSHMCHADERRQTLARLIGRYGYKKLRWATGEKAGTGSTKAAMYLC  249

Query  286  AVLQKPVR  263
            AVLQKP R
Sbjct  250  AVLQKPAR  257



>ref|XP_002437791.1| hypothetical protein SORBIDRAFT_10g002660 [Sorghum bicolor]
 gb|EER89158.1| hypothetical protein SORBIDRAFT_10g002660 [Sorghum bicolor]
Length=386

 Score =   153 bits (387),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 76/128 (59%), Positives = 89/128 (70%), Gaps = 10/128 (8%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGN---------GLDVNGQPEKLEFLMF  464
             N+F++ARGLFPL  S  HRFPFYD VFDLVHVG           L   G  E LEF MF
Sbjct  258  MNEFMSARGLFPLLLSPAHRFPFYDGVFDLVHVGTTALAEGGSPALGQAGTEEALEFFMF  317

Query  463  DMDRVLRAGGLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK-NNGSGKPEVYLS  287
            D+DRVL AGGL W+D++ C SD++++ L RLI RFGYKKLKWV+GEK   GS K  +Y S
Sbjct  318  DVDRVLHAGGLLWIDSYMCHSDERRQVLVRLIGRFGYKKLKWVMGEKAGTGSTKVAMYFS  377

Query  286  AVLQKPVR  263
            AVLQKP R
Sbjct  378  AVLQKPAR  385



>gb|AFW85947.1| hypothetical protein ZEAMMB73_411281 [Zea mays]
Length=194

 Score =   145 bits (367),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 86/128 (67%), Gaps = 10/128 (8%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHV-GNGLDVNGQP--------EKLEFLMF  464
             N+F+AARGL PL  S  HRFPFYD VFDLVHV    L   G P        E LEF MF
Sbjct  66   MNEFVAARGLLPLLLSPAHRFPFYDGVFDLVHVRATALAEGGSPALGQAGTEEALEFFMF  125

Query  463  DMDRVLRAGGLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK-NNGSGKPEVYLS  287
            D+DRVLRAGGL W+D+  C +D++++ L +LI R+GYKKL+W  GEK   GS K  +YL 
Sbjct  126  DVDRVLRAGGLHWIDSHMCHADERRQTLAKLIGRYGYKKLQWATGEKVGTGSTKAAMYLC  185

Query  286  AVLQKPVR  263
            AVLQKP R
Sbjct  186  AVLQKPAR  193



>ref|XP_003561200.1| PREDICTED: uncharacterized protein LOC100825782 [Brachypodium 
distachyon]
Length=385

 Score =   150 bits (378),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 90/129 (70%), Gaps = 12/129 (9%)
 Frame = -2

Query  613  NDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNG----------LDVNGQPEKLEFLMF  464
            ++ +AARGLFPL  S  HR PFYD VFDLVH              + + G PE LEF +F
Sbjct  256  SELVAARGLFPLLLSPAHRLPFYDGVFDLVHAAGAAALDGAGAPAMGLAGTPEALEFFLF  315

Query  463  DMDRVLRAGGLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSG--KPEVYL  290
            D+DRVLR GGL W+D++ C SD++++ + +LI+RFGYKKLKWVVGEK +G G  K  VYL
Sbjct  316  DVDRVLRVGGLLWIDSYPCQSDERRRVVIKLIDRFGYKKLKWVVGEKPSGGGGAKASVYL  375

Query  289  SAVLQKPVR  263
            SAVL+KP R
Sbjct  376  SAVLRKPAR  384



>gb|EMT00430.1| hypothetical protein F775_33158 [Aegilops tauschii]
Length=169

 Score =   139 bits (351),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 81/113 (72%), Gaps = 9/113 (8%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGN------GLDVNGQ---PEKLEFLMF  464
             N+F+A+RGLFPL  S  HRFPFYD VFDLVHVG       G    GQ   PE LEF MF
Sbjct  1    MNEFVASRGLFPLLLSPAHRFPFYDGVFDLVHVGTAALDEAGAPAMGQAATPEALEFFMF  60

Query  463  DMDRVLRAGGLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGK  305
            D+DRVLRAGGL W+D++ C S+++++ + +LIERFGYKKLKWV GEK    G+
Sbjct  61   DVDRVLRAGGLLWIDSYLCQSEERRRVVAKLIERFGYKKLKWVAGEKAGVCGR  113



>ref|XP_002990882.1| hypothetical protein SELMODRAFT_132356 [Selaginella moellendorffii]
 gb|EFJ08155.1| hypothetical protein SELMODRAFT_132356 [Selaginella moellendorffii]
Length=315

 Score =   129 bits (324),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 84/118 (71%), Gaps = 1/118 (1%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            FN+FIAARGL P++ ++  R PF+DN  DLVH  + L      E LEF+++D+DRVLR G
Sbjct  196  FNEFIAARGLVPIFATISQRLPFFDNTLDLVHTMHVLSNWIPLESLEFVLYDIDRVLRPG  255

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVR  263
            G FWLD+F+C+ D        LIER G++++KW VG+K + + + EVYLSA+L+KPVR
Sbjct  256  GFFWLDHFFCTEDQLDTLYVPLIERLGFRRIKWAVGKKLDRANR-EVYLSAILEKPVR  312



>ref|XP_002992478.1| hypothetical protein SELMODRAFT_135385 [Selaginella moellendorffii]
 gb|EFJ06416.1| hypothetical protein SELMODRAFT_135385 [Selaginella moellendorffii]
Length=401

 Score =   129 bits (324),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 79/120 (66%), Gaps = 2/120 (2%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            FN+FIA RGL P++ ++  R PF+DN  DLVH  + L        LEF++FD+DRVLR G
Sbjct  276  FNEFIALRGLVPIFLTVGQRLPFFDNTLDLVHSMHVLSSWIPTRTLEFILFDIDRVLRPG  335

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK--NNGSGKPEVYLSAVLQKPVR  263
            G+ WLD+F+C+ D        ++ER GY KLKWV G K   NG    EVYLSA+L+KPVR
Sbjct  336  GILWLDHFFCTQDQLHTLYAPMVERLGYTKLKWVAGLKLDKNGIKNHEVYLSALLEKPVR  395



>gb|AFW85949.1| hypothetical protein ZEAMMB73_928110 [Zea mays]
Length=353

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 75/109 (69%), Gaps = 9/109 (8%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVG-NGLDVNGQP--------EKLEFLMF  464
             N+F+AARGLFPL  S  HRFPFYD VFDLVHVG   L   G P        E LEF MF
Sbjct  208  MNEFMAARGLFPLLLSPAHRFPFYDGVFDLVHVGATALAEGGSPTLGQAGTEEALEFFMF  267

Query  463  DMDRVLRAGGLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNN  317
            D+DRVLRAGGL W+D+  C +D++++AL RLI R+GYKKL+W   E  +
Sbjct  268  DVDRVLRAGGLLWIDSHMCHADERRQALARLIGRYGYKKLRWARREGQH  316



>ref|XP_002974310.1| hypothetical protein SELMODRAFT_101023 [Selaginella moellendorffii]
 gb|EFJ24532.1| hypothetical protein SELMODRAFT_101023 [Selaginella moellendorffii]
Length=315

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 84/118 (71%), Gaps = 1/118 (1%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            F++FIAARGL P++ ++  R PF+DN  DLVH  + L      E LEF+++D+DRVLR G
Sbjct  196  FSEFIAARGLVPIFATISQRLPFFDNTLDLVHTMHVLSNWIPLESLEFVLYDIDRVLRPG  255

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVR  263
            G FWLD+F+C+ D        LIER G++++KW VG+K + + + EVYLSA+L+KPVR
Sbjct  256  GFFWLDHFFCTEDQLDTLYVPLIERLGFRRIKWAVGKKLDRANR-EVYLSAILEKPVR  312



>ref|XP_007136075.1| hypothetical protein PHAVU_009G015500g [Phaseolus vulgaris]
 gb|ESW08069.1| hypothetical protein PHAVU_009G015500g [Phaseolus vulgaris]
Length=396

 Score =   127 bits (320),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 74/93 (80%), Gaps = 3/93 (3%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            F++FIAARGLFPL+ SLDHRFPFYDNVFDLV   +GLD  G+ EKLEFL+FD+DRVLR G
Sbjct  299  FSEFIAARGLFPLFLSLDHRFPFYDNVFDLVRAASGLDGGGRQEKLEFLIFDIDRVLRGG  358

Query  436  GLFWLDNFYCSSDDKKKALT---RLIERFGYKK  347
            GLFWLDNFYC  ++KK+ L    ++  R  Y++
Sbjct  359  GLFWLDNFYCVDEEKKRVLIVLDQVSHRLCYQQ  391



>gb|KCW69423.1| hypothetical protein EUGRSUZ_F02887 [Eucalyptus grandis]
Length=280

 Score =   122 bits (307),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 80/119 (67%), Gaps = 1/119 (1%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            FN FIA+RG+ PLY S+  R PF+DN  D+VH  + L        L FL+FD+ RVLR G
Sbjct  159  FNSFIASRGVVPLYISISQRLPFFDNTLDIVHSMHVLSNWIPTTLLHFLLFDVYRVLRPG  218

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK-NNGSGKPEVYLSAVLQKPVR  263
            GLFWLD+F+CS D  +K    +IE  G+ KLKWVVG K + G    E+YLSA+L+KP++
Sbjct  219  GLFWLDHFFCSGDQLEKVYAPVIESVGFNKLKWVVGRKLDRGPELQEMYLSALLEKPLK  277



>ref|XP_009390784.1| PREDICTED: probable methyltransferase PMT19 [Musa acuminata subsp. 
malaccensis]
Length=170

 Score =   119 bits (297),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 81/119 (68%), Gaps = 3/119 (3%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEK-LEFLMFDMDRVLRA  440
            FN FIA+RGL P++ S+ HR PF+DN  D+VH  + L  N  PE  LEF ++D+ RVLR 
Sbjct  48   FNSFIASRGLLPMHISVAHRLPFFDNTLDIVHSMHVLS-NWIPEPMLEFALYDVYRVLRP  106

Query  439  GGLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK-NNGSGKPEVYLSAVLQKPV  266
            GGLFWLD+F+C+ +        +IER G+ KL+WV G K + G  K E YLSA+L++P+
Sbjct  107  GGLFWLDHFFCTGEQLNATYVPMIERVGFNKLRWVTGRKLDRGIEKNEWYLSALLERPM  165



>ref|XP_008343074.1| PREDICTED: uncharacterized protein LOC103405840 [Malus domestica]
Length=399

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 81/119 (68%), Gaps = 1/119 (1%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            FN FIA+RG+ PLY S+  R PF+DN  D+VH  + L        L F MFD+ RVLR G
Sbjct  278  FNSFIASRGVVPLYLSISQRLPFFDNTLDIVHSMHVLSNWIPTTLLHFAMFDIYRVLRPG  337

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK-NNGSGKPEVYLSAVLQKPVR  263
            GLFWLD+F+C  +  ++    LIE  GYKKLKWVVG+K + G  + E+YLSA+L+KP++
Sbjct  338  GLFWLDHFFCVGEQLEEVYGPLIESIGYKKLKWVVGKKLDRGPERREMYLSALLEKPLK  396



>ref|XP_010062298.1| PREDICTED: probable methyltransferase PMT19 [Eucalyptus grandis]
Length=401

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 80/119 (67%), Gaps = 1/119 (1%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            FN FIA+RG+ PLY S+  R PF+DN  D+VH  + L        L FL+FD+ RVLR G
Sbjct  280  FNSFIASRGVVPLYISISQRLPFFDNTLDIVHSMHVLSNWIPTTLLHFLLFDVYRVLRPG  339

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK-NNGSGKPEVYLSAVLQKPVR  263
            GLFWLD+F+CS D  +K    +IE  G+ KLKWVVG K + G    E+YLSA+L+KP++
Sbjct  340  GLFWLDHFFCSGDQLEKVYAPVIESVGFNKLKWVVGRKLDRGPELQEMYLSALLEKPLK  398



>gb|KDP25822.1| hypothetical protein JCGZ_22544 [Jatropha curcas]
Length=395

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 80/119 (67%), Gaps = 1/119 (1%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            FN FIA+RG+ PLY S+  R PF+DN  D++H  + L        L FLMFD+ RVLR G
Sbjct  274  FNSFIASRGVLPLYISISQRLPFFDNTLDIIHSMHVLSNWIPTTLLHFLMFDIYRVLRPG  333

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK-NNGSGKPEVYLSAVLQKPVR  263
            GLFWLD+F+C  D+ +K    LIE  G+ KLKWVVG K + G    E+YLSA+L+KP++
Sbjct  334  GLFWLDHFFCVGDELEKVYGPLIESVGFNKLKWVVGRKLDRGPELNEMYLSALLEKPLK  392



>ref|XP_002263360.1| PREDICTED: probable methyltransferase PMT12 [Vitis vinifera]
 emb|CAN83179.1| hypothetical protein VITISV_013308 [Vitis vinifera]
Length=392

 Score =   122 bits (305),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 83/120 (69%), Gaps = 3/120 (3%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKL-EFLMFDMDRVLRA  440
            FN FIA+RG+ PLY S+  R PF+DN  D+VH  + L  N  P  L  FL+FD+ RVLR 
Sbjct  271  FNSFIASRGVVPLYISISQRLPFFDNTLDIVHSMHVLS-NWIPNTLLHFLLFDIYRVLRP  329

Query  439  GGLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK-NNGSGKPEVYLSAVLQKPVR  263
            GGLFWLD+F+C  +  ++    LIE  G+KKLKWVVG+K + G    E+YLSA+L+KP+R
Sbjct  330  GGLFWLDHFFCMDEQMEEVYKPLIESVGFKKLKWVVGKKLDRGPKLREMYLSALLEKPLR  389



>ref|XP_006372524.1| hypothetical protein POPTR_0017s02460g [Populus trichocarpa]
 gb|ERP50321.1| hypothetical protein POPTR_0017s02460g [Populus trichocarpa]
Length=281

 Score =   120 bits (300),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 80/119 (67%), Gaps = 1/119 (1%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            FN+FIA+RG+ PLY S+  R PF+DN  D+VH  + L        L FLMFD+ RVLR G
Sbjct  160  FNNFIASRGVMPLYISISQRLPFFDNTLDIVHSMHVLSNWIPSTLLHFLMFDIYRVLRPG  219

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK-NNGSGKPEVYLSAVLQKPVR  263
            GLFWLD+F+C  D        LIE  G+ KLKWVVG+K + G+   E+YLSA+L+KP++
Sbjct  220  GLFWLDHFFCVEDQFLDVYKPLIESIGFIKLKWVVGKKLDRGAELREMYLSALLEKPLK  278



>ref|XP_010032737.1| PREDICTED: probable methyltransferase PMT19 [Eucalyptus grandis]
Length=397

 Score =   121 bits (304),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 80/119 (67%), Gaps = 1/119 (1%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            FN+FIAARG+ PLY S+  R PF+DN  D+VH  + L        L FLMFD+ RVLR G
Sbjct  276  FNNFIAARGVMPLYISISQRLPFFDNTLDIVHSMHVLSNWIPTTLLHFLMFDIYRVLRPG  335

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK-NNGSGKPEVYLSAVLQKPVR  263
            GLFWLD+F+C  +  +   T LI+  G+ K+KWVVG K + G    E+YLSA+L+KP++
Sbjct  336  GLFWLDHFFCVGEQLEHVYTPLIDSIGFNKIKWVVGRKLDRGPELQEMYLSALLEKPLK  394



>ref|XP_002533472.1| ATRAD3, putative [Ricinus communis]
 gb|EEF28904.1| ATRAD3, putative [Ricinus communis]
Length=400

 Score =   121 bits (303),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 81/119 (68%), Gaps = 1/119 (1%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            FN+FIA+RG+ PLY S+  R PF+DN  D+VH  + L        L FLMFD+ RVLR G
Sbjct  279  FNNFIASRGVVPLYISISQRLPFFDNTLDIVHSMHVLSNWIPTTSLHFLMFDIYRVLRPG  338

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK-NNGSGKPEVYLSAVLQKPVR  263
            GLFWLD+F+C  ++ ++    +IE  G+ KLKWVVG K + G    E+YLSA+L+KP++
Sbjct  339  GLFWLDHFFCVGEELEQVYAPVIESIGFNKLKWVVGRKLDRGPELREMYLSALLEKPLK  397



>ref|XP_006840654.1| hypothetical protein AMTR_s00211p00024570 [Amborella trichopoda]
 gb|ERN02329.1| hypothetical protein AMTR_s00211p00024570 [Amborella trichopoda]
Length=136

 Score =   115 bits (287),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 81/121 (67%), Gaps = 8/121 (7%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDV--NGQPEKLEFLMFDMDRVLR  443
            F +F+AARGLFPLY     R PF+D  FDL+HV   +    +   EK+EF++FD+DRVLR
Sbjct  19   FCEFMAARGLFPLYLVPGQRLPFFDYTFDLIHVVREIAQGRSNSMEKVEFVLFDIDRVLR  78

Query  442  AGGLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEV-YLSAVLQKPV  266
             GG  WL+      + +KK +  LIE+FGYKK+KWVVG K    G  +V YLSAVLQKPV
Sbjct  79   PGGFIWLEKLVLKEEMQKKYVG-LIEKFGYKKVKWVVGAK----GPQQVYYLSAVLQKPV  133

Query  265  R  263
            R
Sbjct  134  R  134



>ref|XP_004248708.1| PREDICTED: probable methyltransferase PMT19 [Solanum lycopersicum]
Length=397

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 81/120 (68%), Gaps = 3/120 (3%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKL-EFLMFDMDRVLRA  440
            FN FIA+RG+ PLY S+  R PF+DN  D+VH  + L  N  PE L  FL+FD+ RVLR 
Sbjct  276  FNSFIASRGVIPLYVSISQRLPFFDNTLDIVHSMHVLS-NWIPETLLHFLLFDIYRVLRP  334

Query  439  GGLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK-NNGSGKPEVYLSAVLQKPVR  263
            GGLFWLD+F+C  D  +K    LIE  G+ K+KW+VG K + G    E+YLSA+L KP++
Sbjct  335  GGLFWLDHFFCVGDQFEKVYAPLIESIGFNKVKWIVGRKFDRGPELNEMYLSALLMKPLK  394



>ref|XP_003616242.1| hypothetical protein MTR_5g077710 [Medicago truncatula]
 gb|AES99200.1| methyltransferase [Medicago truncatula]
Length=388

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 82/120 (68%), Gaps = 3/120 (3%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKL-EFLMFDMDRVLRA  440
            FN FIA+RG+ PLY S+  RFPF+DN  D+VH  + L  N  PE L  FL+FD+ RVLR 
Sbjct  267  FNSFIASRGVLPLYMSISQRFPFFDNTLDIVHSMHVLS-NWIPETLLHFLLFDVYRVLRP  325

Query  439  GGLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK-NNGSGKPEVYLSAVLQKPVR  263
            GGLFWLD+F+C  D  +     +IE  G+KK+KWV G+K + G    E+YLSA+L+KP +
Sbjct  326  GGLFWLDHFFCVGDQLENVYGPMIESVGFKKVKWVTGKKLDKGPQFQEMYLSALLEKPFK  385



>ref|XP_011038251.1| PREDICTED: uncharacterized protein LOC105135192 [Populus euphratica]
Length=402

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 80/119 (67%), Gaps = 1/119 (1%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            FN+FIA+RG+ PLY S+  R PF+DN  D+VH  + L        L FLMFD+ RVLR G
Sbjct  281  FNNFIASRGVMPLYISISQRLPFFDNTLDIVHSMHVLSNWIPSTLLHFLMFDIYRVLRPG  340

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK-NNGSGKPEVYLSAVLQKPVR  263
            GLFWLD+F+C  D        LIE  G+ KLKWVVG+K + G+   E+YLSA+L+KP++
Sbjct  341  GLFWLDHFFCVEDQFLDVYKPLIESIGFIKLKWVVGKKLDRGAELREMYLSALLEKPLK  399



>ref|XP_011043910.1| PREDICTED: uncharacterized protein LOC105139235 [Populus euphratica]
Length=394

 Score =   119 bits (298),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 80/119 (67%), Gaps = 1/119 (1%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            FN+FIA+RG+ PLY S+  R PF+DN  D+VH  + L        L FLMFD+ RVLR G
Sbjct  273  FNNFIASRGVMPLYISISQRLPFFDNTLDIVHSMHVLSNWIPTTLLHFLMFDIYRVLRPG  332

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK-NNGSGKPEVYLSAVLQKPVR  263
            GLFWLD+F+C  D        LIE  G+ KLKWVVG+K + G+   E+YL+A+L+KP++
Sbjct  333  GLFWLDHFFCVEDQFLDVYKPLIETIGFIKLKWVVGKKLDRGAELREMYLTALLEKPLK  391



>ref|XP_004490854.1| PREDICTED: probable methyltransferase PMT16-like [Cicer arietinum]
Length=385

 Score =   119 bits (298),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 81/120 (68%), Gaps = 3/120 (3%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKL-EFLMFDMDRVLRA  440
            FN FIA+RG+ PLY S+  RFPF+DN  D+VH  + L  N  PE L  FL FD+ RVLR 
Sbjct  264  FNSFIASRGVMPLYMSISQRFPFFDNTLDIVHSMHVLS-NWIPETLLHFLFFDIYRVLRP  322

Query  439  GGLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK-NNGSGKPEVYLSAVLQKPVR  263
            GGLFWLD+F+C  D  +     +IE  G+KK+KWV G+K + G    E+YLSA+L+KP +
Sbjct  323  GGLFWLDHFFCVGDQLEMVYGPMIESVGFKKVKWVTGKKLDKGPQFQEMYLSALLEKPFK  382



>ref|XP_011085904.1| PREDICTED: probable methyltransferase PMT19 [Sesamum indicum]
Length=405

 Score =   119 bits (298),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 80/118 (68%), Gaps = 1/118 (1%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            FN+FIA+RG+ PLY S+  R PF+DN  D+VH  + L      E L FL+FD+ RVLR G
Sbjct  284  FNNFIASRGVVPLYMSISQRLPFFDNTLDIVHSMHVLSNWIPTELLHFLVFDIYRVLRPG  343

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK-NNGSGKPEVYLSAVLQKPV  266
            GLFWLD+F+C  +  +K    LIE  G++K+KW VG K + G    E+YLSA+LQKP+
Sbjct  344  GLFWLDHFFCVGEQLEKVYAPLIESVGFEKVKWEVGRKLDRGPELNEMYLSALLQKPM  401



>ref|XP_002305225.1| hypothetical protein POPTR_0004s08210g [Populus trichocarpa]
 gb|EEE85736.1| hypothetical protein POPTR_0004s08210g [Populus trichocarpa]
Length=399

 Score =   119 bits (297),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 80/119 (67%), Gaps = 1/119 (1%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            FN+FIA+RG+ PLY S+  R PF+DN  D+VH  + L        L FLMFD+ RVLR G
Sbjct  278  FNNFIASRGVVPLYISISQRLPFFDNTLDIVHSMHVLSNWIPTTLLHFLMFDIYRVLRPG  337

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK-NNGSGKPEVYLSAVLQKPVR  263
            GLFWLD+F+C  D        LIE  G+ KLKWVVG+K + G+   E+YL+A+L+KP++
Sbjct  338  GLFWLDHFFCVEDQFLDVYKPLIETIGFIKLKWVVGKKLDRGAELREMYLTALLEKPLK  396



>ref|XP_002972857.1| hypothetical protein SELMODRAFT_12874, partial [Selaginella moellendorffii]
 gb|EFJ26078.1| hypothetical protein SELMODRAFT_12874, partial [Selaginella moellendorffii]
Length=320

 Score =   117 bits (294),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 78/117 (67%), Gaps = 1/117 (1%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            FN FIA RG+ PLY ++  RFPF+DN  D+VH  + L        L+F++FD+DR+LR G
Sbjct  203  FNSFIALRGVIPLYLTVSQRFPFFDNTLDIVHSMHVLSNWIPLGMLDFILFDIDRILRPG  262

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK-NNGSGKPEVYLSAVLQKP  269
            G+ WLD+F+C  +   +    +IER GYKKL+W VG+K + G    E YL+AVL+KP
Sbjct  263  GILWLDHFFCIENQLNEVYIPMIERLGYKKLRWTVGKKLDRGPELMERYLTAVLEKP  319



>ref|XP_009774313.1| PREDICTED: probable methyltransferase PMT19 [Nicotiana sylvestris]
Length=396

 Score =   118 bits (296),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 56/119 (47%), Positives = 81/119 (68%), Gaps = 1/119 (1%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            FN+FIA+RG+ PLY S+  R PF+DN  D+VH  + +        L FL+FD+ RVLR G
Sbjct  275  FNNFIASRGVIPLYISISQRLPFFDNTLDIVHSMHVMSNWIPTTLLHFLLFDIYRVLRPG  334

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK-NNGSGKPEVYLSAVLQKPVR  263
            GLFWLD+F+C+ D  ++    LI+  G+ K+KW+VG K + G    E+YLSA+L+KP++
Sbjct  335  GLFWLDHFFCAGDQLEQVYAPLIDSVGFNKVKWIVGRKLDRGPELNEMYLSALLEKPLK  393



>ref|XP_007217596.1| hypothetical protein PRUPE_ppa018544mg [Prunus persica]
 gb|EMJ18795.1| hypothetical protein PRUPE_ppa018544mg [Prunus persica]
Length=396

 Score =   118 bits (296),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 58/119 (49%), Positives = 80/119 (67%), Gaps = 1/119 (1%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            FN FIA+RG+ PLY S+  R PF+DN  D+VH  + L        L F +FD+ R+LR G
Sbjct  275  FNSFIASRGVVPLYISISQRLPFFDNTLDIVHSMHVLSNWIPTTLLHFAVFDIYRILRPG  334

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK-NNGSGKPEVYLSAVLQKPVR  263
            GLFWLD+F+C  +  ++    LIE  G+KKLKWVVG K + G  + E+YLSA+L+KP++
Sbjct  335  GLFWLDHFFCVGEQMEEVYGPLIESVGFKKLKWVVGRKLDRGPERREMYLSALLEKPLK  393



>ref|XP_001767537.1| predicted protein [Physcomitrella patens]
 gb|EDQ67672.1| predicted protein [Physcomitrella patens]
Length=330

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 82/119 (69%), Gaps = 3/119 (3%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQP-EKLEFLMFDMDRVLRA  440
            FN+FIA RG+ P + SL  RFPF+DN  D+VH  + L  N  P E LEF+ +D+DR+LR 
Sbjct  209  FNNFIAQRGVIPFFVSLGQRFPFWDNTLDIVHSMHVLS-NWIPFEILEFVFYDIDRILRP  267

Query  439  GGLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK-NNGSGKPEVYLSAVLQKPV  266
            GG+ WLD+F+C   +       LI  FGYK+L+W VG+K + G+ K EVYLSA+L+KP+
Sbjct  268  GGVLWLDHFFCIQSELDTRYAPLIRSFGYKELRWDVGKKLDRGAEKKEVYLSALLEKPL  326



>ref|XP_010271214.1| PREDICTED: uncharacterized protein LOC104607292 [Nelumbo nucifera]
Length=390

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/119 (49%), Positives = 80/119 (67%), Gaps = 1/119 (1%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            FN FIA+RG+ PLY S+  R PF+DN  D+VH  + L        L FL+FD+ RVLR G
Sbjct  269  FNSFIASRGVVPLYLSISQRLPFFDNTLDIVHSMHVLSNWIPTTLLHFLLFDVYRVLRPG  328

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK-NNGSGKPEVYLSAVLQKPVR  263
            GLFWLD+F+C  +  ++    LI+  G+KK+KWVVG K + G    E+YLSA+L+KP++
Sbjct  329  GLFWLDHFFCVEEQFEEVYAPLIDNIGFKKVKWVVGRKLDRGPELREMYLSALLEKPLK  387



>ref|XP_006494666.1| PREDICTED: probable methyltransferase PMT19-like [Citrus sinensis]
Length=392

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 76/117 (65%), Gaps = 1/117 (1%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            FN+FIA+RG+ PLY S+  R PF+DN  D+VH  + L        L FLMFD+ RVLR G
Sbjct  272  FNNFIASRGVVPLYISISQRLPFFDNTLDIVHSMHVLSNWIPTTLLHFLMFDIYRVLRPG  331

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK-NNGSGKPEVYLSAVLQKP  269
            GLFWLD+F+C     +     LIE  G+ KLKWVVG K + G    E+YLSA+L+KP
Sbjct  332  GLFWLDHFFCVGAQLEDVYVPLIESVGFNKLKWVVGRKLDRGPELREMYLSALLEKP  388



>ref|XP_004240038.1| PREDICTED: probable methyltransferase PMT19 [Solanum lycopersicum]
Length=403

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/119 (49%), Positives = 79/119 (66%), Gaps = 1/119 (1%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            FN FIA+RG+ PLY S+  R PF+DN  D+VH  + L        L FL+FD+ RVLR G
Sbjct  282  FNTFIASRGVIPLYISISQRLPFFDNTLDIVHSMHVLSNWIPSTLLHFLLFDIYRVLRPG  341

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK-NNGSGKPEVYLSAVLQKPVR  263
            GLFWLD+F+C  +  ++    LIE  G+ K+KWVVG K + G    E+YLSA+L+KP++
Sbjct  342  GLFWLDHFFCVGEQFEQVYAPLIESIGFNKVKWVVGRKLDRGPELNEMYLSALLEKPLK  400



>ref|XP_006421083.1| hypothetical protein CICLE_v10006824mg [Citrus clementina]
 gb|ESR34323.1| hypothetical protein CICLE_v10006824mg [Citrus clementina]
 gb|KDO41055.1| hypothetical protein CISIN_1g047630mg [Citrus sinensis]
Length=392

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 76/117 (65%), Gaps = 1/117 (1%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            FN+FIA+RG+ PLY S+  R PF+DN  D+VH  + L        L FLMFD+ RVLR G
Sbjct  272  FNNFIASRGVVPLYISISQRLPFFDNTLDIVHSMHVLSNWIPTTLLHFLMFDIYRVLRPG  331

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK-NNGSGKPEVYLSAVLQKP  269
            GLFWLD+F+C     +     LIE  G+ KLKWVVG K + G    E+YLSA+L+KP
Sbjct  332  GLFWLDHFFCVGAQLEDVYVPLIESVGFNKLKWVVGRKLDRGPELREMYLSALLEKP  388



>ref|XP_009619701.1| PREDICTED: uncharacterized protein LOC104111663 [Nicotiana tomentosiformis]
Length=396

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/119 (47%), Positives = 81/119 (68%), Gaps = 1/119 (1%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            FN+FIA+RG+ PLY S+  R PF+DN  D+VH  + +        L FL+FD+ RVLR G
Sbjct  275  FNNFIASRGVIPLYVSISQRLPFFDNTLDIVHSMHVMSNWIPTTLLHFLLFDIYRVLRPG  334

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK-NNGSGKPEVYLSAVLQKPVR  263
            GLFWLD+F+C+ D  ++    LI+  G+ K+KW+VG K + G    E+YLSA+L+KP++
Sbjct  335  GLFWLDHFFCAGDQLEQVYAPLIDSVGFNKVKWLVGRKLDRGPELNEMYLSALLEKPLK  393



>ref|XP_002994258.1| hypothetical protein SELMODRAFT_2228, partial [Selaginella moellendorffii]
 gb|EFJ04670.1| hypothetical protein SELMODRAFT_2228, partial [Selaginella moellendorffii]
Length=320

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 78/117 (67%), Gaps = 1/117 (1%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            FN FI+ RG+ PLY ++  RFPF+DN  D+VH  + L        L+F++FD+DR+LR G
Sbjct  203  FNSFISLRGVIPLYLTVSQRFPFFDNTLDIVHSMHVLSNWIPLGMLDFILFDIDRILRPG  262

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK-NNGSGKPEVYLSAVLQKP  269
            G+ WLD+F+C  +   +    +IER GYKKL+W VG+K + G    E YL+AVL+KP
Sbjct  263  GILWLDHFFCIENQLNEVYIPMIERLGYKKLRWTVGKKLDRGPELMERYLTAVLEKP  319



>ref|XP_006349637.1| PREDICTED: probable methyltransferase PMT19-like [Solanum tuberosum]
Length=396

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 81/120 (68%), Gaps = 3/120 (3%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKL-EFLMFDMDRVLRA  440
            FN FIA+RG+ PLY S+  R PF+DN  D+VH  + L  N  PE L  FL+FD+ RVLR 
Sbjct  275  FNSFIASRGVIPLYVSISQRLPFFDNTLDIVHSMHVLS-NWIPEILLHFLLFDIYRVLRP  333

Query  439  GGLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK-NNGSGKPEVYLSAVLQKPVR  263
            GGLFWLD+F+C  +  +K    LI+  G+ K+KW+VG K + G    E+YLSA+L KP++
Sbjct  334  GGLFWLDHFFCVGEQLEKQYAPLIDSIGFNKVKWIVGRKLDRGPELNEMYLSALLMKPLK  393



>ref|XP_006850560.1| hypothetical protein AMTR_s00191p00037430 [Amborella trichopoda]
 gb|ERN12141.1| hypothetical protein AMTR_s00191p00037430 [Amborella trichopoda]
Length=380

 Score =   116 bits (291),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/118 (46%), Positives = 75/118 (64%), Gaps = 2/118 (2%)
 Frame = -2

Query  610  DFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAGGL  431
            +  A RGL PL+ +L HRFP +D+  DLVH G  ++       +EFL +D+DRVLRAGGL
Sbjct  262  EIAALRGLPPLHITLHHRFPIFDSTMDLVHCGRAVNRWIPTVTMEFLFYDIDRVLRAGGL  321

Query  430  FWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSG--KPEVYLSAVLQKPVR  263
             W D+F+C   D  K    L+ + GYKKL+W+   K + SG    E++L+A+LQKP R
Sbjct  322  LWFDHFFCKMVDLDKVYGPLMRKMGYKKLRWITANKTDASGVRNGELFLTALLQKPAR  379



>ref|XP_006360379.1| PREDICTED: uncharacterized protein LOC102594943 [Solanum tuberosum]
Length=403

 Score =   116 bits (291),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 58/119 (49%), Positives = 78/119 (66%), Gaps = 1/119 (1%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            FN FIA+RG+ PLY S+  R PF+DN  D+VH  + L        L FL FD+ RVLR G
Sbjct  282  FNTFIASRGVIPLYISISQRLPFFDNTLDIVHSMHVLSNWIPSTLLHFLFFDIYRVLRPG  341

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK-NNGSGKPEVYLSAVLQKPVR  263
            GLFWLD+F+C  +  ++    LIE  G+ K+KWVVG K + G    E+YLSA+L+KP++
Sbjct  342  GLFWLDHFFCVREQFEQVYAPLIESIGFTKVKWVVGRKLDRGPELNEMYLSALLEKPLK  400



>ref|XP_008790999.1| PREDICTED: uncharacterized protein LOC103708022, partial [Phoenix 
dactylifera]
Length=282

 Score =   115 bits (287),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 75/121 (62%), Gaps = 2/121 (2%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            +++  A RG+ PL+  L  RFP  D V DLV  G+ ++       LEFL++D DRVLRAG
Sbjct  143  YSEAAALRGVVPLHAPLQQRFPVQDGVLDLVRSGHAVNRWIPAPALEFLLYDADRVLRAG  202

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKP--EVYLSAVLQKPVR  263
            G  W+D+F+C   D       +I R GYK +KW VG+K +  G P  EVYL+A+LQKP+ 
Sbjct  203  GFLWVDHFFCKGADLDAVYAPMIRRLGYKIIKWAVGDKTHAGGLPYDEVYLTALLQKPLP  262

Query  262  A  260
            A
Sbjct  263  A  263



>ref|XP_006826614.1| hypothetical protein AMTR_s00138p00094100 [Amborella trichopoda]
 gb|ERM93851.1| hypothetical protein AMTR_s00138p00094100 [Amborella trichopoda]
Length=455

 Score =   116 bits (290),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 55/118 (47%), Positives = 77/118 (65%), Gaps = 1/118 (1%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            FN+FIA+RG+ PLY S+  R PF+DN  D+VH  + L        L F+ FD+ R+LR G
Sbjct  338  FNNFIASRGVIPLYISVSQRLPFFDNTLDIVHSMHVLSNWIPTTLLHFIFFDIHRILRPG  397

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK-NNGSGKPEVYLSAVLQKPV  266
            GLFWLD+F+C  D   +    +IE  G+KKLKW +G K + G    E+Y+SA+L+KP+
Sbjct  398  GLFWLDHFFCIEDQMNQVYIPMIEGIGFKKLKWTIGRKLDRGVELHEMYISALLEKPL  455



>ref|XP_009762652.1| PREDICTED: uncharacterized protein LOC104214650 [Nicotiana sylvestris]
Length=405

 Score =   116 bits (290),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 57/119 (48%), Positives = 79/119 (66%), Gaps = 1/119 (1%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            FN FIA+RG+ PLY S+  R PF+DN  D+VH  + L        L FL+FD+ RVLR G
Sbjct  284  FNTFIASRGVVPLYISISQRLPFFDNTLDIVHSMHVLSNWIPTTLLHFLLFDIYRVLRPG  343

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK-NNGSGKPEVYLSAVLQKPVR  263
            GLFWLD+F+C  +  ++    LI+  G+ K+KWVVG K + G    E+YLSA+L+KP++
Sbjct  344  GLFWLDHFFCVGEQFEQVYAPLIDSIGFNKVKWVVGRKMDRGPELNEMYLSALLEKPLK  402



>ref|XP_004289582.1| PREDICTED: probable methyltransferase PMT19 [Fragaria vesca subsp. 
vesca]
 ref|XP_011469425.1| PREDICTED: probable methyltransferase PMT19 [Fragaria vesca subsp. 
vesca]
 ref|XP_011469430.1| PREDICTED: probable methyltransferase PMT19 [Fragaria vesca subsp. 
vesca]
 ref|XP_011469437.1| PREDICTED: probable methyltransferase PMT19 [Fragaria vesca subsp. 
vesca]
 ref|XP_011469439.1| PREDICTED: probable methyltransferase PMT19 [Fragaria vesca subsp. 
vesca]
Length=380

 Score =   115 bits (289),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 77/119 (65%), Gaps = 1/119 (1%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            FN+FIA+RG+ PLY S+  R PF+DN  D+VH  + L        L F  FD+ RVLR G
Sbjct  259  FNNFIASRGVIPLYISISQRLPFFDNTLDIVHSMHVLSNWIPTTLLHFAFFDVYRVLRPG  318

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK-NNGSGKPEVYLSAVLQKPVR  263
            GLFWLD+F+C  D  +     LIE  G+ KLKWVVG K + G    E+YLSA+L+KP++
Sbjct  319  GLFWLDHFFCVGDQLEVTYKPLIESIGFNKLKWVVGRKLDRGPELREMYLSALLEKPLK  377



>ref|XP_009609578.1| PREDICTED: uncharacterized protein LOC104103385 [Nicotiana tomentosiformis]
Length=406

 Score =   115 bits (289),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 56/119 (47%), Positives = 79/119 (66%), Gaps = 1/119 (1%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            FN FIA+RG+ PLY S+  R PF+DN  D+VH  + L        L FL+FD+ RVLR G
Sbjct  285  FNTFIASRGVVPLYISISQRLPFFDNTLDIVHSMHVLSNWIPTTLLHFLLFDIYRVLRPG  344

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK-NNGSGKPEVYLSAVLQKPVR  263
            GLFWLD+F+C  +  ++    LI+  G+ K+KWV+G K + G    E+YLSA+L+KP++
Sbjct  345  GLFWLDHFFCVGEQFEQVYAPLIDSIGFNKVKWVIGRKMDRGPELNEMYLSALLEKPLK  403



>ref|XP_010275732.1| PREDICTED: uncharacterized protein LOC104610690 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010275741.1| PREDICTED: uncharacterized protein LOC104610690 isoform X2 [Nelumbo 
nucifera]
Length=376

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/119 (47%), Positives = 75/119 (63%), Gaps = 2/119 (2%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            +N+  A RGL PL+  L  RFP +D V DLV  G+ ++       +EFL +D+DRVLR G
Sbjct  256  YNEATALRGLVPLHIPLQQRFPIFDGVVDLVRCGHAVNRWIPITTMEFLFYDVDRVLRGG  315

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSG--KPEVYLSAVLQKPV  266
            G FWLD+F+    D +K    LI + GYKK+KW  G K + SG    +VYL+A+LQKPV
Sbjct  316  GYFWLDHFFSKGTDLEKVYAPLIRKLGYKKVKWATGNKTDSSGLKNGDVYLTALLQKPV  374



>gb|ABR17484.1| unknown [Picea sitchensis]
Length=448

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/118 (46%), Positives = 81/118 (69%), Gaps = 2/118 (2%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            FN+FIA+RG+ P+Y S+ HR PF+DN  D+VH  + L        LEF+++D++R+LR G
Sbjct  329  FNNFIASRGVVPMYISVSHRLPFFDNTLDIVHSMHVLSNWIPTVLLEFILYDINRILRPG  388

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK-NNGSGKPEVYLSAVLQKPV  266
            G+FWLD F+C  +D+ K    +IE  G+ KLKW +G K + G    E+Y+SA+L+KP+
Sbjct  389  GVFWLDRFFC-IEDQLKIYVPMIENVGFNKLKWSIGRKLDRGPALKEMYISALLEKPL  445



>ref|XP_009410726.1| PREDICTED: uncharacterized protein LOC103992655 [Musa acuminata 
subsp. malaccensis]
Length=437

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 78/119 (66%), Gaps = 3/119 (3%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEK-LEFLMFDMDRVLRA  440
            FN+FIA+RGL PL+ S+ HR PF+DN  D+VH  + L  N  P+  LEF +FD+ RVLR 
Sbjct  319  FNNFIASRGLLPLHISVAHRLPFFDNTLDIVHSMHVLS-NWIPDAMLEFALFDIHRVLRP  377

Query  439  GGLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK-NNGSGKPEVYLSAVLQKPV  266
            GGLFWLD+F+C           + +R G+KKL+W  G K + G  K E YLSA+L+KP 
Sbjct  378  GGLFWLDHFFCLGTQLNATYVPMFQRIGFKKLRWSAGRKLDRGLDKNEWYLSALLEKPT  436



>ref|XP_006355600.1| PREDICTED: uncharacterized protein LOC102592036 [Solanum tuberosum]
Length=373

 Score =   113 bits (283),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 76/119 (64%), Gaps = 2/119 (2%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            +++ +A RGL PL+  L  R P +D V DLV  G+ ++       +EFL+FD+DRVLRAG
Sbjct  253  YSETVALRGLVPLHVPLQQRLPVFDGVLDLVRCGHAVNRWIPVTMMEFLLFDVDRVLRAG  312

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSG--KPEVYLSAVLQKPV  266
            G  WLD+F+    D +K    LI +  YKK+KW V  KN+ SG    EVYL+A+LQKP+
Sbjct  313  GYLWLDHFFSKRADLEKVFQPLIWKLNYKKVKWAVANKNDASGVKNGEVYLTALLQKPI  371



>ref|XP_011096504.1| PREDICTED: uncharacterized protein LOC105175673 [Sesamum indicum]
Length=370

 Score =   112 bits (281),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 56/119 (47%), Positives = 75/119 (63%), Gaps = 2/119 (2%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            +N+ +A RGL PL+  L  R P +D V DLV  G+ ++       +EFL FD+DRVLR G
Sbjct  250  YNEAVAVRGLVPLHAPLQQRLPVFDGVLDLVRCGHAVNRWIPVTSMEFLFFDVDRVLRGG  309

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSG--KPEVYLSAVLQKPV  266
            G F LD+F+    D +K  T LI + GYKK+KW V  K + SG    EVYL+A+LQKP+
Sbjct  310  GYFLLDHFFSKRTDLEKVFTPLIGKLGYKKVKWAVANKTDSSGVKNGEVYLTALLQKPL  368



>ref|XP_004233013.1| PREDICTED: uncharacterized protein LOC101264173 [Solanum lycopersicum]
Length=373

 Score =   112 bits (281),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 76/119 (64%), Gaps = 2/119 (2%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            +++ +A RGL PL+  L  R P +D V DLV  G+ ++       +EFL+FD+DRVLRAG
Sbjct  253  YSETVALRGLVPLHVPLQQRLPVFDGVLDLVRCGHAVNRWIPVTMMEFLLFDVDRVLRAG  312

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSG--KPEVYLSAVLQKPV  266
            G  WLD+F+    D +K    LI +  YKK+KW V  KN+ SG    EVYL+A+LQKP+
Sbjct  313  GYLWLDHFFSKRADLEKVFQPLIWKLNYKKVKWTVANKNDASGVKNGEVYLTALLQKPL  371



>ref|XP_002519740.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42713.1| conserved hypothetical protein [Ricinus communis]
Length=377

 Score =   112 bits (280),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 74/118 (63%), Gaps = 2/118 (2%)
 Frame = -2

Query  613  NDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAGG  434
            N+ +A RGL PL+  L  R P +D V DLV  G  ++     + +EFL+FD+DRVLR GG
Sbjct  258  NEVVAMRGLVPLHVPLQQRLPMFDGVVDLVRCGRAVNRWIPLKMMEFLLFDVDRVLRGGG  317

Query  433  LFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSG--KPEVYLSAVLQKPV  266
              WLD+F+    D  K    LI + GYKK+KW VG K + SG    EVYL+A+LQKPV
Sbjct  318  YLWLDHFFSKRADLDKIYGPLIGKLGYKKVKWAVGNKTDSSGIKNGEVYLTALLQKPV  375



>ref|XP_010666499.1| PREDICTED: uncharacterized protein LOC104883647 [Beta vulgaris 
subsp. vulgaris]
Length=375

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 74/118 (63%), Gaps = 2/118 (2%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            +++F A RGL PL+  L  R P +D V DLV  G+G++       LEFL+FD+DRVLR G
Sbjct  255  YSEFNAVRGLLPLHAPLQQRLPVFDGVLDLVRCGHGVNRWIPTAMLEFLLFDVDRVLRGG  314

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSG--KPEVYLSAVLQKP  269
            G FW+D+F+    D  K    LI + GYK +KW  G K + SG    EVYL+A+LQKP
Sbjct  315  GFFWVDHFFSKGGDLDKVYKPLINKLGYKIVKWATGSKMDASGVKNGEVYLTALLQKP  372



>ref|XP_011005850.1| PREDICTED: uncharacterized protein LOC105112010 [Populus euphratica]
 ref|XP_011005851.1| PREDICTED: uncharacterized protein LOC105112010 [Populus euphratica]
 ref|XP_011005852.1| PREDICTED: uncharacterized protein LOC105112010 [Populus euphratica]
 ref|XP_011005853.1| PREDICTED: uncharacterized protein LOC105112010 [Populus euphratica]
Length=376

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/118 (47%), Positives = 72/118 (61%), Gaps = 2/118 (2%)
 Frame = -2

Query  613  NDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAGG  434
            N+ +A RGL PL+  L  R P +D V DLV   + ++       +EFL +D+DRVLR GG
Sbjct  257  NEVVAMRGLVPLHVPLQQRLPVFDGVLDLVRCAHAVNRWIPLTMMEFLFYDVDRVLRGGG  316

Query  433  LFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSG--KPEVYLSAVLQKPV  266
              W D+F+C   D  K    LI + GYKK+KW VG K + SG    EVYL+A+LQKPV
Sbjct  317  YLWFDHFFCKRMDLDKVFGPLIGKLGYKKVKWAVGNKTDSSGLKNEEVYLTALLQKPV  374



>ref|XP_006369890.1| hypothetical protein POPTR_0001s34490g [Populus trichocarpa]
 gb|ERP66459.1| hypothetical protein POPTR_0001s34490g [Populus trichocarpa]
Length=376

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/118 (47%), Positives = 72/118 (61%), Gaps = 2/118 (2%)
 Frame = -2

Query  613  NDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAGG  434
            N+ +A RGL PL+  L  R P +D V DLV   + ++       +EFL +D+DRVLR GG
Sbjct  257  NEVVAMRGLVPLHVPLQQRLPVFDGVVDLVRCAHAVNRWIPLTMMEFLFYDVDRVLRGGG  316

Query  433  LFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSG--KPEVYLSAVLQKPV  266
              W D+F+C   D  K    LI + GYKK+KW VG K + SG    EVYL+A+LQKPV
Sbjct  317  YLWFDHFFCKRMDLDKVFGPLIGKLGYKKVKWAVGNKTDSSGLKNEEVYLTALLQKPV  374



>emb|CDP17332.1| unnamed protein product [Coffea canephora]
Length=376

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 56/119 (47%), Positives = 74/119 (62%), Gaps = 2/119 (2%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            +N+ +A RGL PL+  L  R P +D V DLV  G+ ++       +EFL FD+DRVLR G
Sbjct  256  YNEAVALRGLVPLHVPLQQRLPVFDGVVDLVRCGHAVNRWIPVTAMEFLFFDVDRVLRGG  315

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSG--KPEVYLSAVLQKPV  266
            G FWLD+F+    D +K    LI +  YKK+KW V  K + SG    EVYL+A+LQKPV
Sbjct  316  GYFWLDHFFSKKVDLEKVFMPLIGKLVYKKVKWAVANKTDSSGLKNGEVYLTALLQKPV  374



>ref|XP_010243696.1| PREDICTED: uncharacterized protein LOC104587687 [Nelumbo nucifera]
Length=374

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 75/119 (63%), Gaps = 2/119 (2%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            +++  A RGL PL+  L  RFP +D V DLV  G+ ++       +EFL +D+DRVLR G
Sbjct  254  YSEVTALRGLIPLHVPLQQRFPIFDGVVDLVRCGHAVNRWIPITSMEFLFYDVDRVLRGG  313

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSG--KPEVYLSAVLQKPV  266
            G  WLD+F+    D +K    LI + GYKK+KW +G K + SG    EVYL+A+LQKP+
Sbjct  314  GYIWLDHFFSKGIDLEKVYAPLIGKLGYKKVKWAIGNKTDASGLKNGEVYLTALLQKPL  372



>ref|XP_007147539.1| hypothetical protein PHAVU_006G133100g [Phaseolus vulgaris]
 gb|ESW19533.1| hypothetical protein PHAVU_006G133100g [Phaseolus vulgaris]
Length=440

 Score =   111 bits (277),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 82/119 (69%), Gaps = 3/119 (3%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEK-LEFLMFDMDRVLRA  440
            FN+ IA+RGL P++ SL  RFPF+DN  D+VH  + L  N  P+  LEF++FD+ RVLR 
Sbjct  322  FNNIIASRGLVPMHISLSQRFPFFDNTLDIVHSMDVLS-NWIPDTMLEFVLFDIYRVLRP  380

Query  439  GGLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK-NNGSGKPEVYLSAVLQKPV  266
            GGLFWLD+F+C +    K    +++R G+ +L+W VG K + G  K  +Y+S++++KP+
Sbjct  381  GGLFWLDHFFCFASQLNKTYVPMLDRIGFNRLRWHVGTKLDGGVHKNVLYISSLMEKPM  439



>ref|XP_006843184.1| hypothetical protein AMTR_s00146p00079960 [Amborella trichopoda]
 gb|ERN04859.1| hypothetical protein AMTR_s00146p00079960 [Amborella trichopoda]
Length=292

 Score =   110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 58/118 (49%), Positives = 77/118 (65%), Gaps = 2/118 (2%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            FN+ IA RGL PLY SL+ R PF+DN  D++H    LD     + L+F++FD DRVLR G
Sbjct  175  FNEMIALRGLVPLYLSLNQRLPFFDNTLDIIHTTRFLDGWIDFQLLDFVLFDWDRVLRPG  234

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVR  263
            GL W+D+F+CS  D    L  + E+F YKK +W+V  K +  G  EV+ SAVL+KP R
Sbjct  235  GLLWIDSFFCSRGDLNDYL-HMFEQFRYKKHRWLVVPKVDKEGD-EVFFSAVLEKPPR  290



>ref|XP_004293665.1| PREDICTED: uncharacterized protein LOC101310870 [Fragaria vesca 
subsp. vesca]
Length=365

 Score =   110 bits (276),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 73/116 (63%), Gaps = 2/116 (2%)
 Frame = -2

Query  613  NDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAGG  434
            N+ +A RGL PL+  L  RFP +D V DLV  G+ ++       LEFL++D DRVLR GG
Sbjct  250  NEAVALRGLVPLHVPLQQRFPVFDGVLDLVRCGHAVNRWIPVTALEFLLYDADRVLRVGG  309

Query  433  LFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPV  266
              WLD+F+    D +K    LI + GY+++KW    KN  +G  EVYL+A+LQKPV
Sbjct  310  YLWLDHFFSKGVDLEKVFGPLIGKLGYRRVKWATASKNEKNG--EVYLTALLQKPV  363



>ref|XP_006855507.1| hypothetical protein AMTR_s00057p00202850 [Amborella trichopoda]
 gb|ERN16974.1| hypothetical protein AMTR_s00057p00202850 [Amborella trichopoda]
Length=469

 Score =   111 bits (277),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 56/119 (47%), Positives = 77/119 (65%), Gaps = 5/119 (4%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            FN+ IA RGL PLY +L+ R PF+DN  DL+H    LD     + ++F++FD DRVLR G
Sbjct  355  FNEIIALRGLVPLYVTLNQRLPFFDNTMDLIHTSGFLDGWIDLQLMDFILFDWDRVLRPG  414

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVRA  260
            GL W+D F+CS  D    +   ++ F YKK KW++  K+    K EVYLSA+L+KP R+
Sbjct  415  GLLWIDRFFCSRKDLDDYMYMFLQ-FRYKKHKWIISVKS----KEEVYLSALLEKPPRS  468



>ref|XP_010936580.1| PREDICTED: uncharacterized protein LOC105056176 [Elaeis guineensis]
Length=463

 Score =   110 bits (275),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 58/119 (49%), Positives = 77/119 (65%), Gaps = 5/119 (4%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            F++ IA RGL PLY +L  R PF+DN  DL+H    LD     + L+F++FD DRVLR G
Sbjct  349  FSEMIALRGLIPLYTTLSQRLPFFDNTLDLIHTSVFLDGWIDLQLLDFVLFDWDRVLRPG  408

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVRA  260
            GL W+D F+C   D    +  + ++FGYKK KWVV  K+    K EVYLSA+L+KP R+
Sbjct  409  GLLWVDKFFCIRKDLDDYMY-MFQQFGYKKHKWVVSFKS----KEEVYLSALLEKPPRS  462



>ref|XP_002316738.2| hypothetical protein POPTR_0011s02820g [Populus trichocarpa]
 gb|EEE97350.2| hypothetical protein POPTR_0011s02820g [Populus trichocarpa]
Length=375

 Score =   109 bits (273),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 55/118 (47%), Positives = 72/118 (61%), Gaps = 2/118 (2%)
 Frame = -2

Query  613  NDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAGG  434
            N+ +A RGL PL+  L HR P +D V DLV  G+ ++       +EFL +D+DRVLR GG
Sbjct  258  NEVVAMRGLVPLHVPLQHRLPVFDGVVDLVRCGHAVNRWMPLTMMEFLFYDVDRVLRGGG  317

Query  433  LFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSG--KPEVYLSAVLQKPV  266
              W D+F+    D  K    LI + GYKK+KW VG K +  G    EVYL+A+LQKPV
Sbjct  318  YLWFDHFFSKRVDLDKVFGPLIGKLGYKKVKWAVGNKTDSGGLKNGEVYLTALLQKPV  375



>gb|EYU28174.1| hypothetical protein MIMGU_mgv1a008347mg [Erythranthe guttata]
Length=376

 Score =   109 bits (273),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 75/119 (63%), Gaps = 2/119 (2%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            +N+ +A RGL PL+  L  R P +D V DLV  G+ ++       +EFL+FD+DRVLR G
Sbjct  256  YNEAVAIRGLVPLHAPLQQRLPVFDGVVDLVRCGHAVNRWIPVVAMEFLLFDVDRVLRGG  315

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSG--KPEVYLSAVLQKPV  266
            G   LD+F+    D +K  T LI + GYKK+KW V  K + SG    EVYL+A+LQKP+
Sbjct  316  GYLLLDHFFSKKMDLEKVFTPLIGKLGYKKVKWAVANKTDSSGVKNGEVYLTALLQKPL  374



>ref|XP_009787217.1| PREDICTED: uncharacterized protein LOC104235198 [Nicotiana sylvestris]
Length=373

 Score =   109 bits (273),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 74/119 (62%), Gaps = 2/119 (2%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            +++ +A RGL PL+  L  R P +D V DLV  G+ ++       +EFL FD+DRVLR G
Sbjct  253  YSETVALRGLLPLHVPLQQRLPVFDGVVDLVRCGHAVNRWIPLTMMEFLFFDVDRVLRGG  312

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSG--KPEVYLSAVLQKPV  266
            G  WLD+F+    D +K    LI +  Y+K+KW V  KN+ SG    EVYL+A+LQKPV
Sbjct  313  GYLWLDHFFSKKADLEKVFQPLIWKLNYRKVKWAVANKNDASGVKNGEVYLTALLQKPV  371



>gb|KJB26416.1| hypothetical protein B456_004G240200 [Gossypium raimondii]
Length=454

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 56/119 (47%), Positives = 77/119 (65%), Gaps = 5/119 (4%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            FN+ IA RGL PLY +L+ R PF+DN  DL+H    LD       ++F++FD DRVLR G
Sbjct  340  FNEIIALRGLIPLYATLNQRLPFFDNTMDLIHTTGFLDGWIDLLLMDFIIFDWDRVLRPG  399

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVRA  260
            GL W+D F+C+  D +   T + ++  YKK KWV+  K+    + +VYLSAVL+KP RA
Sbjct  400  GLLWIDRFFCNKKDMED-YTYMFQQLRYKKHKWVIAPKS----QHQVYLSAVLEKPPRA  453



>ref|XP_004135617.1| PREDICTED: uncharacterized protein LOC101207467 [Cucumis sativus]
 ref|XP_004157250.1| PREDICTED: uncharacterized LOC101207467 [Cucumis sativus]
Length=473

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 57/119 (48%), Positives = 75/119 (63%), Gaps = 5/119 (4%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            FN+FIA RGLFPLY +L+ R P +DN  DL+H    +D       L+F++FD DRVLR G
Sbjct  359  FNEFIALRGLFPLYLTLNQRLPLFDNTMDLIHTTGFMDGWLDMLLLDFILFDWDRVLRPG  418

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVRA  260
            GL W+D F+C   D    +   ++ F YKK KW +  K+    K EVYLSA+L+KP RA
Sbjct  419  GLLWIDRFFCDRKDLDDYMYMFLQ-FRYKKHKWSIAPKS----KNEVYLSALLEKPPRA  472



>gb|KJB67513.1| hypothetical protein B456_010G194500 [Gossypium raimondii]
Length=449

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 79/119 (66%), Gaps = 3/119 (3%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEK-LEFLMFDMDRVLRA  440
            FN FIA+RGL P++ S+  R PF++N  D+VH  + L  N  P+  LEF ++D+ RVLR 
Sbjct  331  FNSFIASRGLIPIHVSISQRLPFFENTLDIVHSMHILS-NWIPDAMLEFALYDIYRVLRP  389

Query  439  GGLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK-NNGSGKPEVYLSAVLQKPV  266
            GGLFWLD+F+C      +    + +R G+ KL+W VG+K + G  K E YLSA+L+KP+
Sbjct  390  GGLFWLDHFFCQGSQLNQTYAPMFDRIGFTKLRWNVGKKVDRGVDKNEWYLSALLEKPM  448



>ref|XP_009392585.1| PREDICTED: uncharacterized protein LOC103978498 [Musa acuminata 
subsp. malaccensis]
Length=441

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 73/118 (62%), Gaps = 1/118 (1%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            FN FIA+RGL P++ S+ HR PF+D   D+VH  + L        LEF ++D+ RVLR G
Sbjct  323  FNSFIASRGLVPMHVSVAHRLPFFDGTLDIVHSMHVLSNWISDTVLEFALYDIYRVLRPG  382

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK-NNGSGKPEVYLSAVLQKPV  266
            GLFWLD+F+C+          ++   G+ KL+W  G K + G  K E YLSA+L+KP+
Sbjct  383  GLFWLDHFFCAGTQLNSTYVPMLRHVGFNKLRWTAGRKLDRGMAKDEWYLSALLEKPM  440



>ref|XP_008383518.1| PREDICTED: uncharacterized protein LOC103446217 [Malus domestica]
Length=487

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/118 (47%), Positives = 71/118 (60%), Gaps = 2/118 (2%)
 Frame = -2

Query  613  NDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAGG  434
            N+ +A RGL P++  L  R P +D V DLV  G+ ++       LEFL+FD DRVLR GG
Sbjct  368  NEAVALRGLVPIHAPLQQRLPMFDGVVDLVRCGHAVNRWIPATALEFLLFDADRVLRGGG  427

Query  433  LFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSG--KPEVYLSAVLQKPV  266
              WLD F+    D +K    LI + GY+K+KW    KN+  G    EVYLSA+LQKPV
Sbjct  428  YLWLDKFFSKGVDLEKVFGPLIGKLGYRKVKWATANKNDSGGIKNGEVYLSALLQKPV  485



>ref|XP_010934108.1| PREDICTED: uncharacterized protein LOC105054309 [Elaeis guineensis]
Length=360

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 71/119 (60%), Gaps = 2/119 (2%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            +++  A RG+ PL+  L  RFP  D V DLV  G+ ++       LEFL++D DRVLR G
Sbjct  238  YSEAAALRGVVPLHAPLQQRFPVQDGVLDLVRTGHAVNRWIPAPALEFLLYDADRVLRTG  297

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKP--EVYLSAVLQKPV  266
            G  W+D+F+C   D       LI R GYK +KW VG K +  G    EVYL+A+LQKP+
Sbjct  298  GFLWVDHFFCKGPDLDAVYAPLIGRLGYKIIKWAVGNKTDAGGLRYGEVYLTALLQKPL  356



>ref|XP_008644572.1| PREDICTED: uncharacterized protein LOC103625944 [Zea mays]
 gb|AFW67815.1| hypothetical protein ZEAMMB73_756974 [Zea mays]
Length=407

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 78/119 (66%), Gaps = 2/119 (2%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            F+ F+AARG+ PLY S+  R PF+DN  D+VH  + L     P  L+F +FD+ RVLR G
Sbjct  280  FSSFVAARGVVPLYVSVAARLPFFDNTLDIVHSMHVLSGWIPPVALQFALFDVYRVLRPG  339

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK-NNGSGKPEVYLSAVLQKPVR  263
            G+FWLD+F+C  + +      ++E  G+ KL+WV G K + G  + E+YLSA+L KP++
Sbjct  340  GMFWLDHFFC-GEAEMATYVGVVESIGFGKLRWVTGRKLDRGPDRKEMYLSALLDKPLK  397



>ref|XP_008225360.1| PREDICTED: uncharacterized protein LOC103325018 [Prunus mume]
Length=373

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/118 (47%), Positives = 71/118 (60%), Gaps = 2/118 (2%)
 Frame = -2

Query  613  NDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAGG  434
            N+ +A RGL P++  L  R P +D V DLV  G+ ++       LEFL+FD DRVLR GG
Sbjct  254  NEAVALRGLVPIHAPLQQRLPVFDGVVDLVRCGHAVNRWIPVTALEFLLFDADRVLRGGG  313

Query  433  LFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSG--KPEVYLSAVLQKPV  266
              WLD+F+    D  K    LI + GY+K+KW    KN+  G    EVYLSA+LQKPV
Sbjct  314  YLWLDHFFSKEADLDKIFGPLIGKLGYRKVKWATASKNDSGGLKNGEVYLSALLQKPV  371



>ref|XP_002519380.1| ATRAD3, putative [Ricinus communis]
 gb|EEF42997.1| ATRAD3, putative [Ricinus communis]
Length=449

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 80/119 (67%), Gaps = 3/119 (3%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEK-LEFLMFDMDRVLRA  440
            FN FIA+RGL P++ S+  R PF++N  D+VH  + L  N  P+  LEF ++D+ RVLR 
Sbjct  331  FNSFIASRGLIPIHVSVSQRLPFFENTLDIVHSMHVLS-NWIPDAMLEFTLYDIYRVLRP  389

Query  439  GGLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK-NNGSGKPEVYLSAVLQKPV  266
            GGLFWLD+F+C+     +  T +++  G+KKL+W  G+K + G  K E Y SA+L+KP+
Sbjct  390  GGLFWLDHFFCTGSQLNETYTPMLDSVGFKKLRWNAGKKLDRGIHKNEWYFSALLEKPM  448



>emb|CDP15495.1| unnamed protein product [Coffea canephora]
Length=468

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 76/119 (64%), Gaps = 5/119 (4%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            FN+ IA RGL PLY +L+ R PF+DN  DL+H    +D     + L+F++FD DR+LR G
Sbjct  354  FNEMIALRGLVPLYVTLNQRLPFFDNTLDLIHTTGFMDGWIDLQLLDFILFDWDRILRPG  413

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVRA  260
            GL W+D F+C+  D    +   ++ F YKK KW +  K+    K EVYLSA+L+KP RA
Sbjct  414  GLLWIDRFFCNRKDLDDYMYMFLQ-FRYKKHKWAISPKS----KDEVYLSALLEKPPRA  467



>ref|XP_009360845.1| PREDICTED: uncharacterized protein LOC103951245 [Pyrus x bretschneideri]
Length=374

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/118 (47%), Positives = 71/118 (60%), Gaps = 2/118 (2%)
 Frame = -2

Query  613  NDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAGG  434
            N+ +A RGL P++  L  R P +D V DLV  G+ ++       LEFL+FD DRVLR GG
Sbjct  255  NEAVALRGLVPIHAPLQQRLPVFDGVVDLVRCGHAVNRWIPVTALEFLLFDADRVLRGGG  314

Query  433  LFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSG--KPEVYLSAVLQKPV  266
              WLD F+    D +K    LI + GY+K+KW    KN+  G    EVYLSA+LQKPV
Sbjct  315  YLWLDKFFSKGVDLEKVFGPLIGKLGYRKVKWATANKNDSGGIKNGEVYLSALLQKPV  372



>ref|XP_009382936.1| PREDICTED: uncharacterized protein LOC103970749 [Musa acuminata 
subsp. malaccensis]
Length=437

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/119 (47%), Positives = 78/119 (66%), Gaps = 3/119 (3%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPE-KLEFLMFDMDRVLRA  440
            FN+FIA+RGL PL+ S+ HR PFYD+  D+VH  + L  N  P+  LEF +FD+ RVLR 
Sbjct  319  FNNFIASRGLVPLHISVAHRLPFYDSTLDIVHSMHVLS-NWIPDVMLEFALFDIYRVLRP  377

Query  439  GGLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK-NNGSGKPEVYLSAVLQKPV  266
            GGLFWLD+F+C           + +R G+++L+W  G K + G  K E Y+SA+L KP+
Sbjct  378  GGLFWLDHFFCHGKQLNSTYVPMFQRIGFRRLRWHAGRKLDRGFEKDEWYVSALLGKPL  436



>ref|XP_011468973.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101302880 
[Fragaria vesca subsp. vesca]
Length=689

 Score =   111 bits (277),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 55/118 (47%), Positives = 73/118 (62%), Gaps = 1/118 (1%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            FN+ IA RGL PLY +++ R PF+DN  DL+H    LD       L+F++FD DRVLR G
Sbjct  570  FNEMIALRGLVPLYLTINQRLPFFDNTLDLIHTTRFLDGWIDFVLLDFVLFDWDRVLRPG  629

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVR  263
            GL W+D+F+C  +D    L  L +   YKK KWV+  K +     EV+ SAVL+KP R
Sbjct  630  GLLWIDSFFCVKEDLNDYLESL-KMLRYKKHKWVIVPKIDKDDDKEVFFSAVLEKPPR  686



>ref|XP_009353828.1| PREDICTED: uncharacterized protein LOC103945052 [Pyrus x bretschneideri]
Length=374

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/118 (47%), Positives = 71/118 (60%), Gaps = 2/118 (2%)
 Frame = -2

Query  613  NDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAGG  434
            N+ +A RGL P++  L  R P +D V DLV  G+ ++       LEFL+FD DRVLR GG
Sbjct  255  NEAVALRGLVPIHAPLQQRLPVFDGVVDLVRCGHAVNRWIPVTALEFLLFDADRVLRGGG  314

Query  433  LFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSG--KPEVYLSAVLQKPV  266
              WLD F+    D +K    LI + GY+K+KW    KN+  G    EVYLSA+LQKPV
Sbjct  315  YLWLDKFFSKGVDLEKVFGPLIGKLGYRKVKWATANKNDSGGIKNGEVYLSALLQKPV  372



>gb|KDP21207.1| hypothetical protein JCGZ_21678 [Jatropha curcas]
Length=371

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/118 (47%), Positives = 72/118 (61%), Gaps = 2/118 (2%)
 Frame = -2

Query  613  NDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAGG  434
            N+ +A RGL PL+  L  R P +D V DLV  G  ++     E +EFL++D+DRVLRAGG
Sbjct  252  NEVVAMRGLVPLHVPLQQRLPVFDGVVDLVRCGRAVNRWIPLEIMEFLLYDVDRVLRAGG  311

Query  433  LFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSG--KPEVYLSAVLQKPV  266
              WLD+F+    D  K    LI +  YKK+KW V  K +  G    EVYL+A+LQKPV
Sbjct  312  YLWLDHFFSKGVDLDKVYKPLIGKLNYKKVKWAVANKTDSGGLKNGEVYLTALLQKPV  369



>ref|XP_008450643.1| PREDICTED: uncharacterized protein LOC103492170 [Cucumis melo]
Length=473

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/119 (48%), Positives = 74/119 (62%), Gaps = 5/119 (4%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            FN+FIA RGLFPLY +L+ R P +DN  DL+H    +D       L+F++FD DRVLR G
Sbjct  359  FNEFIALRGLFPLYSTLNQRLPLFDNTMDLIHTSGFMDGWLDMLLLDFILFDWDRVLRPG  418

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVRA  260
            GL W+D F+C   D    +   ++ F YKK KW +  K     K EVYLSA+L+KP RA
Sbjct  419  GLLWIDRFFCDRKDLDDYMYMFLQ-FRYKKHKWSIAPK----SKNEVYLSALLEKPPRA  472



>ref|XP_003594435.1| hypothetical protein MTR_2g028590 [Medicago truncatula]
 gb|AES64686.1| ATRAD3, putative [Medicago truncatula]
Length=464

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 81/119 (68%), Gaps = 3/119 (3%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKL-EFLMFDMDRVLRA  440
            FN+ IA+RGL  +Y S+  RFPF+DN  D+VH  + +  N  P+ + EF+++D+ RVLR 
Sbjct  346  FNNMIASRGLISMYISISQRFPFFDNTLDIVHSRDVIG-NWMPDTMVEFVLYDIYRVLRP  404

Query  439  GGLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEV-YLSAVLQKPV  266
            GGLFWLD+F+C +   KK    +++R G+ KL+W VG K +   +  V Y+SA+L+KP+
Sbjct  405  GGLFWLDHFFCFASQIKKTYVPMLDRVGFHKLRWHVGMKVDSVVQKNVWYISALLEKPM  463



>ref|XP_003574397.1| PREDICTED: uncharacterized protein LOC100841753 [Brachypodium 
distachyon]
Length=393

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 73/120 (61%), Gaps = 4/120 (3%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            +++  AARG+ PL+  L HRFP  D   DLV  G+ ++       +EFL +D DRVLRAG
Sbjct  273  YSEAAAARGVVPLHAPLQHRFPVGDGTMDLVRTGHAVNRWIPEPAMEFLWYDADRVLRAG  332

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPE----VYLSAVLQKP  269
            GL W+D+F+C   D       ++ R GYK +KW V +K++  G  +    VYL+A+LQKP
Sbjct  333  GLLWVDHFWCRKGDLDAVYGAMLRRLGYKTIKWAVADKSSRGGNAKDHDLVYLTALLQKP  392



>ref|XP_009396835.1| PREDICTED: uncharacterized protein LOC103981816 [Musa acuminata 
subsp. malaccensis]
Length=385

 Score =   108 bits (269),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 73/121 (60%), Gaps = 2/121 (2%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            +++  A RG+ PL+  L  RFP  D V DLV  G+ ++       LEFL++D DRVLR G
Sbjct  255  YSEAAALRGVVPLHAPLQQRFPVQDGVLDLVRTGHAVNRWIPGPALEFLLYDADRVLRPG  314

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSG--KPEVYLSAVLQKPVR  263
            GL W+D+F+C + D       +I   GY+++KW V  K +  G    EVYL+A+LQKP+ 
Sbjct  315  GLLWIDHFFCRAGDLDAVYVPMIGHLGYRRIKWTVANKTDAGGLKNGEVYLTALLQKPLL  374

Query  262  A  260
            A
Sbjct  375  A  375



>ref|XP_004983526.1| PREDICTED: uncharacterized protein LOC101758913 [Setaria italica]
Length=405

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 73/120 (61%), Gaps = 4/120 (3%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            +++  AARG+ PL+  L  RFP  D   D+V  G+ ++       LEFL +D DR LR G
Sbjct  284  YSEAAAARGVVPLHAPLQQRFPVGDGTMDVVRAGHAVNRWIPEAALEFLWYDADRALRPG  343

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKN----NGSGKPEVYLSAVLQKP  269
            GL W+D+F+C  +D +     ++ R GYK +KW V +K+      SGK EVYL+A+LQKP
Sbjct  344  GLLWVDHFWCRRNDLEGVYAAMLRRLGYKTIKWAVADKSVAGGGNSGKDEVYLTALLQKP  403



>ref|XP_009784071.1| PREDICTED: uncharacterized protein LOC104232543 [Nicotiana sylvestris]
Length=467

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 76/119 (64%), Gaps = 5/119 (4%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            F++ IA RGL PLY +L+ R PF+DN  DL+H    +D     + L+F++FD DRVLR G
Sbjct  353  FSETIALRGLIPLYVTLNQRLPFFDNTMDLIHTSGLMDGWIDLQLLDFILFDWDRVLRPG  412

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVRA  260
            GL W+D F+C+  D    +   ++ F YKK KW +  K+N     EVYLSA+L+KP RA
Sbjct  413  GLLWIDRFFCNRKDLDDYMYMFLQ-FRYKKHKWAISPKSND----EVYLSALLEKPPRA  466



>ref|XP_007030960.1| Methyltransferase, putative [Theobroma cacao]
 gb|EOY11462.1| Methyltransferase, putative [Theobroma cacao]
Length=471

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 57/119 (48%), Positives = 76/119 (64%), Gaps = 5/119 (4%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            FN+ IA RGL PLY +L+ R PF+DN  DL+H    LD       ++F+++D DRVLR G
Sbjct  357  FNEIIALRGLIPLYATLNQRLPFFDNTMDLIHTTGFLDGWIDLLLMDFILYDWDRVLRPG  416

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVRA  260
            GL W+D F+C+  D    +   ++ F YKK KWV+  K+    K EVYLSAVL+KP RA
Sbjct  417  GLLWIDRFFCNKKDLDDYMYMFLQ-FRYKKHKWVLAPKS----KDEVYLSAVLEKPPRA  470



>gb|KJB69768.1| hypothetical protein B456_011G041200 [Gossypium raimondii]
 gb|KJB69769.1| hypothetical protein B456_011G041200 [Gossypium raimondii]
Length=374

 Score =   107 bits (268),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 73/119 (61%), Gaps = 2/119 (2%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            +N+ +A RGL PL+  L  RFP +D   DLV  G  ++       +EF+ +D+DRVLR G
Sbjct  253  YNEAVALRGLVPLHVPLQQRFPVFDGTMDLVRCGRAVNRWIPLSVMEFMFYDVDRVLRGG  312

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSG--KPEVYLSAVLQKPV  266
            G  W+D F+  + D +K    LI + GYKK+KW V  K + SG    EVYLSA+LQKPV
Sbjct  313  GYLWVDRFFSKAVDLEKIYGPLIGKLGYKKVKWAVANKTDPSGLKHGEVYLSALLQKPV  371



>ref|XP_009614046.1| PREDICTED: uncharacterized protein LOC104107050 [Nicotiana tomentosiformis]
Length=373

 Score =   107 bits (268),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 53/118 (45%), Positives = 73/118 (62%), Gaps = 2/118 (2%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            +++ +A RGL PL+  L  R P +D V DLV  G+ ++       +EFL FD+DRVLR G
Sbjct  253  YSETVALRGLVPLHVPLQQRLPVFDGVVDLVRCGHAVNRWIPLTMMEFLFFDVDRVLRGG  312

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSG--KPEVYLSAVLQKP  269
            G  WLD+F+    D +K    LI +  Y+K+KW V  KN+ SG    EVYL+A+LQKP
Sbjct  313  GYLWLDHFFSKKADLEKVFQPLIWKLNYRKVKWAVANKNDASGVKNGEVYLTALLQKP  370



>ref|XP_010907546.1| PREDICTED: uncharacterized protein LOC105034191 [Elaeis guineensis]
Length=440

 Score =   108 bits (269),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 78/119 (66%), Gaps = 3/119 (3%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPE-KLEFLMFDMDRVLRA  440
            FN+FIA+RGL P++ S+ HR PF+DN  D+VH  + L  N  P+  LEF ++D+ RVLR 
Sbjct  322  FNNFIASRGLLPVHISIAHRLPFFDNTLDIVHSMHVLS-NWIPDIVLEFALYDIYRVLRP  380

Query  439  GGLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK-NNGSGKPEVYLSAVLQKPV  266
            GGLFWLD+F+C           + +R G+ KL+W  G K + G  + E YLSA+L+KP+
Sbjct  381  GGLFWLDHFFCLRTQLNATYVPMFDRIGFNKLRWNAGRKLDRGIQRNEWYLSALLEKPM  439



>ref|XP_006586814.1| PREDICTED: uncharacterized protein LOC102664598 [Glycine max]
Length=441

 Score =   108 bits (269),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 80/119 (67%), Gaps = 3/119 (3%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEK-LEFLMFDMDRVLRA  440
            FN+ IA+RGL P++ S+  RFPF+DN  D+VH  + L  N  P+  LEF+++D+ RVLR 
Sbjct  323  FNNLIASRGLVPMHISISRRFPFFDNTLDIVHSMDVLS-NWIPDTMLEFVLYDVYRVLRP  381

Query  439  GGLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK-NNGSGKPEVYLSAVLQKPV  266
            GGLFWLD+F+C      K    +++R G+ +L+W V  K N G  K  +Y+SA+++KP+
Sbjct  382  GGLFWLDHFFCFGSQLNKTYVPILDRIGFNRLRWHVETKLNRGVHKNVLYISALMEKPM  440



>gb|KHN40740.1| Putative methyltransferase PMT15 [Glycine soja]
Length=441

 Score =   107 bits (268),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 80/119 (67%), Gaps = 3/119 (3%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEK-LEFLMFDMDRVLRA  440
            FN+ IA+RGL P++ S+  RFPF+DN  D+VH  + L  N  P+  LEF+++D+ RVLR 
Sbjct  323  FNNLIASRGLVPMHISISRRFPFFDNTLDIVHSMDVLS-NWIPDTMLEFVLYDVYRVLRP  381

Query  439  GGLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK-NNGSGKPEVYLSAVLQKPV  266
            GGLFWLD+F+C      K    +++R G+ +L+W V  K N G  K  +Y+SA+++KP+
Sbjct  382  GGLFWLDHFFCFGSQLNKTYVPILDRIGFNRLRWHVETKLNRGVHKNVLYISALMEKPM  440



>ref|XP_010056869.1| PREDICTED: uncharacterized protein LOC104444812 [Eucalyptus grandis]
 gb|KCW73762.1| hypothetical protein EUGRSUZ_E02364 [Eucalyptus grandis]
Length=376

 Score =   107 bits (267),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 72/119 (61%), Gaps = 2/119 (2%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            +N+  A RGL PL+  L  R P +D V DLV  G+ ++       LEF++FD+DRVLR G
Sbjct  256  YNEAAALRGLVPLHVPLQQRLPVFDGVVDLVRCGHAVNRWIPETVLEFMLFDIDRVLRGG  315

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSG--KPEVYLSAVLQKPV  266
            G  WLD+F+      +K    LI + GYKK+KW    K + SG    EVYL+A+LQKPV
Sbjct  316  GYLWLDHFFGKGVSMEKVYKPLIGKLGYKKVKWATANKTDSSGLKNGEVYLTALLQKPV  374



>ref|XP_006470793.1| PREDICTED: uncharacterized protein LOC102607511 [Citrus sinensis]
Length=451

 Score =   108 bits (269),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 78/119 (66%), Gaps = 3/119 (3%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEK-LEFLMFDMDRVLRA  440
            FN FIA+RGL P++ S+  R PF++N  D+VH  + L  N  P+  LEF ++D+ R+LR 
Sbjct  333  FNSFIASRGLIPMHISVSQRLPFFENTLDIVHSMHVLS-NWIPDSMLEFTLYDIYRLLRP  391

Query  439  GGLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK-NNGSGKPEVYLSAVLQKPV  266
            GG+FWLD F+C      +    +++R G+KKL+W VG K + G  K E Y SAVL+KP+
Sbjct  392  GGIFWLDRFFCFGSQLNETYVPMLDRIGFKKLRWNVGMKLDRGVNKNEWYFSAVLEKPM  450



>ref|XP_007023112.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
 gb|EOY25734.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
Length=314

 Score =   107 bits (266),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 54/118 (46%), Positives = 76/118 (64%), Gaps = 3/118 (3%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEK-LEFLMFDMDRVLRA  440
            FN FIA+RGL P++ S+  R PF+DN  D+VH  + L  N  P+  LE  ++D+ RVLR 
Sbjct  196  FNSFIASRGLIPIHVSVSQRLPFFDNTLDIVHSMHVLS-NWIPDAMLELTLYDIYRVLRP  254

Query  439  GGLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK-NNGSGKPEVYLSAVLQKP  269
            GGLFWLD+F+C      +    ++ R G+KKL+W  G+K + G  K E Y SA+L+KP
Sbjct  255  GGLFWLDHFFCQGSQLNQTYVPMLGRIGFKKLRWNSGKKLDRGVDKNEWYFSALLEKP  312



>ref|XP_006433384.1| hypothetical protein CICLE_v10003882mg [Citrus clementina]
 ref|XP_006472058.1| PREDICTED: uncharacterized protein LOC102629548 [Citrus sinensis]
 gb|ESR46624.1| hypothetical protein CICLE_v10003882mg [Citrus clementina]
Length=467

 Score =   107 bits (268),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 75/119 (63%), Gaps = 5/119 (4%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            FN+ IA RGL PLY +L+ R PF+DN  DL+H    +D       L+F++FD DR+LR G
Sbjct  353  FNEMIALRGLIPLYVTLNQRLPFFDNTMDLIHTTGFMDGWLDMLLLDFILFDWDRILRPG  412

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVRA  260
            GL W+D F+C+  D    +   ++ F YKK KW +  K+    K EVYLSA+L+KP RA
Sbjct  413  GLLWIDRFFCNKKDLDDYMYMFLQ-FRYKKHKWAISPKS----KDEVYLSALLEKPPRA  466



>ref|XP_007211455.1| hypothetical protein PRUPE_ppa007323mg [Prunus persica]
 gb|EMJ12654.1| hypothetical protein PRUPE_ppa007323mg [Prunus persica]
Length=373

 Score =   107 bits (266),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 54/118 (46%), Positives = 70/118 (59%), Gaps = 2/118 (2%)
 Frame = -2

Query  613  NDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAGG  434
            N+ +A RGL P++  L  R P +D V DLV  G+ ++       LEFL+FD DRVLR GG
Sbjct  254  NEAVALRGLVPIHAPLQQRLPVFDGVVDLVRCGHAVNRWIPVTALEFLLFDADRVLRGGG  313

Query  433  LFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSG--KPEVYLSAVLQKPV  266
              WLD+F+    D  K    L  + GY+K+KW    KN+  G    EVYLSA+LQKPV
Sbjct  314  YLWLDHFFSKEADLDKVFGPLFGKLGYRKVKWATASKNDSGGLKNGEVYLSALLQKPV  371



>gb|KDP23499.1| hypothetical protein JCGZ_23332 [Jatropha curcas]
Length=451

 Score =   107 bits (267),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 76/119 (64%), Gaps = 5/119 (4%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            F++ IA RGL PLY +L+ R PF+DN  DL+H    +D       ++F++FD DR+LR G
Sbjct  337  FSEMIALRGLIPLYVTLNQRLPFFDNTMDLIHTTGFMDGWIDLLLMDFILFDWDRILRPG  396

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVRA  260
            GL W+D F+C+  D    L   ++ F YKK KWV+  K+    K EVYLSA+L+KP RA
Sbjct  397  GLLWIDRFFCNRKDLDDYLYMFLQ-FRYKKHKWVISPKS----KDEVYLSALLEKPPRA  450



>gb|KDO56273.1| hypothetical protein CISIN_1g012235mg [Citrus sinensis]
Length=467

 Score =   107 bits (268),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 75/119 (63%), Gaps = 5/119 (4%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            FN+ IA RGL PLY +L+ R PF+DN  DL+H    +D       L+F++FD DR+LR G
Sbjct  353  FNEMIALRGLIPLYVTLNQRLPFFDNTMDLIHTTGFMDGWLDMLLLDFILFDWDRILRPG  412

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVRA  260
            GL W+D F+C+  D    +   ++ F YKK KW +  K+    K EVYLSA+L+KP RA
Sbjct  413  GLLWIDRFFCNKKDLDDYMYMFLQ-FRYKKHKWAISPKS----KDEVYLSALLEKPPRA  466



>ref|XP_011045306.1| PREDICTED: uncharacterized protein LOC105140252 [Populus euphratica]
 ref|XP_011045307.1| PREDICTED: uncharacterized protein LOC105140252 [Populus euphratica]
Length=374

 Score =   107 bits (266),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 70/117 (60%), Gaps = 2/117 (2%)
 Frame = -2

Query  613  NDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAGG  434
            N+ +A RGL PL+  L HR P +D V DLV  G  ++       +EFL +D+DRVLR GG
Sbjct  257  NEVVAMRGLVPLHVPLQHRLPVFDGVVDLVRCGRAVNRWMPLTIMEFLFYDVDRVLRGGG  316

Query  433  LFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSG--KPEVYLSAVLQKP  269
              W D+F+    D  K    LI + GYKK+KW VG K + S     EVYL+A+LQKP
Sbjct  317  YLWFDHFFSKRVDLDKVFGPLIGKLGYKKVKWAVGNKTDSSSLKNGEVYLTALLQKP  373



>ref|XP_004986277.1| PREDICTED: uncharacterized protein LOC101771363 [Setaria italica]
Length=429

 Score =   107 bits (267),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 78/119 (66%), Gaps = 2/119 (2%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            F+   AARG+ PLY S+  R PF+DN  D+VH  + L     P  L+F +FD+ RVLR G
Sbjct  292  FSAVAAARGVVPLYVSVAARLPFFDNTLDVVHSMHVLSGWMPPAALQFALFDVYRVLRPG  351

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK-NNGSGKPEVYLSAVLQKPVR  263
            GLFWLD+F+C  + +  A   ++E  G+ KL+WV   K + G+ + E+YLSA+L+KP++
Sbjct  352  GLFWLDHFFC-GEAEMAAYVEVVESVGFGKLRWVTRRKLDRGAERKEMYLSALLEKPLK  409



>ref|XP_010546711.1| PREDICTED: uncharacterized protein LOC104818707 [Tarenaya hassleriana]
Length=462

 Score =   107 bits (267),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 76/119 (64%), Gaps = 5/119 (4%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            FN+ IA RGL PLY SL+ R PF+DN  D++H    +D       ++F+++D DRVLR G
Sbjct  348  FNEMIALRGLIPLYASLNQRLPFFDNTMDMIHTTGLMDGWIDLLLMDFILYDWDRVLRPG  407

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVRA  260
            GL W+D F+C+  D    +   ++ F YKK KW + +K+    K EVYLSA+L+KP RA
Sbjct  408  GLLWIDRFFCNKTDLDDYMYMFLQ-FRYKKHKWAIAQKS----KDEVYLSALLEKPPRA  461



>ref|XP_008784991.1| PREDICTED: uncharacterized protein LOC103703787 [Phoenix dactylifera]
Length=472

 Score =   107 bits (268),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 57/119 (48%), Positives = 77/119 (65%), Gaps = 5/119 (4%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            F++ IA RGL PLY +L  R PF+DN  DL+H    LD     + L+F++FD DRVLR G
Sbjct  358  FSEVIALRGLIPLYATLGQRLPFFDNTMDLIHTSVFLDGWVDLQLLDFILFDWDRVLRPG  417

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVRA  260
            GL W+D F+CS  D  + +   ++ F Y+K KWVV  K+    K EVYLSA+L+KP R+
Sbjct  418  GLLWVDKFFCSRKDLDEYMYMFLQ-FRYRKHKWVVSFKS----KEEVYLSALLEKPPRS  471



>ref|XP_010930345.1| PREDICTED: uncharacterized protein LOC105051544 [Elaeis guineensis]
Length=438

 Score =   107 bits (267),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 78/119 (66%), Gaps = 3/119 (3%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPE-KLEFLMFDMDRVLRA  440
            FN+FIA+RGL P++ S+ HR PF+DN  D+VH  + L  N  P+  LEF ++D+ RVLR 
Sbjct  320  FNNFIASRGLVPIHISIAHRLPFFDNTLDIVHSMHVLS-NWVPDIMLEFALYDIYRVLRP  378

Query  439  GGLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK-NNGSGKPEVYLSAVLQKPV  266
            GGLFWLD+F+C           + +R  +KKL+W  G K + G  K E Y+SA+L+KP+
Sbjct  379  GGLFWLDHFFCIGKQLNSTYVPMFDRIRFKKLRWNAGRKLDKGIDKDEWYVSALLEKPM  437



>ref|XP_009628987.1| PREDICTED: uncharacterized protein LOC104119243 [Nicotiana tomentosiformis]
Length=467

 Score =   107 bits (267),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 76/119 (64%), Gaps = 5/119 (4%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            F++ IA RGL PLY +L+ R PF+DN  DL+H    +D     + L+F++FD DRVLR G
Sbjct  353  FSETIALRGLIPLYVTLNQRLPFFDNTMDLIHTAGLMDGWIDLQLLDFILFDWDRVLRPG  412

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVRA  260
            GL W+D F+C+  D    +   ++ F YKK KW +  K+N     EVYLSA+L+KP R+
Sbjct  413  GLLWIDRFFCNRKDLDDFMYMFLQ-FRYKKHKWAISPKSND----EVYLSALLEKPPRS  466



>ref|XP_004504712.1| PREDICTED: uncharacterized protein LOC101498967 [Cicer arietinum]
Length=390

 Score =   107 bits (266),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 51/119 (43%), Positives = 73/119 (61%), Gaps = 2/119 (2%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            +++ +A RGL PL+  L  R P +D V D+V  G  ++       +EFL+FD+DRVLR G
Sbjct  270  YSETVALRGLVPLHVPLQQRLPIFDGVVDIVRCGRAVNRWIPVTMMEFLLFDVDRVLRGG  329

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSG--KPEVYLSAVLQKPV  266
            G  WLD+F+    D +K    LI + GYKK+KW  G K +  G    E+YL+A+LQKP+
Sbjct  330  GFLWLDHFFSKGVDLEKVYAPLIGKLGYKKVKWATGNKTDAGGVKNGELYLTALLQKPL  388



>ref|XP_008781960.1| PREDICTED: uncharacterized protein LOC103701603, partial [Phoenix 
dactylifera]
Length=231

 Score =   104 bits (260),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 53/118 (45%), Positives = 78/118 (66%), Gaps = 2/118 (2%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            FN F+AARG+ PLY S+  R PF+DN  D+VH  + L        L F++FD+ RVLR G
Sbjct  111  FNSFVAARGVVPLYISISQRLPFFDNTLDIVHSMHVLSNWIPTTLLHFILFDVYRVLRPG  170

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK-NNGSGKPEVYLSAVLQKPV  266
            GLFWLD+F+   +D+ +    +IE  G++K++W VG K + G    E+Y+SA+L+KP+
Sbjct  171  GLFWLDHFFF-VEDQMEEYVPVIESVGFRKVRWEVGRKLDRGPELGEMYISALLEKPL  227



>ref|XP_008678318.1| PREDICTED: uncharacterized protein LOC103653138 [Zea mays]
 gb|AFW61396.1| hypothetical protein ZEAMMB73_416691 [Zea mays]
Length=447

 Score =   107 bits (266),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 50/117 (43%), Positives = 76/117 (65%), Gaps = 5/117 (4%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            F  F+A+RGL  L+ +  HR P +D   D+VH G+GL   G  + LEF ++D+ RVLR G
Sbjct  335  FGSFVASRGLVALHVTPAHRLPLFDGAMDIVHAGHGL---GAGDMLEFALYDVYRVLRPG  391

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPV  266
            GLFWLD+F C++      L  +++R G++KL+W  G +  G  K + Y+SA+L+KP+
Sbjct  392  GLFWLDHFVCAAMQLNATLAPMLDRVGFRKLRWNTGHR--GKEKDQWYVSALLEKPM  446



>ref|XP_002884510.1| hypothetical protein ARALYDRAFT_477828 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60769.1| hypothetical protein ARALYDRAFT_477828 [Arabidopsis lyrata subsp. 
lyrata]
Length=463

 Score =   107 bits (267),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 74/119 (62%), Gaps = 5/119 (4%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            FN+ IA RGL PLY SL+ R PF+DN  D++H    +D       ++F+++D DRVLR G
Sbjct  349  FNEMIALRGLIPLYLSLNQRLPFFDNTMDMIHTAGLMDGWIDLLLMDFVLYDWDRVLRPG  408

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVRA  260
            GL W+D F+C   D    +   ++ F YKK KW V  K+    K EVYLSA+L+KP RA
Sbjct  409  GLLWIDRFFCKKKDLDDYMYMFLQ-FRYKKHKWAVSPKS----KDEVYLSALLEKPPRA  462



>ref|XP_006836952.1| hypothetical protein AMTR_s00099p00160150 [Amborella trichopoda]
 gb|ERM99805.1| hypothetical protein AMTR_s00099p00160150 [Amborella trichopoda]
Length=453

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/118 (45%), Positives = 77/118 (65%), Gaps = 3/118 (3%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPE-KLEFLMFDMDRVLRA  440
            FN FIA+RGL PL+ ++ HR PF+    D+VH  + L  N  PE  LE +++D+ RVLR 
Sbjct  337  FNSFIASRGLVPLHLTVAHRLPFFQGTLDIVHSMHVLS-NWVPEVMLEQVLYDVYRVLRP  395

Query  439  GGLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPV  266
            GGLFW+D+F+C      +    +  R G+++L+W VG K +  G  EVYLSA+L+KP+
Sbjct  396  GGLFWVDHFFCLGPQLNRTYVPMFVRIGFRQLRWTVGRKAD-KGPHEVYLSAILEKPM  452



>ref|XP_004165527.1| PREDICTED: uncharacterized LOC101208739 isoform 1 [Cucumis sativus]
 ref|XP_004165528.1| PREDICTED: uncharacterized LOC101208739 isoform 2 [Cucumis sativus]
Length=373

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/119 (43%), Positives = 71/119 (60%), Gaps = 2/119 (2%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            +N+  A RGL PL+  L  R P +D V DLV  G+ ++     + +EFL +D+DRVLR G
Sbjct  253  YNEVAALRGLVPLHVPLQQRLPIFDGVMDLVRCGHAVNRWIPAKSMEFLFYDLDRVLRVG  312

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSG--KPEVYLSAVLQKPV  266
            G  W D+F+    D  K  + LI + GY+K+KW    K +  G    EVYL+A+LQKPV
Sbjct  313  GYLWFDHFFSKGVDLDKLYSPLITKLGYRKVKWATANKTDSGGLKNGEVYLTALLQKPV  371



>ref|XP_007205147.1| hypothetical protein PRUPE_ppa005305mg [Prunus persica]
 gb|EMJ06346.1| hypothetical protein PRUPE_ppa005305mg [Prunus persica]
Length=467

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 74/119 (62%), Gaps = 5/119 (4%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            FN+ IA RGL PLY +L+ R PF+DN+ D++H    LD     + L+F++FD DR+LR G
Sbjct  353  FNEMIALRGLIPLYLTLNQRLPFFDNIMDMIHTSGFLDGWIDLQLLDFILFDWDRILRPG  412

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVRA  260
            GL W+D F+C   D    +   ++   YKK KW +  K+    K EVY SA+L+KP RA
Sbjct  413  GLLWIDRFFCQRKDLDVFMYMFLQ-LRYKKHKWAISPKS----KDEVYFSALLEKPPRA  466



>gb|KJB66909.1| hypothetical protein B456_010G164500 [Gossypium raimondii]
Length=370

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/119 (44%), Positives = 73/119 (61%), Gaps = 2/119 (2%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            +++ +AARGL PL+  L  R P +D   DLV  G  ++       +EF+ +D+DRVLR G
Sbjct  250  YSEAVAARGLVPLHVPLQQRLPVFDGTMDLVRCGRAVNRWIPLPVMEFMFYDVDRVLRGG  309

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSG--KPEVYLSAVLQKPV  266
            G  WLD F+  + D ++    +I + GYKK+KW V  K + SG    EVYL+AVLQKPV
Sbjct  310  GYLWLDRFFSKAMDLEEVYEPMIGKLGYKKVKWAVANKTDPSGLKNGEVYLTAVLQKPV  368



>ref|XP_003524786.2| PREDICTED: uncharacterized protein LOC100785300 [Glycine max]
Length=419

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/118 (45%), Positives = 72/118 (61%), Gaps = 2/118 (2%)
 Frame = -2

Query  613  NDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAGG  434
            ++ +A RGL PL+  L  R P +D V DLV  G  ++       +EFL+ D+DRVLR GG
Sbjct  300  SEAVALRGLVPLHVPLQQRLPLFDGVVDLVRCGRAVNRWIPLTVMEFLLLDVDRVLRGGG  359

Query  433  LFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSG--KPEVYLSAVLQKPV  266
              W+D+F+    D +K    LI + GYKK+KW  G K + SG    EVYL+A+LQKPV
Sbjct  360  YLWVDHFFSKVVDLEKVYAPLIGKLGYKKVKWATGNKTDASGVKNGEVYLTALLQKPV  417



>ref|XP_004230216.1| PREDICTED: uncharacterized protein LOC101247261 [Solanum lycopersicum]
Length=470

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 75/119 (63%), Gaps = 5/119 (4%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            F++ IA RGL PLY +L+ R PF+DN  DL+H    +D     + L+F++FD DRVLR G
Sbjct  356  FSETIALRGLIPLYVTLNQRLPFFDNTMDLIHTAGFMDGWIDLQLLDFILFDWDRVLRPG  415

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVRA  260
            GL W+D F+C+  D    +   ++ F YKK KW +  K     K EVYLSA+L+KP R+
Sbjct  416  GLLWIDRFFCNRTDLDDFMYMFLQ-FRYKKHKWSIAPK----AKDEVYLSALLEKPARS  469



>ref|XP_008789125.1| PREDICTED: uncharacterized protein LOC103706698 [Phoenix dactylifera]
 ref|XP_008778151.1| PREDICTED: uncharacterized protein LOC103697983 [Phoenix dactylifera]
Length=440

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 77/119 (65%), Gaps = 3/119 (3%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEK-LEFLMFDMDRVLRA  440
            FN+FIA+RGL P++ S+ HR PF+DN  D+VH  + L  N  P+  LEF ++D+ RVLR 
Sbjct  322  FNNFIASRGLVPVHISIAHRLPFFDNTLDMVHSMHVLS-NWIPDVVLEFALYDIYRVLRP  380

Query  439  GGLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK-NNGSGKPEVYLSAVLQKPV  266
            GGLFWLD+F+C           + +R  + KL+W  G K + G  K E YLSA+L+KP+
Sbjct  381  GGLFWLDHFFCLGTQLNTTYAPMFDRIAFNKLRWNAGRKLDRGIEKNEWYLSALLEKPM  439



>ref|XP_006344639.1| PREDICTED: uncharacterized protein LOC102595416 [Solanum tuberosum]
Length=470

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 75/119 (63%), Gaps = 5/119 (4%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            F++ IA RGL PLY +L+ R PF+DN  DL+H    +D     + L+F++FD DRVLR G
Sbjct  356  FSETIALRGLIPLYVTLNQRLPFFDNTMDLIHTAGFMDGWIDLQLLDFILFDWDRVLRPG  415

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVRA  260
            GL W+D F+C+  D    +   ++ F YKK KW +  K     K EVYLSA+L+KP R+
Sbjct  416  GLLWIDRFFCNRTDLDDFMYMFLQ-FRYKKHKWSIAPK----AKDEVYLSALLEKPARS  469



>ref|XP_006299195.1| hypothetical protein CARUB_v10015342mg [Capsella rubella]
 gb|EOA32093.1| hypothetical protein CARUB_v10015342mg [Capsella rubella]
Length=463

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 74/119 (62%), Gaps = 5/119 (4%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            FN+ IA RGL PLY SL+ R PF+DN  D++H    +D       ++F+++D DRVLR G
Sbjct  349  FNEMIALRGLIPLYISLNQRLPFFDNTMDMIHTAGLMDGWIDLLLMDFVLYDWDRVLRPG  408

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVRA  260
            GL W+D F+C   D    +   ++ F YKK KW +  K+    K EVYLSA+L+KP RA
Sbjct  409  GLLWIDRFFCKKKDLDDYMYMFLQ-FRYKKHKWAISPKS----KDEVYLSALLEKPPRA  462



>ref|XP_004147405.1| PREDICTED: uncharacterized protein LOC101208739 isoform 1 [Cucumis 
sativus]
 ref|XP_004147406.1| PREDICTED: uncharacterized protein LOC101208739 isoform 2 [Cucumis 
sativus]
 gb|KGN65567.1| hypothetical protein Csa_1G448980 [Cucumis sativus]
Length=373

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/119 (43%), Positives = 71/119 (60%), Gaps = 2/119 (2%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            +N+  A RGL PL+  L  R P +D V DLV  G+ ++     + +EFL +D+DRVLR G
Sbjct  253  YNEVAALRGLVPLHVPLQQRLPIFDGVMDLVRCGHAVNRWIPVKSMEFLFYDLDRVLRVG  312

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSG--KPEVYLSAVLQKPV  266
            G  W D+F+    D  K  + LI + GY+K+KW    K +  G    EVYL+A+LQKPV
Sbjct  313  GYLWFDHFFSKGVDLDKLYSPLITKLGYRKVKWATASKTDSGGLKNGEVYLTALLQKPV  371



>ref|XP_011092056.1| PREDICTED: uncharacterized protein LOC105172364 [Sesamum indicum]
Length=465

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 75/119 (63%), Gaps = 5/119 (4%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            FN+ IA RGL PLY +L+ R PF+DN  D++H    LD     + L+F++FD DRVLR G
Sbjct  351  FNEMIALRGLIPLYMTLNQRLPFFDNTMDIIHTSGFLDGWIDLQLLDFILFDWDRVLRPG  410

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVRA  260
            GL W+D F+C   D    +   ++ F Y+K KW +  K+    K EV+LSA+L+KP R+
Sbjct  411  GLLWIDRFFCKRKDLDDYMYMFLQ-FRYRKHKWAIAPKS----KDEVFLSALLEKPPRS  464



>gb|KEH31356.1| S-adenosyl-L-methionine-dependent methyltransferase [Medicago 
truncatula]
Length=377

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/119 (44%), Positives = 72/119 (61%), Gaps = 2/119 (2%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            +++ +A RGL PL+  L  R P +D V D+V  G  ++       LEFL+FD+DRVLR G
Sbjct  257  YSEAVALRGLVPLHVPLQQRLPMFDGVVDIVRCGRAVNRWIPVTMLEFLLFDVDRVLRGG  316

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSG--KPEVYLSAVLQKPV  266
            G  WLD+F+    D  K    LI + GYKK+KW  G K +  G    E+YL+A+LQKP+
Sbjct  317  GYLWLDHFFSKGVDLDKVYKPLIAKMGYKKVKWATGNKTDAGGVKHGELYLTALLQKPL  375



>gb|KDP32453.1| hypothetical protein JCGZ_13378 [Jatropha curcas]
Length=413

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 78/119 (66%), Gaps = 3/119 (3%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEK-LEFLMFDMDRVLRA  440
            FN FIA+RGL P++ S+  R PF++N  D+VH  + L  N  P+  LEF ++D+ RVLR 
Sbjct  295  FNSFIASRGLIPIHLSVSQRLPFFENTLDIVHSMHVLS-NWIPDTMLEFNLYDIYRVLRP  353

Query  439  GGLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK-NNGSGKPEVYLSAVLQKPV  266
            GGLFWLD+F+C      +    +I+R G+KKL+W  G K + G  K E Y SA+L+KP+
Sbjct  354  GGLFWLDHFFCFGSQLNQTYIPMIDRVGFKKLRWNAGMKLDRGIQKNEWYFSALLEKPM  412



>ref|XP_003546232.1| PREDICTED: uncharacterized protein LOC100794863 [Glycine max]
Length=437

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 80/118 (68%), Gaps = 4/118 (3%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEK-LEFLMFDMDRVLRA  440
            FN+ IA+RGL P++ S+  RFPF+DN  D+VH  + L  N  P+  LEF+++D+ RVLR 
Sbjct  322  FNNIIASRGLVPMHISISQRFPFFDNTLDIVHSMDVLS-NWIPDTMLEFVLYDVYRVLRP  380

Query  439  GGLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPV  266
            GGLFWLD+F+C      K    +++R G+ +L+W VG K +   K  +Y+SA+++KP+
Sbjct  381  GGLFWLDHFFCFGSQLNKTYVPMLDRIGFNRLRWHVGTKLD--RKNVLYISALMEKPM  436



>emb|CDY05163.1| BnaC05g46400D [Brassica napus]
Length=464

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 74/119 (62%), Gaps = 5/119 (4%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            FN+ IA RGL PLY SL+ R PF+DN  D++H    +D       ++F+++D DRVLR G
Sbjct  350  FNEMIALRGLVPLYISLNQRLPFFDNTMDMIHTAGLMDGWIDLLLMDFVLYDWDRVLRPG  409

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVRA  260
            GL W+D F+C   D    +   ++ F YKK KW +  K+    K EVYLSA+L+KP RA
Sbjct  410  GLLWIDRFFCKKKDLDDYMYMFLQ-FRYKKHKWAISPKS----KDEVYLSALLEKPPRA  463



>gb|KHN14379.1| hypothetical protein glysoja_012417 [Glycine soja]
Length=374

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 80/118 (68%), Gaps = 4/118 (3%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEK-LEFLMFDMDRVLRA  440
            FN+ IA+RGL P++ S+  RFPF+DN  D+VH  + L  N  P+  LEF+++D+ RVLR 
Sbjct  259  FNNIIASRGLVPMHISISQRFPFFDNTLDIVHSMDVLS-NWIPDTMLEFVLYDVYRVLRP  317

Query  439  GGLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPV  266
            GGLFWLD+F+C      K    +++R G+ +L+W VG K +   K  +Y+SA+++KP+
Sbjct  318  GGLFWLDHFFCFGSQLNKTYVPMLDRIGFNRLRWHVGTKLD--RKNVLYISALMEKPM  373



>ref|XP_006585013.1| PREDICTED: uncharacterized protein LOC100816366 [Glycine max]
Length=271

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 71/118 (60%), Gaps = 2/118 (2%)
 Frame = -2

Query  613  NDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAGG  434
            ++ +A RGL PL+  L  R P +D V DLV  G  ++       +EFL+ D+DRVLR GG
Sbjct  152  SEAVALRGLVPLHMPLQQRLPLFDGVLDLVRCGRAVNRWIPLTVMEFLLLDVDRVLRGGG  211

Query  433  LFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSG--KPEVYLSAVLQKPV  266
              W+D+F+    D +K    LI + GYKK+KW  G K +  G    EVYL+A+LQKPV
Sbjct  212  YLWVDHFFSKGVDLEKVYAPLIGKLGYKKVKWATGNKTDAGGVKNGEVYLTALLQKPV  269



>ref|XP_008443998.1| PREDICTED: uncharacterized protein LOC103487447 [Cucumis melo]
 ref|XP_008444006.1| PREDICTED: uncharacterized protein LOC103487447 [Cucumis melo]
Length=373

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/119 (43%), Positives = 71/119 (60%), Gaps = 2/119 (2%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            +N+  A RGL PL+  L  R P +D V DLV  G+ ++     + +EFL +D+DRVLR G
Sbjct  253  YNEVAALRGLVPLHVPLQQRLPIFDGVMDLVRCGHAVNRWIPVKSMEFLFYDLDRVLRVG  312

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSG--KPEVYLSAVLQKPV  266
            G  W D+F+    D  K  + LI + GY+K+KW    K +  G    EVYL+A+LQKPV
Sbjct  313  GYLWFDHFFSKGVDLDKLYSPLITKLGYRKVKWATANKTDSGGLKNGEVYLTALLQKPV  371



>emb|CAN66988.1| hypothetical protein VITISV_005164 [Vitis vinifera]
Length=713

 Score =   108 bits (269),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 54/119 (45%), Positives = 72/119 (61%), Gaps = 2/119 (2%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            FN+ IA RGL PLY S+  R PF+DN  D+VH    LD     E L+F++FD DRVLR  
Sbjct  597  FNEVIALRGLLPLYISIGSRLPFFDNTLDIVHSTLFLDGWIGVELLQFMLFDWDRVLRPK  656

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVRA  260
            G+ W+D F+C  +D K  L     R GY+KL W V  K +  G  E++ SAV +KP++ 
Sbjct  657  GILWVDRFFCKKEDMKLYLEEF-NRLGYRKLMWRVLPKTDKLGD-ELFFSAVXEKPLKG  713



>ref|NP_187190.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAF64543.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAT69207.1| hypothetical protein At3g05390 [Arabidopsis thaliana]
 gb|AEE74232.1| uncharacterized protein AT3G05390 [Arabidopsis thaliana]
Length=463

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 74/119 (62%), Gaps = 5/119 (4%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            FN+ IA RGL PLY SL+ R PF+DN  D++H    +D       ++F+++D DRVLR G
Sbjct  349  FNEMIALRGLIPLYISLNQRLPFFDNTMDMIHTTGLMDGWIDLLLMDFVLYDWDRVLRPG  408

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVRA  260
            GL W+D F+C   D    +   ++ F YKK KW +  K+    K EVYLSA+L+KP RA
Sbjct  409  GLLWIDRFFCKKKDLDDYMYMFLQ-FRYKKHKWAISPKS----KDEVYLSALLEKPPRA  462



>ref|XP_007158974.1| hypothetical protein PHAVU_002G197700g [Phaseolus vulgaris]
 gb|ESW30968.1| hypothetical protein PHAVU_002G197700g [Phaseolus vulgaris]
Length=375

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/118 (45%), Positives = 73/118 (62%), Gaps = 2/118 (2%)
 Frame = -2

Query  613  NDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAGG  434
            ++ +A RGL PL+  L  R P +D V DLV  G  ++       LEFL+FD+DRVLR GG
Sbjct  256  SEAVALRGLVPLHVPLQQRLPLFDGVVDLVRCGRAVNRWIPMTVLEFLLFDVDRVLRGGG  315

Query  433  LFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSG--KPEVYLSAVLQKPV  266
              W+D+F+    D +K    LI + GYKK+KW +G K +  G    EV+L+A+LQKPV
Sbjct  316  YLWVDHFFSKRVDLEKVYAPLIGKLGYKKVKWAMGNKTDAGGVKNGEVFLTALLQKPV  373



>gb|EPS68166.1| hypothetical protein M569_06606, partial [Genlisea aurea]
Length=368

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 75/122 (61%), Gaps = 9/122 (7%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            + + +AARGL PL+  L  R P +D + DLV  G+ ++       +EFL+FD DRVLR G
Sbjct  251  YGEAVAARGLVPLHAPLHQRLPVFDGILDLVRFGHAVNRWIPLTSMEFLLFDADRVLRGG  310

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGE-----KNNGSGKPEVYLSAVLQK  272
            G  WLD+F+    D  +  + LI + GYKK+KW VG      KNNG    +VYL+A+LQK
Sbjct  311  GYLWLDHFFSKKLDLDRVFSPLIGKLGYKKVKWTVGNKTSDFKNNG----DVYLTALLQK  366

Query  271  PV  266
            P+
Sbjct  367  PL  368



>ref|XP_010426521.1| PREDICTED: uncharacterized protein LOC104711485 [Camelina sativa]
Length=463

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 74/119 (62%), Gaps = 5/119 (4%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            FN+ IA RGL PLY S++ R PF+DN  D++H    +D       ++F+++D DRVLR G
Sbjct  349  FNEMIALRGLIPLYISMNQRLPFFDNTMDMIHTAGLMDGWIDLLLMDFVLYDWDRVLRPG  408

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVRA  260
            GL W+D F+C   D    +   ++ F YKK KW +  K+    K EVYLSA+L+KP RA
Sbjct  409  GLLWIDRFFCKKKDLDDYMYMFLQ-FRYKKHKWAISPKS----KDEVYLSALLEKPPRA  462



>ref|XP_010930346.1| PREDICTED: uncharacterized protein LOC105051545 [Elaeis guineensis]
Length=438

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 75/119 (63%), Gaps = 3/119 (3%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPE-KLEFLMFDMDRVLRA  440
            FN FIA+RGL P++ S+ HR PF+DN  D+VH  + L  N  P+  LEF + D+ R+LR 
Sbjct  320  FNSFIASRGLVPMHISIAHRLPFFDNTLDIVHSMHVLS-NWIPDIMLEFALHDIYRLLRP  378

Query  439  GGLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK-NNGSGKPEVYLSAVLQKPV  266
            GGLFWLD+F+C           +  R G+KKL+W  G K + G    E YLSA+L+KP+
Sbjct  379  GGLFWLDHFFCIGTQLNTTYVPMFNRIGFKKLRWNAGRKLDRGIQMDEWYLSALLEKPM  437



>ref|XP_007216965.1| hypothetical protein PRUPE_ppa015454mg [Prunus persica]
 gb|EMJ18164.1| hypothetical protein PRUPE_ppa015454mg [Prunus persica]
Length=465

 Score =   106 bits (264),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 57/119 (48%), Positives = 73/119 (61%), Gaps = 2/119 (2%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            FN+ IA RGL PLY S+  R PF+DN  D++H  + LD     E L+F++FD DRVLR  
Sbjct  349  FNEVIALRGLLPLYTSIGSRLPFFDNTLDMIHSTSFLDGWIGIELLQFVLFDWDRVLRPK  408

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVRA  260
            GL W+D F+C  +D K  L     R GYK L W V  K +  G  E++ SAVL+KPVR 
Sbjct  409  GLLWIDRFFCHKEDMKLYLDEF-NRLGYKPLLWRVVPKTDKLGD-ELFFSAVLEKPVRV  465



>emb|CAN63784.1| hypothetical protein VITISV_009253 [Vitis vinifera]
Length=366

 Score =   105 bits (261),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 52/119 (44%), Positives = 71/119 (60%), Gaps = 2/119 (2%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            +N+  A RGL PL+  L  R P +D V DLV  G  ++       +EF  +D+DRVLR G
Sbjct  246  YNEATALRGLVPLHAPLQQRLPVFDGVVDLVRCGRAVNRWIPTVAMEFFFYDVDRVLRGG  305

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSG--KPEVYLSAVLQKPV  266
            G  WLD+F+    D +K    +I + GYKK+KW +  K + SG    EVYL+A+LQKPV
Sbjct  306  GYLWLDHFFSKGADLQKLYAPVIGKLGYKKVKWTMANKTDSSGVKNGEVYLTALLQKPV  364



>ref|XP_011087590.1| PREDICTED: uncharacterized protein LOC105169030 [Sesamum indicum]
Length=449

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 76/119 (64%), Gaps = 3/119 (3%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEK-LEFLMFDMDRVLRA  440
            FN FIA+RGL P++ S+  RFPF++N  D+VH  + L  N  P+  LEF ++D+ RVLR 
Sbjct  331  FNSFIASRGLIPMHVSVSQRFPFFENTLDIVHSMHVLS-NWIPDAMLEFTLYDIYRVLRP  389

Query  439  GGLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK-NNGSGKPEVYLSAVLQKPV  266
            GGLFWLD F+C           + +R G+++L+W  G K + G  K E Y SAVL+KP+
Sbjct  390  GGLFWLDRFFCFGSQLNATYVPMFDRVGFRRLRWNTGMKLDRGIDKNEWYFSAVLEKPM  448



>ref|XP_004306056.1| PREDICTED: uncharacterized protein LOC101293034 [Fragaria vesca 
subsp. vesca]
Length=469

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 73/118 (62%), Gaps = 2/118 (2%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            FN+ IA RGL PLY S+  R PF+DN  D++H    LD     E L+F++FD DRVLR  
Sbjct  353  FNEVIALRGLLPLYTSIGSRLPFFDNTLDIIHSTLFLDGWIGIELLQFVLFDWDRVLRPK  412

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVR  263
            GL W+D F+C  +D K  L     R GYK L W V  KN+  G  E++ SAVL+KP+R
Sbjct  413  GLLWIDRFFCHKEDMKLYLEEF-NRLGYKPLLWRVVPKNDKLGD-ELFFSAVLEKPIR  468



>ref|XP_002273992.1| PREDICTED: uncharacterized protein LOC100250442 [Vitis vinifera]
Length=366

 Score =   105 bits (261),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 52/119 (44%), Positives = 71/119 (60%), Gaps = 2/119 (2%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            +N+  A RGL PL+  L  R P +D V DLV  G  ++       +EF  +D+DRVLR G
Sbjct  246  YNEATALRGLVPLHAPLQQRLPVFDGVVDLVRCGRAVNRWIPTVAMEFFFYDVDRVLRGG  305

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSG--KPEVYLSAVLQKPV  266
            G  WLD+F+    D +K    +I + GYKK+KW +  K + SG    EVYL+A+LQKPV
Sbjct  306  GYLWLDHFFSKGADLQKLYAPVIGKLGYKKVKWTMANKTDSSGVKNGEVYLTALLQKPV  364



>ref|XP_006408083.1| hypothetical protein EUTSA_v10020681mg [Eutrema salsugineum]
 gb|ESQ49536.1| hypothetical protein EUTSA_v10020681mg [Eutrema salsugineum]
Length=463

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 74/119 (62%), Gaps = 5/119 (4%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            FN+ IA RGL PLY S++ R PF+DN  D++H    +D       ++F+++D DRVLR G
Sbjct  349  FNEMIALRGLIPLYISVNQRLPFFDNTMDMIHTAGLMDGWIDLLLMDFVLYDWDRVLRPG  408

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVRA  260
            GL W+D F+C   D    +   ++ F YKK KW +  K+    K EVYLSA+L+KP RA
Sbjct  409  GLLWIDRFFCKKKDLDDYMYMFLQ-FRYKKHKWAISPKS----KDEVYLSALLEKPPRA  462



>ref|XP_008231024.1| PREDICTED: uncharacterized protein LOC103330263 [Prunus mume]
Length=465

 Score =   105 bits (263),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 57/119 (48%), Positives = 73/119 (61%), Gaps = 2/119 (2%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            FN+ IA RGL PLY S+  R PF+DN  D++H  + LD     E L+F++FD DRVLR  
Sbjct  349  FNEVIALRGLLPLYTSIGSRLPFFDNTLDMIHSTSFLDGWIGIELLQFVLFDWDRVLRPK  408

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVRA  260
            GL W+D F+C  +D K  L     R GYK L W V  K +  G  E++ SAVL+KPVR 
Sbjct  409  GLLWIDRFFCHMEDMKLYLDEF-NRLGYKPLLWRVVPKTDKLGD-ELFFSAVLEKPVRV  465



>ref|XP_006431374.1| hypothetical protein CICLE_v10003316mg [Citrus clementina]
 gb|ESR44614.1| hypothetical protein CICLE_v10003316mg [Citrus clementina]
Length=451

 Score =   105 bits (262),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 77/119 (65%), Gaps = 3/119 (3%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEK-LEFLMFDMDRVLRA  440
            FN FIA+RGL  ++ S+  R PF++N  D+VH  + L  N  P+  LEF ++D+ RVLR 
Sbjct  333  FNSFIASRGLISMHISVSQRLPFFENTLDIVHSMHVLS-NWIPDSMLEFTLYDIYRVLRP  391

Query  439  GGLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK-NNGSGKPEVYLSAVLQKPV  266
            GG+FWLD F+C      +    +++R G+KKL+W VG K + G  K E Y SAVL+KP+
Sbjct  392  GGIFWLDRFFCFGSQLNETYVPMLDRIGFKKLRWNVGMKLDRGVKKNEWYFSAVLEKPM  450



>gb|KDP24284.1| hypothetical protein JCGZ_25580 [Jatropha curcas]
Length=343

 Score =   104 bits (260),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 55/118 (47%), Positives = 72/118 (61%), Gaps = 2/118 (2%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            FN+ IA RGL PLY S+  R PF+DN  D++H    LD     E L+F++FD DRVLR  
Sbjct  224  FNEVIALRGLLPLYLSIGSRLPFFDNTLDIIHSTLFLDGWIGIELLQFVLFDWDRVLRPK  283

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVR  263
            G+ W+D F+C  DD K  L     R GYKKL W V  K +   + E++ S VL+KP+R
Sbjct  284  GILWVDRFFCKKDDMKLYLDEF-TRLGYKKLLWRVVPKTD-KLEDELFFSGVLEKPIR  339



>ref|XP_004486558.1| PREDICTED: uncharacterized protein LOC101503433 [Cicer arietinum]
Length=462

 Score =   105 bits (262),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 52/119 (44%), Positives = 79/119 (66%), Gaps = 3/119 (3%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEK-LEFLMFDMDRVLRA  440
            FN+ IA+RGL P++ S+  RFPF++N  D+VH  N +  N  P+  LEF+++D+ RVLR 
Sbjct  344  FNNMIASRGLIPMHISISQRFPFFENTLDIVHSMNVIG-NWMPDTMLEFVLYDIYRVLRP  402

Query  439  GGLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK-NNGSGKPEVYLSAVLQKPV  266
            GGLFWLD+F+C      K    +++R G+ KL+W VG K + G  K   ++SA+++KP 
Sbjct  403  GGLFWLDHFFCFGSQLNKTYMPMLDRVGFNKLRWHVGVKLDPGVRKNVWFISALMEKPT  461



>ref|XP_003594437.1| hypothetical protein MTR_2g028610 [Medicago truncatula]
 gb|AES64688.1| ATRAD3, putative [Medicago truncatula]
Length=459

 Score =   105 bits (261),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 82/121 (68%), Gaps = 7/121 (6%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQ--PEK-LEFLMFDMDRVL  446
            FN+ +A+RGL P++ S+  RFPF++N  D+VH    +DV G   P+  LEF+++D+ RVL
Sbjct  341  FNNMVASRGLIPMHISISQRFPFFENTLDIVH---SMDVIGNWMPDTMLEFVLYDIYRVL  397

Query  445  RAGGLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYL-SAVLQKP  269
            R GGLFWLD+F+C      K    +++R G+ KL+W VG K +   + +V+L SA+++KP
Sbjct  398  RPGGLFWLDHFFCFGSQLNKTYVPMLDRVGFNKLRWHVGMKLDPKVRKDVWLISALMEKP  457

Query  268  V  266
            +
Sbjct  458  M  458



>ref|NP_001132903.1| hypothetical protein [Zea mays]
 ref|XP_008664641.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 ref|XP_008664648.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACF81941.1| unknown [Zea mays]
 gb|ACN36083.1| unknown [Zea mays]
 tpg|DAA46515.1| TPA: hypothetical protein ZEAMMB73_351893 [Zea mays]
 tpg|DAA46516.1| TPA: hypothetical protein ZEAMMB73_351893 [Zea mays]
 tpg|DAA46517.1| TPA: hypothetical protein ZEAMMB73_351893 [Zea mays]
 tpg|DAA46518.1| TPA: hypothetical protein ZEAMMB73_351893 [Zea mays]
Length=398

 Score =   104 bits (260),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 71/119 (60%), Gaps = 4/119 (3%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            +++  AARG+ PL+  L  RFP  D   D+V  G+ ++       LEFL +D DRVLR G
Sbjct  277  YSEAAAARGVVPLHVPLQQRFPVGDGTMDVVRAGHAVNRWIPEVALEFLWYDADRVLRPG  336

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKN----NGSGKPEVYLSAVLQK  272
            GL W+D+F+C   D +     ++ R GYK +KWV  +K+      S K EVYL+A+LQK
Sbjct  337  GLLWVDHFWCRRSDLEGVYAAMLRRLGYKTIKWVAADKSVAIGGNSSKDEVYLTALLQK  395



>ref|XP_007135150.1| hypothetical protein PHAVU_010G105300g [Phaseolus vulgaris]
 gb|ESW07144.1| hypothetical protein PHAVU_010G105300g [Phaseolus vulgaris]
Length=392

 Score =   104 bits (260),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 75/118 (64%), Gaps = 2/118 (2%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            FN+ IA RGL PLY +++ R PF+DN  DL+H    LD       LEF+++D DRVLR G
Sbjct  274  FNEMIALRGLVPLYLTINQRLPFFDNTLDLIHTTRFLDGWIDFVLLEFILYDWDRVLRPG  333

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVR  263
            GL W+D+F+C  +D    L +  E   YKKLKWVV  K +   + E++ SAVL+KP R
Sbjct  334  GLLWIDSFFCLKEDLYDYL-KAFEMLRYKKLKWVVVPKLDKDDQ-EMFFSAVLEKPPR  389



>ref|XP_010269453.1| PREDICTED: uncharacterized protein LOC104606102 [Nelumbo nucifera]
Length=469

 Score =   105 bits (261),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 74/119 (62%), Gaps = 5/119 (4%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            F + IA RGL PLY +L+ R PF+DN  DL+H    LD     + ++F++FD DRVLR G
Sbjct  355  FCEMIALRGLIPLYVTLNQRLPFFDNTMDLIHTTGFLDGWIDLQLMDFMLFDWDRVLRPG  414

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVRA  260
            GL W+D F+C+  D    +   ++ F YKK KW +  K+    K EVYLS +L+KP R+
Sbjct  415  GLLWIDRFFCNRKDLDDYMYMFLQ-FRYKKHKWAISPKS----KEEVYLSVLLEKPPRS  468



>ref|XP_002965799.1| hypothetical protein SELMODRAFT_84529 [Selaginella moellendorffii]
 gb|EFJ33219.1| hypothetical protein SELMODRAFT_84529 [Selaginella moellendorffii]
Length=331

 Score =   103 bits (258),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 74/120 (62%), Gaps = 5/120 (4%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQP-EKLEFLMFDMDRVLRA  440
             +  +AARGL P++ ++  R PF+DN  D+VH  + +     P E  EFL++D+DR+LR 
Sbjct  216  LSSVVAARGLVPMHVTISQRLPFFDNTMDIVHAEDIVGSGSMPAESFEFLVYDLDRILRP  275

Query  439  GGLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVRA  260
            GGL WL+   CS +  +      I+R GY++++W V   N+      V+L+A+L+KPVR+
Sbjct  276  GGLLWLEKLACSYEMLQTVYVPAIDRMGYERVRWSVDSHNSR----HVFLTALLEKPVRS  331



>ref|XP_006353397.1| PREDICTED: uncharacterized protein LOC102598299 [Solanum tuberosum]
Length=460

 Score =   105 bits (261),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 76/119 (64%), Gaps = 5/119 (4%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            F++ IA RGL PLY +L+ R PF+DN  DL+H    +D     + L+F++FD DRVLR G
Sbjct  347  FSETIALRGLVPLYVTLNQRLPFFDNTMDLIHTIGLMDGWIDLQLLDFILFDWDRVLRPG  406

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVRA  260
            GL W+D F+C+  D    +   ++ F YKK KW +  K+    K EVYLSA+L+KP R+
Sbjct  407  GLLWIDRFFCNRRDIDDFMYMFLQ-FRYKKHKWAISPKS----KDEVYLSALLEKPQRS  460



>gb|ACG41203.1| hypothetical protein [Zea mays]
Length=399

 Score =   104 bits (259),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 71/119 (60%), Gaps = 4/119 (3%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            +++  AARG+ PL+  L  RFP  D   D+V  G+ ++       LEFL +D DRVLR G
Sbjct  278  YSEAAAARGVVPLHVPLQQRFPVGDGTMDVVRAGHAVNRWIPEVALEFLWYDADRVLRPG  337

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKN----NGSGKPEVYLSAVLQK  272
            GL W+D+F+C   D +     ++ R GYK +KWV  +K+      S K EVYL+A+LQK
Sbjct  338  GLLWVDHFWCRRSDLEGVYAAMLRRLGYKTIKWVAADKSVAIGGNSSKDEVYLTALLQK  396



>ref|XP_008246399.1| PREDICTED: uncharacterized protein LOC103344579 [Prunus mume]
Length=467

 Score =   105 bits (261),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 52/119 (44%), Positives = 74/119 (62%), Gaps = 5/119 (4%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            FN+ IA RGL PL+ +L+ R PF+DN+ D++H    LD     + L+F++FD DR+LR G
Sbjct  353  FNEMIALRGLIPLHLTLNQRLPFFDNIMDMIHTTGFLDGWIDLQLLDFILFDWDRILRPG  412

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVRA  260
            GL W+D F+C   D    +   ++   YKK KW +  K+    K EVY SA+L+KP RA
Sbjct  413  GLLWIDRFFCQRKDLDVFMYMFLQ-LRYKKHKWAISPKS----KDEVYFSALLEKPPRA  466



>ref|XP_009147246.1| PREDICTED: uncharacterized protein LOC103870827 [Brassica rapa]
Length=464

 Score =   104 bits (260),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 74/119 (62%), Gaps = 5/119 (4%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            F++ IA RGL PLY SL+ R PF+DN  D++H    +D       ++F+++D DRVLR G
Sbjct  350  FSEMIALRGLVPLYISLNQRLPFFDNTMDMIHTAGLMDGWIDLLLMDFVLYDWDRVLRPG  409

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVRA  260
            GL W+D F+C   D    +   ++ F YKK KW +  K+    K EVYLSA+L+KP RA
Sbjct  410  GLLWIDRFFCKKKDLDDYMYMFLQ-FRYKKHKWAISPKS----KDEVYLSALLEKPPRA  463



>emb|CDY27772.1| BnaA05g31810D [Brassica napus]
Length=464

 Score =   104 bits (260),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 74/119 (62%), Gaps = 5/119 (4%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            F++ IA RGL PLY SL+ R PF+DN  D++H    +D       ++F+++D DRVLR G
Sbjct  350  FSEMIALRGLVPLYISLNQRLPFFDNTMDMIHTAGLMDGWIDLLLMDFVLYDWDRVLRPG  409

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVRA  260
            GL W+D F+C   D    +   ++ F YKK KW +  K+    K EVYLSA+L+KP RA
Sbjct  410  GLLWIDRFFCKKKDLDDYMYMFLQ-FRYKKHKWAISPKS----KDEVYLSALLEKPPRA  463



>ref|XP_006651088.1| PREDICTED: uncharacterized protein LOC102701157 [Oryza brachyantha]
Length=280

 Score =   103 bits (256),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 70/122 (57%), Gaps = 6/122 (5%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            +++  AARG+ P++  L  RFP  D   DLV  G+ ++       LEFL +D DRVLR  
Sbjct  159  YSEAAAARGVVPVHAPLQQRFPVGDATMDLVRTGHAVNRWIPEAALEFLWYDADRVLRPR  218

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNN------GSGKPEVYLSAVLQ  275
            GL W+D+F+C   D       ++ R GYK +KW VG+K+       G    EVYL+A+LQ
Sbjct  219  GLLWVDHFWCRRADLAAVYAPMLRRLGYKTVKWAVGDKSTPAAAAAGGKHDEVYLTALLQ  278

Query  274  KP  269
            KP
Sbjct  279  KP  280



>gb|KDO40688.1| hypothetical protein CISIN_1g043503mg [Citrus sinensis]
Length=430

 Score =   104 bits (259),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 77/119 (65%), Gaps = 3/119 (3%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEK-LEFLMFDMDRVLRA  440
            FN FIA+RGL  ++ S+  R PF++N  D+VH  + L  N  P+  LEF ++D+ R+LR 
Sbjct  312  FNSFIASRGLISMHISVSQRLPFFENTLDIVHSMHVLS-NWIPDSMLEFTLYDIYRLLRP  370

Query  439  GGLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK-NNGSGKPEVYLSAVLQKPV  266
            GG+FWLD F+C      +    +++R G+KKL+W VG K + G  K E Y SAVL+KP+
Sbjct  371  GGIFWLDRFFCFGSQLNETYVPMLDRIGFKKLRWNVGMKLDRGVKKNEWYFSAVLEKPM  429



>ref|XP_009380402.1| PREDICTED: uncharacterized protein LOC103968807 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009380403.1| PREDICTED: uncharacterized protein LOC103968807 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009380404.1| PREDICTED: uncharacterized protein LOC103968807 [Musa acuminata 
subsp. malaccensis]
Length=473

 Score =   105 bits (261),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 56/119 (47%), Positives = 76/119 (64%), Gaps = 5/119 (4%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            F + IA RGL PLY +L+ R PF+DN  DL+H    LD     + L+F++FD DRVLR G
Sbjct  359  FGEMIALRGLIPLYATLNQRLPFFDNTLDLIHTSVFLDGWIDLQLLDFVLFDWDRVLRPG  418

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVRA  260
            GL W+D F+C+  D    +   ++ F YKK KWVV  K+    K +VYLSA+L+KP R+
Sbjct  419  GLLWVDKFFCNRKDLDDYMYMFLQ-FRYKKHKWVVSFKS----KDDVYLSALLEKPPRS  472



>ref|XP_011093041.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105173085 
[Sesamum indicum]
Length=685

 Score =   106 bits (264),  Expect = 9e-23, Method: Composition-based stats.
 Identities = 49/118 (42%), Positives = 74/118 (63%), Gaps = 1/118 (1%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            F++ IA RGL PLY +++ R PF+DN  DL+H    LD       L+F+++D DRVLR G
Sbjct  567  FSEMIALRGLIPLYLTVNQRLPFFDNTLDLIHTTRFLDGWIDLVLLDFVLYDWDRVLRPG  626

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVR  263
            GL W+D+F+C  +D    L  + +   Y+K KW++  K + +   EV+ SAV++KP R
Sbjct  627  GLLWIDSFFCLKEDLDDYLA-VFKMLKYRKHKWIIVPKWDKNNDREVFFSAVMEKPPR  683



>gb|EMT20494.1| hypothetical protein F775_33030 [Aegilops tauschii]
Length=182

 Score =   100 bits (250),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 71/122 (58%), Gaps = 5/122 (4%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVG----NGLDVNGQPEKLEFLMFDMDRV  449
            F  F+A+RGL PL+     R PF++   D+VH G     G  V G    LEF +FD+ RV
Sbjct  60   FGSFVASRGLVPLHVGPARRLPFFEGTLDVVHAGRELTGGWMVPGDGVALEFALFDVYRV  119

Query  448  LRAGGLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGS-GKPEVYLSAVLQK  272
            LR GGLFWLD+F             ++ R G+K+L+W  G+K +G   K E YLSA+LQK
Sbjct  120  LRPGGLFWLDHFVFPGTQLNSTYAPMLHRVGFKRLRWNAGQKPDGGVEKNEWYLSALLQK  179

Query  271  PV  266
            P+
Sbjct  180  PM  181



>ref|XP_007135151.1| hypothetical protein PHAVU_010G105300g [Phaseolus vulgaris]
 gb|ESW07145.1| hypothetical protein PHAVU_010G105300g [Phaseolus vulgaris]
Length=484

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 75/118 (64%), Gaps = 2/118 (2%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            FN+ IA RGL PLY +++ R PF+DN  DL+H    LD       LEF+++D DRVLR G
Sbjct  366  FNEMIALRGLVPLYLTINQRLPFFDNTLDLIHTTRFLDGWIDFVLLEFILYDWDRVLRPG  425

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVR  263
            GL W+D+F+C  +D    L +  E   YKKLKWVV  K +   + E++ SAVL+KP R
Sbjct  426  GLLWIDSFFCLKEDLYDYL-KAFEMLRYKKLKWVVVPKLDKDDQ-EMFFSAVLEKPPR  481



>gb|AAT68360.1| hypothetical protein At3g05390 [Arabidopsis thaliana]
Length=463

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 74/119 (62%), Gaps = 5/119 (4%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            FN+ IA RGL PLY SL+ R PF+DN  D++H    +D       ++F+++D DRVLR G
Sbjct  349  FNEMIALRGLIPLYISLNQRLPFFDNTMDMIHTTGLMDGWIDLLLMDFVLYDWDRVLRPG  408

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVRA  260
            GL W+D F+C   D    +   ++ F YKK KW +  K+    K EVYLSA+L+KP RA
Sbjct  409  GLPWVDRFFCKKKDLDDYMYMFLQ-FRYKKHKWAISPKS----KDEVYLSALLEKPPRA  462



>ref|XP_010464063.1| PREDICTED: uncharacterized protein LOC104744673 [Camelina sativa]
 ref|XP_010464064.1| PREDICTED: uncharacterized protein LOC104744673 [Camelina sativa]
Length=463

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/119 (44%), Positives = 74/119 (62%), Gaps = 5/119 (4%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            F++ IA RGL PLY S++ R PF+DN  D++H    +D       ++F+++D DRVLR G
Sbjct  349  FSEMIALRGLIPLYISMNQRLPFFDNTMDMIHTAGLMDGWIDLLLMDFVLYDWDRVLRPG  408

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVRA  260
            GL W+D F+C   D    +   ++ F YKK KW +  K+    K EVYLSA+L+KP RA
Sbjct  409  GLLWIDRFFCKKKDLDDYMYMFLQ-FRYKKHKWAISPKS----KDEVYLSALLEKPPRA  462



>ref|XP_010485980.1| PREDICTED: uncharacterized protein LOC104764193 [Camelina sativa]
Length=463

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/119 (44%), Positives = 74/119 (62%), Gaps = 5/119 (4%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            F++ IA RGL PLY S++ R PF+DN  D++H    +D       ++F+++D DRVLR G
Sbjct  349  FSEMIALRGLIPLYISMNQRLPFFDNTMDMIHTAGLMDGWIDLLLMDFVLYDWDRVLRPG  408

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVRA  260
            GL W+D F+C   D    +   ++ F YKK KW +  K+    K EVYLSA+L+KP RA
Sbjct  409  GLLWIDRFFCKKKDLDDYMYMFLQ-FRYKKHKWAISPKS----KDEVYLSALLEKPPRA  462



>gb|KJB24637.1| hypothetical protein B456_004G154700 [Gossypium raimondii]
Length=466

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/118 (46%), Positives = 73/118 (62%), Gaps = 1/118 (1%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            FN+ IA RGL PLY S++ R PF+DN  DL+H    LD       L+F++FD DRVLR G
Sbjct  348  FNEMIALRGLVPLYLSINQRLPFFDNTLDLIHTTRFLDGWIDFVLLDFVLFDWDRVLRPG  407

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVR  263
            GL W+D+F+C  +D +  +    +   Y+K KWVV  K +     EV+ SAVL+KP R
Sbjct  408  GLLWIDSFFCLKEDLEDYM-EAFKVLRYRKHKWVVVPKRDKDDDREVFFSAVLEKPPR  464



>ref|XP_007025169.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 1 [Theobroma cacao]
 ref|XP_007025170.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY27791.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY27792.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 1 [Theobroma cacao]
Length=373

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/119 (43%), Positives = 71/119 (60%), Gaps = 2/119 (2%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            +N+ +A RGL PL+  L  R P +D   DLV  G  ++     + +EF+ +D+DRVLR G
Sbjct  253  YNEAVALRGLVPLHVPLQQRLPVFDGTMDLVRCGRAVNRWIPVKVMEFMFYDVDRVLRGG  312

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSG--KPEVYLSAVLQKPV  266
            G  W+D F+    D +K    LI + GY K+KW V  K + SG    EVYL+A+LQKPV
Sbjct  313  GYLWVDRFFSKGVDLEKIYGPLIGKLGYTKVKWAVANKTDSSGLKNGEVYLTALLQKPV  371



>ref|XP_006444936.1| hypothetical protein CICLE_v10024550mg [Citrus clementina]
 ref|XP_006491197.1| PREDICTED: uncharacterized protein LOC102624556 [Citrus sinensis]
 gb|ESR58176.1| hypothetical protein CICLE_v10024550mg [Citrus clementina]
 gb|KDO86330.1| hypothetical protein CISIN_1g046488mg [Citrus sinensis]
Length=480

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/118 (46%), Positives = 75/118 (64%), Gaps = 2/118 (2%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            FN+ IA RGL PLY +++ R PF+DN  DL+H    LD       L+F+++D DRVLR G
Sbjct  361  FNEMIALRGLVPLYITINQRVPFFDNTLDLIHTTRFLDGWIDFVLLDFILYDWDRVLRPG  420

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVR  263
            GL W+D+F+C+ +D    L  + +   YKK KWVV  K +   + EV+ SAVL+KP R
Sbjct  421  GLLWIDSFFCAKEDMNDYL-EVFKMLKYKKHKWVVVPKRDKDDR-EVFFSAVLEKPPR  476



>ref|XP_009380075.1| PREDICTED: uncharacterized protein LOC103968547 [Musa acuminata 
subsp. malaccensis]
Length=395

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 78/119 (66%), Gaps = 2/119 (2%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            F+ F+AARG+ PLY S+  R PF+DN  DLVH  + L        L F++FD+ RVLR G
Sbjct  275  FSSFMAARGVVPLYLSVSQRLPFFDNTLDLVHSMHVLSNWIPTTLLHFILFDIYRVLRPG  334

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK-NNGSGKPEVYLSAVLQKPVR  263
            GLFWLD+F+   + +      +I+R G+KKL+W VG K + G    E+Y+SA+LQKP++
Sbjct  335  GLFWLDHFF-FVEPQMGEYVPVIDRVGFKKLRWEVGRKLDRGLELREMYISALLQKPLK  392



>gb|EYU45763.1| hypothetical protein MIMGU_mgv1a020775mg [Erythranthe guttata]
Length=401

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 81/119 (68%), Gaps = 1/119 (1%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            FN FIAARG+ PLY S+  RFPF+DN  D+VH  + L      E L F+MFD+ RVLR G
Sbjct  280  FNSFIAARGVVPLYVSISQRFPFFDNTLDIVHSMHVLSNWIPTEMLHFMMFDIYRVLRPG  339

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEK-NNGSGKPEVYLSAVLQKPVR  263
            GLFW+D+F+C  +   +    LIE  G+ K+KWVVG+K + G    E+YLSA+L+KP++
Sbjct  340  GLFWMDHFFCVGEQLAEVYAPLIESVGFVKVKWVVGKKLDRGPELNEMYLSALLEKPLK  398



>ref|XP_011023653.1| PREDICTED: uncharacterized protein LOC105125062 [Populus euphratica]
Length=468

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/119 (44%), Positives = 74/119 (62%), Gaps = 5/119 (4%)
 Frame = -2

Query  616  FNDFIAARGLFPLYFSLDHRFPFYDNVFDLVHVGNGLDVNGQPEKLEFLMFDMDRVLRAG  437
            FN+ IA RGL PLY +L+ R PF+DN  DL+H    +D       ++F++FD DR+LR G
Sbjct  354  FNEMIALRGLVPLYVTLNQRLPFFDNTMDLIHTTGFMDGWIDLMLMDFILFDWDRILRPG  413

Query  436  GLFWLDNFYCSSDDKKKALTRLIERFGYKKLKWVVGEKNNGSGKPEVYLSAVLQKPVRA  260
            GL W+D F+C+  D    +   ++ F YKK +W +  K+    K EVYLSA+L+KP R 
Sbjct  414  GLLWIDRFFCNRKDLDDYMYMFLQ-FRYKKHRWAISPKS----KDEVYLSALLEKPPRG  467



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 856559115090