BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF001A09

Length=669
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006342130.1|  PREDICTED: BTB/POZ domain-containing protein...    274   9e-83   Solanum tuberosum [potatoes]
ref|XP_006342129.1|  PREDICTED: BTB/POZ domain-containing protein...    274   1e-82   Solanum tuberosum [potatoes]
ref|XP_004238427.1|  PREDICTED: BTB/POZ domain-containing protein...    269   6e-81   Solanum lycopersicum
ref|XP_010320455.1|  PREDICTED: BTB/POZ domain-containing protein...    269   6e-81   Solanum lycopersicum
ref|XP_009631576.1|  PREDICTED: BTB/POZ domain-containing protein...    268   2e-80   Nicotiana tomentosiformis
ref|XP_009631572.1|  PREDICTED: BTB/POZ domain-containing protein...    268   3e-80   Nicotiana tomentosiformis
ref|XP_009631574.1|  PREDICTED: BTB/POZ domain-containing protein...    267   3e-80   
ref|XP_004291228.1|  PREDICTED: BTB/POZ domain-containing protein...    263   6e-79   Fragaria vesca subsp. vesca
ref|XP_002510674.1|  protein binding protein, putative                  263   1e-78   Ricinus communis
ref|XP_002879271.1|  BTB/POZ domain-containing protein                  263   1e-78   
ref|XP_006293695.1|  hypothetical protein CARUB_v10022653mg             262   3e-78   Capsella rubella
gb|KJB57964.1|  hypothetical protein B456_009G187700                    261   4e-78   Gossypium raimondii
dbj|BAD95193.1|  hypothetical protein                                   248   1e-77   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010469824.1|  PREDICTED: BTB/POZ domain-containing protein...    260   1e-77   Camelina sativa [gold-of-pleasure]
ref|XP_010469826.1|  PREDICTED: BTB/POZ domain-containing protein...    260   1e-77   Camelina sativa [gold-of-pleasure]
ref|XP_010414240.1|  PREDICTED: BTB/POZ domain-containing protein...    260   2e-77   
ref|XP_008452951.1|  PREDICTED: BTB/POZ domain-containing protein...    259   2e-77   Cucumis melo [Oriental melon]
ref|XP_010469825.1|  PREDICTED: BTB/POZ domain-containing protein...    259   2e-77   Camelina sativa [gold-of-pleasure]
gb|KFK23322.1|  hypothetical protein AALP_AAs74635U001200               259   2e-77   Arabis alpina [alpine rockcress]
ref|XP_010061166.1|  PREDICTED: BTB/POZ domain-containing protein...    259   2e-77   Eucalyptus grandis [rose gum]
emb|CDY29657.1|  BnaA04g17700D                                          259   3e-77   Brassica napus [oilseed rape]
gb|KHG01113.1|  hypothetical protein F383_22949                         258   6e-77   Gossypium arboreum [tree cotton]
ref|XP_008221133.1|  PREDICTED: BTB/POZ domain-containing protein...    258   7e-77   Prunus mume [ume]
ref|XP_007221940.1|  hypothetical protein PRUPE_ppa001540mg             258   8e-77   Prunus persica
ref|XP_010061165.1|  PREDICTED: BTB/POZ domain-containing protein...    258   8e-77   Eucalyptus grandis [rose gum]
ref|XP_010510327.1|  PREDICTED: BTB/POZ domain-containing protein...    258   9e-77   Camelina sativa [gold-of-pleasure]
ref|NP_180618.2|  BTB/POZ domain-containing protein                     258   1e-76   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001189642.1|  BTB/POZ domain-containing protein                  257   2e-76   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011074097.1|  PREDICTED: BTB/POZ domain-containing protein...    256   3e-76   Sesamum indicum [beniseed]
emb|CDP07293.1|  unnamed protein product                                256   3e-76   Coffea canephora [robusta coffee]
ref|XP_010556054.1|  PREDICTED: BTB/POZ domain-containing protein...    256   3e-76   Tarenaya hassleriana [spider flower]
gb|EYU36560.1|  hypothetical protein MIMGU_mgv1a001528mg                256   4e-76   Erythranthe guttata [common monkey flower]
ref|XP_008377080.1|  PREDICTED: BTB/POZ domain-containing protein...    255   8e-76   Malus domestica [apple tree]
ref|XP_008377081.1|  PREDICTED: BTB/POZ domain-containing protein...    255   8e-76   
emb|CBI40712.3|  unnamed protein product                                254   2e-75   Vitis vinifera
ref|XP_004145539.1|  PREDICTED: BTB/POZ domain-containing protein...    254   2e-75   Cucumis sativus [cucumbers]
ref|XP_002270675.1|  PREDICTED: BTB/POZ domain-containing protein...    254   2e-75   Vitis vinifera
ref|XP_009418296.1|  PREDICTED: BTB/POZ domain-containing protein...    254   2e-75   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011034881.1|  PREDICTED: BTB/POZ domain-containing protein...    254   3e-75   Populus euphratica
ref|XP_011034879.1|  PREDICTED: BTB/POZ domain-containing protein...    254   3e-75   Populus euphratica
ref|XP_002300643.1|  BTB/POZ domain-containing family protein           254   3e-75   Populus trichocarpa [western balsam poplar]
ref|XP_006410166.1|  hypothetical protein EUTSA_v10016264mg             253   9e-75   Eutrema salsugineum [saltwater cress]
ref|XP_006664953.1|  PREDICTED: BTB/POZ domain-containing protein...    252   1e-74   Oryza brachyantha
ref|XP_002307790.1|  BTB/POZ domain-containing family protein           251   3e-74   
ref|XP_007018025.1|  BTB/POZ domain-containing protein isoform 1        251   3e-74   
ref|XP_007018027.1|  BTB/POZ domain-containing protein isoform 3        251   3e-74   
ref|XP_010935266.1|  PREDICTED: BTB/POZ domain-containing protein...    250   6e-74   
emb|CDX97805.1|  BnaC04g41340D                                          250   7e-74   
dbj|BAD93995.1|  hypothetical protein                                   249   2e-73   Arabidopsis thaliana [mouse-ear cress]
gb|AES98295.2|  BTB/POZ domain plant protein                            246   2e-72   Medicago truncatula
ref|NP_001174372.1|  Os05g0345500                                       228   2e-72   
ref|XP_010692549.1|  PREDICTED: BTB/POZ domain-containing protein...    246   3e-72   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011013905.1|  PREDICTED: BTB/POZ domain-containing protein...    245   5e-72   Populus euphratica
ref|XP_011041233.1|  PREDICTED: BTB/POZ domain-containing protein...    245   6e-72   Populus euphratica
ref|XP_010094552.1|  BTB/POZ domain-containing protein                  244   8e-72   Morus notabilis
ref|XP_003615337.1|  Kelch-like protein                                 245   8e-72   
ref|XP_008781287.1|  PREDICTED: BTB/POZ domain-containing protein...    244   9e-72   
ref|XP_008781284.1|  PREDICTED: BTB/POZ domain-containing protein...    244   1e-71   
gb|EEE63337.1|  hypothetical protein OsJ_18148                          243   1e-71   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003545003.1|  PREDICTED: BTB/POZ domain-containing protein...    244   1e-71   Glycine max [soybeans]
ref|XP_006596517.1|  PREDICTED: BTB/POZ domain-containing protein...    244   1e-71   
gb|AAV43802.1|  unknown protein                                         243   2e-71   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006473784.1|  PREDICTED: BTB/POZ domain-containing protein...    243   4e-71   Citrus sinensis [apfelsine]
ref|XP_006473785.1|  PREDICTED: BTB/POZ domain-containing protein...    243   4e-71   Citrus sinensis [apfelsine]
ref|XP_006435355.1|  hypothetical protein CICLE_v10003249mg             242   7e-71   
ref|XP_003561246.1|  PREDICTED: BTB/POZ domain-containing protein...    242   7e-71   Brachypodium distachyon [annual false brome]
gb|EEC79014.1|  hypothetical protein OsI_19541                          242   8e-71   Oryza sativa Indica Group [Indian rice]
ref|XP_007160598.1|  hypothetical protein PHAVU_001G001100g             239   5e-70   Phaseolus vulgaris [French bean]
emb|CDM85346.1|  unnamed protein product                                239   6e-70   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009141084.1|  PREDICTED: BTB/POZ domain-containing protein...    237   4e-69   Brassica rapa
ref|XP_009141083.1|  PREDICTED: BTB/POZ domain-containing protein...    237   4e-69   Brassica rapa
ref|XP_010266159.1|  PREDICTED: BTB/POZ domain-containing protein...    236   7e-69   Nelumbo nucifera [Indian lotus]
ref|XP_004964253.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma...    235   5e-68   
ref|XP_004512608.1|  PREDICTED: BTB/POZ domain-containing protein...    232   3e-67   Cicer arietinum [garbanzo]
ref|XP_004512607.1|  PREDICTED: BTB/POZ domain-containing protein...    232   3e-67   Cicer arietinum [garbanzo]
ref|XP_008377082.1|  PREDICTED: BTB/POZ domain-containing protein...    231   4e-67   
ref|XP_002437659.1|  hypothetical protein SORBIDRAFT_10g000240          230   2e-66   Sorghum bicolor [broomcorn]
ref|XP_006828729.1|  hypothetical protein AMTR_s00001p00041750          230   2e-66   
ref|XP_009759339.1|  PREDICTED: BTB/POZ domain-containing protein...    229   5e-66   Nicotiana sylvestris
gb|EPS65824.1|  hypothetical protein M569_08953                         214   8e-61   Genlisea aurea
ref|XP_002962812.1|  hypothetical protein SELMODRAFT_438140             211   9e-60   
ref|XP_001751401.1|  predicted protein                                  210   2e-59   
ref|XP_002965955.1|  hypothetical protein SELMODRAFT_84039              209   3e-59   
gb|AAB63076.1|  unknown protein                                         192   1e-58   Arabidopsis thaliana [mouse-ear cress]
gb|KIY99757.1|  hypothetical protein MNEG_8204                          181   4e-49   Monoraphidium neglectum
ref|XP_005845262.1|  hypothetical protein CHLNCDRAFT_58586              177   4e-48   Chlorella variabilis
ref|XP_005650913.1|  hypothetical protein COCSUDRAFT_46062              150   4e-39   Coccomyxa subellipsoidea C-169
ref|XP_011399599.1|  BTB/POZ domain-containing protein                  131   4e-32   Auxenochlorella protothecoides
ref|XP_001697437.1|  predicted protein                                  118   6e-30   Chlamydomonas reinhardtii
ref|XP_002950189.1|  hypothetical protein VOLCADRAFT_48365              116   2e-29   Volvox carteri f. nagariensis
ref|XP_004339299.1|  BTB/POZ domain containing protein                  103   1e-21   Acanthamoeba castellanii str. Neff
gb|KDD72973.1|  hypothetical protein H632_c2675p1                     87.8    2e-18   Helicosporidium sp. ATCC 50920
ref|XP_006596518.1|  PREDICTED: BTB/POZ domain-containing protein...  88.2    2e-16   
ref|XP_005708947.1|  ubiquitin-protein ligase                         84.3    5e-15   Galdieria sulphuraria
ref|XP_005708288.1|  ubiquitin-protein ligase isoform 1               78.6    4e-13   Galdieria sulphuraria
ref|XP_005708289.1|  ubiquitin-protein ligase isoform 2               78.6    4e-13   Galdieria sulphuraria
ref|XP_011189868.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  77.8    1e-12   Zeugodacus cucurbitae [melon fruit fly]
ref|XP_011189870.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  77.8    1e-12   Zeugodacus cucurbitae [melon fruit fly]
ref|XP_011189869.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  77.8    1e-12   Zeugodacus cucurbitae [melon fruit fly]
ref|XP_011189866.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  77.8    1e-12   Zeugodacus cucurbitae [melon fruit fly]
ref|XP_005842130.1|  hypothetical protein GUITHDRAFT_41514            71.2    2e-12   Guillardia theta CCMP2712
ref|XP_639138.1|  BTB/POZ domain-containing protein                   76.3    2e-12   Dictyostelium discoideum AX4
ref|XP_004333299.1|  BTB/POZ domain containing protein                75.9    2e-12   Acanthamoeba castellanii str. Neff
gb|AAB47544.1|  MigA                                                  76.3    2e-12   Dictyostelium discoideum
ref|XP_011406508.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  76.3    3e-12   
ref|XP_011199880.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  76.3    3e-12   Bactrocera dorsalis [papaya fruit fly]
ref|XP_011199881.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  75.9    3e-12   Bactrocera dorsalis [papaya fruit fly]
ref|XP_011199879.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  75.9    3e-12   Bactrocera dorsalis [papaya fruit fly]
ref|XP_011199876.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  75.9    3e-12   
ref|XP_004521542.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  75.9    4e-12   Ceratitis capitata [medfly]
ref|XP_004521546.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  75.9    4e-12   Ceratitis capitata [medfly]
ref|XP_004521545.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  75.9    4e-12   Ceratitis capitata [medfly]
ref|XP_004521547.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  75.5    5e-12   
ref|XP_011414031.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  74.7    9e-12   Crassostrea gigas
ref|XP_011414030.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  74.7    9e-12   Crassostrea gigas
gb|EKC30956.1|  E3 ubiquitin-protein ligase HECTD1                    74.7    1e-11   Crassostrea gigas
ref|XP_005178040.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.6    2e-11   
ref|XP_011290265.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.6    2e-11   Musca domestica
ref|XP_005178039.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.6    2e-11   Musca domestica
ref|XP_011290263.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.6    2e-11   Musca domestica
ref|XP_011290264.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.6    2e-11   Musca domestica
ref|XP_003288046.1|  hypothetical protein DICPUDRAFT_16127            72.4    3e-11   Dictyostelium purpureum
ref|XP_001749884.1|  hypothetical protein                             72.8    4e-11   Monosiga brevicollis MX1
ref|XP_004341500.1|  BTB/POZ domain containing protein                70.5    5e-11   Acanthamoeba castellanii str. Neff
ref|XP_005832107.1|  hypothetical protein GUITHDRAFT_46879            65.1    3e-10   Guillardia theta CCMP2712
ref|XP_002424807.1|  hect E3 ubiquitin ligase, putative               69.7    3e-10   Pediculus humanus corporis [human body lice]
ref|XP_001969437.1|  GG23957                                          69.7    4e-10   
ref|XP_002089068.1|  GE26196                                          69.3    4e-10   Drosophila yakuba
dbj|GAM18790.1|  hypothetical protein SAMD00019534_019650             68.6    5e-10   Acytostelium subglobosum LB1
ref|XP_004989701.1|  hypothetical protein PTSG_12883                  69.3    5e-10   Salpingoeca rosetta
ref|XP_005842128.1|  hypothetical protein GUITHDRAFT_52999            64.3    5e-10   Guillardia theta CCMP2712
emb|CDK13343.1|  HECD-1, isoform e                                    68.9    6e-10   Caenorhabditis elegans [roundworm]
emb|CDK13339.1|  HECD-1, isoform a                                    68.9    6e-10   Caenorhabditis elegans [roundworm]
emb|CDK13344.1|  HECD-1, isoform f                                    68.9    6e-10   Caenorhabditis elegans [roundworm]
emb|CDK13342.1|  HECD-1, isoform d                                    68.9    6e-10   Caenorhabditis elegans [roundworm]
emb|CDK13341.1|  HECD-1, isoform c                                    68.9    6e-10   Caenorhabditis elegans [roundworm]
emb|CDK13346.1|  HECD-1, isoform h                                    68.9    6e-10   Caenorhabditis elegans [roundworm]
emb|CDK13340.1|  HECD-1, isoform b                                    68.9    6e-10   Caenorhabditis elegans [roundworm]
emb|CDK13345.1|  HECD-1, isoform g                                    68.9    6e-10   Caenorhabditis elegans [roundworm]
ref|XP_002078905.1|  GD22285                                          68.9    6e-10   
ref|NP_501120.1|  Protein HECD-1                                      68.6    7e-10   
ref|XP_004209170.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  68.6    7e-10   
ref|XP_002036468.1|  GM11846                                          68.6    7e-10   Drosophila sechellia
ref|XP_001963078.1|  GF14121                                          67.4    2e-09   Drosophila ananassae
ref|WP_029637034.1|  hypothetical protein [                           64.3    2e-09   [Scytonema hofmanni] UTEX B 1581
gb|ETN82977.1|  HECT-domain protein                                   66.6    3e-09   Necator americanus
ref|XP_002633092.1|  Hypothetical protein CBG05779                    66.6    3e-09   Caenorhabditis briggsae
gb|KDR14371.1|  E3 ubiquitin-protein ligase HECTD1                    66.6    3e-09   Zootermopsis nevadensis
emb|CAP26541.2|  Protein CBR-HECD-1                                   66.6    3e-09   Caenorhabditis briggsae
ref|XP_002676026.1|  predicted protein                                65.9    4e-09   Naegleria gruberi strain NEG-M
ref|XP_011314687.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.2    4e-09   Fopius arisanus
ref|XP_005792638.1|  hypothetical protein EMIHUDRAFT_108691           63.2    4e-09   Emiliania huxleyi CCMP1516
ref|XP_004909451.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.2    4e-09   
ref|XP_004864091.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.2    4e-09   Heterocephalus glaber [naked mole rat]
ref|XP_011314688.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.2    4e-09   Fopius arisanus
ref|XP_011314681.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.2    4e-09   Fopius arisanus
ref|XP_011314680.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.2    4e-09   Fopius arisanus
ref|XP_011314679.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.2    4e-09   Fopius arisanus
ref|XP_011314686.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.2    4e-09   Fopius arisanus
ref|XP_011314685.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.2    4e-09   Fopius arisanus
ref|XP_011314684.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.2    4e-09   Fopius arisanus
ref|XP_011314682.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  66.2    4e-09   Fopius arisanus
ref|XP_002052386.1|  GJ21961                                          65.9    5e-09   Drosophila virilis
ref|NP_609369.1|  CG5604                                              65.9    5e-09   Drosophila melanogaster
gb|AAQ23602.1|  LP05936p                                              65.9    5e-09   Drosophila melanogaster
ref|XP_007429074.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  65.9    6e-09   
ref|XP_004909450.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  65.9    6e-09   
ref|XP_004864090.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  65.9    6e-09   Heterocephalus glaber [naked mole rat]
ref|XP_004909448.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  65.9    6e-09   
ref|XP_004864088.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  65.9    6e-09   Heterocephalus glaber [naked mole rat]
ref|XP_007063755.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...  65.9    6e-09   
gb|KFB39857.1|  AGAP009511-PA-like protein                            65.9    6e-09   Anopheles sinensis
gb|EYB85246.1|  hypothetical protein Y032_0302g1869                   65.9    6e-09   Ancylostoma ceylanicum
ref|XP_007429075.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  65.5    7e-09   
ref|XP_007429073.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  65.5    7e-09   
ref|XP_310184.4|  AGAP009511-PA                                       65.5    8e-09   Anopheles gambiae str. PEST
gb|ENN80588.1|  hypothetical protein YQE_02993                        65.5    8e-09   Dendroctonus ponderosae
ref|XP_010631866.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  65.5    8e-09   Fukomys damarensis [Damara mole rat]
gb|KHJ84376.1|  hypothetical protein OESDEN_15912                     64.7    8e-09   Oesophagostomum dentatum [nodule worm]
ref|XP_005196337.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  65.1    8e-09   
gb|EMP32200.1|  E3 ubiquitin-protein ligase HECTD1                    65.5    8e-09   Chelonia mydas [green seaturtle]
ref|XP_005196336.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  65.1    8e-09   
ref|XP_010631867.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  65.5    8e-09   Fukomys damarensis [Damara mole rat]
gb|ERL91993.1|  hypothetical protein D910_09315                       65.1    8e-09   Dendroctonus ponderosae
ref|XP_008162333.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  65.1    9e-09   Chrysemys picta bellii
ref|XP_010333268.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  65.1    9e-09   Saimiri boliviensis boliviensis
ref|XP_010333269.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  65.1    9e-09   Saimiri boliviensis boliviensis
ref|XP_003294753.1|  hypothetical protein DICPUDRAFT_51693            64.7    9e-09   Dictyostelium purpureum
ref|XP_009909049.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    65.1    9e-09   Picoides pubescens
ref|XP_005196335.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  65.1    9e-09   
ref|XP_006116433.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  65.1    9e-09   
ref|XP_005196334.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  65.1    1e-08   
ref|XP_005881051.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  65.1    1e-08   Myotis brandtii
ref|XP_005695270.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  65.1    1e-08   
emb|CDY65033.1|  BnaC03g78060D                                        62.0    1e-08   Brassica napus [oilseed rape]
ref|XP_006085913.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  65.1    1e-08   
ref|XP_005881050.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  65.1    1e-08   
ref|XP_011374706.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  65.1    1e-08   Pteropus vampyrus
ref|XP_006085912.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  65.1    1e-08   
ref|XP_005377019.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  65.1    1e-08   
ref|XP_004467983.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  65.1    1e-08   Dasypus novemcinctus
ref|XP_005881054.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  65.1    1e-08   Myotis brandtii
ref|XP_010586873.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  65.1    1e-08   Loxodonta africana [African bush elephant]
ref|XP_010961316.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  65.1    1e-08   Camelus bactrianus [camel]
ref|XP_004755203.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  65.1    1e-08   Mustela putorius furo [black ferret]
ref|XP_010961314.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  65.1    1e-08   Camelus bactrianus [camel]
ref|XP_004755201.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  65.1    1e-08   Mustela putorius furo [black ferret]
ref|XP_004801249.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    65.1    1e-08   
ref|XP_010845303.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  65.1    1e-08   Bison bison bison
ref|XP_010372961.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  65.1    1e-08   Rhinopithecus roxellana
ref|XP_009004155.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  65.1    1e-08   Callithrix jacchus [common marmoset]
ref|XP_006056670.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  65.1    1e-08   
ref|XP_006116431.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  65.1    1e-08   Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_006056668.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  65.1    1e-08   
ref|XP_005695269.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  65.1    1e-08   
ref|XP_005377020.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  65.1    1e-08   
ref|XP_011222354.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  65.1    1e-08   Ailuropoda melanoleuca
ref|XP_010372959.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  65.1    1e-08   Rhinopithecus roxellana
ref|XP_005222130.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  65.1    1e-08   Bos taurus [bovine]
ref|XP_005377022.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  65.1    1e-08   
ref|XP_006056669.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  65.1    1e-08   
ref|XP_010845301.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  65.1    1e-08   Bison bison bison
ref|XP_009004153.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  65.1    1e-08   Callithrix jacchus [common marmoset]
ref|XP_006056667.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  65.1    1e-08   
ref|XP_005695268.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  65.1    1e-08   
ref|XP_011222356.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  65.1    1e-08   Ailuropoda melanoleuca
ref|XP_007984591.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  65.1    1e-08   Chlorocebus sabaeus
ref|XP_007098141.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  65.1    1e-08   Panthera tigris altaica
ref|XP_005222132.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  65.1    1e-08   Bos taurus [bovine]
gb|ELK17058.1|  E3 ubiquitin-protein ligase HECTD1                    65.1    1e-08   Pteropus alecto
ref|XP_004055105.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    65.1    1e-08   
ref|XP_008972942.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  65.1    1e-08   Pan paniscus [bonobo]
ref|XP_007098140.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  65.1    1e-08   Panthera tigris altaica
ref|XP_005267560.2|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  65.1    1e-08   
ref|XP_005285366.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.7    1e-08   Chrysemys picta bellii
ref|XP_005285367.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.7    1e-08   
ref|XP_001844071.1|  E3 ubiquitin-protein ligase HECTD1               64.7    1e-08   Culex quinquefasciatus
ref|XP_008565372.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.7    1e-08   Galeopterus variegatus [Malayan flying lemur]
ref|XP_010631865.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.7    1e-08   Fukomys damarensis [Damara mole rat]
ref|XP_010631864.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.7    1e-08   Fukomys damarensis [Damara mole rat]
ref|XP_008101614.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.7    1e-08   Anolis carolinensis [Carolina anole]
ref|XP_007113428.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.7    1e-08   
ref|XP_008101615.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.7    1e-08   Anolis carolinensis [Carolina anole]
ref|XP_008101612.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.7    1e-08   Anolis carolinensis [Carolina anole]
ref|XP_007472588.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.7    1e-08   Monodelphis domestica
ref|XP_007660828.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.7    1e-08   
ref|XP_010214811.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.7    1e-08   Tinamus guttatus
ref|XP_007660814.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.7    1e-08   Ornithorhynchus anatinus [duck-billed platypus]
ref|XP_007472586.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.7    1e-08   Monodelphis domestica
ref|XP_010333267.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.7    1e-08   Saimiri boliviensis boliviensis
ref|XP_003924275.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.7    1e-08   Saimiri boliviensis boliviensis
ref|XP_008267700.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.7    1e-08   Oryctolagus cuniculus [domestic rabbit]
ref|XP_645290.1|  hypothetical protein DDB_G0272218                   64.3    1e-08   Dictyostelium discoideum AX4
ref|XP_004612165.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    64.7    1e-08   Sorex araneus [Eurasian shrew]
ref|XP_008267702.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.7    1e-08   Oryctolagus cuniculus [domestic rabbit]
ref|XP_008565371.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.7    1e-08   Galeopterus variegatus [Malayan flying lemur]
gb|ELW63202.1|  E3 ubiquitin-protein ligase HECTD1                    64.7    1e-08   Tupaia chinensis
ref|XP_006766087.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    64.7    1e-08   
ref|XP_004376588.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    64.7    1e-08   
ref|XP_006263085.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.7    1e-08   
ref|XP_006022320.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.7    1e-08   
ref|XP_004755202.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.7    1e-08   Mustela putorius furo [black ferret]
ref|XP_004637178.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    64.7    1e-08   
ref|XP_010961313.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.7    1e-08   Camelus bactrianus [camel]
ref|XP_004755200.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.7    1e-08   Mustela putorius furo [black ferret]
ref|XP_004755199.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.7    1e-08   Mustela putorius furo [black ferret]
ref|XP_004755198.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.7    1e-08   Mustela putorius furo [black ferret]
ref|XP_850301.2|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin-pr...  64.7    1e-08   Canis lupus familiaris [dogs]
gb|KFV19064.1|  E3 ubiquitin-protein ligase HECTD1                    64.7    1e-08   Tauraco erythrolophus
ref|XP_010572563.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.7    1e-08   Haliaeetus leucocephalus
ref|XP_011281667.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    64.7    1e-08   
ref|XP_010586874.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.7    1e-08   Loxodonta africana [African bush elephant]
ref|XP_006116430.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.7    1e-08   Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_006116428.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.7    1e-08   Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_010984469.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...  64.7    1e-08   Camelus dromedarius [camel]
ref|XP_008708622.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...  64.7    1e-08   Ursus maritimus [white bear]
ref|XP_007516893.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    64.7    1e-08   Erinaceus europaeus [common hedgehog]
ref|XP_005881052.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.7    1e-08   Myotis brandtii
ref|XP_004584798.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    64.7    1e-08   Ochotona princeps [southern American pika]
ref|XP_003408766.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.7    1e-08   
gb|AAP13073.1|  E3 ligase for inhibin receptor                        64.7    1e-08   
ref|XP_006263086.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.7    1e-08   
ref|XP_006116432.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.7    1e-08   
ref|XP_006263084.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.7    1e-08   
ref|XP_006022319.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.7    1e-08   
ref|XP_010572562.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.7    1e-08   
gb|ETN62256.1|  hect E3 ubiquitin ligase                              64.7    1e-08   
ref|XP_003792055.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    64.7    1e-08   
ref|XP_011222355.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.7    1e-08   
ref|XP_010845302.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.7    1e-08   
ref|XP_010372960.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.7    1e-08   
ref|XP_008972943.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.7    1e-08   
ref|XP_009004154.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.7    1e-08   
ref|XP_007984590.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.7    1e-08   
ref|XP_005377021.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.7    1e-08   
ref|XP_005222131.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.7    1e-08   
ref|XP_004467984.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.7    1e-08   
gb|KFO93631.1|  E3 ubiquitin-protein ligase HECTD1                    64.3    1e-08   
ref|XP_010586872.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.7    1e-08   
ref|XP_011374705.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.7    1e-08   
ref|XP_011222353.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.7    1e-08   
ref|XP_010845300.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.7    1e-08   
ref|XP_010372958.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.7    1e-08   
ref|XP_008972941.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.7    1e-08   
ref|XP_009004152.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.7    1e-08   
ref|XP_007984588.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.7    1e-08   
ref|XP_007098139.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.7    1e-08   
ref|XP_005222129.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.7    1e-08   
ref|XP_004467982.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.7    1e-08   
gb|ELR60436.1|  E3 ubiquitin-protein ligase HECTD1                    64.7    1e-08   
ref|XP_006152455.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    64.7    1e-08   
ref|XP_011374703.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.7    1e-08   
ref|XP_010372956.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.7    1e-08   
ref|XP_008071204.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    64.7    1e-08   
ref|XP_002918561.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.7    1e-08   
ref|XP_002696742.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.7    1e-08   
ref|XP_006056666.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.7    1e-08   
ref|XP_007098138.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.7    1e-08   
ref|XP_006906925.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...  64.7    1e-08   
ref|XP_006890036.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    64.7    1e-08   
ref|XP_006191324.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    64.7    1e-08   
ref|XP_005890166.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    64.7    1e-08   
ref|XP_005377018.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.7    1e-08   
ref|XP_004467981.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.7    1e-08   
ref|XP_004421198.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    64.7    1e-08   
ref|XP_004017927.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    64.7    1e-08   
ref|XP_003821255.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.7    1e-08   
ref|XP_001924707.4|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...  64.7    1e-08   
ref|XP_003260766.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    64.7    1e-08   
ref|XP_002753836.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.7    1e-08   
sp|Q9ULT8.3|HECD1_HUMAN  RecName: Full=E3 ubiquitin-protein ligas...  64.7    1e-08   
ref|NP_001248188.1|  E3 ubiquitin-protein ligase HECTD1               64.7    1e-08   
ref|XP_010140687.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    64.3    1e-08   
gb|EPQ16917.1|  E3 ubiquitin-protein ligase HECTD1                    64.7    1e-08   
ref|XP_010709956.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    1e-08   
ref|XP_010572566.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    1e-08   
ref|XP_010390313.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    1e-08   
ref|XP_009317632.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    1e-08   
ref|XP_005020674.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    1e-08   
ref|XP_010709953.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    1e-08   
ref|XP_010390298.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    1e-08   
ref|XP_009317630.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    1e-08   
ref|XP_005020671.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    1e-08   
ref|XP_008101613.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    1e-08   
ref|XP_010709952.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    1e-08   
ref|XP_010390290.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    1e-08   
ref|XP_009288638.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    1e-08   
ref|XP_005020668.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    1e-08   
ref|XP_010214809.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    1e-08   
ref|XP_006022318.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    1e-08   
ref|XP_008101609.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    1e-08   
ref|XP_008101608.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    1e-08   
ref|XP_006085911.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    1e-08   
ref|XP_008267701.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    1e-08   
ref|XP_009288633.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    1e-08   
ref|XP_008267699.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    1e-08   
ref|XP_007180745.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...  64.3    1e-08   
ref|XP_002718172.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    1e-08   
ref|XP_006835428.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    64.3    1e-08   
ref|XP_009288642.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    1e-08   
ref|XP_009317628.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    1e-08   
ref|XP_004941800.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    1e-08   
ref|XP_008101611.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    1e-08   
ref|XP_008101607.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    1e-08   
gb|EMC83831.1|  E3 ubiquitin-protein ligase HECTD1                    64.3    1e-08   
ref|XP_009288640.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    1e-08   
ref|XP_007660818.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    1e-08   
ref|XP_007936773.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    64.3    1e-08   
ref|XP_009288639.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    1e-08   
gb|KFV93612.1|  E3 ubiquitin-protein ligase HECTD1                    64.3    1e-08   
ref|XP_007472585.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    1e-08   
ref|XP_007451326.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    64.3    2e-08   
ref|XP_007113426.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    2e-08   
ref|XP_004282185.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    64.3    2e-08   
ref|XP_009209622.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    2e-08   
ref|XP_007472587.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    2e-08   
ref|XP_003464797.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...  64.3    2e-08   
ref|XP_008565370.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    2e-08   
ref|XP_007660823.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    2e-08   
ref|XP_007660811.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    2e-08   
ref|XP_001512305.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    2e-08   
ref|XP_001364091.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    2e-08   
gb|KGL94873.1|  E3 ubiquitin-protein ligase HECTD1                    64.3    2e-08   
ref|XP_009288631.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    2e-08   
gb|KFP02468.1|  E3 ubiquitin-protein ligase HECTD1                    64.3    2e-08   
ref|XP_007113427.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    2e-08   
ref|XP_009209621.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    2e-08   
ref|XP_005561083.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    2e-08   
ref|XP_005561082.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    2e-08   
ref|XP_006729616.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    64.3    2e-08   
ref|XP_004400006.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    64.3    2e-08   
ref|XP_004361480.1|  BTB/POZ domain-containing protein                63.9    2e-08   
ref|XP_003756170.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    64.3    2e-08   
ref|XP_004324112.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    64.3    2e-08   
ref|XP_009288641.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    2e-08   
ref|XP_009288636.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    2e-08   
ref|XP_009288632.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    2e-08   
ref|XP_010709954.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    2e-08   
ref|XP_009806354.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    64.3    2e-08   
ref|XP_009317629.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    2e-08   
gb|KFP99363.1|  E3 ubiquitin-protein ligase HECTD1                    64.3    2e-08   
ref|XP_010709951.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    2e-08   
ref|XP_010307144.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    64.3    2e-08   
ref|XP_010151091.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    64.3    2e-08   
ref|XP_009951548.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    64.3    2e-08   
ref|XP_009942450.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    64.3    2e-08   
ref|XP_009877228.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    64.3    2e-08   
ref|XP_009668205.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    64.3    2e-08   
ref|XP_009574994.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    64.3    2e-08   
ref|XP_009462362.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    64.3    2e-08   
ref|XP_009100181.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    64.3    2e-08   
ref|XP_005149352.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    64.3    2e-08   
ref|XP_005020673.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    2e-08   
ref|XP_010709950.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    2e-08   
ref|XP_010390277.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    2e-08   
ref|XP_009288635.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    2e-08   
ref|XP_009317624.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    2e-08   
ref|XP_009288634.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    2e-08   
ref|XP_009317623.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    2e-08   
ref|XP_009317622.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    2e-08   
ref|XP_005020666.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    2e-08   
ref|XP_005020665.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    2e-08   
ref|XP_005951436.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    2e-08   
ref|XP_009317631.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    2e-08   
ref|XP_010169085.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    64.3    2e-08   
ref|XP_009317626.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    2e-08   
ref|XP_005520368.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    64.3    2e-08   
ref|XP_002200542.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    64.3    2e-08   
gb|EOB00564.1|  E3 ubiquitin-protein ligase HECTD1                    64.3    2e-08   
ref|XP_009317621.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    2e-08   
ref|XP_009317620.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    2e-08   
ref|XP_421227.3|  PREDICTED: E3 ubiquitin-protein ligase HECTD1 i...  64.3    2e-08   
ref|XP_009986276.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    64.3    2e-08   
ref|XP_010286320.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    64.3    2e-08   
ref|XP_010015718.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    64.3    2e-08   
ref|XP_005020669.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    2e-08   
ref|XP_010572565.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    2e-08   
ref|XP_010572561.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    2e-08   
ref|XP_010125887.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    64.3    2e-08   
ref|XP_009644998.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    64.3    2e-08   
ref|XP_009561891.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    64.3    2e-08   
ref|XP_008923247.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    64.3    2e-08   
ref|XP_008637792.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    64.3    2e-08   
ref|XP_005417553.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    64.3    2e-08   
ref|XP_005479915.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    64.3    2e-08   
ref|XP_009317625.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    2e-08   
ref|XP_010709948.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    2e-08   
gb|KFP49559.1|  E3 ubiquitin-protein ligase HECTD1                    64.3    2e-08   
ref|XP_010709955.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    2e-08   
ref|XP_010390306.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    2e-08   
ref|XP_005020670.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    2e-08   
ref|XP_010572559.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    2e-08   
ref|XP_009992149.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    64.3    2e-08   
ref|XP_009698490.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    64.3    2e-08   
gb|KFP65021.1|  E3 ubiquitin-protein ligase HECTD1                    64.3    2e-08   
ref|XP_010572558.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    2e-08   
ref|XP_010709949.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    2e-08   
ref|XP_010390270.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    2e-08   
ref|XP_004941799.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    2e-08   
ref|XP_010390263.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    2e-08   
ref|XP_005020667.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    2e-08   
ref|XP_005020664.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    2e-08   
ref|XP_005020672.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  64.3    2e-08   
gb|KFV06434.1|  E3 ubiquitin-protein ligase HECTD1                    63.9    2e-08   
ref|XP_010572564.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  63.9    2e-08   
ref|XP_010572556.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  63.9    2e-08   
ref|XP_004941798.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  63.9    2e-08   
gb|EHH27804.1|  hypothetical protein EGK_18090                        63.9    2e-08   
ref|XP_009209620.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  63.9    2e-08   
dbj|BAA86445.2|  KIAA1131 protein                                     63.9    2e-08   
ref|XP_004941801.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  63.9    2e-08   
ref|XP_005502361.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    63.9    2e-08   
ref|XP_010572557.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  63.9    2e-08   
ref|XP_004941797.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  63.9    2e-08   
ref|XP_005456015.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  63.9    2e-08   
ref|XP_009507570.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    63.9    2e-08   
ref|XP_008494127.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    63.9    2e-08   
ref|XP_008312937.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  63.9    2e-08   
ref|XP_009885241.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    63.9    2e-08   
ref|XP_010071203.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    63.9    2e-08   
ref|NP_001131085.1|  HECT domain containing E3 ubiquitin protein ...  63.9    2e-08   
ref|XP_009075355.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    63.9    2e-08   
ref|XP_005090788.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  63.9    2e-08   
ref|XP_008942534.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    63.9    2e-08   
ref|XP_005047457.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    63.9    2e-08   
ref|XP_004698576.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    63.9    2e-08   
ref|XP_005603479.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  63.9    2e-08   
ref|XP_005603477.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  63.9    2e-08   
ref|XP_005603476.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  63.9    2e-08   
ref|XP_005603478.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  63.9    2e-08   
ref|XP_008521116.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  63.9    2e-08   
ref|XP_008521118.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  63.9    2e-08   
ref|XP_002004091.1|  GI19489                                          63.9    2e-08   
ref|XP_008159020.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    63.9    2e-08   
ref|XP_005456014.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  63.5    3e-08   
ref|XP_005456013.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  63.5    3e-08   
ref|XP_008312929.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  63.5    3e-08   
ref|XP_008312922.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  63.5    3e-08   
ref|XP_009968713.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    63.5    3e-08   
ref|XP_005240951.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    63.5    3e-08   



>ref|XP_006342130.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X2 [Solanum tuberosum]
 ref|XP_006342131.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X3 [Solanum tuberosum]
Length=804

 Score =   274 bits (700),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 124/152 (82%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            PVLSKRV +TASSP SR TDPKVLVSRNFQGTS AGPQ+E G  +SWWM+D+G DHQLMC
Sbjct  653  PVLSKRVIITASSPISRCTDPKVLVSRNFQGTSVAGPQMEGGRNASWWMVDIGPDHQLMC  712

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
            NYYT+RQDGSRAF+R WNFQGS DG NWTNLRVH++DQTICKPGQFASWPITG N LLPF
Sbjct  713  NYYTLRQDGSRAFIRRWNFQGSLDGKNWTNLRVHENDQTICKPGQFASWPITGSNALLPF  772

Query  308  RFFRIVMTGPGTDGMNPWNCCICVLELYGYFR  213
            RFFR++MTGP TD  NPWNCCIC LELYGYFR
Sbjct  773  RFFRVLMTGPTTDDTNPWNCCICFLELYGYFR  804



>ref|XP_006342129.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X1 [Solanum tuberosum]
Length=824

 Score =   274 bits (700),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/152 (82%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            PVLSKRV +TASSP SR TDPKVLVSRNFQGTS AGPQ+E G  +SWWM+D+G DHQLMC
Sbjct  673  PVLSKRVIITASSPISRCTDPKVLVSRNFQGTSVAGPQMEGGRNASWWMVDIGPDHQLMC  732

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
            NYYT+RQDGSRAF+R WNFQGS DG NWTNLRVH++DQTICKPGQFASWPITG N LLPF
Sbjct  733  NYYTLRQDGSRAFIRRWNFQGSLDGKNWTNLRVHENDQTICKPGQFASWPITGSNALLPF  792

Query  308  RFFRIVMTGPGTDGMNPWNCCICVLELYGYFR  213
            RFFR++MTGP TD  NPWNCCIC LELYGYFR
Sbjct  793  RFFRVLMTGPTTDDTNPWNCCICFLELYGYFR  824



>ref|XP_004238427.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Solanum lycopersicum]
 ref|XP_010320456.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Solanum lycopersicum]
Length=804

 Score =   269 bits (688),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            PVLSKRV +TASSP SR TDPKVLVSRNFQGTS AGPQ+E G  +SWWM+D+G DHQLMC
Sbjct  653  PVLSKRVIITASSPISRCTDPKVLVSRNFQGTSVAGPQMEGGRNTSWWMVDIGPDHQLMC  712

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
            NYYT+RQDGSRAF+R WN QGS DG +WTNLRVH++DQTICKPGQFASWP+TG N LLPF
Sbjct  713  NYYTLRQDGSRAFIRRWNLQGSLDGKSWTNLRVHENDQTICKPGQFASWPVTGSNALLPF  772

Query  308  RFFRIVMTGPGTDGMNPWNCCICVLELYGYFR  213
            RFFR++MTGP TD  NPWNCCIC LELYGYFR
Sbjct  773  RFFRVLMTGPTTDDTNPWNCCICFLELYGYFR  804



>ref|XP_010320455.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X1 [Solanum lycopersicum]
Length=824

 Score =   269 bits (688),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            PVLSKRV +TASSP SR TDPKVLVSRNFQGTS AGPQ+E G  +SWWM+D+G DHQLMC
Sbjct  673  PVLSKRVIITASSPISRCTDPKVLVSRNFQGTSVAGPQMEGGRNTSWWMVDIGPDHQLMC  732

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
            NYYT+RQDGSRAF+R WN QGS DG +WTNLRVH++DQTICKPGQFASWP+TG N LLPF
Sbjct  733  NYYTLRQDGSRAFIRRWNLQGSLDGKSWTNLRVHENDQTICKPGQFASWPVTGSNALLPF  792

Query  308  RFFRIVMTGPGTDGMNPWNCCICVLELYGYFR  213
            RFFR++MTGP TD  NPWNCCIC LELYGYFR
Sbjct  793  RFFRVLMTGPTTDDTNPWNCCICFLELYGYFR  824



>ref|XP_009631576.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X3 [Nicotiana tomentosiformis]
Length=804

 Score =   268 bits (684),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            PVLSKRV +TASSP SR TDPKVLVSRNFQGTS AGPQ+E G  +SWWM+D+G DHQLMC
Sbjct  653  PVLSKRVSITASSPISRCTDPKVLVSRNFQGTSLAGPQMEGGRNTSWWMVDVGQDHQLMC  712

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
            NYYT+RQDGSRAFMR WNFQGS DG +WTNLRVH++DQ+ICKP QFASWPIT PN LLPF
Sbjct  713  NYYTLRQDGSRAFMRRWNFQGSLDGKSWTNLRVHENDQSICKPCQFASWPITDPNALLPF  772

Query  308  RFFRIVMTGPGTDGMNPWNCCICVLELYGYFR  213
            RFFR++M+ P TD  NPWNCCIC LELYGYFR
Sbjct  773  RFFRVLMSAPTTDDTNPWNCCICFLELYGYFR  804



>ref|XP_009631572.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X1 [Nicotiana tomentosiformis]
Length=826

 Score =   268 bits (684),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            PVLSKRV +TASSP SR TDPKVLVSRNFQGTS AGPQ+E G  +SWWM+D+G DHQLMC
Sbjct  675  PVLSKRVSITASSPISRCTDPKVLVSRNFQGTSLAGPQMEGGRNTSWWMVDVGQDHQLMC  734

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
            NYYT+RQDGSRAFMR WNFQGS DG +WTNLRVH++DQ+ICKP QFASWPIT PN LLPF
Sbjct  735  NYYTLRQDGSRAFMRRWNFQGSLDGKSWTNLRVHENDQSICKPCQFASWPITDPNALLPF  794

Query  308  RFFRIVMTGPGTDGMNPWNCCICVLELYGYFR  213
            RFFR++M+ P TD  NPWNCCIC LELYGYFR
Sbjct  795  RFFRVLMSAPTTDDTNPWNCCICFLELYGYFR  826



>ref|XP_009631574.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Nicotiana tomentosiformis]
 ref|XP_009631575.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Nicotiana tomentosiformis]
Length=824

 Score =   267 bits (683),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            PVLSKRV +TASSP SR TDPKVLVSRNFQGTS AGPQ+E G  +SWWM+D+G DHQLMC
Sbjct  673  PVLSKRVSITASSPISRCTDPKVLVSRNFQGTSLAGPQMEGGRNTSWWMVDVGQDHQLMC  732

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
            NYYT+RQDGSRAFMR WNFQGS DG +WTNLRVH++DQ+ICKP QFASWPIT PN LLPF
Sbjct  733  NYYTLRQDGSRAFMRRWNFQGSLDGKSWTNLRVHENDQSICKPCQFASWPITDPNALLPF  792

Query  308  RFFRIVMTGPGTDGMNPWNCCICVLELYGYFR  213
            RFFR++M+ P TD  NPWNCCIC LELYGYFR
Sbjct  793  RFFRVLMSAPTTDDTNPWNCCICFLELYGYFR  824



>ref|XP_004291228.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Fragaria 
vesca subsp. vesca]
 ref|XP_011459073.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Fragaria 
vesca subsp. vesca]
Length=803

 Score =   263 bits (673),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            PVL+KR+ +TASSP SRFTDPKVLVSR +QGTSFAGP +EDG  ++WWM+D+G DHQL+C
Sbjct  652  PVLAKRITITASSPPSRFTDPKVLVSRTYQGTSFAGPHIEDGRNNTWWMVDIGADHQLIC  711

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
            NYYT+R DGSRA+MR WNFQGS DG  WTNLRVH++DQTICKPGQFASWP+TGPN LLPF
Sbjct  712  NYYTLRHDGSRAYMRYWNFQGSLDGKTWTNLRVHENDQTICKPGQFASWPVTGPNALLPF  771

Query  308  RFFRIVMTGPGTDGMNPWNCCICVLELYGYFR  213
            RFFR+V+TGP  D  NPWN CIC LELYGYF 
Sbjct  772  RFFRVVLTGPTMDASNPWNFCICFLELYGYFH  803



>ref|XP_002510674.1| protein binding protein, putative [Ricinus communis]
 gb|EEF52861.1| protein binding protein, putative [Ricinus communis]
Length=806

 Score =   263 bits (672),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            PVL+KR+ +TASSP  R TDPK LVSR +QGTSFAGP++EDGN  +WWM+D+G DHQLMC
Sbjct  655  PVLAKRITITASSPTLRHTDPKALVSRTYQGTSFAGPRMEDGNKCAWWMVDIGKDHQLMC  714

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
            NYYT+RQDGSRA++R WN QGS DG +WTNLRVHKDDQT+CKPGQFASWPITGPN LLPF
Sbjct  715  NYYTLRQDGSRAYIRFWNLQGSLDGKSWTNLRVHKDDQTVCKPGQFASWPITGPNSLLPF  774

Query  308  RFFRIVMTGPGTDGMNPWNCCICVLELYGYFR  213
            RFFR+++TGP TD  +PWN CIC LELYGYFR
Sbjct  775  RFFRVILTGPTTDVSDPWNLCICFLELYGYFR  806



>ref|XP_002879271.1| BTB/POZ domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55530.1| BTB/POZ domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
Length=809

 Score =   263 bits (671),  Expect = 1e-78, Method: Composition-based stats.
 Identities = 111/152 (73%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            PVL+K++ +T+SSP SRFTDPK L S+ + GTSFAGP++EDG+ISSWWM+DLG DHQLMC
Sbjct  658  PVLAKKIIITSSSPTSRFTDPKALASKTYVGTSFAGPRMEDGHISSWWMVDLGEDHQLMC  717

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
            NYYT RQDGSRAF RSW FQGS DG  WT+LRVH+DDQT+CK GQFASWPIT  N LLPF
Sbjct  718  NYYTFRQDGSRAFTRSWKFQGSMDGKTWTDLRVHEDDQTMCKAGQFASWPITAANALLPF  777

Query  308  RFFRIVMTGPGTDGMNPWNCCICVLELYGYFR  213
            RFFR+V+TGP  D   PWN CIC LELYGY+R
Sbjct  778  RFFRLVLTGPTADTSTPWNFCICYLELYGYYR  809



>ref|XP_006293695.1| hypothetical protein CARUB_v10022653mg [Capsella rubella]
 gb|EOA26593.1| hypothetical protein CARUB_v10022653mg [Capsella rubella]
Length=809

 Score =   262 bits (669),  Expect = 3e-78, Method: Composition-based stats.
 Identities = 111/152 (73%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            PVL+K++ +T+SSP SRFTDPK L S+ + GTSFAGP++E G+ISSWWM+DLG DHQLMC
Sbjct  658  PVLAKKIIITSSSPTSRFTDPKALASKTYVGTSFAGPRMEGGHISSWWMVDLGEDHQLMC  717

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
            NYYT RQDGSRAF RSW FQGS DG  WT+LR+H+DDQT+CK GQFASWPIT  N LLPF
Sbjct  718  NYYTFRQDGSRAFTRSWKFQGSMDGKTWTDLRIHEDDQTMCKVGQFASWPITAANALLPF  777

Query  308  RFFRIVMTGPGTDGMNPWNCCICVLELYGYFR  213
            RFFR+V+TGP TD   PWN CIC LELYGYFR
Sbjct  778  RFFRLVLTGPTTDTSTPWNFCICYLELYGYFR  809



>gb|KJB57964.1| hypothetical protein B456_009G187700 [Gossypium raimondii]
 gb|KJB57965.1| hypothetical protein B456_009G187700 [Gossypium raimondii]
Length=802

 Score =   261 bits (667),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            PVLSKR+ +TASSP SR TDPKVLVSR +QGT FAGP++E+GNI +WWM+D+G DHQLMC
Sbjct  651  PVLSKRITITASSPASRHTDPKVLVSRTYQGTCFAGPRMENGNICAWWMVDIGKDHQLMC  710

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
            NYYT+RQDGSRA++R+W FQG  DG  W +LRVH++DQT+CKPGQFASWP+TGPN LLPF
Sbjct  711  NYYTLRQDGSRAYIRNWKFQGCMDGKTWIDLRVHENDQTMCKPGQFASWPVTGPNALLPF  770

Query  308  RFFRIVMTGPGTDGMNPWNCCICVLELYGYFR  213
            RFFR+++TGP TD  NPWN CIC LELYGYFR
Sbjct  771  RFFRVLLTGPTTDASNPWNLCICFLELYGYFR  802



>dbj|BAD95193.1| hypothetical protein [Arabidopsis thaliana]
Length=331

 Score =   248 bits (634),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 127/152 (84%), Gaps = 0/152 (0%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            PVL+K++ +T+SSP SRFTDPK L S+ + GTSFAGP++EDG+ISSWW++DLG +HQLMC
Sbjct  180  PVLAKKINITSSSPTSRFTDPKALASKAYAGTSFAGPRMEDGHISSWWVVDLGEEHQLMC  239

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
            NYYT RQDGSRAF R W FQGS DG  WT+LRVH+DDQT+CK GQFASWPIT  N LLPF
Sbjct  240  NYYTFRQDGSRAFTRFWKFQGSMDGKTWTDLRVHEDDQTMCKAGQFASWPITAANALLPF  299

Query  308  RFFRIVMTGPGTDGMNPWNCCICVLELYGYFR  213
            RFFR+V+TGP  D   PWN CIC LELYGYFR
Sbjct  300  RFFRLVLTGPTADTSTPWNFCICYLELYGYFR  331



>ref|XP_010469824.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X1 [Camelina sativa]
Length=823

 Score =   260 bits (665),  Expect = 1e-77, Method: Composition-based stats.
 Identities = 111/152 (73%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            PVL+K++ +T+SSP SRFTDPK L S+ + GTSFAGP++E G+ISSWWM+DLG DHQLMC
Sbjct  672  PVLAKKIIITSSSPTSRFTDPKALASKAYVGTSFAGPRMEGGHISSWWMVDLGEDHQLMC  731

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
            NYYT RQDGSRAF RSW FQGS DG  WT+LRVH+DDQT+CK GQFASWPIT  N LLPF
Sbjct  732  NYYTFRQDGSRAFTRSWKFQGSMDGKIWTDLRVHEDDQTMCKAGQFASWPITAANALLPF  791

Query  308  RFFRIVMTGPGTDGMNPWNCCICVLELYGYFR  213
            RFFR+V+TGP TD   PWN CIC LELYGY+R
Sbjct  792  RFFRLVLTGPTTDTSTPWNFCICYLELYGYYR  823



>ref|XP_010469826.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X3 [Camelina sativa]
 ref|XP_010469827.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X3 [Camelina sativa]
 ref|XP_010469828.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X3 [Camelina sativa]
 ref|XP_010469829.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X3 [Camelina sativa]
Length=809

 Score =   260 bits (664),  Expect = 1e-77, Method: Composition-based stats.
 Identities = 111/152 (73%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            PVL+K++ +T+SSP SRFTDPK L S+ + GTSFAGP++E G+ISSWWM+DLG DHQLMC
Sbjct  658  PVLAKKIIITSSSPTSRFTDPKALASKAYVGTSFAGPRMEGGHISSWWMVDLGEDHQLMC  717

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
            NYYT RQDGSRAF RSW FQGS DG  WT+LRVH+DDQT+CK GQFASWPIT  N LLPF
Sbjct  718  NYYTFRQDGSRAFTRSWKFQGSMDGKIWTDLRVHEDDQTMCKAGQFASWPITAANALLPF  777

Query  308  RFFRIVMTGPGTDGMNPWNCCICVLELYGYFR  213
            RFFR+V+TGP TD   PWN CIC LELYGY+R
Sbjct  778  RFFRLVLTGPTTDTSTPWNFCICYLELYGYYR  809



>ref|XP_010414240.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like [Camelina 
sativa]
Length=824

 Score =   260 bits (664),  Expect = 2e-77, Method: Composition-based stats.
 Identities = 110/152 (72%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            PVL+K++ +T+SSP SRFTDPK L S+ + GTSFAGP++E G+ISSWWM+DLG DHQLMC
Sbjct  673  PVLAKKIIITSSSPTSRFTDPKALASKAYVGTSFAGPRMEGGHISSWWMVDLGEDHQLMC  732

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
            NYYT RQDGSRAF RSW FQGS DG  WT+LRVH+DDQT+CK GQFASWPIT  N LLPF
Sbjct  733  NYYTFRQDGSRAFTRSWKFQGSMDGRTWTDLRVHEDDQTMCKAGQFASWPITAANALLPF  792

Query  308  RFFRIVMTGPGTDGMNPWNCCICVLELYGYFR  213
            RFFR+++TGP TD   PWN CIC LELYGY+R
Sbjct  793  RFFRLLLTGPTTDTSTPWNFCICYLELYGYYR  824



>ref|XP_008452951.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Cucumis 
melo]
 ref|XP_008452952.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Cucumis 
melo]
 ref|XP_008452953.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Cucumis 
melo]
Length=806

 Score =   259 bits (663),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 112/151 (74%), Positives = 130/151 (86%), Gaps = 0/151 (0%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            P+LSK++ +T SSP SR+TDPKVLVSR +QGTSFAG +VEDG   SWWM+D+G DHQLMC
Sbjct  655  PILSKKITITTSSPPSRYTDPKVLVSRTYQGTSFAGLRVEDGKTCSWWMVDIGEDHQLMC  714

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
            NYYT+RQDGSRAF+R WN QGS DG  WTNLRVH++DQT+CKPGQFASWP+TGPN LLPF
Sbjct  715  NYYTLRQDGSRAFIRYWNLQGSLDGKTWTNLRVHENDQTVCKPGQFASWPVTGPNALLPF  774

Query  308  RFFRIVMTGPGTDGMNPWNCCICVLELYGYF  216
            RFFR+++T P TD  NPWN CIC LELYGYF
Sbjct  775  RFFRVLLTAPTTDASNPWNLCICFLELYGYF  805



>ref|XP_010469825.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X2 [Camelina sativa]
Length=818

 Score =   259 bits (663),  Expect = 2e-77, Method: Composition-based stats.
 Identities = 111/152 (73%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            PVL+K++ +T+SSP SRFTDPK L S+ + GTSFAGP++E G+ISSWWM+DLG DHQLMC
Sbjct  667  PVLAKKIIITSSSPTSRFTDPKALASKAYVGTSFAGPRMEGGHISSWWMVDLGEDHQLMC  726

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
            NYYT RQDGSRAF RSW FQGS DG  WT+LRVH+DDQT+CK GQFASWPIT  N LLPF
Sbjct  727  NYYTFRQDGSRAFTRSWKFQGSMDGKIWTDLRVHEDDQTMCKAGQFASWPITAANALLPF  786

Query  308  RFFRIVMTGPGTDGMNPWNCCICVLELYGYFR  213
            RFFR+V+TGP TD   PWN CIC LELYGY+R
Sbjct  787  RFFRLVLTGPTTDTSTPWNFCICYLELYGYYR  818



>gb|KFK23322.1| hypothetical protein AALP_AAs74635U001200 [Arabis alpina]
Length=807

 Score =   259 bits (663),  Expect = 2e-77, Method: Composition-based stats.
 Identities = 110/152 (72%), Positives = 127/152 (84%), Gaps = 0/152 (0%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            PVL+K++ +T+SSP SRFTDPK L S+ + GTSFAGP++EDG+ISSWWM+DLG DHQLMC
Sbjct  656  PVLAKKIIITSSSPTSRFTDPKALASKTYVGTSFAGPRMEDGHISSWWMVDLGEDHQLMC  715

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
            NYYT RQDGSRAF RSW FQGS DG  WT+LRVH++DQT+CK GQFASWPIT  N LLPF
Sbjct  716  NYYTFRQDGSRAFTRSWKFQGSMDGKTWTDLRVHENDQTMCKAGQFASWPITAANALLPF  775

Query  308  RFFRIVMTGPGTDGMNPWNCCICVLELYGYFR  213
            RFFR+V+TGP  D   PWN CIC LELYGY R
Sbjct  776  RFFRLVLTGPTVDTSTPWNFCICYLELYGYLR  807



>ref|XP_010061166.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Eucalyptus grandis]
 gb|KCW68087.1| hypothetical protein EUGRSUZ_F01772 [Eucalyptus grandis]
 gb|KCW68088.1| hypothetical protein EUGRSUZ_F01772 [Eucalyptus grandis]
Length=802

 Score =   259 bits (662),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 114/152 (75%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            PV++KR+ +TASSP SR+TDPKVLVSR FQGTSFAGP++EDG+  SWWM+D+G DHQLMC
Sbjct  651  PVIAKRIFITASSPISRYTDPKVLVSRTFQGTSFAGPRIEDGHNCSWWMVDIGEDHQLMC  710

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
            NYYT+RQDGSRA+MRSW  QGS DG +WT+LR H +DQTICKPGQFASWPITGPN LLPF
Sbjct  711  NYYTLRQDGSRAYMRSWKLQGSVDGSSWTDLRAHDNDQTICKPGQFASWPITGPNALLPF  770

Query  308  RFFRIVMTGPGTDGMNPWNCCICVLELYGYFR  213
            R+FR V+TGP T   NPWN  IC LELYGYFR
Sbjct  771  RYFRFVLTGPTTGASNPWNFSICFLELYGYFR  802



>emb|CDY29657.1| BnaA04g17700D [Brassica napus]
Length=844

 Score =   259 bits (663),  Expect = 3e-77, Method: Composition-based stats.
 Identities = 110/152 (72%), Positives = 127/152 (84%), Gaps = 0/152 (0%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            PVL+K++ +T+SSP SRFTDPK L S+ + GTSFAGP++EDG ISSWWM+DLG DHQLMC
Sbjct  693  PVLAKKIIITSSSPTSRFTDPKALASKTYVGTSFAGPRMEDGRISSWWMVDLGEDHQLMC  752

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
            NYYT RQDGSRA+ RSW FQGS DG  WT+LRVH++DQT+CK GQFASWPIT  N LLPF
Sbjct  753  NYYTFRQDGSRAYARSWKFQGSMDGNTWTDLRVHENDQTMCKAGQFASWPITAANALLPF  812

Query  308  RFFRIVMTGPGTDGMNPWNCCICVLELYGYFR  213
            RFFR+V+TGP  D   PWN CIC LELYGYFR
Sbjct  813  RFFRLVLTGPTADTSTPWNFCICYLELYGYFR  844



>gb|KHG01113.1| hypothetical protein F383_22949 [Gossypium arboreum]
Length=802

 Score =   258 bits (659),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            PVLSKR+ +TASSP SR TDPKVLVSR +QGT FAGP++E+GNI +WWM+D+G DHQLMC
Sbjct  651  PVLSKRITITASSPASRHTDPKVLVSRTYQGTCFAGPRMENGNICAWWMVDIGKDHQLMC  710

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
            NYYT+RQDGSRA++R+W FQG  DG  W +LRVH++DQT+CKPGQFASWP+TGPN LLPF
Sbjct  711  NYYTLRQDGSRAYIRNWKFQGCMDGKTWIDLRVHENDQTMCKPGQFASWPVTGPNALLPF  770

Query  308  RFFRIVMTGPGTDGMNPWNCCICVLELYGYFR  213
            RFFR+++TG  TD  NPWN CIC LELYGYFR
Sbjct  771  RFFRVLLTGLTTDASNPWNLCICFLELYGYFR  802



>ref|XP_008221133.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Prunus 
mume]
 ref|XP_008221134.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Prunus 
mume]
 ref|XP_008221135.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Prunus 
mume]
 ref|XP_008221136.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Prunus 
mume]
Length=805

 Score =   258 bits (659),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            PVL+KR+ +TASSP SRFTDPK LVSR +QGTSFAGPQ+ DG+  +WWM+D+  DHQL+C
Sbjct  654  PVLAKRITITASSPPSRFTDPKALVSRTYQGTSFAGPQIIDGHNCTWWMVDISADHQLIC  713

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
            NYYT+RQDGSRA+MR W FQGS DG  WTNLRVH++DQTICKPGQFASWP+TGPN LLP+
Sbjct  714  NYYTLRQDGSRAYMRYWKFQGSLDGKTWTNLRVHENDQTICKPGQFASWPVTGPNALLPY  773

Query  308  RFFRIVMTGPGTDGMNPWNCCICVLELYGYFR  213
            RFFR+V+TGP TD  NPWN CIC+LELYGY  
Sbjct  774  RFFRVVLTGPTTDASNPWNFCICLLELYGYLH  805



>ref|XP_007221940.1| hypothetical protein PRUPE_ppa001540mg [Prunus persica]
 gb|EMJ23139.1| hypothetical protein PRUPE_ppa001540mg [Prunus persica]
Length=805

 Score =   258 bits (659),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            PVL+KR+ +TASSP SRFTDPK LVSR +QGTSFAGPQ+ DG+  +WWM+D+  DHQL+C
Sbjct  654  PVLAKRITITASSPPSRFTDPKALVSRTYQGTSFAGPQIIDGHNCTWWMVDISADHQLIC  713

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
            NYYT+RQDGSR +MR W FQGS DG  WTNLRVH++DQTICKPGQFASWP+TGPN LLP+
Sbjct  714  NYYTLRQDGSRTYMRYWKFQGSLDGKTWTNLRVHENDQTICKPGQFASWPVTGPNALLPY  773

Query  308  RFFRIVMTGPGTDGMNPWNCCICVLELYGYFR  213
            RFFR+V+TGP TD  NPWN CIC+LELYGYF 
Sbjct  774  RFFRVVLTGPTTDASNPWNFCICLLELYGYFH  805



>ref|XP_010061165.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X1 [Eucalyptus grandis]
Length=853

 Score =   258 bits (660),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 114/152 (75%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            PV++KR+ +TASSP SR+TDPKVLVSR FQGTSFAGP++EDG+  SWWM+D+G DHQLMC
Sbjct  702  PVIAKRIFITASSPISRYTDPKVLVSRTFQGTSFAGPRIEDGHNCSWWMVDIGEDHQLMC  761

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
            NYYT+RQDGSRA+MRSW  QGS DG +WT+LR H +DQTICKPGQFASWPITGPN LLPF
Sbjct  762  NYYTLRQDGSRAYMRSWKLQGSVDGSSWTDLRAHDNDQTICKPGQFASWPITGPNALLPF  821

Query  308  RFFRIVMTGPGTDGMNPWNCCICVLELYGYFR  213
            R+FR V+TGP T   NPWN  IC LELYGYFR
Sbjct  822  RYFRFVLTGPTTGASNPWNFSICFLELYGYFR  853



>ref|XP_010510327.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Camelina 
sativa]
 ref|XP_010510328.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Camelina 
sativa]
Length=809

 Score =   258 bits (659),  Expect = 9e-77, Method: Composition-based stats.
 Identities = 111/152 (73%), Positives = 127/152 (84%), Gaps = 0/152 (0%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            PVL+K++ +T+SSP SRFTDPK L S+ + GTSFAGP++E G+ISSWWM+DLG DHQLMC
Sbjct  658  PVLAKKIIITSSSPTSRFTDPKALASKAYVGTSFAGPRMEGGHISSWWMVDLGEDHQLMC  717

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
            NYYT RQDGSRAF RSW FQGS DG  WT+LRVH+DDQT+CK GQFASWPIT  N LLPF
Sbjct  718  NYYTFRQDGSRAFTRSWKFQGSMDGKTWTDLRVHEDDQTMCKAGQFASWPITAANALLPF  777

Query  308  RFFRIVMTGPGTDGMNPWNCCICVLELYGYFR  213
            RFFR+V+TGP TD   PWN  IC LELYGYFR
Sbjct  778  RFFRLVLTGPTTDTSTPWNFYICYLELYGYFR  809



>ref|NP_180618.2| BTB/POZ domain-containing protein [Arabidopsis thaliana]
 ref|NP_850151.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
 ref|NP_001031447.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
 ref|NP_001031448.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
 sp|Q8LEV3.1|Y2060_ARATH RecName: Full=BTB/POZ domain-containing protein At2g30600 [Arabidopsis 
thaliana]
 gb|AAM62449.1| unknown [Arabidopsis thaliana]
 dbj|BAD42918.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43840.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD44307.1| unknown protein [Arabidopsis thaliana]
 gb|AEC08413.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
 gb|AEC08414.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
 gb|AEC08415.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
 gb|AEC08416.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
Length=809

 Score =   258 bits (658),  Expect = 1e-76, Method: Composition-based stats.
 Identities = 109/152 (72%), Positives = 127/152 (84%), Gaps = 0/152 (0%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            PVL+K++ +T+SSP SRFTDPK L S+ + GTSFAGP++EDG+ISSWW++DLG +HQLMC
Sbjct  658  PVLAKKINITSSSPTSRFTDPKALASKAYAGTSFAGPRMEDGHISSWWVVDLGEEHQLMC  717

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
            NYYT RQDGSRAF R W FQGS DG  WT+LRVH+DDQT+CK GQFASWPIT  N LLPF
Sbjct  718  NYYTFRQDGSRAFTRFWKFQGSMDGKTWTDLRVHEDDQTMCKAGQFASWPITAANALLPF  777

Query  308  RFFRIVMTGPGTDGMNPWNCCICVLELYGYFR  213
            RFFR+V+TGP  D   PWN CIC LELYGYFR
Sbjct  778  RFFRLVLTGPTADTSTPWNFCICYLELYGYFR  809



>ref|NP_001189642.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
 gb|AEC08417.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
Length=855

 Score =   257 bits (657),  Expect = 2e-76, Method: Composition-based stats.
 Identities = 109/152 (72%), Positives = 127/152 (84%), Gaps = 0/152 (0%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            PVL+K++ +T+SSP SRFTDPK L S+ + GTSFAGP++EDG+ISSWW++DLG +HQLMC
Sbjct  704  PVLAKKINITSSSPTSRFTDPKALASKAYAGTSFAGPRMEDGHISSWWVVDLGEEHQLMC  763

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
            NYYT RQDGSRAF R W FQGS DG  WT+LRVH+DDQT+CK GQFASWPIT  N LLPF
Sbjct  764  NYYTFRQDGSRAFTRFWKFQGSMDGKTWTDLRVHEDDQTMCKAGQFASWPITAANALLPF  823

Query  308  RFFRIVMTGPGTDGMNPWNCCICVLELYGYFR  213
            RFFR+V+TGP  D   PWN CIC LELYGYFR
Sbjct  824  RFFRLVLTGPTADTSTPWNFCICYLELYGYFR  855



>ref|XP_011074097.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Sesamum 
indicum]
Length=804

 Score =   256 bits (655),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 113/152 (74%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            PVLSK+V +T SSP SRFTDPKVLVSR++QGTSFAGP+ EDG  +SWWM+D+G+ HQLMC
Sbjct  653  PVLSKKVTITPSSPLSRFTDPKVLVSRSYQGTSFAGPRKEDGRTTSWWMVDIGHGHQLMC  712

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
            NYYT+RQDGSRAF+R+W+FQGS DG NWTNLRVH++D T+CKPGQ+ASWP+ GPN LLPF
Sbjct  713  NYYTLRQDGSRAFIRNWSFQGSMDGNNWTNLRVHENDVTMCKPGQYASWPVVGPNALLPF  772

Query  308  RFFRIVMTGPGTDGMNPWNCCICVLELYGYFR  213
            RFFR V+T P TD  NPW+ CIC LELYGYFR
Sbjct  773  RFFRAVLTAPTTDITNPWSFCICFLELYGYFR  804



>emb|CDP07293.1| unnamed protein product [Coffea canephora]
Length=802

 Score =   256 bits (655),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 114/152 (75%), Positives = 129/152 (85%), Gaps = 0/152 (0%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            PVLSK+V VTASSP SRFTDPKVL SR +QGTSFAG ++ DG  +SWWM+D+G  HQLMC
Sbjct  651  PVLSKKVTVTASSPTSRFTDPKVLASRTYQGTSFAGSRMGDGRNTSWWMVDIGPGHQLMC  710

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
            NYYT+RQDGS+AFMR WNFQGS+DG NWTNLR+H+ D+T+CKPGQFASWPI  PN LLPF
Sbjct  711  NYYTLRQDGSKAFMRCWNFQGSSDGRNWTNLRIHEKDETLCKPGQFASWPINDPNALLPF  770

Query  308  RFFRIVMTGPGTDGMNPWNCCICVLELYGYFR  213
            RFFR+ MT P TD  NPWNCCIC LELYGYF 
Sbjct  771  RFFRVTMTAPTTDDTNPWNCCICFLELYGYFH  802



>ref|XP_010556054.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Tarenaya 
hassleriana]
 ref|XP_010556055.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Tarenaya 
hassleriana]
 ref|XP_010556056.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Tarenaya 
hassleriana]
Length=804

 Score =   256 bits (655),  Expect = 3e-76, Method: Composition-based stats.
 Identities = 107/152 (70%), Positives = 125/152 (82%), Gaps = 0/152 (0%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            PVL+K++ +  SSP SRFTDPK L SR + GTSFAGP++EDG ISSWWM+DLG DHQLMC
Sbjct  653  PVLAKKITIIVSSPTSRFTDPKTLASRTYMGTSFAGPRMEDGQISSWWMVDLGKDHQLMC  712

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
            NYYT+RQDGSR + RSW  QGS DG +W ++RVH+DDQT+CK GQFASWPI G N LLPF
Sbjct  713  NYYTLRQDGSRTYPRSWKLQGSMDGNSWADVRVHEDDQTMCKLGQFASWPIVGANSLLPF  772

Query  308  RFFRIVMTGPGTDGMNPWNCCICVLELYGYFR  213
            R+FR+VMTGP  D  NPW+ CIC LELYGYFR
Sbjct  773  RYFRVVMTGPTADASNPWSFCICFLELYGYFR  804



>gb|EYU36560.1| hypothetical protein MIMGU_mgv1a001528mg [Erythranthe guttata]
Length=802

 Score =   256 bits (654),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            PVLSK+V +TASSPFSRFTDPKVLVSR++ GTSFAGP++E+G  ++WWM+D+G+ HQLMC
Sbjct  651  PVLSKKVIITASSPFSRFTDPKVLVSRSYLGTSFAGPRMENGRNTAWWMVDIGHSHQLMC  710

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
            N+YT+RQDGSRAFMR+WNFQGS DG NWTNLRVH++D+T+ KPGQFASWP+ GP  LLPF
Sbjct  711  NHYTLRQDGSRAFMRNWNFQGSMDGNNWTNLRVHENDETMSKPGQFASWPVVGPTALLPF  770

Query  308  RFFRIVMTGPGTDGMNPWNCCICVLELYGYFR  213
            RFFR+V+  P TD  NPW+ CIC LELYGYFR
Sbjct  771  RFFRVVLVAPTTDATNPWSLCICFLELYGYFR  802



>ref|XP_008377080.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X1 [Malus domestica]
Length=805

 Score =   255 bits (652),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            PVL+KR+ +TASSP SRFTDPK LVSR ++GTSFAGPQ+EDG+ S+WW +D+G DHQL+C
Sbjct  654  PVLAKRITITASSPPSRFTDPKALVSRTYRGTSFAGPQIEDGHKSTWWTVDIGADHQLIC  713

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
            N YT+RQDGSRA+MR WNFQGS DG  WTNLRVH++DQTICKPGQFASWP+ G N LLPF
Sbjct  714  NNYTLRQDGSRAYMRYWNFQGSLDGKTWTNLRVHENDQTICKPGQFASWPVIGQNALLPF  773

Query  308  RFFRIVMTGPGTDGMNPWNCCICVLELYGYFR  213
            RFFR+V+TGP  D  NPWN CIC LELYGYF 
Sbjct  774  RFFRVVLTGPTADASNPWNFCICFLELYGYFH  805



>ref|XP_008377081.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Malus domestica]
Length=803

 Score =   255 bits (651),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            PVL+KR+ +TASSP SRFTDPK LVSR ++GTSFAGPQ+EDG+ S+WW +D+G DHQL+C
Sbjct  652  PVLAKRITITASSPPSRFTDPKALVSRTYRGTSFAGPQIEDGHKSTWWTVDIGADHQLIC  711

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
            N YT+RQDGSRA+MR WNFQGS DG  WTNLRVH++DQTICKPGQFASWP+ G N LLPF
Sbjct  712  NNYTLRQDGSRAYMRYWNFQGSLDGKTWTNLRVHENDQTICKPGQFASWPVIGQNALLPF  771

Query  308  RFFRIVMTGPGTDGMNPWNCCICVLELYGYFR  213
            RFFR+V+TGP  D  NPWN CIC LELYGYF 
Sbjct  772  RFFRVVLTGPTADASNPWNFCICFLELYGYFH  803



>emb|CBI40712.3| unnamed protein product [Vitis vinifera]
Length=789

 Score =   254 bits (649),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 129/152 (85%), Gaps = 0/152 (0%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            P+L+KR+ +TASSP SR TDPKVLVSR +QGTSF GP+VEDG   SWWM+D+G DHQLMC
Sbjct  638  PILAKRITITASSPTSRHTDPKVLVSRTYQGTSFTGPRVEDGKNCSWWMVDIGEDHQLMC  697

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
            NYYT+RQDGSRA++R WN QGS DG  WTNLRVH++DQT+CKPGQ+ASWPI  PN LLPF
Sbjct  698  NYYTLRQDGSRAYIRFWNLQGSLDGKAWTNLRVHENDQTMCKPGQYASWPIMAPNALLPF  757

Query  308  RFFRIVMTGPGTDGMNPWNCCICVLELYGYFR  213
            RFFR+++TGP +D  NPWN CIC LELYGYF 
Sbjct  758  RFFRVILTGPTSDASNPWNFCICFLELYGYFH  789



>ref|XP_004145539.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like [Cucumis 
sativus]
 ref|XP_004164111.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like [Cucumis 
sativus]
 gb|KGN55497.1| hypothetical protein Csa_4G658570 [Cucumis sativus]
Length=806

 Score =   254 bits (649),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 110/151 (73%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            P+LSK++ +T SSP SR+TDPKVLVSR +QGTSF G +VEDG   SWWM+D+G DHQLMC
Sbjct  655  PILSKKITITTSSPPSRYTDPKVLVSRTYQGTSFTGLRVEDGKTCSWWMVDIGEDHQLMC  714

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
            NYYT+RQDGSRAF+R WN QGS DG  WTNLRVH++DQT+CKPGQFASW +TGPN LLPF
Sbjct  715  NYYTLRQDGSRAFIRYWNLQGSFDGKTWTNLRVHENDQTVCKPGQFASWAVTGPNALLPF  774

Query  308  RFFRIVMTGPGTDGMNPWNCCICVLELYGYF  216
            RFFR+++T P TD  NPWN CIC LELYGYF
Sbjct  775  RFFRVLLTAPTTDASNPWNLCICFLELYGYF  805



>ref|XP_002270675.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Vitis 
vinifera]
Length=806

 Score =   254 bits (649),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 129/152 (85%), Gaps = 0/152 (0%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            P+L+KR+ +TASSP SR TDPKVLVSR +QGTSF GP+VEDG   SWWM+D+G DHQLMC
Sbjct  655  PILAKRITITASSPTSRHTDPKVLVSRTYQGTSFTGPRVEDGKNCSWWMVDIGEDHQLMC  714

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
            NYYT+RQDGSRA++R WN QGS DG  WTNLRVH++DQT+CKPGQ+ASWPI  PN LLPF
Sbjct  715  NYYTLRQDGSRAYIRFWNLQGSLDGKAWTNLRVHENDQTMCKPGQYASWPIMAPNALLPF  774

Query  308  RFFRIVMTGPGTDGMNPWNCCICVLELYGYFR  213
            RFFR+++TGP +D  NPWN CIC LELYGYF 
Sbjct  775  RFFRVILTGPTSDASNPWNFCICFLELYGYFH  806



>ref|XP_009418296.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009418297.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009418298.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009418299.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009418300.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009418301.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Musa 
acuminata subsp. malaccensis]
Length=803

 Score =   254 bits (649),  Expect = 2e-75, Method: Composition-based stats.
 Identities = 104/151 (69%), Positives = 126/151 (83%), Gaps = 0/151 (0%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            PVLSK++ +TASSP SR+TD K LVSR +Q TSFAGP++EDG+ S+WWM+D+G+DHQLMC
Sbjct  652  PVLSKKITLTASSPASRYTDSKALVSRTYQATSFAGPRIEDGHSSAWWMVDIGHDHQLMC  711

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
            NYYT+RQDGS  ++RSW FQGS DG NWTNLRVH DDQTIC+ GQFASWP+ GP  LLPF
Sbjct  712  NYYTLRQDGSSTYIRSWAFQGSVDGKNWTNLRVHNDDQTICRSGQFASWPVIGPMALLPF  771

Query  308  RFFRIVMTGPGTDGMNPWNCCICVLELYGYF  216
            R FR+++TGP +   N WN CIC +ELYGYF
Sbjct  772  RIFRVILTGPASGDANVWNLCICFIELYGYF  802



>ref|XP_011034881.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X2 [Populus euphratica]
Length=801

 Score =   254 bits (648),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 129/152 (85%), Gaps = 0/152 (0%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            P+L+KR+ +TASSP SR+TDPK LVSR +QGT FAGP+VE G I +WWMID+G DHQLMC
Sbjct  650  PLLAKRITITASSPPSRYTDPKALVSRTYQGTCFAGPRVEGGQIHAWWMIDIGQDHQLMC  709

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
            NYYT+RQDGSRAF+R WN QGS DG  WTNLRVH++DQT+CK GQFASWPITGP  LLPF
Sbjct  710  NYYTLRQDGSRAFIRYWNLQGSLDGKTWTNLRVHENDQTMCKAGQFASWPITGPQALLPF  769

Query  308  RFFRIVMTGPGTDGMNPWNCCICVLELYGYFR  213
            RFFR+++TGP TDG NP N CIC LELYGYF 
Sbjct  770  RFFRVLLTGPTTDGSNPHNLCICFLELYGYFH  801



>ref|XP_011034879.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X1 [Populus euphratica]
 ref|XP_011034880.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X1 [Populus euphratica]
Length=808

 Score =   254 bits (648),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 129/152 (85%), Gaps = 0/152 (0%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            P+L+KR+ +TASSP SR+TDPK LVSR +QGT FAGP+VE G I +WWMID+G DHQLMC
Sbjct  657  PLLAKRITITASSPPSRYTDPKALVSRTYQGTCFAGPRVEGGQIHAWWMIDIGQDHQLMC  716

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
            NYYT+RQDGSRAF+R WN QGS DG  WTNLRVH++DQT+CK GQFASWPITGP  LLPF
Sbjct  717  NYYTLRQDGSRAFIRYWNLQGSLDGKTWTNLRVHENDQTMCKAGQFASWPITGPQALLPF  776

Query  308  RFFRIVMTGPGTDGMNPWNCCICVLELYGYFR  213
            RFFR+++TGP TDG NP N CIC LELYGYF 
Sbjct  777  RFFRVLLTGPTTDGSNPHNLCICFLELYGYFH  808



>ref|XP_002300643.1| BTB/POZ domain-containing family protein [Populus trichocarpa]
 gb|EEE79916.1| BTB/POZ domain-containing family protein [Populus trichocarpa]
Length=801

 Score =   254 bits (648),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 129/152 (85%), Gaps = 0/152 (0%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            P+L+KR+ +TASSP SR+TDPK LVSR +QGT FAGP+VE G I +WWMID+G DHQLMC
Sbjct  650  PLLAKRITITASSPPSRYTDPKALVSRTYQGTCFAGPRVEGGQIHAWWMIDIGQDHQLMC  709

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
            N+YT+RQDGSRAF+R WN QGS DG  WTNLRVH++DQT+CK GQFASWPITGP  LLPF
Sbjct  710  NHYTLRQDGSRAFIRCWNLQGSLDGKTWTNLRVHENDQTMCKAGQFASWPITGPQALLPF  769

Query  308  RFFRIVMTGPGTDGMNPWNCCICVLELYGYFR  213
            RFFR+V+TGP TDG NP N CIC LELYGYF 
Sbjct  770  RFFRVVLTGPTTDGSNPHNLCICFLELYGYFH  801



>ref|XP_006410166.1| hypothetical protein EUTSA_v10016264mg [Eutrema salsugineum]
 gb|ESQ51619.1| hypothetical protein EUTSA_v10016264mg [Eutrema salsugineum]
Length=806

 Score =   253 bits (645),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 127/152 (84%), Gaps = 0/152 (0%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            PVL+K++ +T+SSP SRFTDPK L S+ + GTSFAGP+ EDG+ISSWWM+DLG DHQLMC
Sbjct  655  PVLAKKINITSSSPTSRFTDPKALASKTYVGTSFAGPRKEDGHISSWWMVDLGEDHQLMC  714

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
            NYYT RQDGSRAF RSW FQGS DG  WT+LRVH+DDQT+CK GQFASWPIT  N LLPF
Sbjct  715  NYYTFRQDGSRAFTRSWKFQGSMDGKTWTDLRVHEDDQTMCKAGQFASWPITAANALLPF  774

Query  308  RFFRIVMTGPGTDGMNPWNCCICVLELYGYFR  213
            RFFR+ +TGP TD   PWN CIC LELYGYFR
Sbjct  775  RFFRLFLTGPTTDTSTPWNFCICYLELYGYFR  806



>ref|XP_006664953.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like [Oryza 
brachyantha]
Length=805

 Score =   252 bits (643),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 129/152 (85%), Gaps = 0/152 (0%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            PVL+K + V ASSP SR+TDPK LVS+N+QGT FAGP++EDG + SWWM+D+G+DHQLMC
Sbjct  654  PVLAKNIKVIASSPNSRYTDPKALVSKNYQGTCFAGPRLEDGKMCSWWMVDIGHDHQLMC  713

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
            NYYT+RQDGS  FMRSW  QGS DG NWT+LR+HKDDQTIC+PGQFASWPITGP+ LLPF
Sbjct  714  NYYTVRQDGSTTFMRSWVLQGSMDGQNWTSLRIHKDDQTICQPGQFASWPITGPSALLPF  773

Query  308  RFFRIVMTGPGTDGMNPWNCCICVLELYGYFR  213
            RFFR+++TG  T   N WN CIC LELYGYFR
Sbjct  774  RFFRVMLTGHATGVSNTWNLCICFLELYGYFR  805



>ref|XP_002307790.1| BTB/POZ domain-containing family protein [Populus trichocarpa]
 gb|EEE94786.1| BTB/POZ domain-containing family protein [Populus trichocarpa]
Length=806

 Score =   251 bits (641),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            PVL+KR+ +TASSP SR+TDPK LVSR +QGTSFAGP +EDG+I +WWM+D+G DHQLMC
Sbjct  655  PVLAKRITITASSPPSRYTDPKTLVSRTYQGTSFAGPCMEDGHIRAWWMVDIGQDHQLMC  714

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
            N+YT+RQDGSRAF+R WN QGS DG  WTNLRVH++DQT+CK  QFASWPITGP+ LLPF
Sbjct  715  NHYTLRQDGSRAFIRFWNLQGSLDGKTWTNLRVHENDQTMCKADQFASWPITGPHALLPF  774

Query  308  RFFRIVMTGPGTDGMNPWNCCICVLELYGYFR  213
            RFFR+V+TGP TD  NP N CIC LELYGYF 
Sbjct  775  RFFRVVLTGPTTDASNPHNLCICFLELYGYFH  806



>ref|XP_007018025.1| BTB/POZ domain-containing protein isoform 1 [Theobroma cacao]
 gb|EOY15250.1| BTB/POZ domain-containing protein isoform 1 [Theobroma cacao]
Length=805

 Score =   251 bits (640),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            PVLSKR+ +TASSP SR+TDPKVLVSR +QGT FAGP++E G I +WWMID+G DHQL+C
Sbjct  654  PVLSKRIAITASSPTSRYTDPKVLVSRTYQGTCFAGPRMEGGRICAWWMIDIGQDHQLIC  713

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
            NYYT+RQDGSRA++R W  QGS DG +W +LRVH++DQT+CKPGQFASWP+TG N LLPF
Sbjct  714  NYYTLRQDGSRAYIRCWKIQGSVDGRSWIDLRVHENDQTMCKPGQFASWPVTGTNALLPF  773

Query  308  RFFRIVMTGPGTDGMNPWNCCICVLELYGYFR  213
            RFFR+++TGP TD  +PWN CIC LELYGY+R
Sbjct  774  RFFRVLLTGPTTDSSHPWNFCICFLELYGYYR  805



>ref|XP_007018027.1| BTB/POZ domain-containing protein isoform 3 [Theobroma cacao]
 gb|EOY15252.1| BTB/POZ domain-containing protein isoform 3 [Theobroma cacao]
Length=789

 Score =   251 bits (640),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            PVLSKR+ +TASSP SR+TDPKVLVSR +QGT FAGP++E G I +WWMID+G DHQL+C
Sbjct  638  PVLSKRIAITASSPTSRYTDPKVLVSRTYQGTCFAGPRMEGGRICAWWMIDIGQDHQLIC  697

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
            NYYT+RQDGSRA++R W  QGS DG +W +LRVH++DQT+CKPGQFASWP+TG N LLPF
Sbjct  698  NYYTLRQDGSRAYIRCWKIQGSVDGRSWIDLRVHENDQTMCKPGQFASWPVTGTNALLPF  757

Query  308  RFFRIVMTGPGTDGMNPWNCCICVLELYGYFR  213
            RFFR+++TGP TD  +PWN CIC LELYGY+R
Sbjct  758  RFFRVLLTGPTTDSSHPWNFCICFLELYGYYR  789



>ref|XP_010935266.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Elaeis 
guineensis]
 ref|XP_010935267.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Elaeis 
guineensis]
 ref|XP_010935268.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Elaeis 
guineensis]
Length=805

 Score =   250 bits (639),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            PVLSK++ VTASSP SR+TDPK LVSR +QGTSFAGP++EDG   +WWM+D+G DHQLMC
Sbjct  654  PVLSKKITVTASSPASRYTDPKTLVSRAYQGTSFAGPRIEDGMNCAWWMVDIGQDHQLMC  713

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
            NYYT+RQDGS  +MRSW FQGS DG NWTNLRVH++DQTIC+PGQFASWPI G   LLPF
Sbjct  714  NYYTLRQDGSTTYMRSWAFQGSMDGENWTNLRVHENDQTICRPGQFASWPIIGSTSLLPF  773

Query  308  RFFRIVMTGPGTDGMNPWNCCICVLELYGYFR  213
            RFFR+++TGP T   N WN CIC +ELYGYFR
Sbjct  774  RFFRVILTGPATGYSNVWNLCICFIELYGYFR  805



>emb|CDX97805.1| BnaC04g41340D [Brassica napus]
Length=796

 Score =   250 bits (638),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 127/152 (84%), Gaps = 0/152 (0%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            PVL+K++ +T+SSP SRFTDPK L S+ + GTSFAGP++EDG ISSWWM+DLG DHQLMC
Sbjct  645  PVLAKKIIITSSSPTSRFTDPKALASKTYVGTSFAGPRMEDGRISSWWMVDLGEDHQLMC  704

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
            NYYT RQDGSRA+ RSW FQGS DG  WT+LRVH++DQT+CK GQFASWPIT  N LLPF
Sbjct  705  NYYTFRQDGSRAYARSWKFQGSMDGNTWTDLRVHENDQTMCKAGQFASWPITAANALLPF  764

Query  308  RFFRIVMTGPGTDGMNPWNCCICVLELYGYFR  213
            RFFR+V+TGP  D   PWN CIC LELYGYFR
Sbjct  765  RFFRLVLTGPTADTSTPWNFCICYLELYGYFR  796



>dbj|BAD93995.1| hypothetical protein [Arabidopsis thaliana]
Length=812

 Score =   249 bits (635),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 127/152 (84%), Gaps = 0/152 (0%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            PVL+K++ +T+SSP SRFTDPK L S+ + GTSFAGP++EDG+ISSWW++DLG +HQLMC
Sbjct  661  PVLAKKINITSSSPTSRFTDPKALASKAYAGTSFAGPRMEDGHISSWWVVDLGEEHQLMC  720

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
            NYYT RQDGSRAF R W FQGS DG  WT+LRVH+DDQT+CK GQFASWPIT  N LLPF
Sbjct  721  NYYTFRQDGSRAFTRFWKFQGSMDGKTWTDLRVHEDDQTMCKAGQFASWPITAANALLPF  780

Query  308  RFFRIVMTGPGTDGMNPWNCCICVLELYGYFR  213
            RFFR+V+TGP  D   PWN CIC LELYGYFR
Sbjct  781  RFFRLVLTGPTADTSTPWNFCICYLELYGYFR  812



>gb|AES98295.2| BTB/POZ domain plant protein [Medicago truncatula]
Length=799

 Score =   246 bits (627),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 106/148 (72%), Positives = 128/148 (86%), Gaps = 0/148 (0%)
 Frame = -2

Query  659  SKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMCNYY  480
            +K++ +TASSP SR+TDPKVLVSR +QGT FAGP++E+G+  SWWMIDLG DHQLMCNYY
Sbjct  651  AKKITITASSPHSRYTDPKVLVSRTYQGTCFAGPRLENGHNCSWWMIDLGQDHQLMCNYY  710

Query  479  TIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPFRFF  300
            T+RQDGS+AF R WN QGS DG +W +LRVH++D+T+CKPGQFASWP+ GPN LLPFR+F
Sbjct  711  TMRQDGSKAFPRCWNIQGSADGKSWRDLRVHENDRTVCKPGQFASWPVVGPNALLPFRYF  770

Query  299  RIVMTGPGTDGMNPWNCCICVLELYGYF  216
            R+V+TGP TD  NPWN CIC LELYGYF
Sbjct  771  RVVLTGPTTDATNPWNFCICYLELYGYF  798



>ref|NP_001174372.1| Os05g0345500 [Oryza sativa Japonica Group]
 dbj|BAH93100.1| Os05g0345500 [Oryza sativa Japonica Group]
Length=152

 Score =   228 bits (582),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 119/144 (83%), Gaps = 0/144 (0%)
 Frame = -2

Query  644  VTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQD  465
            VTASSP SR+TDPK LVS+N+Q T FAGP++EDG + SWWM+D+G DHQLMCNYYT+RQD
Sbjct  9    VTASSPNSRYTDPKALVSKNYQATCFAGPRLEDGKMCSWWMVDIGPDHQLMCNYYTVRQD  68

Query  464  GSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMT  285
            GS  FMRSW  QGS DG +WT+L VH+DDQTIC+PGQFASWPITG   LLPFRFFR+++T
Sbjct  69   GSATFMRSWVLQGSMDGRSWTSLHVHEDDQTICQPGQFASWPITGQTALLPFRFFRVMLT  128

Query  284  GPGTDGMNPWNCCICVLELYGYFR  213
             P T   N WN CIC LELYGYFR
Sbjct  129  APATGVSNTWNLCICFLELYGYFR  152



>ref|XP_010692549.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010692550.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Beta 
vulgaris subsp. vulgaris]
Length=805

 Score =   246 bits (627),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 123/152 (81%), Gaps = 0/152 (0%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            P+LS R+ +T SSP SRFTDPKVL SR +QGTSF+GP+ EDG   SWWMID+G DHQLMC
Sbjct  654  PMLSNRITITTSSPISRFTDPKVLASRTYQGTSFSGPRFEDGRTCSWWMIDVGEDHQLMC  713

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
            NYYT+RQDGSR F+R WN QGS DG +WTNLR HK+DQ ICKPGQFASWP+TGP  LL F
Sbjct  714  NYYTLRQDGSRTFIRHWNLQGSLDGKHWTNLREHKNDQKICKPGQFASWPVTGPQALLSF  773

Query  308  RFFRIVMTGPGTDGMNPWNCCICVLELYGYFR  213
            RFFR+++TGP TD    W  CIC LELYGYFR
Sbjct  774  RFFRVILTGPTTDPTETWKFCICFLELYGYFR  805



>ref|XP_011013905.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like [Populus 
euphratica]
 ref|XP_011013907.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like [Populus 
euphratica]
Length=806

 Score =   245 bits (625),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 129/152 (85%), Gaps = 0/152 (0%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            PVL+KR+ +TASSP SR+TDPK LVSR +QGTSFAGP +E+G+I +WW +D+G DHQLMC
Sbjct  655  PVLAKRITITASSPPSRYTDPKTLVSRTYQGTSFAGPCMENGHIRAWWTVDIGQDHQLMC  714

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
            N+YT+RQDGSRAF+R WN QGS DG  WTNLRVH++DQT+CK  QFASWP+TGP+ LLPF
Sbjct  715  NHYTLRQDGSRAFIRFWNLQGSLDGKTWTNLRVHENDQTMCKADQFASWPVTGPHALLPF  774

Query  308  RFFRIVMTGPGTDGMNPWNCCICVLELYGYFR  213
            RFFR+++TGP TD  NP N CIC LELYGYF 
Sbjct  775  RFFRVLLTGPTTDASNPHNLCICFLELYGYFH  806



>ref|XP_011041233.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like [Populus 
euphratica]
 ref|XP_011041234.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like [Populus 
euphratica]
Length=806

 Score =   245 bits (625),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 129/152 (85%), Gaps = 0/152 (0%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            P+L+KR+ +TASSP SR+TDPK LVSR +QGTSFAGP +E+G+I +WW +D+G DHQLMC
Sbjct  655  PILAKRITITASSPPSRYTDPKTLVSRTYQGTSFAGPCMENGHIRAWWTVDIGQDHQLMC  714

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
            N+YT+RQDGSRAF+R WN QGS DG  WTNLRVH++DQT+CK  QFASWP+TGP+ LLPF
Sbjct  715  NHYTLRQDGSRAFIRFWNLQGSLDGKTWTNLRVHENDQTMCKADQFASWPVTGPHALLPF  774

Query  308  RFFRIVMTGPGTDGMNPWNCCICVLELYGYFR  213
            RFFR+++TGP TD  NP N CIC LELYGYF 
Sbjct  775  RFFRVLLTGPTTDASNPHNLCICFLELYGYFH  806



>ref|XP_010094552.1| BTB/POZ domain-containing protein [Morus notabilis]
 gb|EXB56306.1| BTB/POZ domain-containing protein [Morus notabilis]
Length=810

 Score =   244 bits (624),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            PVL+K + +TASSP SRFTDPKVL SR +QGTSFAGP++EDG+ S+WWM+D+G +HQLMC
Sbjct  659  PVLAKTITITASSPPSRFTDPKVLASRTYQGTSFAGPRIEDGHSSTWWMVDIGSNHQLMC  718

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
            NYYT+RQDGSRA++RSW+ QGS DG  WTNL VH++DQT+CK GQFASWPI GPN L PF
Sbjct  719  NYYTLRQDGSRAYIRSWSLQGSLDGKTWTNLSVHENDQTVCKLGQFASWPIVGPNALRPF  778

Query  308  RFFRIVMTGPGTDGMNPWNCCICVLELYGYFR  213
            RFFR ++TGP TD  NP N CIC LELYGYF 
Sbjct  779  RFFRALLTGPTTDISNPCNLCICFLELYGYFH  810



>ref|XP_003615337.1| Kelch-like protein [Medicago truncatula]
Length=884

 Score =   245 bits (626),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 106/148 (72%), Positives = 128/148 (86%), Gaps = 0/148 (0%)
 Frame = -2

Query  659  SKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMCNYY  480
            +K++ +TASSP SR+TDPKVLVSR +QGT FAGP++E+G+  SWWMIDLG DHQLMCNYY
Sbjct  736  AKKITITASSPHSRYTDPKVLVSRTYQGTCFAGPRLENGHNCSWWMIDLGQDHQLMCNYY  795

Query  479  TIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPFRFF  300
            T+RQDGS+AF R WN QGS DG +W +LRVH++D+T+CKPGQFASWP+ GPN LLPFR+F
Sbjct  796  TMRQDGSKAFPRCWNIQGSADGKSWRDLRVHENDRTVCKPGQFASWPVVGPNALLPFRYF  855

Query  299  RIVMTGPGTDGMNPWNCCICVLELYGYF  216
            R+V+TGP TD  NPWN CIC LELYGYF
Sbjct  856  RVVLTGPTTDATNPWNFCICYLELYGYF  883



>ref|XP_008781287.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Phoenix dactylifera]
Length=803

 Score =   244 bits (623),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 127/152 (84%), Gaps = 0/152 (0%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            PVL+K++ VTASSP SR+TDPK LVSR +QGTSFAGP++EDG   +WWM+D+G DHQLMC
Sbjct  652  PVLAKKITVTASSPASRYTDPKALVSRAYQGTSFAGPRIEDGKNCAWWMVDIGQDHQLMC  711

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
            NYYT+RQDGS  +MRSW  QGS DG NWTNLRVH++DQTIC+PGQFASW +TG   LLPF
Sbjct  712  NYYTLRQDGSTTYMRSWACQGSMDGENWTNLRVHENDQTICRPGQFASWTVTGSTALLPF  771

Query  308  RFFRIVMTGPGTDGMNPWNCCICVLELYGYFR  213
            RFFR+++TGP +   + WN CIC +ELYGYFR
Sbjct  772  RFFRVILTGPASGDSDAWNLCICFIELYGYFR  803



>ref|XP_008781284.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X1 [Phoenix dactylifera]
 ref|XP_008781285.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X1 [Phoenix dactylifera]
 ref|XP_008781286.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X1 [Phoenix dactylifera]
Length=805

 Score =   244 bits (623),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 127/152 (84%), Gaps = 0/152 (0%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            PVL+K++ VTASSP SR+TDPK LVSR +QGTSFAGP++EDG   +WWM+D+G DHQLMC
Sbjct  654  PVLAKKITVTASSPASRYTDPKALVSRAYQGTSFAGPRIEDGKNCAWWMVDIGQDHQLMC  713

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
            NYYT+RQDGS  +MRSW  QGS DG NWTNLRVH++DQTIC+PGQFASW +TG   LLPF
Sbjct  714  NYYTLRQDGSTTYMRSWACQGSMDGENWTNLRVHENDQTICRPGQFASWTVTGSTALLPF  773

Query  308  RFFRIVMTGPGTDGMNPWNCCICVLELYGYFR  213
            RFFR+++TGP +   + WN CIC +ELYGYFR
Sbjct  774  RFFRVILTGPASGDSDAWNLCICFIELYGYFR  805



>gb|EEE63337.1| hypothetical protein OsJ_18148 [Oryza sativa Japonica Group]
Length=734

 Score =   243 bits (620),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 125/152 (82%), Gaps = 0/152 (0%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            PVL+K + VTASSP SR+TDPK LVS+N+Q T FAGP++EDG + SWWM+D+G DHQLMC
Sbjct  583  PVLAKNITVTASSPNSRYTDPKALVSKNYQATCFAGPRLEDGKMCSWWMVDIGPDHQLMC  642

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
            NYYT+RQDGS  FMRSW  QGS DG +WT+L VH+DDQTIC+PGQFASWPITG   LLPF
Sbjct  643  NYYTVRQDGSATFMRSWVLQGSMDGRSWTSLHVHEDDQTICQPGQFASWPITGQTALLPF  702

Query  308  RFFRIVMTGPGTDGMNPWNCCICVLELYGYFR  213
            RFFR+++T P T   N WN CIC LELYGYFR
Sbjct  703  RFFRVMLTAPATGVSNTWNLCICFLELYGYFR  734



>ref|XP_003545003.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X1 [Glycine max]
 gb|KHN12601.1| BTB/POZ domain-containing protein [Glycine soja]
Length=802

 Score =   244 bits (622),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 108/153 (71%), Positives = 130/153 (85%), Gaps = 2/153 (1%)
 Frame = -2

Query  668  PVLS--KRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQL  495
            P+L+  +++ +TASSP SR+TDPKVLVSR +QGT FAGP++E+G   SWWM+DLG DHQL
Sbjct  649  PLLAEPRKITITASSPHSRYTDPKVLVSRTYQGTCFAGPRLENGQNCSWWMVDLGQDHQL  708

Query  494  MCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLL  315
            MCNYYT+RQDGS+AF R WN QGS DG +WTNLRVH++D++ICKPGQFASWPI GPN LL
Sbjct  709  MCNYYTLRQDGSKAFPRCWNVQGSLDGKSWTNLRVHENDRSICKPGQFASWPIIGPNALL  768

Query  314  PFRFFRIVMTGPGTDGMNPWNCCICVLELYGYF  216
            PFR+FR+V+TG  TD  NPWN CIC LELYGYF
Sbjct  769  PFRYFRVVLTGTTTDATNPWNFCICYLELYGYF  801



>ref|XP_006596517.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X2 [Glycine max]
Length=806

 Score =   244 bits (622),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 108/153 (71%), Positives = 130/153 (85%), Gaps = 2/153 (1%)
 Frame = -2

Query  668  PVLS--KRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQL  495
            P+L+  +++ +TASSP SR+TDPKVLVSR +QGT FAGP++E+G   SWWM+DLG DHQL
Sbjct  653  PLLAEPRKITITASSPHSRYTDPKVLVSRTYQGTCFAGPRLENGQNCSWWMVDLGQDHQL  712

Query  494  MCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLL  315
            MCNYYT+RQDGS+AF R WN QGS DG +WTNLRVH++D++ICKPGQFASWPI GPN LL
Sbjct  713  MCNYYTLRQDGSKAFPRCWNVQGSLDGKSWTNLRVHENDRSICKPGQFASWPIIGPNALL  772

Query  314  PFRFFRIVMTGPGTDGMNPWNCCICVLELYGYF  216
            PFR+FR+V+TG  TD  NPWN CIC LELYGYF
Sbjct  773  PFRYFRVVLTGTTTDATNPWNFCICYLELYGYF  805



>gb|AAV43802.1| unknown protein [Oryza sativa Japonica Group]
Length=806

 Score =   243 bits (621),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 125/152 (82%), Gaps = 0/152 (0%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            PVL+K + VTASSP SR+TDPK LVS+N+Q T FAGP++EDG + SWWM+D+G DHQLMC
Sbjct  655  PVLAKNITVTASSPNSRYTDPKALVSKNYQATCFAGPRLEDGKMCSWWMVDIGPDHQLMC  714

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
            NYYT+RQDGS  FMRSW  QGS DG +WT+L VH+DDQTIC+PGQFASWPITG   LLPF
Sbjct  715  NYYTVRQDGSATFMRSWVLQGSMDGRSWTSLHVHEDDQTICQPGQFASWPITGQTALLPF  774

Query  308  RFFRIVMTGPGTDGMNPWNCCICVLELYGYFR  213
            RFFR+++T P T   N WN CIC LELYGYFR
Sbjct  775  RFFRVMLTAPATGVSNTWNLCICFLELYGYFR  806



>ref|XP_006473784.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X1 [Citrus sinensis]
Length=817

 Score =   243 bits (619),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 125/152 (82%), Gaps = 0/152 (0%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            PVL+KR+ +TASSP SR+TDPK L SR +QG SFAGP++EDG+  +WWM+D+G DHQLMC
Sbjct  666  PVLAKRINITASSPISRYTDPKALASRTYQGLSFAGPRMEDGHNCTWWMVDIGQDHQLMC  725

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
            NYYT+R DGSRA++R WNFQGS DG +WTNLRVH++DQT+CK GQFASW + GPN L PF
Sbjct  726  NYYTLRMDGSRAYIRYWNFQGSMDGKSWTNLRVHENDQTMCKHGQFASWAVIGPNALRPF  785

Query  308  RFFRIVMTGPGTDGMNPWNCCICVLELYGYFR  213
            RFFR+V+ GP  D  N WN CIC LELYGYF 
Sbjct  786  RFFRVVLMGPTADAANSWNFCICFLELYGYFH  817



>ref|XP_006473785.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X2 [Citrus sinensis]
 ref|XP_006473786.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X3 [Citrus sinensis]
 gb|KDO85089.1| hypothetical protein CISIN_1g040529mg [Citrus sinensis]
Length=806

 Score =   243 bits (619),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 125/152 (82%), Gaps = 0/152 (0%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            PVL+KR+ +TASSP SR+TDPK L SR +QG SFAGP++EDG+  +WWM+D+G DHQLMC
Sbjct  655  PVLAKRINITASSPISRYTDPKALASRTYQGLSFAGPRMEDGHNCTWWMVDIGQDHQLMC  714

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
            NYYT+R DGSRA++R WNFQGS DG +WTNLRVH++DQT+CK GQFASW + GPN L PF
Sbjct  715  NYYTLRMDGSRAYIRYWNFQGSMDGKSWTNLRVHENDQTMCKHGQFASWAVIGPNALRPF  774

Query  308  RFFRIVMTGPGTDGMNPWNCCICVLELYGYFR  213
            RFFR+V+ GP  D  N WN CIC LELYGYF 
Sbjct  775  RFFRVVLMGPTADAANSWNFCICFLELYGYFH  806



>ref|XP_006435355.1| hypothetical protein CICLE_v10003249mg [Citrus clementina]
 gb|ESR48595.1| hypothetical protein CICLE_v10003249mg [Citrus clementina]
Length=818

 Score =   242 bits (618),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 125/152 (82%), Gaps = 0/152 (0%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            PVL+KR+ +TASSP SR+TDPK L SR +QG SFAGP++EDG+  +WWM+D+G DHQLMC
Sbjct  667  PVLAKRINITASSPISRYTDPKALASRTYQGLSFAGPRMEDGHNCTWWMVDIGQDHQLMC  726

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
            NYYT+R DGSRA++R WNFQGS DG +WTNLRVH++DQT+CK GQFASW + GPN L PF
Sbjct  727  NYYTLRMDGSRAYIRYWNFQGSMDGKSWTNLRVHENDQTMCKHGQFASWAVIGPNALRPF  786

Query  308  RFFRIVMTGPGTDGMNPWNCCICVLELYGYFR  213
            RFFR+V+ GP  D  N WN CIC LELYGYF 
Sbjct  787  RFFRVVLMGPTADAANSWNFCICFLELYGYFH  818



>ref|XP_003561246.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Brachypodium 
distachyon]
Length=812

 Score =   242 bits (617),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            PVL+K + V ASSP SR+T+PK LVS+N+QGT FAGP+ E+G   SWWM+D+G DHQLMC
Sbjct  661  PVLAKNITVMASSPNSRYTNPKALVSKNYQGTCFAGPRDENGKKCSWWMVDIGEDHQLMC  720

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
            NYYT+RQDGS  FMRSW FQGS DG NWT+L VH+++QTIC+PGQFASWPITGP+ LLPF
Sbjct  721  NYYTVRQDGSTTFMRSWVFQGSMDGENWTSLGVHEEEQTICQPGQFASWPITGPSALLPF  780

Query  308  RFFRIVMTGPGTDGMNPWNCCICVLELYGYFR  213
            RFFR+ +TGP T   N WN CIC LELYGYFR
Sbjct  781  RFFRLALTGPATGMSNTWNLCICFLELYGYFR  812



>gb|EEC79014.1| hypothetical protein OsI_19541 [Oryza sativa Indica Group]
Length=806

 Score =   242 bits (617),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 125/152 (82%), Gaps = 0/152 (0%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            PVL+K + VTASSP SR+TDPK LVS+N+Q T FAGP++EDG + SWWM+D+G DHQLMC
Sbjct  655  PVLAKNITVTASSPNSRYTDPKALVSKNYQATCFAGPRLEDGKMCSWWMVDIGPDHQLMC  714

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
            NYYT+RQDGS  FMRSW  QGS DG +WT+L VH+DDQTIC+PGQFASWPITG   LLPF
Sbjct  715  NYYTVRQDGSATFMRSWVLQGSMDGRSWTSLHVHEDDQTICQPGQFASWPITGQTALLPF  774

Query  308  RFFRIVMTGPGTDGMNPWNCCICVLELYGYFR  213
            RFFR+++T P T   + WN CIC LELYGYFR
Sbjct  775  RFFRVMLTAPATGVSHTWNLCICFLELYGYFR  806



>ref|XP_007160598.1| hypothetical protein PHAVU_001G001100g [Phaseolus vulgaris]
 ref|XP_007160599.1| hypothetical protein PHAVU_001G001100g [Phaseolus vulgaris]
 gb|ESW32592.1| hypothetical protein PHAVU_001G001100g [Phaseolus vulgaris]
 gb|ESW32593.1| hypothetical protein PHAVU_001G001100g [Phaseolus vulgaris]
Length=802

 Score =   239 bits (611),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 105/153 (69%), Positives = 130/153 (85%), Gaps = 2/153 (1%)
 Frame = -2

Query  668  PVLS--KRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQL  495
            P+L+  +++ +TASSP SR+TDPKVLVSR +QGT FAGP++E+G   +WWM+DLG DHQL
Sbjct  649  PLLAEQRKITITASSPHSRYTDPKVLVSRTYQGTCFAGPRLENGQNCTWWMVDLGQDHQL  708

Query  494  MCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLL  315
            MCNYYT+RQDGS+AF R WN QGS +G +WTNL VH++D+++CKPGQFASWPI GPN LL
Sbjct  709  MCNYYTLRQDGSKAFPRFWNIQGSQEGKSWTNLWVHENDRSVCKPGQFASWPIVGPNALL  768

Query  314  PFRFFRIVMTGPGTDGMNPWNCCICVLELYGYF  216
            PFR+FR+V+TGP TD  NPWN CIC LELYGYF
Sbjct  769  PFRYFRVVLTGPTTDATNPWNFCICYLELYGYF  801



>emb|CDM85346.1| unnamed protein product [Triticum aestivum]
Length=805

 Score =   239 bits (610),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 126/152 (83%), Gaps = 2/152 (1%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            PVL+K + VTASSP SR+TDPK LVS+N+QGT FAGP+ EDG   SWWM+D+G DHQLMC
Sbjct  656  PVLAKNITVTASSPNSRYTDPKALVSKNYQGTCFAGPRDEDGKKCSWWMVDIGQDHQLMC  715

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
            NYYT+RQDGS AFMRSW  QGS DG NWT+L V++D++ IC+PGQFASWPITGP+ LLPF
Sbjct  716  NYYTVRQDGSTAFMRSWVLQGSMDGENWTSLVVNEDERAICQPGQFASWPITGPSALLPF  775

Query  308  RFFRIVMTGPGTDGMNPWNCCICVLELYGYFR  213
            RFFR+ +TGP T   N WN CIC LELYGYFR
Sbjct  776  RFFRLALTGPTTS--NTWNLCICFLELYGYFR  805



>ref|XP_009141084.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Brassica rapa]
 ref|XP_009141086.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Brassica rapa]
Length=801

 Score =   237 bits (604),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 127/152 (84%), Gaps = 0/152 (0%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            PVL+K++ +T+SSP SRFTDPK L S+ + GTSFAGP++EDG ISSWWM+DLG DHQLMC
Sbjct  650  PVLAKKISITSSSPTSRFTDPKALASKTYVGTSFAGPRMEDGRISSWWMVDLGEDHQLMC  709

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
            NYYT RQDGSRA+ RSW FQGS DG  WT+LRVH++DQT+CK GQFASWPIT  N LLPF
Sbjct  710  NYYTFRQDGSRAYARSWKFQGSMDGNTWTDLRVHENDQTMCKAGQFASWPITAANALLPF  769

Query  308  RFFRIVMTGPGTDGMNPWNCCICVLELYGYFR  213
            RFFR+V+TGP  D   PWN CIC LELYGYFR
Sbjct  770  RFFRLVLTGPTADTSTPWNFCICYLELYGYFR  801



>ref|XP_009141083.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X1 [Brassica rapa]
Length=806

 Score =   237 bits (604),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 127/152 (84%), Gaps = 0/152 (0%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            PVL+K++ +T+SSP SRFTDPK L S+ + GTSFAGP++EDG ISSWWM+DLG DHQLMC
Sbjct  655  PVLAKKISITSSSPTSRFTDPKALASKTYVGTSFAGPRMEDGRISSWWMVDLGEDHQLMC  714

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
            NYYT RQDGSRA+ RSW FQGS DG  WT+LRVH++DQT+CK GQFASWPIT  N LLPF
Sbjct  715  NYYTFRQDGSRAYARSWKFQGSMDGNTWTDLRVHENDQTMCKAGQFASWPITAANALLPF  774

Query  308  RFFRIVMTGPGTDGMNPWNCCICVLELYGYFR  213
            RFFR+V+TGP  D   PWN CIC LELYGYFR
Sbjct  775  RFFRLVLTGPTADTSTPWNFCICYLELYGYFR  806



>ref|XP_010266159.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Nelumbo 
nucifera]
 ref|XP_010266161.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Nelumbo 
nucifera]
 ref|XP_010266162.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Nelumbo 
nucifera]
 ref|XP_010266163.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Nelumbo 
nucifera]
Length=806

 Score =   236 bits (603),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 124/152 (82%), Gaps = 0/152 (0%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            PVL++++ VTASSP SR+TDPKVLVSR +Q TSFAGP++EDG   +WWM+DLG DHQLMC
Sbjct  655  PVLAQKITVTASSPASRYTDPKVLVSRTYQATSFAGPRMEDGKNCAWWMVDLGQDHQLMC  714

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
            N YT+RQDGS  +MR W  QGS DG NWT+L+VH +DQTICKPGQFASWP+ GP  +LPF
Sbjct  715  NCYTLRQDGSNVYMRCWALQGSLDGRNWTDLKVHGNDQTICKPGQFASWPVQGPAAVLPF  774

Query  308  RFFRIVMTGPGTDGMNPWNCCICVLELYGYFR  213
            RFFR+++TGP T   +PWN  IC LELYGYF 
Sbjct  775  RFFRVILTGPTTSNSSPWNLSICFLELYGYFH  806



>ref|XP_004964253.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ domain-containing protein 
At2g30600-like [Setaria italica]
Length=862

 Score =   235 bits (599),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 106/154 (69%), Positives = 120/154 (78%), Gaps = 2/154 (1%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            PVL+K + V ASSP SR TDPK LVS+N+QGT FAGP +EDG   SWWM+D+G DHQLMC
Sbjct  709  PVLAKNITVVASSPNSRHTDPKALVSKNYQGTCFAGPCIEDGKKISWWMVDIGQDHQLMC  768

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
            NYYT+RQDGS  FMRSW  QGS DG NWT+LRVH++D TIC PGQFASWP+ GP  LLPF
Sbjct  769  NYYTVRQDGSTTFMRSWVLQGSMDGRNWTSLRVHEEDATICHPGQFASWPVVGPPALLPF  828

Query  308  RFFRIVMTGPGTDG--MNPWNCCICVLELYGYFR  213
            RFFR+ +TGP   G   N WN CIC LELYGY R
Sbjct  829  RFFRVALTGPAAGGSVSNAWNLCICFLELYGYLR  862



>ref|XP_004512608.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X2 [Cicer arietinum]
 ref|XP_004512609.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X3 [Cicer arietinum]
 ref|XP_004512610.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X4 [Cicer arietinum]
Length=795

 Score =   232 bits (591),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 103/153 (67%), Positives = 124/153 (81%), Gaps = 2/153 (1%)
 Frame = -2

Query  668  PVLS--KRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQL  495
            P+L+  K++ +TASSP SR+TDPKVL SR ++GT FAGP++E+G+  SWWM+DLG DHQL
Sbjct  642  PLLAEPKKITITASSPHSRYTDPKVLASRTYRGTCFAGPRLENGHNCSWWMVDLGQDHQL  701

Query  494  MCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLL  315
            MCNYYT+RQDGS+AF R WN QGS DG +W  LR+H++D TICKPGQFASWPI  PN LL
Sbjct  702  MCNYYTMRQDGSKAFPRCWNIQGSMDGKSWRELRIHENDGTICKPGQFASWPIVAPNALL  761

Query  314  PFRFFRIVMTGPGTDGMNPWNCCICVLELYGYF  216
            PFR+FRI +TGP TD  NPWN  IC  ELYGYF
Sbjct  762  PFRYFRIALTGPTTDATNPWNFSICYFELYGYF  794



>ref|XP_004512607.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X1 [Cicer arietinum]
Length=815

 Score =   232 bits (592),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 103/153 (67%), Positives = 124/153 (81%), Gaps = 2/153 (1%)
 Frame = -2

Query  668  PVLS--KRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQL  495
            P+L+  K++ +TASSP SR+TDPKVL SR ++GT FAGP++E+G+  SWWM+DLG DHQL
Sbjct  662  PLLAEPKKITITASSPHSRYTDPKVLASRTYRGTCFAGPRLENGHNCSWWMVDLGQDHQL  721

Query  494  MCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLL  315
            MCNYYT+RQDGS+AF R WN QGS DG +W  LR+H++D TICKPGQFASWPI  PN LL
Sbjct  722  MCNYYTMRQDGSKAFPRCWNIQGSMDGKSWRELRIHENDGTICKPGQFASWPIVAPNALL  781

Query  314  PFRFFRIVMTGPGTDGMNPWNCCICVLELYGYF  216
            PFR+FRI +TGP TD  NPWN  IC  ELYGYF
Sbjct  782  PFRYFRIALTGPTTDATNPWNFSICYFELYGYF  814



>ref|XP_008377082.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X3 [Malus domestica]
Length=797

 Score =   231 bits (590),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 122/152 (80%), Gaps = 8/152 (5%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            PVL+KR+ +TASSP SRFTDPK LVSR ++        +EDG+ S+WW +D+G DHQL+C
Sbjct  654  PVLAKRITITASSPPSRFTDPKALVSRTYR--------IEDGHKSTWWTVDIGADHQLIC  705

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
            N YT+RQDGSRA+MR WNFQGS DG  WTNLRVH++DQTICKPGQFASWP+ G N LLPF
Sbjct  706  NNYTLRQDGSRAYMRYWNFQGSLDGKTWTNLRVHENDQTICKPGQFASWPVIGQNALLPF  765

Query  308  RFFRIVMTGPGTDGMNPWNCCICVLELYGYFR  213
            RFFR+V+TGP  D  NPWN CIC LELYGYF 
Sbjct  766  RFFRVVLTGPTADASNPWNFCICFLELYGYFH  797



>ref|XP_002437659.1| hypothetical protein SORBIDRAFT_10g000240 [Sorghum bicolor]
 gb|EER89026.1| hypothetical protein SORBIDRAFT_10g000240 [Sorghum bicolor]
Length=807

 Score =   230 bits (586),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 118/152 (78%), Gaps = 2/152 (1%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            PVL+K + V ASSP SR TDPK LVS+N+QGT FAGP +E+G   SWWM+D+G D+QLMC
Sbjct  658  PVLTKNITVVASSPNSRHTDPKALVSKNYQGTCFAGPCIENGKKLSWWMVDIGQDYQLMC  717

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
            NYYT+RQDGS  FMRSW  QGS DG NWT+LRVH DD TIC PGQFASWPI GP  LLPF
Sbjct  718  NYYTVRQDGSTTFMRSWALQGSMDGRNWTSLRVHDDDPTICHPGQFASWPIVGPAALLPF  777

Query  308  RFFRIVMTGPGTDGMNPWNCCICVLELYGYFR  213
            RFFR+ +TGP       WN CIC LELYGYFR
Sbjct  778  RFFRVALTGPAAGC--AWNLCICFLELYGYFR  807



>ref|XP_006828729.1| hypothetical protein AMTR_s00001p00041750 [Amborella trichopoda]
 gb|ERM96145.1| hypothetical protein AMTR_s00001p00041750 [Amborella trichopoda]
Length=827

 Score =   230 bits (586),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 120/152 (79%), Gaps = 0/152 (0%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            P L+KRV VTASSP SR+TDPK LVSR +Q TSFAGP++  G   +WW ID+G DH+LMC
Sbjct  676  PFLAKRVIVTASSPASRYTDPKSLVSRTYQATSFAGPRIVGGKNCAWWKIDIGQDHELMC  735

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
            NYYTIRQDGS  F R W+ QGS D  NWT+LRVH++D+TICKP QFASWPI  PN LLPF
Sbjct  736  NYYTIRQDGSTGFTRHWSLQGSRDAENWTDLRVHENDRTICKPAQFASWPIHPPNALLPF  795

Query  308  RFFRIVMTGPGTDGMNPWNCCICVLELYGYFR  213
            RFFR+++TG  T   NPWN C+C LELYGYFR
Sbjct  796  RFFRVLLTGLTTSDSNPWNLCMCFLELYGYFR  827



>ref|XP_009759339.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Nicotiana 
sylvestris]
Length=810

 Score =   229 bits (583),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 119/152 (78%), Gaps = 14/152 (9%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            PVLSKRV +TASSP SR TDPKVLVSRNFQGTS AGPQ+EDG  +SWWM+D+G DHQLMC
Sbjct  673  PVLSKRVTITASSPISRCTDPKVLVSRNFQGTSLAGPQMEDGRNASWWMVDVGQDHQLMC  732

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
            NYYT+RQDGS AFMR WNFQGS DG +WTNLR+       C P        TGPN LLPF
Sbjct  733  NYYTLRQDGSGAFMRRWNFQGSLDGKSWTNLRI------XCSP--------TGPNALLPF  778

Query  308  RFFRIVMTGPGTDGMNPWNCCICVLELYGYFR  213
            RFFR++MT P TD  NPWNCCIC LELYGYFR
Sbjct  779  RFFRLLMTAPTTDDTNPWNCCICFLELYGYFR  810



>gb|EPS65824.1| hypothetical protein M569_08953, partial [Genlisea aurea]
Length=780

 Score =   214 bits (545),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 113/129 (88%), Gaps = 0/129 (0%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            PVLSK+V +T SSP SRFTDPKVLVSR++QGTSFAGP++E+G  ++WWM+D+G DHQL+C
Sbjct  652  PVLSKKVFITGSSPVSRFTDPKVLVSRSYQGTSFAGPRMENGKNTAWWMVDIGDDHQLIC  711

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
            NYYTIRQDGSRAF+R W+ QGSTDG NW +LRVH++D T+CK GQ+ASWP+ G N LLPF
Sbjct  712  NYYTIRQDGSRAFLRHWSLQGSTDGANWASLRVHENDATMCKSGQYASWPVVGSNALLPF  771

Query  308  RFFRIVMTG  282
            RFFRI +TG
Sbjct  772  RFFRIALTG  780



>ref|XP_002962812.1| hypothetical protein SELMODRAFT_438140 [Selaginella moellendorffii]
 gb|EFJ36275.1| hypothetical protein SELMODRAFT_438140 [Selaginella moellendorffii]
Length=792

 Score =   211 bits (537),  Expect = 9e-60, Method: Composition-based stats.
 Identities = 87/151 (58%), Positives = 112/151 (74%), Gaps = 0/151 (0%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            P+++K++ ++ASSP SR+TDPKVL SRN+Q TSFAGP +E G   SWW +DLG DH+LMC
Sbjct  641  PMVTKQITLSASSPHSRYTDPKVLASRNYQATSFAGPCIERGETVSWWRVDLGPDHKLMC  700

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
            NYY++RQDGS  F R+W FQGS DG  WT+LR H+ D +I +P Q+ASWP+ G   L+PF
Sbjct  701  NYYSVRQDGSTNFARNWTFQGSGDGETWTDLRKHEKDHSIYRPAQYASWPVHGSKSLIPF  760

Query  308  RFFRIVMTGPGTDGMNPWNCCICVLELYGYF  216
            RFFR+++  P      PWN  IC LELYGY 
Sbjct  761  RFFRVLLQQPIAAVAAPWNLSICYLELYGYL  791



>ref|XP_001751401.1| predicted protein [Physcomitrella patens]
 gb|EDQ83718.1| predicted protein, partial [Physcomitrella patens]
Length=784

 Score =   210 bits (535),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/152 (62%), Positives = 114/152 (75%), Gaps = 0/152 (0%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            P L+K++ V+ASSP SRFTD K LVSRN+QGTSFAGP    G +S+WW +DLG D QL+C
Sbjct  633  PALTKKLVVSASSPPSRFTDAKALVSRNYQGTSFAGPCNVGGQMSAWWKVDLGADQQLLC  692

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
            NYYT+RQD S +FMR+W+ QGS DG  WT LR H +DQTI   GQ+ASWP+ G N LLPF
Sbjct  693  NYYTVRQDSSSSFMRNWSLQGSVDGQRWTQLRTHHNDQTIGHGGQYASWPVFGANALLPF  752

Query  308  RFFRIVMTGPGTDGMNPWNCCICVLELYGYFR  213
            RFFR+++ GP T    PWN  +C LELYGY R
Sbjct  753  RFFRVILLGPTTSVSTPWNLSLCYLELYGYLR  784



>ref|XP_002965955.1| hypothetical protein SELMODRAFT_84039 [Selaginella moellendorffii]
 gb|EFJ33375.1| hypothetical protein SELMODRAFT_84039 [Selaginella moellendorffii]
Length=772

 Score =   209 bits (533),  Expect = 3e-59, Method: Composition-based stats.
 Identities = 87/151 (58%), Positives = 112/151 (74%), Gaps = 0/151 (0%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            P+++K++ ++ASSP SR+TDPKVL SRN+Q TSFAGP +E G   SWW +DLG DH+LMC
Sbjct  621  PMVTKQITLSASSPPSRYTDPKVLASRNYQATSFAGPCIERGETVSWWRVDLGPDHKLMC  680

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
            NYY++RQDGS  F R+W FQGS DG  WT+LR H+ D +I +P Q+ASWP+ G   L+PF
Sbjct  681  NYYSVRQDGSTNFARNWTFQGSGDGETWTDLRKHEKDHSIYRPAQYASWPVHGSKSLIPF  740

Query  308  RFFRIVMTGPGTDGMNPWNCCICVLELYGYF  216
            RFFR+++  P      PWN  IC LELYGY 
Sbjct  741  RFFRVLLQQPIAAVAAPWNLSICYLELYGYL  771



>gb|AAB63076.1| unknown protein [Arabidopsis thaliana]
Length=114

 Score =   192 bits (488),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 95/114 (83%), Gaps = 0/114 (0%)
 Frame = -2

Query  554  VEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQ  375
            +EDG+ISSWW++DLG +HQLMCNYYT RQDGSRAF R W FQGS DG  WT+LRVH+DDQ
Sbjct  1    MEDGHISSWWVVDLGEEHQLMCNYYTFRQDGSRAFTRFWKFQGSMDGKTWTDLRVHEDDQ  60

Query  374  TICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYGYFR  213
            T+CK GQFASWPIT  N LLPFRFFR+V+TGP  D   PWN CIC LELYGYFR
Sbjct  61   TMCKAGQFASWPITAANALLPFRFFRLVLTGPTADTSTPWNFCICYLELYGYFR  114



>gb|KIY99757.1| hypothetical protein MNEG_8204 [Monoraphidium neglectum]
Length=725

 Score =   181 bits (458),  Expect = 4e-49, Method: Composition-based stats.
 Identities = 82/151 (54%), Positives = 101/151 (67%), Gaps = 0/151 (0%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            PVL+KR+ V ASSP SRFTDPK LVS  F  TSFA P+ E G  SSWW++DLG  H+L+C
Sbjct  534  PVLAKRIEVRASSPASRFTDPKALVSGAFLRTSFACPRYEGGQPSSWWLVDLGPSHRLLC  593

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
            NYYT+R D S  F R W  Q S D  +W +LR H  D  I  PGQ+ASWP++GP   +PF
Sbjct  594  NYYTMRHDSSSDFPRHWVLQASNDLQHWVDLRRHIADAAIRLPGQYASWPVSGPASHMPF  653

Query  308  RFFRIVMTGPGTDGMNPWNCCICVLELYGYF  216
            R FR+++ GP      PWN C+  +E YGYF
Sbjct  654  RAFRLLLAGPTLSAATPWNFCLSHVEFYGYF  684



>ref|XP_005845262.1| hypothetical protein CHLNCDRAFT_58586 [Chlorella variabilis]
 gb|EFN53160.1| hypothetical protein CHLNCDRAFT_58586 [Chlorella variabilis]
Length=669

 Score =   177 bits (450),  Expect = 4e-48, Method: Composition-based stats.
 Identities = 76/151 (50%), Positives = 106/151 (70%), Gaps = 0/151 (0%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            PVL+ R+ V ASSP  R TDPK L   NF   +FAGP++E+G +SSWW++DLG +H+L+C
Sbjct  503  PVLAGRLQVRASSPACRSTDPKALAGNNFARCNFAGPRMENGQLSSWWVLDLGPEHRLIC  562

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
            N+YT+R DGS  F+RSW  QGS DG +W +LR H  D+T+  PGQ+ASWP++     +P+
Sbjct  563  NHYTLRHDGSTDFLRSWVLQGSNDGASWADLRRHISDRTVRMPGQYASWPVSSHAAAVPY  622

Query  308  RFFRIVMTGPGTDGMNPWNCCICVLELYGYF  216
            R FR+++ GP  +  NP + C+   ELYGY 
Sbjct  623  RMFRLLLVGPNPEAANPHHVCLSFWELYGYL  653



>ref|XP_005650913.1| hypothetical protein COCSUDRAFT_46062 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE26369.1| hypothetical protein COCSUDRAFT_46062 [Coccomyxa subellipsoidea 
C-169]
Length=448

 Score =   150 bits (380),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 96/153 (63%), Gaps = 5/153 (3%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            P LS R+ VTASSP  RFTDPK +VS +F   + AG Q  DG   +WW +DLG  H+LMC
Sbjct  290  PALSGRLQVTASSPSCRFTDPKAVVSGHFLRNNAAG-QRRDGG--TWWRVDLGEQHRLMC  346

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
            NYYT+R D S  + RSW  Q STDG  W +LR H DD TI   GQ+ASWP+TG     PF
Sbjct  347  NYYTMRHDASPDYARSWALQASTDGTVWVDLRQHADDCTINMAGQYASWPVTGHAARRPF  406

Query  308  RFFRIVMT--GPGTDGMNPWNCCICVLELYGYF  216
            RFF++++T   P +   N     +  LE YGYF
Sbjct  407  RFFQLLLTPAAPASGKANGRVFSLSYLEFYGYF  439



>ref|XP_011399599.1| BTB/POZ domain-containing protein [Auxenochlorella protothecoides]
 gb|KFM26661.1| BTB/POZ domain-containing protein [Auxenochlorella protothecoides]
Length=465

 Score =   131 bits (330),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 88/153 (58%), Gaps = 2/153 (1%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            P+LS RV V ASSP  R T+P   V+      +FA P+ E G + SWW +DLG  HQL C
Sbjct  290  PMLSGRVKVQASSPACRSTNPASCVALGPPRLNFAAPRSEAGRLVSWWSLDLGPRHQLAC  349

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDG--VNWTNLRVHKDDQTICKPGQFASWPITGPNPLL  315
            + YT+R D S   +RSW  Q S DG    W +LR H++D T+  PGQ+ SW +TG    +
Sbjct  350  SAYTLRHDKSHDPLRSWTLQASRDGPQCGWEDLRRHENDLTLRLPGQYGSWAVTGHAATV  409

Query  314  PFRFFRIVMTGPGTDGMNPWNCCICVLELYGYF  216
            P+R FRI +        NPW+  +  +ELYG  
Sbjct  410  PYRCFRICVMQMQKGNENPWHASLAQIELYGNL  442



>ref|XP_001697437.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP00099.1| predicted protein, partial [Chlamydomonas reinhardtii]
Length=113

 Score =   118 bits (296),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 72/113 (64%), Gaps = 2/113 (2%)
 Frame = -2

Query  548  DGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTI  369
            +G  SSWW +DLG  HQL   YYT+R DGS+ F RSW  QGS D  NW +L+ H +D T+
Sbjct  1    NGVASSWWQVDLGEQHQLAITYYTLRHDGSQDFARSWVLQGSHDLSNWVDLKRHANDTTV  60

Query  368  CKPGQFASWPITGPNPLLPFRFFRIVMTGPGT--DGMNPWNCCICVLELYGYF  216
              PGQ+ASWP+ GP    P+R FR+++T P    +  + +N C+  +E YG+ 
Sbjct  61   KVPGQYASWPVIGPAAATPYRAFRLLLTAPNASPNPASRYNFCLSNVEFYGFM  113



>ref|XP_002950189.1| hypothetical protein VOLCADRAFT_48365 [Volvox carteri f. nagariensis]
 gb|EFJ48857.1| hypothetical protein VOLCADRAFT_48365 [Volvox carteri f. nagariensis]
Length=108

 Score =   116 bits (291),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 70/108 (65%), Gaps = 2/108 (2%)
 Frame = -2

Query  533  SWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQ  354
            SWW +DLG  HQL   YYT+R DGS+ F+RSW  QGS D   W +L+ H +D TI  PGQ
Sbjct  1    SWWQVDLGEQHQLAITYYTLRHDGSQDFVRSWVLQGSHDLAVWVDLKRHSNDTTIKVPGQ  60

Query  353  FASWPITGPNPLLPFRFFRIVMTGPGT--DGMNPWNCCICVLELYGYF  216
            +ASWP+ GP   +P+R FR+++T P    +  +  N C+  LELYG+ 
Sbjct  61   YASWPVIGPAAAVPYRAFRLLLTAPNASPNPASRHNFCLSNLELYGFL  108



>ref|XP_004339299.1| BTB/POZ domain containing protein [Acanthamoeba castellanii str. 
Neff]
 gb|ELR17286.1| BTB/POZ domain containing protein [Acanthamoeba castellanii str. 
Neff]
Length=775

 Score =   103 bits (257),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 50/151 (33%), Positives = 82/151 (54%), Gaps = 8/151 (5%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            P  +  V V  S+P SR+++P+ +V R F  T +       G    W ++ L  +   + 
Sbjct  632  PCRAGLVKVVCSAPPSRYSNPEAVVDRAFHTTWYT-----SGRPHPWLIVQLLKEKAFVM  686

Query  488  NYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
              Y IRQDGS  F+RSW+ QGS DG +W +L  H +D  +  P ++  WP++    ++P+
Sbjct  687  KGYAIRQDGSTVFLRSWSMQGSNDGQSWVDLSTHVNDCGLASPSRWVFWPVSS---VVPY  743

Query  308  RFFRIVMTGPGTDGMNPWNCCICVLELYGYF  216
              FR++MTGP    ++P    +  +E YG+F
Sbjct  744  AQFRLIMTGPSASPVSPNTLALSNIEFYGFF  774



>gb|KDD72973.1| hypothetical protein H632_c2675p1, partial [Helicosporidium sp. 
ATCC 50920]
Length=110

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 54/102 (53%), Gaps = 0/102 (0%)
 Frame = -2

Query  521  IDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASW  342
            +DLG   +L   +Y +R D SR F+R W  Q S DG  W ++R H  D ++    Q+A+W
Sbjct  1    VDLGPRRRLALTHYALRHDASRDFLRDWVVQASADGEAWVDVRRHASDPSLKVAHQWAAW  60

Query  341  PITGPNPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYGYF  216
            P+ G     P+R  R+++  P     NPW+  +   E YG+ 
Sbjct  61   PLVGHAAARPWRALRVLLDRPNAGADNPWHLALSAWEFYGHL  102



>ref|XP_006596518.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X3 [Glycine max]
Length=714

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 37/59 (63%), Positives = 49/59 (83%), Gaps = 2/59 (3%)
 Frame = -2

Query  668  PVLS--KRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQ  498
            P+L+  +++ +TASSP SR+TDPKVLVSR +QGT FAGP++E+G   SWWM+DLG DHQ
Sbjct  653  PLLAEPRKITITASSPHSRYTDPKVLVSRTYQGTCFAGPRLENGQNCSWWMVDLGQDHQ  711



>ref|XP_005708947.1| ubiquitin-protein ligase [Galdieria sulphuraria]
 gb|EME32427.1| ubiquitin-protein ligase [Galdieria sulphuraria]
Length=970

 Score = 84.3 bits (207),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 43/125 (34%), Positives = 74/125 (59%), Gaps = 5/125 (4%)
 Frame = -2

Query  650  VXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR  471
            V +T+SS  SRF   + L   +   + FA   + + +   W+ +DLG +  L C++YT+ 
Sbjct  829  VSITSSSG-SRFAKLESLAESSVNRSCFA---LSNSSSLVWFALDLGAERVLACSFYTLA  884

Query  470  QDGSRA-FMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPFRFFRI  294
             DGS + F+R+W  +GS DG +WT L+ H++D+T+  P Q A+W +  P   + +R+FR+
Sbjct  885  HDGSESNFLRNWCLEGSKDGKSWTVLKEHQNDETLQSPLQRATWRLEEPTSQVFYRYFRV  944

Query  293  VMTGP  279
            +   P
Sbjct  945  IARPP  949



>ref|XP_005708288.1| ubiquitin-protein ligase isoform 1 [Galdieria sulphuraria]
 gb|EME31768.1| ubiquitin-protein ligase isoform 1 [Galdieria sulphuraria]
Length=944

 Score = 78.6 bits (192),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 48/143 (34%), Positives = 77/143 (54%), Gaps = 10/143 (7%)
 Frame = -2

Query  638  ASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGS  459
            +SS  +RF+  + LV      +SFA P   D +  +W+ +D G  ++L C+ Y++  DGS
Sbjct  804  SSSSGARFSRLENLVESGANRSSFALP---DSSGLAWFSLDFGTKYELACSAYSLVHDGS  860

Query  458  RA-FMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTG  282
             + F+R+W  +GS DG  W+ L+ H +D+++  P Q + W I        FR+FRI+   
Sbjct  861  ESNFLRNWCLEGSKDGTQWSILKEHINDKSLQHPLQRSVWKIDNVMSQEFFRYFRILARS  920

Query  281  PGTDGMNPWNCCICVLELYGYFR  213
             G+  +N  N     LE YG  R
Sbjct  921  RGSR-LNLGN-----LEFYGRLR  937



>ref|XP_005708289.1| ubiquitin-protein ligase isoform 2 [Galdieria sulphuraria]
 gb|EME31769.1| ubiquitin-protein ligase isoform 2 [Galdieria sulphuraria]
Length=960

 Score = 78.6 bits (192),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 48/143 (34%), Positives = 77/143 (54%), Gaps = 10/143 (7%)
 Frame = -2

Query  638  ASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGS  459
            +SS  +RF+  + LV      +SFA P   D +  +W+ +D G  ++L C+ Y++  DGS
Sbjct  820  SSSSGARFSRLENLVESGANRSSFALP---DSSGLAWFSLDFGTKYELACSAYSLVHDGS  876

Query  458  RA-FMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTG  282
             + F+R+W  +GS DG  W+ L+ H +D+++  P Q + W I        FR+FRI+   
Sbjct  877  ESNFLRNWCLEGSKDGTQWSILKEHINDKSLQHPLQRSVWKIDNVMSQEFFRYFRILARS  936

Query  281  PGTDGMNPWNCCICVLELYGYFR  213
             G+  +N  N     LE YG  R
Sbjct  937  RGSR-LNLGN-----LEFYGRLR  953



>ref|XP_011189868.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Bactrocera 
cucurbitae]
Length=2901

 Score = 77.8 bits (190),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 41/110 (37%), Positives = 60/110 (55%), Gaps = 6/110 (5%)
 Frame = -2

Query  542   NISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTI  369
             N  +W+ IDLG    L+ N YT+R  +   R+ +R+W  QGS DGV WT L  H DD+++
Sbjct  1226  NKKAWFAIDLGV--YLIPNAYTLRHARGYGRSALRNWMLQGSKDGVTWTTLVTHTDDKSL  1283

Query  368   CKPGQFASWPIT-GPNPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +PG  A+WPI   P+ +  FR  R+   G    G   +   +   E+YG
Sbjct  1284  VEPGSTATWPIVCAPDEMHGFRHIRVQQNGRNASGQTHY-LSLSGFEIYG  1332



>ref|XP_011189870.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Bactrocera 
cucurbitae]
Length=2889

 Score = 77.8 bits (190),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 41/110 (37%), Positives = 60/110 (55%), Gaps = 6/110 (5%)
 Frame = -2

Query  542   NISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTI  369
             N  +W+ IDLG    L+ N YT+R  +   R+ +R+W  QGS DGV WT L  H DD+++
Sbjct  1214  NKKAWFAIDLGV--YLIPNAYTLRHARGYGRSALRNWMLQGSKDGVTWTTLVTHTDDKSL  1271

Query  368   CKPGQFASWPIT-GPNPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +PG  A+WPI   P+ +  FR  R+   G    G   +   +   E+YG
Sbjct  1272  VEPGSTATWPIVCAPDEMHGFRHIRVQQNGRNASGQTHY-LSLSGFEIYG  1320



>ref|XP_011189869.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Bactrocera 
cucurbitae]
Length=2893

 Score = 77.8 bits (190),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 41/110 (37%), Positives = 60/110 (55%), Gaps = 6/110 (5%)
 Frame = -2

Query  542   NISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTI  369
             N  +W+ IDLG    L+ N YT+R  +   R+ +R+W  QGS DGV WT L  H DD+++
Sbjct  1214  NKKAWFAIDLGV--YLIPNAYTLRHARGYGRSALRNWMLQGSKDGVTWTTLVTHTDDKSL  1271

Query  368   CKPGQFASWPIT-GPNPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +PG  A+WPI   P+ +  FR  R+   G    G   +   +   E+YG
Sbjct  1272  VEPGSTATWPIVCAPDEMHGFRHIRVQQNGRNASGQTHY-LSLSGFEIYG  1320



>ref|XP_011189866.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Bactrocera 
cucurbitae]
 ref|XP_011189867.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Bactrocera 
cucurbitae]
Length=2905

 Score = 77.8 bits (190),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 41/110 (37%), Positives = 60/110 (55%), Gaps = 6/110 (5%)
 Frame = -2

Query  542   NISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTI  369
             N  +W+ IDLG    L+ N YT+R  +   R+ +R+W  QGS DGV WT L  H DD+++
Sbjct  1226  NKKAWFAIDLGV--YLIPNAYTLRHARGYGRSALRNWMLQGSKDGVTWTTLVTHTDDKSL  1283

Query  368   CKPGQFASWPIT-GPNPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +PG  A+WPI   P+ +  FR  R+   G    G   +   +   E+YG
Sbjct  1284  VEPGSTATWPIVCAPDEMHGFRHIRVQQNGRNASGQTHY-LSLSGFEIYG  1332



>ref|XP_005842130.1| hypothetical protein GUITHDRAFT_41514, partial [Guillardia theta 
CCMP2712]
 gb|EKX55150.1| hypothetical protein GUITHDRAFT_41514, partial [Guillardia theta 
CCMP2712]
Length=111

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 59/113 (52%), Gaps = 8/113 (7%)
 Frame = -2

Query  536  SSWWMIDLGYDHQLMCNYYTIRQDG--SRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICK  363
            S W  +DLG    L+   Y+I      S   MRSW F+GS +  +W  LR H +D  +  
Sbjct  1    SPWLAVDLGEGRGLIATAYSIMHGSGSSSNAMRSWRFEGSNNKNSWITLREHLNDPRMQT  60

Query  362  PGQFASWPITGPNP----LLPFRFFRIVMTGPGTDGMNPWNCCICVLELYGYF  216
            PGQ  ++ +   +     L  FR+FRI++TGP +   N +  C C LELYG +
Sbjct  61   PGQVETFFLHNLDKEVTRLQAFRYFRILLTGPNSS--NFFRLCACRLELYGRY  111



>ref|XP_639138.1| BTB/POZ domain-containing protein [Dictyostelium discoideum AX4]
 gb|EAL65772.1| BTB/POZ domain-containing protein [Dictyostelium discoideum AX4]
Length=863

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 44/107 (41%), Positives = 62/107 (58%), Gaps = 6/107 (6%)
 Frame = -2

Query  536  SSWWMIDLGYDHQLMCNYYTIRQDGSRAF--MRSWNFQGSTDGVNWTNLRVHKDDQTICK  363
            +SW MIDLG +  ++  YYTIR   S     +R+W+FQGST+G  WT L+ H +D ++  
Sbjct  751  ASWVMIDLGPNRTVVPMYYTIRHGLSYKSDSLRTWDFQGSTNGEQWTVLKRHTNDPSLNY  810

Query  362  PGQFASWPITGPNPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
                 SWP+TG      FR+FRI+ TG  ++  N     I  LE+YG
Sbjct  811  KYATHSWPVTGCET--AFRYFRILQTGKNSNNRN--FLVIGGLEIYG  853



>ref|XP_004333299.1| BTB/POZ domain containing protein [Acanthamoeba castellanii str. 
Neff]
 gb|ELR11286.1| BTB/POZ domain containing protein [Acanthamoeba castellanii str. 
Neff]
Length=764

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 50/139 (36%), Positives = 74/139 (53%), Gaps = 14/139 (10%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNI-SSWWMIDLGYDHQLM  492
            P  + R+ VTASS      DP  LVS+          ++  G++ +SW+ IDLG    L+
Sbjct  621  PHSAGRLRVTASS--IEKGDPVKLVSKK-------PSELWSGDVPASWFAIDLGPSRTLV  671

Query  491  CNYYTIRQDGSRAF--MRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPL  318
             NYYT+R  G+     +R+W+ QGS+DG  W  L+ H +D ++  P    SWPI  P+  
Sbjct  672  PNYYTLRHGGNYKADSLRTWDLQGSSDGKTWIVLKRHTNDTSLSGPFATHSWPI--PSVT  729

Query  317  LPFRFFRIVMTGPGTDGMN  261
              +R FRI+ TG  +   N
Sbjct  730  EAYRHFRILQTGHNSSNHN  748



>gb|AAB47544.1| MigA [Dictyostelium discoideum]
Length=813

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 44/107 (41%), Positives = 62/107 (58%), Gaps = 6/107 (6%)
 Frame = -2

Query  536  SSWWMIDLGYDHQLMCNYYTIRQDGSRAF--MRSWNFQGSTDGVNWTNLRVHKDDQTICK  363
            +SW MIDLG +  ++  YYTIR   S     +R+W+FQGST+G  WT L+ H +D ++  
Sbjct  701  ASWVMIDLGPNRTVVPMYYTIRHGLSYKSDSLRTWDFQGSTNGEQWTVLKRHTNDPSLNY  760

Query  362  PGQFASWPITGPNPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
                 SWP+TG      FR+FRI+ TG  ++  N     I  LE+YG
Sbjct  761  KYATHSWPVTGCET--AFRYFRILQTGKNSNNRN--FLVIGGLEIYG  803



>ref|XP_011406508.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1-like [Amphimedon 
queenslandica]
Length=2146

 Score = 76.3 bits (186),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 38/111 (34%), Positives = 62/111 (56%), Gaps = 6/111 (5%)
 Frame = -2

Query  536   SSWWMIDLGYDHQLMCNYYTIRQD---GSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTIC  366
             +SW+ +D G        +Y++R     G+R+ +RSW+FQ S DGV WT +  H +D ++ 
Sbjct  1070  NSWFAVDTGV--WFFPTHYSLRHSRGYGNRSALRSWDFQVSKDGVTWTTVYSHVNDNSLN  1127

Query  365   KPGQFASWPITGPNPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYGYFR  213
             +PG  ASW ++ P     +R  R+++TGP   G   +   +  LE+YG  R
Sbjct  1128  EPGSTASWSLSPPTDPEGWRHLRLILTGPNASGHTHY-LSLSGLEVYGEVR  1177



>ref|XP_011199880.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Bactrocera 
dorsalis]
Length=2887

 Score = 76.3 bits (186),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 39/110 (35%), Positives = 60/110 (55%), Gaps = 6/110 (5%)
 Frame = -2

Query  542   NISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTI  369
             N  +W+ IDLG    ++ N YT+R  +   R+ +R+W  QGS DG+ WT L  H DD+++
Sbjct  1209  NKKAWFAIDLGV--YIIPNAYTLRHARGYGRSALRNWMLQGSKDGITWTTLVTHTDDKSL  1266

Query  368   CKPGQFASWPIT-GPNPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +PG  A+WPI   P+ +  FR  R+   G    G   +   +   E+YG
Sbjct  1267  VEPGSTATWPIVCAPDEMHGFRHIRVQQNGRNASGQTHY-LSLSGFEIYG  1315



>ref|XP_011199881.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Bactrocera 
dorsalis]
Length=2883

 Score = 75.9 bits (185),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 39/110 (35%), Positives = 60/110 (55%), Gaps = 6/110 (5%)
 Frame = -2

Query  542   NISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTI  369
             N  +W+ IDLG    ++ N YT+R  +   R+ +R+W  QGS DG+ WT L  H DD+++
Sbjct  1209  NKKAWFAIDLGV--YIIPNAYTLRHARGYGRSALRNWMLQGSKDGITWTTLVTHTDDKSL  1266

Query  368   CKPGQFASWPIT-GPNPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +PG  A+WPI   P+ +  FR  R+   G    G   +   +   E+YG
Sbjct  1267  VEPGSTATWPIVCAPDEMHGFRHIRVQQNGRNASGQTHY-LSLSGFEIYG  1315



>ref|XP_011199879.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Bactrocera 
dorsalis]
Length=2895

 Score = 75.9 bits (185),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 39/110 (35%), Positives = 60/110 (55%), Gaps = 6/110 (5%)
 Frame = -2

Query  542   NISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTI  369
             N  +W+ IDLG    ++ N YT+R  +   R+ +R+W  QGS DG+ WT L  H DD+++
Sbjct  1221  NKKAWFAIDLGV--YIIPNAYTLRHARGYGRSALRNWMLQGSKDGITWTTLVTHTDDKSL  1278

Query  368   CKPGQFASWPIT-GPNPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +PG  A+WPI   P+ +  FR  R+   G    G   +   +   E+YG
Sbjct  1279  VEPGSTATWPIVCAPDEMHGFRHIRVQQNGRNASGQTHY-LSLSGFEIYG  1327



>ref|XP_011199876.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Bactrocera 
dorsalis]
 ref|XP_011199877.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Bactrocera 
dorsalis]
 ref|XP_011199878.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Bactrocera 
dorsalis]
Length=2899

 Score = 75.9 bits (185),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 39/110 (35%), Positives = 60/110 (55%), Gaps = 6/110 (5%)
 Frame = -2

Query  542   NISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTI  369
             N  +W+ IDLG    ++ N YT+R  +   R+ +R+W  QGS DG+ WT L  H DD+++
Sbjct  1221  NKKAWFAIDLGV--YIIPNAYTLRHARGYGRSALRNWMLQGSKDGITWTTLVTHTDDKSL  1278

Query  368   CKPGQFASWPIT-GPNPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +PG  A+WPI   P+ +  FR  R+   G    G   +   +   E+YG
Sbjct  1279  VEPGSTATWPIVCAPDEMHGFRHIRVQQNGRNASGQTHY-LSLSGFEIYG  1327



>ref|XP_004521542.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1-like isoform X1 
[Ceratitis capitata]
 ref|XP_004521543.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1-like isoform X2 
[Ceratitis capitata]
 ref|XP_004521544.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1-like isoform X3 
[Ceratitis capitata]
Length=2900

 Score = 75.9 bits (185),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 40/110 (36%), Positives = 59/110 (54%), Gaps = 6/110 (5%)
 Frame = -2

Query  542   NISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTI  369
             N  +W+ IDLG    ++ N YT+R  +   R+ +R+W  QGS DG  WT L  H DD+++
Sbjct  1223  NKKAWFAIDLGV--YIIPNAYTLRHARGYGRSALRNWMLQGSKDGATWTTLVTHNDDKSL  1280

Query  368   CKPGQFASWPIT-GPNPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +PG  A+WPI   P+ +  FR  RI   G    G   +   +   E+YG
Sbjct  1281  VEPGSTATWPIVCSPDEMQGFRHIRIQQNGRNASGQTHY-LSLSGFEIYG  1329



>ref|XP_004521546.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1-like isoform X5 
[Ceratitis capitata]
Length=2888

 Score = 75.9 bits (185),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 40/110 (36%), Positives = 59/110 (54%), Gaps = 6/110 (5%)
 Frame = -2

Query  542   NISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTI  369
             N  +W+ IDLG    ++ N YT+R  +   R+ +R+W  QGS DG  WT L  H DD+++
Sbjct  1211  NKKAWFAIDLGV--YIIPNAYTLRHARGYGRSALRNWMLQGSKDGATWTTLVTHNDDKSL  1268

Query  368   CKPGQFASWPIT-GPNPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +PG  A+WPI   P+ +  FR  RI   G    G   +   +   E+YG
Sbjct  1269  VEPGSTATWPIVCSPDEMQGFRHIRIQQNGRNASGQTHY-LSLSGFEIYG  1317



>ref|XP_004521545.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1-like isoform X4 
[Ceratitis capitata]
Length=2896

 Score = 75.9 bits (185),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 40/110 (36%), Positives = 59/110 (54%), Gaps = 6/110 (5%)
 Frame = -2

Query  542   NISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTI  369
             N  +W+ IDLG    ++ N YT+R  +   R+ +R+W  QGS DG  WT L  H DD+++
Sbjct  1223  NKKAWFAIDLGV--YIIPNAYTLRHARGYGRSALRNWMLQGSKDGATWTTLVTHNDDKSL  1280

Query  368   CKPGQFASWPIT-GPNPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +PG  A+WPI   P+ +  FR  RI   G    G   +   +   E+YG
Sbjct  1281  VEPGSTATWPIVCSPDEMQGFRHIRIQQNGRNASGQTHY-LSLSGFEIYG  1329



>ref|XP_004521547.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1-like isoform X6 
[Ceratitis capitata]
Length=2477

 Score = 75.5 bits (184),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 40/110 (36%), Positives = 59/110 (54%), Gaps = 6/110 (5%)
 Frame = -2

Query  542   NISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTI  369
             N  +W+ IDLG    ++ N YT+R  +   R+ +R+W  QGS DG  WT L  H DD+++
Sbjct  1223  NKKAWFAIDLGV--YIIPNAYTLRHARGYGRSALRNWMLQGSKDGATWTTLVTHNDDKSL  1280

Query  368   CKPGQFASWPIT-GPNPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +PG  A+WPI   P+ +  FR  RI   G    G   +   +   E+YG
Sbjct  1281  VEPGSTATWPIVCSPDEMQGFRHIRIQQNGRNASGQTHY-LSLSGFEIYG  1329



>ref|XP_011414031.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1-like isoform X2 
[Crassostrea gigas]
Length=2445

 Score = 74.7 bits (182),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 38/107 (36%), Positives = 62/107 (58%), Gaps = 6/107 (6%)
 Frame = -2

Query  533   SWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKP  360
             +W+ IDLG    ++  +YT+R  +   R+ +R+W FQ S DG+NW  L+ HKDD ++ +P
Sbjct  1145  AWFAIDLGV--WIVPTHYTLRHARGYGRSALRNWQFQVSKDGINWVTLKTHKDDTSLNEP  1202

Query  359   GQFASWPITGP-NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
             G  A+WP+T P +    +R  +I  TG    G   +   +  +E+YG
Sbjct  1203  GSTATWPLTPPEDEKQGWRHIKIQQTGRNASGQTHY-LSVSGMEIYG  1248



>ref|XP_011414030.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1-like isoform X1 
[Crassostrea gigas]
Length=2448

 Score = 74.7 bits (182),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 38/107 (36%), Positives = 62/107 (58%), Gaps = 6/107 (6%)
 Frame = -2

Query  533   SWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKP  360
             +W+ IDLG    ++  +YT+R  +   R+ +R+W FQ S DG+NW  L+ HKDD ++ +P
Sbjct  1148  AWFAIDLGV--WIVPTHYTLRHARGYGRSALRNWQFQVSKDGINWVTLKTHKDDTSLNEP  1205

Query  359   GQFASWPITGP-NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
             G  A+WP+T P +    +R  +I  TG    G   +   +  +E+YG
Sbjct  1206  GSTATWPLTPPEDEKQGWRHIKIQQTGRNASGQTHY-LSVSGMEIYG  1251



>gb|EKC30956.1| E3 ubiquitin-protein ligase HECTD1 [Crassostrea gigas]
Length=2380

 Score = 74.7 bits (182),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 38/107 (36%), Positives = 62/107 (58%), Gaps = 6/107 (6%)
 Frame = -2

Query  533   SWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKP  360
             +W+ IDLG    ++  +YT+R  +   R+ +R+W FQ S DG+NW  L+ HKDD ++ +P
Sbjct  1145  AWFAIDLGV--WIVPTHYTLRHARGYGRSALRNWQFQVSKDGINWVTLKTHKDDTSLNEP  1202

Query  359   GQFASWPITGP-NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
             G  A+WP+T P +    +R  +I  TG    G   +   +  +E+YG
Sbjct  1203  GSTATWPLTPPEDEKQGWRHIKIQQTGRNASGQTHY-LSVSGMEIYG  1248



>ref|XP_005178040.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X5 [Musca 
domestica]
Length=2792

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 41/110 (37%), Positives = 59/110 (54%), Gaps = 6/110 (5%)
 Frame = -2

Query  542   NISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTI  369
             N  +W+ IDLG    ++ N YT+R  +   R+ +R+W  Q S DGVNWT L  H DD+++
Sbjct  1189  NKKAWFAIDLGV--FIIPNAYTLRHARGYGRSALRNWMLQASKDGVNWTTLVTHADDKSL  1246

Query  368   CKPGQFASWPIT-GPNPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +PG  A+WPI   P+    FR  RI   G    G   +   +   E+YG
Sbjct  1247  VEPGSTATWPIVCAPDENQGFRHIRIQQNGRNASGQTHY-LSLSGFEIYG  1295



>ref|XP_011290265.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Musca 
domestica]
Length=2804

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 41/110 (37%), Positives = 59/110 (54%), Gaps = 6/110 (5%)
 Frame = -2

Query  542   NISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTI  369
             N  +W+ IDLG    ++ N YT+R  +   R+ +R+W  Q S DGVNWT L  H DD+++
Sbjct  1201  NKKAWFAIDLGV--FIIPNAYTLRHARGYGRSALRNWMLQASKDGVNWTTLVTHADDKSL  1258

Query  368   CKPGQFASWPIT-GPNPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +PG  A+WPI   P+    FR  RI   G    G   +   +   E+YG
Sbjct  1259  VEPGSTATWPIVCAPDENQGFRHIRIQQNGRNASGQTHY-LSLSGFEIYG  1307



>ref|XP_005178039.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Musca 
domestica]
Length=2847

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 41/110 (37%), Positives = 59/110 (54%), Gaps = 6/110 (5%)
 Frame = -2

Query  542   NISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTI  369
             N  +W+ IDLG    ++ N YT+R  +   R+ +R+W  Q S DGVNWT L  H DD+++
Sbjct  1244  NKKAWFAIDLGV--FIIPNAYTLRHARGYGRSALRNWMLQASKDGVNWTTLVTHADDKSL  1301

Query  368   CKPGQFASWPIT-GPNPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +PG  A+WPI   P+    FR  RI   G    G   +   +   E+YG
Sbjct  1302  VEPGSTATWPIVCAPDENQGFRHIRIQQNGRNASGQTHY-LSLSGFEIYG  1350



>ref|XP_011290263.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Musca 
domestica]
Length=2848

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 41/110 (37%), Positives = 59/110 (54%), Gaps = 6/110 (5%)
 Frame = -2

Query  542   NISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTI  369
             N  +W+ IDLG    ++ N YT+R  +   R+ +R+W  Q S DGVNWT L  H DD+++
Sbjct  1245  NKKAWFAIDLGV--FIIPNAYTLRHARGYGRSALRNWMLQASKDGVNWTTLVTHADDKSL  1302

Query  368   CKPGQFASWPIT-GPNPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +PG  A+WPI   P+    FR  RI   G    G   +   +   E+YG
Sbjct  1303  VEPGSTATWPIVCAPDENQGFRHIRIQQNGRNASGQTHY-LSLSGFEIYG  1351



>ref|XP_011290264.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Musca 
domestica]
Length=2836

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 41/110 (37%), Positives = 59/110 (54%), Gaps = 6/110 (5%)
 Frame = -2

Query  542   NISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTI  369
             N  +W+ IDLG    ++ N YT+R  +   R+ +R+W  Q S DGVNWT L  H DD+++
Sbjct  1233  NKKAWFAIDLGV--FIIPNAYTLRHARGYGRSALRNWMLQASKDGVNWTTLVTHADDKSL  1290

Query  368   CKPGQFASWPIT-GPNPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +PG  A+WPI   P+    FR  RI   G    G   +   +   E+YG
Sbjct  1291  VEPGSTATWPIVCAPDENQGFRHIRIQQNGRNASGQTHY-LSLSGFEIYG  1339



>ref|XP_003288046.1| hypothetical protein DICPUDRAFT_16127 [Dictyostelium purpureum]
 gb|EGC35433.1| hypothetical protein DICPUDRAFT_16127 [Dictyostelium purpureum]
Length=602

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 63/107 (59%), Gaps = 6/107 (6%)
 Frame = -2

Query  536  SSWWMIDLGYDHQLMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDDQTICK  363
            +SW MID+G +  ++ +YYTIR   S     +R+W+FQGST+G  WT L+ H +D ++  
Sbjct  490  ASWVMIDVGPNRSVVPHYYTIRHGLSFKSDSLRTWDFQGSTNGEQWTVLKRHTNDLSLNF  549

Query  362  PGQFASWPITGPNPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
                 SWPITG      +R+FRI+ TG  ++  N     I  +E+YG
Sbjct  550  KYATHSWPITGCET--AYRYFRILQTGKNSNNRN--FLVIGGIEIYG  592



>ref|XP_001749884.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ85263.1| predicted protein [Monosiga brevicollis MX1]
Length=2345

 Score = 72.8 bits (177),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 40/110 (36%), Positives = 57/110 (52%), Gaps = 5/110 (5%)
 Frame = -2

Query  545   GNISSWWMIDLGYDHQLMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDDQT  372
             G   SW+ IDLG   +  C  YT+R      R+ +R W+FQ S DG  WT +R H+ D  
Sbjct  1119  GRKDSWFSIDLGIYVKPTC--YTLRHARGYHRSALRDWDFQVSEDGDTWTTIREHRGDTA  1176

Query  371   ICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
             + +PG  A++ ++ P     +R FRI M GP  +    +  C    ELYG
Sbjct  1177  LDEPGSTATFEVSAPEHATGWRHFRIFMRGPTANSNTHYLSC-SGFELYG  1225



>ref|XP_004341500.1| BTB/POZ domain containing protein [Acanthamoeba castellanii str. 
Neff]
 gb|ELR19414.1| BTB/POZ domain containing protein [Acanthamoeba castellanii str. 
Neff]
Length=326

 Score = 70.5 bits (171),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 38/107 (36%), Positives = 59/107 (55%), Gaps = 6/107 (6%)
 Frame = -2

Query  536  SSWWMIDLGYDHQLMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDDQTICK  363
            +SW  +DLG +  ++  +YT+R  G+     +R+W+FQGS DG  W+ LR H +D+++  
Sbjct  202  ASWVQLDLGPNRAVVPTFYTVRHGGTFKADSLRTWDFQGSVDGTGWSLLRRHVNDESLND  261

Query  362  PGQFASWPITGPNPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
                 +WPI G      +R FRI+ TG  +   N     +  LELYG
Sbjct  262  LFATHTWPIEGQTK--AYRLFRILQTGHNSSNHNF--LVLSGLELYG  304



>ref|XP_005832107.1| hypothetical protein GUITHDRAFT_46879, partial [Guillardia theta 
CCMP2712]
 gb|EKX45127.1| hypothetical protein GUITHDRAFT_46879, partial [Guillardia theta 
CCMP2712]
Length=108

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 60/111 (54%), Gaps = 10/111 (9%)
 Frame = -2

Query  533  SWWMIDLGYDHQLMCNYYTI---RQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICK  363
            SW  IDLG    L+   Y +   + DG+ A +RSWNFQ S +  +W  LR H++D  I +
Sbjct  1    SWIEIDLGEGFGLIPTCYEVYHGKADGNDA-LRSWNFQASHNDRHWQTLREHRNDFRITE  59

Query  362  PGQFASWPITGPN----PLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              Q  +  +   N    PL  FR+FRI+MTG  + G    + CI  +EL+G
Sbjct  60   GFQKITSSLHYINDITEPLRAFRYFRILMTGSNSSGRE--HLCISKVELFG  108



>ref|XP_002424807.1| hect E3 ubiquitin ligase, putative [Pediculus humanus corporis]
 gb|EEB12069.1| hect E3 ubiquitin ligase, putative [Pediculus humanus corporis]
Length=2686

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 52/150 (35%), Positives = 77/150 (51%), Gaps = 17/150 (11%)
 Frame = -2

Query  650   VXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMCNY  483
             V VT+S     P+ R  D   ++SR+   +S       D +  +W+ IDLG    L+ + 
Sbjct  1113  VMVTSSDGRNLPYGRLED---ILSRD---SSALNCHTND-DRKAWFAIDLGL--WLIPSC  1163

Query  482   YTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP-NPLLP  312
             YTIR  +   R+ +R+W FQ S DGVNWT L  H DD ++ +PG  ASWP+  P +    
Sbjct  1164  YTIRHARGYGRSALRNWLFQVSKDGVNWTTLYTHTDDTSLNEPGSTASWPLDPPLDETQG  1223

Query  311   FRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
             +R  R+  TG    G   +   +   E+YG
Sbjct  1224  WRHVRLQQTGKNASGQAHY-LSLSGFEVYG  1252



>ref|XP_001969437.1| GG23957 [Drosophila erecta]
 gb|EDV58496.1| GG23957 [Drosophila erecta]
Length=2724

 Score = 69.7 bits (169),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 38/110 (35%), Positives = 59/110 (54%), Gaps = 6/110 (5%)
 Frame = -2

Query  542   NISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTI  369
             N  +W+ IDLG    ++   YT+R  +   R+ +R+W  QGS DG+ WT L  H DD+++
Sbjct  1189  NKKAWFAIDLGV--YIIPTAYTLRHARGYGRSALRNWLLQGSKDGLTWTTLSTHVDDKSL  1246

Query  368   CKPGQFASWPIT-GPNPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +PG  A+WPIT   +  + +R  RI   G    G   +   +   E+YG
Sbjct  1247  VEPGSTATWPITCATDDSVRYRHIRIQQNGRNASGQTHY-LSLSGFEIYG  1295



>ref|XP_002089068.1| GE26196 [Drosophila yakuba]
 gb|EDW88780.1| GE26196 [Drosophila yakuba]
Length=2725

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 38/110 (35%), Positives = 59/110 (54%), Gaps = 6/110 (5%)
 Frame = -2

Query  542   NISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTI  369
             N  +W+ IDLG    ++   YT+R  +   R+ +R+W  QGS DG+ WT L  H DD+++
Sbjct  1190  NKKAWFAIDLGV--YIIPTAYTLRHARGYGRSALRNWLLQGSKDGLTWTTLSTHVDDKSL  1247

Query  368   CKPGQFASWPIT-GPNPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +PG  A+WPIT   +  + +R  RI   G    G   +   +   E+YG
Sbjct  1248  VEPGSTATWPITCATDDSVRYRHIRIQQNGRNASGQTHY-LSLSGFEIYG  1296



>dbj|GAM18790.1| hypothetical protein SAMD00019534_019650, partial [Acytostelium 
subglobosum LB1]
Length=448

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 48/155 (31%), Positives = 73/155 (47%), Gaps = 20/155 (13%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            P L K V VT+S     +  P  L++R             D ++++ + +DLG  + L  
Sbjct  300  PALRKIVRVTSSEMSIGY--PHTLINRT------PTNMYTDKSVNAHFTVDLGRKYVLCP  351

Query  488  NYYTIRQDGSR-----AFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPN  324
            N+Y++R  G       A  ++W  +GS DGV W  L  HKDD  +        WP+   +
Sbjct  352  NFYSMRYGGDSQGSIYAAPKNWQMKGSLDGVQWDVLVDHKDDLELKHGYSIGGWPV---H  408

Query  323  PLLPFRFFRIVMTGPGT-DGMNPWNCCICVLELYG  222
             +  +R+ RI MTGP   DG      C+C  E+YG
Sbjct  409  AIHSYRYLRIQMTGPNQRDGS---ELCVCCFEVYG  440



>ref|XP_004989701.1| hypothetical protein PTSG_12883 [Salpingoeca rosetta]
 gb|EGD78378.1| hypothetical protein PTSG_12883 [Salpingoeca rosetta]
Length=2036

 Score = 69.3 bits (168),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 48/140 (34%), Positives = 70/140 (50%), Gaps = 17/140 (12%)
 Frame = -2

Query  629   PFSRFTDPKVLVSRNFQGTSFAGPQV--EDGNISSWWMIDLGYDHQLMCNYYTIRQDG--  462
             PF R  D   +VSR+      + P+    + N S W  IDLG    +  ++YT+R     
Sbjct  947   PFGRVRD---IVSRD------SSPRNCHTNNNKSGWVSIDLGL--LIKPSHYTLRHATGY  995

Query  461   SRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTG  282
             S + +R+W+ +GS +G  W  LR H+ D+ +  PG   +W IT   P  P   FRI   G
Sbjct  996   SSSALRTWSLEGSDNGKEWFTLREHEKDEHLRSPGDTHTWEITTAPP-RPVCMFRIKQKG  1054

Query  281   PGTDGMNPWNCCICVLELYG  222
             P +DG N +   I   E+YG
Sbjct  1055  PDSDGKNHY-ISISGFEVYG  1073



>ref|XP_005842128.1| hypothetical protein GUITHDRAFT_52999, partial [Guillardia theta 
CCMP2712]
 gb|EKX55148.1| hypothetical protein GUITHDRAFT_52999, partial [Guillardia theta 
CCMP2712]
Length=108

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 38/109 (35%), Positives = 59/109 (54%), Gaps = 11/109 (10%)
 Frame = -2

Query  530  WWMIDLGYDHQLMCNYYTIRQ--DGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTIC---  366
            W  + LG    L+ ++YT+R     S   +R++ FQGS DGV W  LR H++D ++    
Sbjct  1    WISVFLGEGRHLVPSHYTLRHGFTTSAMLLRNFEFQGSNDGVTWQVLRRHRNDHSMVISS  60

Query  365  KPGQF-ASWPITGPNPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              G++ AS+P++      PF  FRI+ TG    G +    C+  +ELYG
Sbjct  61   HHGRYAASYPVSTAQ---PFSHFRILQTGANASGNH--RLCLGGIELYG  104



>emb|CDK13343.1| HECD-1, isoform e [Caenorhabditis elegans]
Length=2646

 Score = 68.9 bits (167),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 48/151 (32%), Positives = 71/151 (47%), Gaps = 10/151 (7%)
 Frame = -2

Query  668   PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
             P   K V +T S     F  P+ L+SR+           +D N  + + IDLG    ++ 
Sbjct  1219  PATVKAVKITCSDTRQPFGKPEDLLSRD--QNPINCHTSDDKN--AHFTIDLGL--FVVP  1272

Query  488   NYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLL  315
               Y++R      R+ +R+W  QGS D   W N+ VH DD+ + +PG  A+W + G     
Sbjct  1273  TSYSLRHSRGYGRSALRNWMLQGSVDAKRWENVIVHTDDKGLGEPGSTATWHV-GEKGTT  1331

Query  314   PFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              FRFFRI   G  + G   +  C    E+YG
Sbjct  1332  AFRFFRIAQNGKNSSGQTHYLSC-SGFEIYG  1361



>emb|CDK13339.1| HECD-1, isoform a [Caenorhabditis elegans]
Length=2648

 Score = 68.9 bits (167),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 48/151 (32%), Positives = 71/151 (47%), Gaps = 10/151 (7%)
 Frame = -2

Query  668   PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
             P   K V +T S     F  P+ L+SR+           +D N  + + IDLG    ++ 
Sbjct  1221  PATVKAVKITCSDTRQPFGKPEDLLSRD--QNPINCHTSDDKN--AHFTIDLGL--FVVP  1274

Query  488   NYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLL  315
               Y++R      R+ +R+W  QGS D   W N+ VH DD+ + +PG  A+W + G     
Sbjct  1275  TSYSLRHSRGYGRSALRNWMLQGSVDAKRWENVIVHTDDKGLGEPGSTATWHV-GEKGTT  1333

Query  314   PFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              FRFFRI   G  + G   +  C    E+YG
Sbjct  1334  AFRFFRIAQNGKNSSGQTHYLSC-SGFEIYG  1363



>emb|CDK13344.1| HECD-1, isoform f [Caenorhabditis elegans]
Length=2650

 Score = 68.9 bits (167),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 48/151 (32%), Positives = 71/151 (47%), Gaps = 10/151 (7%)
 Frame = -2

Query  668   PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
             P   K V +T S     F  P+ L+SR+           +D N  + + IDLG    ++ 
Sbjct  1223  PATVKAVKITCSDTRQPFGKPEDLLSRD--QNPINCHTSDDKN--AHFTIDLGL--FVVP  1276

Query  488   NYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLL  315
               Y++R      R+ +R+W  QGS D   W N+ VH DD+ + +PG  A+W + G     
Sbjct  1277  TSYSLRHSRGYGRSALRNWMLQGSVDAKRWENVIVHTDDKGLGEPGSTATWHV-GEKGTT  1335

Query  314   PFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              FRFFRI   G  + G   +  C    E+YG
Sbjct  1336  AFRFFRIAQNGKNSSGQTHYLSC-SGFEIYG  1365



>emb|CDK13342.1| HECD-1, isoform d [Caenorhabditis elegans]
Length=2644

 Score = 68.9 bits (167),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 48/151 (32%), Positives = 71/151 (47%), Gaps = 10/151 (7%)
 Frame = -2

Query  668   PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
             P   K V +T S     F  P+ L+SR+           +D N  + + IDLG    ++ 
Sbjct  1217  PATVKAVKITCSDTRQPFGKPEDLLSRD--QNPINCHTSDDKN--AHFTIDLGL--FVVP  1270

Query  488   NYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLL  315
               Y++R      R+ +R+W  QGS D   W N+ VH DD+ + +PG  A+W + G     
Sbjct  1271  TSYSLRHSRGYGRSALRNWMLQGSVDAKRWENVIVHTDDKGLGEPGSTATWHV-GEKGTT  1329

Query  314   PFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              FRFFRI   G  + G   +  C    E+YG
Sbjct  1330  AFRFFRIAQNGKNSSGQTHYLSC-SGFEIYG  1359



>emb|CDK13341.1| HECD-1, isoform c [Caenorhabditis elegans]
Length=2607

 Score = 68.9 bits (167),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 48/151 (32%), Positives = 71/151 (47%), Gaps = 10/151 (7%)
 Frame = -2

Query  668   PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
             P   K V +T S     F  P+ L+SR+           +D N  + + IDLG    ++ 
Sbjct  1180  PATVKAVKITCSDTRQPFGKPEDLLSRD--QNPINCHTSDDKN--AHFTIDLGL--FVVP  1233

Query  488   NYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLL  315
               Y++R      R+ +R+W  QGS D   W N+ VH DD+ + +PG  A+W + G     
Sbjct  1234  TSYSLRHSRGYGRSALRNWMLQGSVDAKRWENVIVHTDDKGLGEPGSTATWHV-GEKGTT  1292

Query  314   PFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              FRFFRI   G  + G   +  C    E+YG
Sbjct  1293  AFRFFRIAQNGKNSSGQTHYLSC-SGFEIYG  1322



>emb|CDK13346.1| HECD-1, isoform h [Caenorhabditis elegans]
Length=2609

 Score = 68.9 bits (167),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 48/151 (32%), Positives = 71/151 (47%), Gaps = 10/151 (7%)
 Frame = -2

Query  668   PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
             P   K V +T S     F  P+ L+SR+           +D N  + + IDLG    ++ 
Sbjct  1182  PATVKAVKITCSDTRQPFGKPEDLLSRD--QNPINCHTSDDKN--AHFTIDLGL--FVVP  1235

Query  488   NYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLL  315
               Y++R      R+ +R+W  QGS D   W N+ VH DD+ + +PG  A+W + G     
Sbjct  1236  TSYSLRHSRGYGRSALRNWMLQGSVDAKRWENVIVHTDDKGLGEPGSTATWHV-GEKGTT  1294

Query  314   PFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              FRFFRI   G  + G   +  C    E+YG
Sbjct  1295  AFRFFRIAQNGKNSSGQTHYLSC-SGFEIYG  1324



>emb|CDK13340.1| HECD-1, isoform b [Caenorhabditis elegans]
Length=2611

 Score = 68.9 bits (167),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 48/151 (32%), Positives = 71/151 (47%), Gaps = 10/151 (7%)
 Frame = -2

Query  668   PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
             P   K V +T S     F  P+ L+SR+           +D N  + + IDLG    ++ 
Sbjct  1184  PATVKAVKITCSDTRQPFGKPEDLLSRD--QNPINCHTSDDKN--AHFTIDLGL--FVVP  1237

Query  488   NYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLL  315
               Y++R      R+ +R+W  QGS D   W N+ VH DD+ + +PG  A+W + G     
Sbjct  1238  TSYSLRHSRGYGRSALRNWMLQGSVDAKRWENVIVHTDDKGLGEPGSTATWHV-GEKGTT  1296

Query  314   PFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              FRFFRI   G  + G   +  C    E+YG
Sbjct  1297  AFRFFRIAQNGKNSSGQTHYLSC-SGFEIYG  1326



>emb|CDK13345.1| HECD-1, isoform g [Caenorhabditis elegans]
Length=2613

 Score = 68.9 bits (167),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 48/151 (32%), Positives = 71/151 (47%), Gaps = 10/151 (7%)
 Frame = -2

Query  668   PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
             P   K V +T S     F  P+ L+SR+           +D N  + + IDLG    ++ 
Sbjct  1186  PATVKAVKITCSDTRQPFGKPEDLLSRD--QNPINCHTSDDKN--AHFTIDLGL--FVVP  1239

Query  488   NYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLL  315
               Y++R      R+ +R+W  QGS D   W N+ VH DD+ + +PG  A+W + G     
Sbjct  1240  TSYSLRHSRGYGRSALRNWMLQGSVDAKRWENVIVHTDDKGLGEPGSTATWHV-GEKGTT  1298

Query  314   PFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              FRFFRI   G  + G   +  C    E+YG
Sbjct  1299  AFRFFRIAQNGKNSSGQTHYLSC-SGFEIYG  1328



>ref|XP_002078905.1| GD22285 [Drosophila simulans]
 gb|EDX04490.1| GD22285 [Drosophila simulans]
Length=2404

 Score = 68.9 bits (167),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 38/110 (35%), Positives = 58/110 (53%), Gaps = 6/110 (5%)
 Frame = -2

Query  542   NISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTI  369
             N  +W+ IDLG    ++   YT+R  +   R+ +R+W  QGS DG  WT L  H DD+++
Sbjct  1024  NKKAWFAIDLGV--YIIPTAYTLRHARGYGRSALRNWLLQGSKDGSTWTTLSTHVDDKSL  1081

Query  368   CKPGQFASWPIT-GPNPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +PG  A+WPIT   +  + +R  RI   G    G   +   +   E+YG
Sbjct  1082  VEPGSTATWPITCATDDSVRYRHIRIQQNGRNASGQTHY-LSLSGFEIYG  1130



>ref|NP_501120.1| Protein HECD-1 [Caenorhabditis elegans]
Length=2761

 Score = 68.6 bits (166),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 48/151 (32%), Positives = 71/151 (47%), Gaps = 10/151 (7%)
 Frame = -2

Query  668   PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
             P   K V +T S     F  P+ L+SR+           +D N  + + IDLG    ++ 
Sbjct  1259  PATVKAVKITCSDTRQPFGKPEDLLSRD--QNPINCHTSDDKN--AHFTIDLGL--FVVP  1312

Query  488   NYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLL  315
               Y++R      R+ +R+W  QGS D   W N+ VH DD+ + +PG  A+W + G     
Sbjct  1313  TSYSLRHSRGYGRSALRNWMLQGSVDAKRWENVIVHTDDKGLGEPGSTATWHV-GEKGTT  1371

Query  314   PFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              FRFFRI   G  + G   +  C    E+YG
Sbjct  1372  AFRFFRIAQNGKNSSGQTHYLSC-SGFEIYG  1401



>ref|XP_004209170.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1-like, partial [Hydra 
vulgaris]
Length=1793

 Score = 68.6 bits (166),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 36/111 (32%), Positives = 61/111 (55%), Gaps = 9/111 (8%)
 Frame = -2

Query  536  SSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICK  363
            ++W+ IDLG    ++   YT+R  +   R+ +R+W FQ S DGV+W  L+ H++D+++ +
Sbjct  210  AAWFSIDLGV--HVIPTAYTLRHARGYGRSALRNWLFQVSKDGVSWLTLKKHENDESLKE  267

Query  362  PGQFASWPITGPNPLLP----FRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
            PG   +WP+  P+  L     + F R+   GP   G   +   +   ELYG
Sbjct  268  PGSTTTWPLDMPDSALNETEGWHFVRLQQNGPNASGQTHY-LSVSGFELYG  317



>ref|XP_002036468.1| GM11846 [Drosophila sechellia]
 gb|EDW52391.1| GM11846 [Drosophila sechellia]
Length=2725

 Score = 68.6 bits (166),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 38/110 (35%), Positives = 58/110 (53%), Gaps = 6/110 (5%)
 Frame = -2

Query  542   NISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTI  369
             N  +W+ IDLG    ++   YT+R  +   R+ +R+W  QGS DG  WT L  H DD+++
Sbjct  1190  NKKAWFAIDLGV--YIIPTAYTLRHARGYGRSALRNWLLQGSKDGSTWTTLSTHVDDKSL  1247

Query  368   CKPGQFASWPIT-GPNPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +PG  A+WPIT   +  + +R  RI   G    G   +   +   E+YG
Sbjct  1248  VEPGSTATWPITCATDDSVRYRHIRIQQNGRNASGQTHY-LSLSGFEIYG  1296



>ref|XP_001963078.1| GF14121 [Drosophila ananassae]
 gb|EDV32299.1| GF14121 [Drosophila ananassae]
Length=2704

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 37/110 (34%), Positives = 59/110 (54%), Gaps = 6/110 (5%)
 Frame = -2

Query  542   NISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTI  369
             N  +W+ IDLG    ++   Y++R  +  +R+ +R+W  QGS DG+ WT L  H DD+++
Sbjct  1175  NKKAWFAIDLGV--YIIPTAYSLRHARGYARSALRNWLLQGSKDGIVWTTLSTHVDDKSL  1232

Query  368   CKPGQFASWPITGP-NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
               PG  A+WPI+ P +    +R  RI   G    G   +   +   E+YG
Sbjct  1233  VDPGSTATWPISCPQDDSQRYRHIRIQQNGRNASGQTHY-LSLSGFEIYG  1281



>ref|WP_029637034.1| hypothetical protein [[Scytonema hofmanni] UTEX B 1581]
Length=223

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/95 (36%), Positives = 51/95 (54%), Gaps = 6/95 (6%)
 Frame = -2

Query  497  LMCNYYTIR-QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNP  321
            L CNYY+IR +     ++R+W FQGS DG  W +L V  ++ T+  P Q+ S+PIT  N 
Sbjct  132  LKCNYYSIRNRSNVDHYLRNWKFQGSNDGSVWADLDVRTNNITLSSPSQWLSFPITTTNF  191

Query  320  LLPFRFFRIVMTGPGTDGMNPWNCCICVLELYGYF  216
               FR  +  +   G   +     C+  +ELYG +
Sbjct  192  YTQFRLLQNGLNSAGYAYL-----CLGEIELYGTY  221



>gb|ETN82977.1| HECT-domain protein [Necator americanus]
Length=2630

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 45/145 (31%), Positives = 67/145 (46%), Gaps = 9/145 (6%)
 Frame = -2

Query  650   VXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR  471
             V VT S     F  P+ ++SR+    +      ++ N +    IDLG    +  + YT+R
Sbjct  1230  VQVTCSDQRQPFGKPEDVLSRDVNPINCHSSDDKNANFT----IDLGV--LIYPSAYTLR  1283

Query  470   --QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPFRFFR  297
               +   R+ +R+W  QGS D   W  L  H DD ++  PG  A+WPI       PFR+ R
Sbjct  1284  HARGYGRSALRNWLLQGSKDKQVWEVLVAHTDDTSLGDPGSTATWPIEDDRSKGPFRYLR  1343

Query  296   IVMTGPGTDGMNPWNCCICVLELYG  222
             I   G  + G   +   I   E+YG
Sbjct  1344  IAQNGKNSSGQT-YYLSISGFEVYG  1367



>ref|XP_002633092.1| Hypothetical protein CBG05779 [Caenorhabditis briggsae]
Length=2752

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 46/151 (30%), Positives = 71/151 (47%), Gaps = 10/151 (7%)
 Frame = -2

Query  668   PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
             P   K V VT S P   F  P+ L+SR+           +D N  S +  DLG    L+ 
Sbjct  1253  PATVKAVKVTCSDPRQPFGKPEDLLSRD--SNPINCHSSDDKN--SHFTFDLGV--FLIP  1306

Query  488   NYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLL  315
               YT+R      R+ +R+W  QGS D   W ++  H DD+++ +PG  A+W +      +
Sbjct  1307  TSYTMRHSRGYGRSALRNWTLQGSIDSKKWDDIINHVDDKSLGEPGSTATWHVPEKGT-V  1365

Query  314   PFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +R++RI   G  + G   +  C    E+YG
Sbjct  1366  AYRYYRIAQNGKNSSGQTHYLSC-SGFEIYG  1395



>gb|KDR14371.1| E3 ubiquitin-protein ligase HECTD1 [Zootermopsis nevadensis]
Length=2759

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 48/150 (32%), Positives = 77/150 (51%), Gaps = 17/150 (11%)
 Frame = -2

Query  650   VXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMCNY  483
             V VT+S     P+ R  D   ++SR+   +S       D +  +W+ IDLG    ++ + 
Sbjct  1160  VMVTSSDGRNLPYGRLED---ILSRD---SSALNCHTND-DKRAWFAIDLGL--WVLPSS  1210

Query  482   YTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLP-  312
             YT+R  +   R+ +R+W FQ S DG+NWT L  H DD ++ +PG  +SWP+  P   +  
Sbjct  1211  YTLRHARGYGRSALRNWLFQVSKDGLNWTTLYTHMDDGSLNEPGSTSSWPLEPPTEEVQG  1270

Query  311   FRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
             +R  R+  TG    G   +   +   E+YG
Sbjct  1271  WRHIRLQQTGKNASGQTHY-LSLSGFEIYG  1299



>emb|CAP26541.2| Protein CBR-HECD-1 [Caenorhabditis briggsae]
Length=2727

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 46/151 (30%), Positives = 71/151 (47%), Gaps = 10/151 (7%)
 Frame = -2

Query  668   PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
             P   K V VT S P   F  P+ L+SR+           +D N  S +  DLG    L+ 
Sbjct  1239  PATVKAVKVTCSDPRQPFGKPEDLLSRD--SNPINCHSSDDKN--SHFTFDLGV--FLIP  1292

Query  488   NYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLL  315
               YT+R      R+ +R+W  QGS D   W ++  H DD+++ +PG  A+W +      +
Sbjct  1293  TSYTMRHSRGYGRSALRNWTLQGSIDSKKWDDIINHVDDKSLGEPGSTATWHVPEKGT-V  1351

Query  314   PFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +R++RI   G  + G   +  C    E+YG
Sbjct  1352  AYRYYRIAQNGKNSSGQTHYLSC-SGFEIYG  1381



>ref|XP_002676026.1| predicted protein [Naegleria gruberi]
 gb|EFC43282.1| predicted protein [Naegleria gruberi]
Length=601

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 47/76 (62%), Gaps = 4/76 (5%)
 Frame = -2

Query  482  YTIRQDGSR--AFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
            YTIR   +R    +R+W FQGS DG+ +T+L+VH +D T+    Q A++PIT  N    +
Sbjct  512  YTIRHTNARDTECLRTWRFQGSIDGLTFTDLKVHNNDSTLTTKSQSATFPITDCNEY--Y  569

Query  308  RFFRIVMTGPGTDGMN  261
            ++FRI+  GP +   N
Sbjct  570  KYFRILQDGPNSSSNN  585



>ref|XP_011314687.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X8 [Fopius 
arisanus]
Length=2365

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 38/107 (36%), Positives = 58/107 (54%), Gaps = 6/107 (6%)
 Frame = -2

Query  533   SWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKP  360
             +W+ IDLG    L+ + YT+R  +   R+ +R+W FQ S DG+NWT L  H DD ++ +P
Sbjct  1191  AWFSIDLGV--WLIPSAYTLRHARGYGRSALRNWMFQVSKDGINWTTLYTHVDDCSLNEP  1248

Query  359   GQFASWPITGP-NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
             G  A+W +  P      +R  R+  TG    G   +   +  LE+YG
Sbjct  1249  GSTATWTLEAPAEETQGWRHLRLQQTGKNASGQTHY-LSVSGLEVYG  1294



>ref|XP_005792638.1| hypothetical protein EMIHUDRAFT_108691 [Emiliania huxleyi CCMP1516]
 gb|EOD40209.1| hypothetical protein EMIHUDRAFT_108691 [Emiliania huxleyi CCMP1516]
Length=176

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 53/108 (49%), Gaps = 5/108 (5%)
 Frame = -2

Query  533  SWWMIDLGYDHQLMCNYYTIRQDGSRAF-MRSWNFQGSTDGVNWTNLRVHKDDQTICKPG  357
            SW  +D+G +  L  +YY +RQ  S  F MR+W  QG  DG++W  L  H+ D +  +  
Sbjct  2    SWMSVDIGENRWLSVSYYCLRQGVSSGFRMRNWELQGCNDGLSWQMLCKHERDLSFGEQA  61

Query  356  Q-FASWPITGPNPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYGYF  216
               A W +        +R FRI+ TG  +D ++        +ELYG  
Sbjct  62   HGVAGWAVENAT---AYRHFRILQTGKNSDAVHTGVLACAGIELYGAL  106



>ref|XP_004909451.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Heterocephalus 
glaber]
Length=2562

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 51/156 (33%), Positives = 79/156 (51%), Gaps = 17/156 (11%)
 Frame = -2

Query  668   PVLSKRVXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  501
             P     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG   
Sbjct  1093  PAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLGL--  1143

Query  500   QLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  327
              ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+  P
Sbjct  1144  WVVPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPLDPP  1203

Query  326   -NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +    +R  RI   G    G   +   +  LELYG
Sbjct  1204  KDEKQGWRHVRIKQMGKNASGQTHY-LSLSGLELYG  1238



>ref|XP_004864091.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Heterocephalus 
glaber]
Length=2563

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 51/156 (33%), Positives = 79/156 (51%), Gaps = 17/156 (11%)
 Frame = -2

Query  668   PVLSKRVXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  501
             P     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG   
Sbjct  1093  PAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLGL--  1143

Query  500   QLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  327
              ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+  P
Sbjct  1144  WVVPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPLDPP  1203

Query  326   -NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +    +R  RI   G    G   +   +  LELYG
Sbjct  1204  KDEKQGWRHVRIKQMGKNASGQTHY-LSLSGLELYG  1238



>ref|XP_011314688.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X9 [Fopius 
arisanus]
Length=2535

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 38/107 (36%), Positives = 58/107 (54%), Gaps = 6/107 (6%)
 Frame = -2

Query  533   SWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKP  360
             +W+ IDLG    L+ + YT+R  +   R+ +R+W FQ S DG+NWT L  H DD ++ +P
Sbjct  1139  AWFSIDLGV--WLIPSAYTLRHARGYGRSALRNWMFQVSKDGINWTTLYTHVDDCSLNEP  1196

Query  359   GQFASWPITGP-NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
             G  A+W +  P      +R  R+  TG    G   +   +  LE+YG
Sbjct  1197  GSTATWTLEAPAEETQGWRHLRLQQTGKNASGQTHY-LSVSGLEVYG  1242



>ref|XP_011314681.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Fopius 
arisanus]
Length=2579

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 38/107 (36%), Positives = 58/107 (54%), Gaps = 6/107 (6%)
 Frame = -2

Query  533   SWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKP  360
             +W+ IDLG    L+ + YT+R  +   R+ +R+W FQ S DG+NWT L  H DD ++ +P
Sbjct  1179  AWFSIDLGV--WLIPSAYTLRHARGYGRSALRNWMFQVSKDGINWTTLYTHVDDCSLNEP  1236

Query  359   GQFASWPITGP-NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
             G  A+W +  P      +R  R+  TG    G   +   +  LE+YG
Sbjct  1237  GSTATWTLEAPAEETQGWRHLRLQQTGKNASGQTHY-LSVSGLEVYG  1282



>ref|XP_011314680.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Fopius 
arisanus]
Length=2587

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 38/107 (36%), Positives = 58/107 (54%), Gaps = 6/107 (6%)
 Frame = -2

Query  533   SWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKP  360
             +W+ IDLG    L+ + YT+R  +   R+ +R+W FQ S DG+NWT L  H DD ++ +P
Sbjct  1191  AWFSIDLGV--WLIPSAYTLRHARGYGRSALRNWMFQVSKDGINWTTLYTHVDDCSLNEP  1248

Query  359   GQFASWPITGP-NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
             G  A+W +  P      +R  R+  TG    G   +   +  LE+YG
Sbjct  1249  GSTATWTLEAPAEETQGWRHLRLQQTGKNASGQTHY-LSVSGLEVYG  1294



>ref|XP_011314679.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Fopius 
arisanus]
Length=2591

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 38/107 (36%), Positives = 58/107 (54%), Gaps = 6/107 (6%)
 Frame = -2

Query  533   SWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKP  360
             +W+ IDLG    L+ + YT+R  +   R+ +R+W FQ S DG+NWT L  H DD ++ +P
Sbjct  1191  AWFSIDLGV--WLIPSAYTLRHARGYGRSALRNWMFQVSKDGINWTTLYTHVDDCSLNEP  1248

Query  359   GQFASWPITGP-NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
             G  A+W +  P      +R  R+  TG    G   +   +  LE+YG
Sbjct  1249  GSTATWTLEAPAEETQGWRHLRLQQTGKNASGQTHY-LSVSGLEVYG  1294



>ref|XP_011314686.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X7 [Fopius 
arisanus]
Length=2524

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 38/107 (36%), Positives = 58/107 (54%), Gaps = 6/107 (6%)
 Frame = -2

Query  533   SWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKP  360
             +W+ IDLG    L+ + YT+R  +   R+ +R+W FQ S DG+NWT L  H DD ++ +P
Sbjct  1191  AWFSIDLGV--WLIPSAYTLRHARGYGRSALRNWMFQVSKDGINWTTLYTHVDDCSLNEP  1248

Query  359   GQFASWPITGP-NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
             G  A+W +  P      +R  R+  TG    G   +   +  LE+YG
Sbjct  1249  GSTATWTLEAPAEETQGWRHLRLQQTGKNASGQTHY-LSVSGLEVYG  1294



>ref|XP_011314685.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X6 [Fopius 
arisanus]
Length=2539

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 38/107 (36%), Positives = 58/107 (54%), Gaps = 6/107 (6%)
 Frame = -2

Query  533   SWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKP  360
             +W+ IDLG    L+ + YT+R  +   R+ +R+W FQ S DG+NWT L  H DD ++ +P
Sbjct  1139  AWFSIDLGV--WLIPSAYTLRHARGYGRSALRNWMFQVSKDGINWTTLYTHVDDCSLNEP  1196

Query  359   GQFASWPITGP-NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
             G  A+W +  P      +R  R+  TG    G   +   +  LE+YG
Sbjct  1197  GSTATWTLEAPAEETQGWRHLRLQQTGKNASGQTHY-LSVSGLEVYG  1242



>ref|XP_011314684.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X5 [Fopius 
arisanus]
Length=2547

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 38/107 (36%), Positives = 58/107 (54%), Gaps = 6/107 (6%)
 Frame = -2

Query  533   SWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKP  360
             +W+ IDLG    L+ + YT+R  +   R+ +R+W FQ S DG+NWT L  H DD ++ +P
Sbjct  1151  AWFSIDLGV--WLIPSAYTLRHARGYGRSALRNWMFQVSKDGINWTTLYTHVDDCSLNEP  1208

Query  359   GQFASWPITGP-NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
             G  A+W +  P      +R  R+  TG    G   +   +  LE+YG
Sbjct  1209  GSTATWTLEAPAEETQGWRHLRLQQTGKNASGQTHY-LSVSGLEVYG  1254



>ref|XP_011314682.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Fopius 
arisanus]
Length=2551

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 38/107 (36%), Positives = 58/107 (54%), Gaps = 6/107 (6%)
 Frame = -2

Query  533   SWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKP  360
             +W+ IDLG    L+ + YT+R  +   R+ +R+W FQ S DG+NWT L  H DD ++ +P
Sbjct  1151  AWFSIDLGV--WLIPSAYTLRHARGYGRSALRNWMFQVSKDGINWTTLYTHVDDCSLNEP  1208

Query  359   GQFASWPITGP-NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
             G  A+W +  P      +R  R+  TG    G   +   +  LE+YG
Sbjct  1209  GSTATWTLEAPAEETQGWRHLRLQQTGKNASGQTHY-LSVSGLEVYG  1254



>ref|XP_002052386.1| GJ21961 [Drosophila virilis]
 gb|EDW64541.1| GJ21961 [Drosophila virilis]
Length=2710

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 38/110 (35%), Positives = 58/110 (53%), Gaps = 6/110 (5%)
 Frame = -2

Query  542   NISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTI  369
             N  +W+ IDLG    ++   YT+R  +   R+ +R+W  Q S DG+NWT L  H DD+++
Sbjct  1181  NKKAWFSIDLGV--CIVPTAYTLRHARGYGRSALRNWLLQASKDGINWTTLISHVDDKSL  1238

Query  368   CKPGQFASWPIT-GPNPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +PG  A+WPI    +    +R  RI   G    G   +   +  LE+YG
Sbjct  1239  AEPGSTATWPIVCTSDDTKGYRHIRIQQNGRNASGQTHY-LSLSGLEIYG  1287



>ref|NP_609369.1| CG5604 [Drosophila melanogaster]
 gb|AAF52899.1| CG5604 [Drosophila melanogaster]
Length=2727

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 37/110 (34%), Positives = 57/110 (52%), Gaps = 6/110 (5%)
 Frame = -2

Query  542   NISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTI  369
             N  +W+ IDLG    ++   YT+R  +   R+ +R+W  QGS DG  WT L  H DD+++
Sbjct  1190  NKKAWFAIDLGV--YIIPTAYTLRHARGYGRSALRNWLLQGSKDGSTWTTLSTHVDDKSL  1247

Query  368   CKPGQFASWPIT-GPNPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +PG  A+WPI    +  + +R  RI   G    G   +   +   E+YG
Sbjct  1248  VEPGSTATWPINCATDDSVWYRHIRIQQNGRNASGQTHY-LSLSGFEIYG  1296



>gb|AAQ23602.1| LP05936p [Drosophila melanogaster]
Length=2727

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 37/110 (34%), Positives = 57/110 (52%), Gaps = 6/110 (5%)
 Frame = -2

Query  542   NISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTI  369
             N  +W+ IDLG    ++   YT+R  +   R+ +R+W  QGS DG  WT L  H DD+++
Sbjct  1190  NKKAWFAIDLGV--YIIPTAYTLRHARGYGRSALRNWLLQGSKDGSTWTTLSTHVDDKSL  1247

Query  368   CKPGQFASWPIT-GPNPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +PG  A+WPI    +  + +R  RI   G    G   +   +   E+YG
Sbjct  1248  VEPGSTATWPINCATDDSVWYRHIRIQQNGRNASGQTHY-LSLSGFEIYG  1296



>ref|XP_007429074.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Python 
bivittatus]
Length=2523

 Score = 65.9 bits (159),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 77/156 (49%), Gaps = 17/156 (11%)
 Frame = -2

Query  668   PVLSKRVXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  501
             P     V VT+S     P+ R  D   ++SR  + ++      +D N  +W+ IDLG   
Sbjct  1093  PAAYGLVVVTSSEGRNLPYGRLED---ILSR--ESSALNCHTNDDKN--AWFAIDLGL--  1143

Query  500   QLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  327
              ++ + YT+R  +   R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+WP+  P
Sbjct  1144  WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTATWPLDSP  1203

Query  326   -NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +    +R  RI   G    G   +   +   ELYG
Sbjct  1204  KDEKQGWRHIRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_004909450.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Heterocephalus 
glaber]
Length=2607

 Score = 65.9 bits (159),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 51/156 (33%), Positives = 79/156 (51%), Gaps = 17/156 (11%)
 Frame = -2

Query  668   PVLSKRVXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  501
             P     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG   
Sbjct  1093  PAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLGL--  1143

Query  500   QLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  327
              ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+  P
Sbjct  1144  WVVPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPLDPP  1203

Query  326   -NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +    +R  RI   G    G   +   +  LELYG
Sbjct  1204  KDEKQGWRHVRIKQMGKNASGQTHY-LSLSGLELYG  1238



>ref|XP_004864090.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Heterocephalus 
glaber]
Length=2608

 Score = 65.9 bits (159),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 51/156 (33%), Positives = 79/156 (51%), Gaps = 17/156 (11%)
 Frame = -2

Query  668   PVLSKRVXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  501
             P     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG   
Sbjct  1093  PAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLGL--  1143

Query  500   QLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  327
              ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+  P
Sbjct  1144  WVVPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPLDPP  1203

Query  326   -NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +    +R  RI   G    G   +   +  LELYG
Sbjct  1204  KDEKQGWRHVRIKQMGKNASGQTHY-LSLSGLELYG  1238



>ref|XP_004909448.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Heterocephalus 
glaber]
 ref|XP_004909449.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Heterocephalus 
glaber]
 gb|EHB18581.1| E3 ubiquitin-protein ligase HECTD1 [Heterocephalus glaber]
Length=2609

 Score = 65.9 bits (159),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 51/156 (33%), Positives = 79/156 (51%), Gaps = 17/156 (11%)
 Frame = -2

Query  668   PVLSKRVXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  501
             P     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG   
Sbjct  1093  PAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLGL--  1143

Query  500   QLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  327
              ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+  P
Sbjct  1144  WVVPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPLDPP  1203

Query  326   -NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +    +R  RI   G    G   +   +  LELYG
Sbjct  1204  KDEKQGWRHVRIKQMGKNASGQTHY-LSLSGLELYG  1238



>ref|XP_004864088.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Heterocephalus 
glaber]
 ref|XP_004864089.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Heterocephalus 
glaber]
Length=2610

 Score = 65.9 bits (159),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 51/156 (33%), Positives = 79/156 (51%), Gaps = 17/156 (11%)
 Frame = -2

Query  668   PVLSKRVXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  501
             P     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG   
Sbjct  1093  PAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLGL--  1143

Query  500   QLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  327
              ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+  P
Sbjct  1144  WVVPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPLDPP  1203

Query  326   -NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +    +R  RI   G    G   +   +  LELYG
Sbjct  1204  KDEKQGWRHVRIKQMGKNASGQTHY-LSLSGLELYG  1238



>ref|XP_007063755.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase HECTD1 
[Chelonia mydas]
Length=2577

 Score = 65.9 bits (159),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 51/156 (33%), Positives = 77/156 (49%), Gaps = 17/156 (11%)
 Frame = -2

Query  668   PVLSKRVXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  501
             P     V VT+S     P+ R  D   ++SR  + ++      +D N  +W+ IDLG   
Sbjct  1093  PAAYGLVVVTSSEGRNLPYGRLED---ILSR--ESSALNCHTNDDKN--AWFAIDLGL--  1143

Query  500   QLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  327
              ++ + YT+R  +   R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+WPI  P
Sbjct  1144  WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTATWPIDPP  1203

Query  326   -NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +    +R  RI   G    G   +   +   ELYG
Sbjct  1204  KDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  1238



>gb|KFB39857.1| AGAP009511-PA-like protein [Anopheles sinensis]
Length=3042

 Score = 65.9 bits (159),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 39/111 (35%), Positives = 56/111 (50%), Gaps = 7/111 (6%)
 Frame = -2

Query  542   NISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTI  369
             N  SW+ IDLG    ++   YT+R  +   R+ +R+W FQ S DGVNW     H DD+++
Sbjct  1219  NKKSWFAIDLGM--YIIPTAYTLRHARGYGRSALRNWMFQLSKDGVNWVTALTHTDDKSL  1276

Query  368   CKPGQFASWPITGPN--PLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +PG   +WPI  P+      FR  RI   G    G   +   +   E+YG
Sbjct  1277  AEPGSTCTWPIDCPSDGDGQGFRHVRIHQNGRNASGQTHY-LSLSGFEIYG  1326



>gb|EYB85246.1| hypothetical protein Y032_0302g1869 [Ancylostoma ceylanicum]
Length=1818

 Score = 65.9 bits (159),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 44/145 (30%), Positives = 66/145 (46%), Gaps = 9/145 (6%)
 Frame = -2

Query  650   VXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR  471
             V VT S     F  P+ ++SR+    +      ++ N +    IDLG    +    YT+R
Sbjct  1157  VQVTCSDQRQPFGKPEDVLSRDVNPINCHSSDDKNANFT----IDLGV--LIYPTAYTLR  1210

Query  470   --QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPFRFFR  297
               +   R+ +R+W  QGS D   W  L  H DD ++  PG  A+WPI       PFR+ R
Sbjct  1211  HARGYGRSALRNWLLQGSKDKQVWEVLVAHADDTSLGDPGSTATWPIEDDRTKGPFRYLR  1270

Query  296   IVMTGPGTDGMNPWNCCICVLELYG  222
             +   G  + G   +   I   E+YG
Sbjct  1271  VAQNGKNSSGQT-YYLSISGFEVYG  1294



>ref|XP_007429075.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Python 
bivittatus]
Length=2509

 Score = 65.5 bits (158),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 77/156 (49%), Gaps = 17/156 (11%)
 Frame = -2

Query  668   PVLSKRVXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  501
             P     V VT+S     P+ R  D   ++SR  + ++      +D N  +W+ IDLG   
Sbjct  1093  PAAYGLVVVTSSEGRNLPYGRLED---ILSR--ESSALNCHTNDDKN--AWFAIDLGL--  1143

Query  500   QLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  327
              ++ + YT+R  +   R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+WP+  P
Sbjct  1144  WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTATWPLDSP  1203

Query  326   -NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +    +R  RI   G    G   +   +   ELYG
Sbjct  1204  KDEKQGWRHIRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_007429073.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Python 
bivittatus]
Length=2570

 Score = 65.5 bits (158),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 77/156 (49%), Gaps = 17/156 (11%)
 Frame = -2

Query  668   PVLSKRVXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  501
             P     V VT+S     P+ R  D   ++SR  + ++      +D N  +W+ IDLG   
Sbjct  1093  PAAYGLVVVTSSEGRNLPYGRLED---ILSR--ESSALNCHTNDDKN--AWFAIDLGL--  1143

Query  500   QLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  327
              ++ + YT+R  +   R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+WP+  P
Sbjct  1144  WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTATWPLDSP  1203

Query  326   -NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +    +R  RI   G    G   +   +   ELYG
Sbjct  1204  KDEKQGWRHIRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_310184.4| AGAP009511-PA [Anopheles gambiae str. PEST]
 gb|EAA05937.5| AGAP009511-PA [Anopheles gambiae str. PEST]
Length=2929

 Score = 65.5 bits (158),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 38/110 (35%), Positives = 57/110 (52%), Gaps = 6/110 (5%)
 Frame = -2

Query  542   NISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTI  369
             N  SW+ IDLG    ++   YT+R  +   R+ +R+W FQ S DGV+W  L  H DD+++
Sbjct  1241  NKKSWFAIDLGI--FILPTAYTLRHARGYGRSALRNWLFQMSKDGVSWVTLLTHTDDKSL  1298

Query  368   CKPGQFASWPITGP-NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +PG   +WPI  P +    +R  RI   G    G   +   +   E+YG
Sbjct  1299  AEPGSTCTWPIDCPADEQQGYRHVRIHQNGRNASGQTHY-LSLSGFEIYG  1347



>gb|ENN80588.1| hypothetical protein YQE_02993, partial [Dendroctonus ponderosae]
Length=2689

 Score = 65.5 bits (158),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 48/149 (32%), Positives = 72/149 (48%), Gaps = 16/149 (11%)
 Frame = -2

Query  650   VXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMCNY  483
             V VT+S     P+ R  D   ++SR+    S A     D +  +W+ IDLG    ++   
Sbjct  1128  VTVTSSDGRNLPYGRLED---ILSRD----SSALNCHTDDDKRAWFSIDLGL--FIIPTA  1178

Query  482   YTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
             YT+R  +   R+ +R+W FQ S DGV WT L  H  D ++ +PG  A+WP+  P     +
Sbjct  1179  YTLRHARGYGRSALRNWLFQMSKDGVVWTTLSTHTHDISLNEPGSTATWPVESPPDEQGW  1238

Query  308   RFFRIVMTGPGTDGMNPWNCCICVLELYG  222
             R  RI   G    G   +   +   E+YG
Sbjct  1239  RHVRIQQAGKNESGQTHY-LSLSGFEIYG  1266



>ref|XP_010631866.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Fukomys 
damarensis]
Length=2563

 Score = 65.5 bits (158),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 78/156 (50%), Gaps = 17/156 (11%)
 Frame = -2

Query  668   PVLSKRVXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  501
             P     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG   
Sbjct  1093  PAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLGL--  1143

Query  500   QLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  327
              ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+  P
Sbjct  1144  WMVPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPLDPP  1203

Query  326   -NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +    +R  RI   G    G   +   +   ELYG
Sbjct  1204  KDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  1238



>gb|KHJ84376.1| hypothetical protein OESDEN_15912, partial [Oesophagostomum dentatum]
Length=395

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 45/145 (31%), Positives = 65/145 (45%), Gaps = 9/145 (6%)
 Frame = -2

Query  650  VXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR  471
            V VT S     F  P+ ++SR+    +      ++ N +    IDLG    +    YT+R
Sbjct  110  VQVTCSDQRQPFGKPEDVLSRDVNPINCHSSDDKNANFT----IDLGV--LIYPTAYTLR  163

Query  470  QDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPFRFFR  297
                  R+ +R+W  QGS D   W  L  H DD ++  PG  A+WPI       PFR+ R
Sbjct  164  HARGYGRSALRNWLLQGSKDKQVWEVLVAHTDDTSLGDPGSTATWPIEDDRTKGPFRYLR  223

Query  296  IVMTGPGTDGMNPWNCCICVLELYG  222
            I   G  + G   +   I   E+YG
Sbjct  224  IAQNGKNSSGQT-YYLSISGFEVYG  247



>ref|XP_005196337.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Bos 
taurus]
Length=1507

 Score = 65.1 bits (157),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 78/156 (50%), Gaps = 17/156 (11%)
 Frame = -2

Query  668   PVLSKRVXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  501
             P     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG   
Sbjct  1093  PAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLGL--  1143

Query  500   QLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  327
              ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+  P
Sbjct  1144  WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPLDPP  1203

Query  326   -NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +    +R  RI   G    G   +   +   ELYG
Sbjct  1204  KDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  1238



>gb|EMP32200.1| E3 ubiquitin-protein ligase HECTD1 [Chelonia mydas]
Length=2610

 Score = 65.5 bits (158),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 51/156 (33%), Positives = 77/156 (49%), Gaps = 17/156 (11%)
 Frame = -2

Query  668   PVLSKRVXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  501
             P     V VT+S     P+ R  D   ++SR  + ++      +D N  +W+ IDLG   
Sbjct  1133  PAAYGLVVVTSSEGRNLPYGRLED---ILSR--ESSALNCHTNDDKN--AWFAIDLGL--  1183

Query  500   QLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  327
              ++ + YT+R  +   R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+WPI  P
Sbjct  1184  WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTATWPIDPP  1243

Query  326   -NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +    +R  RI   G    G   +   +   ELYG
Sbjct  1244  KDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  1278



>ref|XP_005196336.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Bos 
taurus]
Length=1739

 Score = 65.1 bits (157),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 78/156 (50%), Gaps = 17/156 (11%)
 Frame = -2

Query  668   PVLSKRVXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  501
             P     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG   
Sbjct  1093  PAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLGL--  1143

Query  500   QLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  327
              ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+  P
Sbjct  1144  WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPLDPP  1203

Query  326   -NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +    +R  RI   G    G   +   +   ELYG
Sbjct  1204  KDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_010631867.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Fukomys 
damarensis]
Length=2331

 Score = 65.5 bits (158),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 78/156 (50%), Gaps = 17/156 (11%)
 Frame = -2

Query  668   PVLSKRVXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  501
             P     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG   
Sbjct  1093  PAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLGL--  1143

Query  500   QLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  327
              ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+  P
Sbjct  1144  WMVPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPLDPP  1203

Query  326   -NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +    +R  RI   G    G   +   +   ELYG
Sbjct  1204  KDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  1238



>gb|ERL91993.1| hypothetical protein D910_09315 [Dendroctonus ponderosae]
Length=2651

 Score = 65.1 bits (157),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 48/149 (32%), Positives = 72/149 (48%), Gaps = 16/149 (11%)
 Frame = -2

Query  650   VXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMCNY  483
             V VT+S     P+ R  D   ++SR+    S A     D +  +W+ IDLG    ++   
Sbjct  1147  VTVTSSDGRNLPYGRLED---ILSRD----SSALNCHTDDDKRAWFSIDLGL--FIIPTA  1197

Query  482   YTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPF  309
             YT+R  +   R+ +R+W FQ S DGV WT L  H  D ++ +PG  A+WP+  P     +
Sbjct  1198  YTLRHARGYGRSALRNWLFQMSKDGVVWTTLSTHTHDISLNEPGSTATWPVESPPDEQGW  1257

Query  308   RFFRIVMTGPGTDGMNPWNCCICVLELYG  222
             R  RI   G    G   +   +   E+YG
Sbjct  1258  RHVRIQQAGKNESGQTHY-LSLSGFEIYG  1285



>ref|XP_008162333.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Chrysemys 
picta bellii]
Length=2523

 Score = 65.1 bits (157),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 77/156 (49%), Gaps = 17/156 (11%)
 Frame = -2

Query  668   PVLSKRVXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  501
             P     V VT+S     P+ R  D   ++SR  + ++      +D N  +W+ IDLG   
Sbjct  1093  PAAYGLVVVTSSEGRNLPYGRLED---ILSR--ESSALNCHTNDDKN--AWFAIDLGL--  1143

Query  500   QLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  327
              ++ + YT+R  +   R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+WP+  P
Sbjct  1144  WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTATWPVDPP  1203

Query  326   -NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +    +R  RI   G    G   +   +   ELYG
Sbjct  1204  KDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_010333268.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Saimiri 
boliviensis boliviensis]
Length=2563

 Score = 65.1 bits (157),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 78/156 (50%), Gaps = 17/156 (11%)
 Frame = -2

Query  668   PVLSKRVXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  501
             P     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG   
Sbjct  1093  PAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLGL--  1143

Query  500   QLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  327
              ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+  P
Sbjct  1144  WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPLDTP  1203

Query  326   -NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +    +R  RI   G    G   +   +   ELYG
Sbjct  1204  KDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_010333269.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Saimiri 
boliviensis boliviensis]
Length=2331

 Score = 65.1 bits (157),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 78/156 (50%), Gaps = 17/156 (11%)
 Frame = -2

Query  668   PVLSKRVXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  501
             P     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG   
Sbjct  1093  PAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLGL--  1143

Query  500   QLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  327
              ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+  P
Sbjct  1144  WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPLDTP  1203

Query  326   -NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +    +R  RI   G    G   +   +   ELYG
Sbjct  1204  KDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_003294753.1| hypothetical protein DICPUDRAFT_51693 [Dictyostelium purpureum]
 gb|EGC28716.1| hypothetical protein DICPUDRAFT_51693 [Dictyostelium purpureum]
Length=576

 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 47/155 (30%), Positives = 72/155 (46%), Gaps = 20/155 (13%)
 Frame = -2

Query  668  PVLSKRVXVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMC  489
            P   K V VT+SS    +  P   VSR       +     D   +S++ +DLG  H L  
Sbjct  371  PATRKIVTVTSSSMSIGYPHP--FVSRT------STNMYTDKEENSFFCVDLGAKHVLCP  422

Query  488  NYYTIRQDGSR-----AFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPN  324
             YY++R  G       A  ++W   GS DG+ W+ L  HK+D ++ +    A W +    
Sbjct  423  TYYSMRYGGDSQGSIYAAPKNWQLLGSLDGIEWSILCDHKNDMSLKEGYSIAGWEVKS--  480

Query  323  PLLPFRFFRIVMTGPGT-DGMNPWNCCICVLELYG  222
             +  +R+ +I+ TGP   DG      C+C  E+YG
Sbjct  481  -IHSYRYLKILQTGPNQRDG---HELCVCCFEVYG  511



>ref|XP_009909049.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 [Picoides pubescens]
Length=2570

 Score = 65.1 bits (157),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 51/156 (33%), Positives = 77/156 (49%), Gaps = 17/156 (11%)
 Frame = -2

Query  668   PVLSKRVXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  501
             P     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG   
Sbjct  1093  PAAYGLVVVTSSEGRNLPYGRLED---ILSRD--SSALNCHTNDDKN--AWFAIDLGL--  1143

Query  500   QLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  327
              ++ + YT+R  +   R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+WPI  P
Sbjct  1144  WVVPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTATWPIDPP  1203

Query  326   -NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +    +R  RI   G    G   +   +   ELYG
Sbjct  1204  KDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_005196335.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Bos 
taurus]
Length=1784

 Score = 65.1 bits (157),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 78/156 (50%), Gaps = 17/156 (11%)
 Frame = -2

Query  668   PVLSKRVXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  501
             P     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG   
Sbjct  1093  PAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLGL--  1143

Query  500   QLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  327
              ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+  P
Sbjct  1144  WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPLDPP  1203

Query  326   -NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +    +R  RI   G    G   +   +   ELYG
Sbjct  1204  KDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_006116433.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X6 [Pelodiscus 
sinensis]
Length=2523

 Score = 65.1 bits (157),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 77/156 (49%), Gaps = 17/156 (11%)
 Frame = -2

Query  668   PVLSKRVXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  501
             P     V VT+S     P+ R  D   ++SR  + ++      +D N  +W+ IDLG   
Sbjct  1093  PAAYGLVVVTSSEGRNLPYGRLED---ILSR--ESSALNCHTNDDKN--AWFAIDLGL--  1143

Query  500   QLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  327
              ++ + YT+R  +   R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+WP+  P
Sbjct  1144  WVVPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTATWPVDPP  1203

Query  326   -NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +    +R  RI   G    G   +   +   ELYG
Sbjct  1204  KDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_005196334.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Bos 
taurus]
 ref|XP_877459.4| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Bos 
taurus]
Length=1786

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 78/156 (50%), Gaps = 17/156 (11%)
 Frame = -2

Query  668   PVLSKRVXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  501
             P     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG   
Sbjct  1093  PAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLGL--  1143

Query  500   QLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  327
              ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+  P
Sbjct  1144  WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPLDPP  1203

Query  326   -NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +    +R  RI   G    G   +   +   ELYG
Sbjct  1204  KDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_005881051.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Myotis 
brandtii]
 ref|XP_006085914.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Myotis 
lucifugus]
Length=2331

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 78/156 (50%), Gaps = 17/156 (11%)
 Frame = -2

Query  668   PVLSKRVXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  501
             P     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG   
Sbjct  1093  PAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLGL--  1143

Query  500   QLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  327
              ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+  P
Sbjct  1144  WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPLDPP  1203

Query  326   -NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +    +R  RI   G    G   +   +   ELYG
Sbjct  1204  KDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_005695270.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Capra 
hircus]
Length=2502

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 78/156 (50%), Gaps = 17/156 (11%)
 Frame = -2

Query  668   PVLSKRVXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  501
             P     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG   
Sbjct  1093  PAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLGL--  1143

Query  500   QLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  327
              ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+  P
Sbjct  1144  WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPLDPP  1203

Query  326   -NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +    +R  RI   G    G   +   +   ELYG
Sbjct  1204  KDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  1238



>emb|CDY65033.1| BnaC03g78060D [Brassica napus]
Length=176

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 36/56 (64%), Gaps = 5/56 (9%)
 Frame = -2

Query  635  SSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQ  468
            SSP SR T PK L S+   G  +   +     ISSWWM+DLG DHQLMC+YYT R+
Sbjct  22   SSPTSRLTYPKALASKTHVGLGWKKKR-----ISSWWMVDLGEDHQLMCSYYTFRR  72



>ref|XP_006085913.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Myotis 
lucifugus]
Length=2561

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 78/156 (50%), Gaps = 17/156 (11%)
 Frame = -2

Query  668   PVLSKRVXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  501
             P     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG   
Sbjct  1093  PAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLGL--  1143

Query  500   QLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  327
              ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+  P
Sbjct  1144  WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPLDPP  1203

Query  326   -NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +    +R  RI   G    G   +   +   ELYG
Sbjct  1204  KDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_005881050.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Myotis 
brandtii]
Length=2561

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 78/156 (50%), Gaps = 17/156 (11%)
 Frame = -2

Query  668   PVLSKRVXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  501
             P     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG   
Sbjct  1093  PAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLGL--  1143

Query  500   QLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  327
              ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+  P
Sbjct  1144  WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPLDPP  1203

Query  326   -NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +    +R  RI   G    G   +   +   ELYG
Sbjct  1204  KDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_011374706.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Pteropus 
vampyrus]
Length=2563

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 78/156 (50%), Gaps = 17/156 (11%)
 Frame = -2

Query  668   PVLSKRVXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  501
             P     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG   
Sbjct  1093  PAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLGL--  1143

Query  500   QLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  327
              ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+  P
Sbjct  1144  WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPLDPP  1203

Query  326   -NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +    +R  RI   G    G   +   +   ELYG
Sbjct  1204  KDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_006085912.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Myotis 
lucifugus]
Length=2563

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 78/156 (50%), Gaps = 17/156 (11%)
 Frame = -2

Query  668   PVLSKRVXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  501
             P     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG   
Sbjct  1093  PAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLGL--  1143

Query  500   QLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  327
              ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+  P
Sbjct  1144  WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPLDPP  1203

Query  326   -NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +    +R  RI   G    G   +   +   ELYG
Sbjct  1204  KDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_005377019.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Chinchilla 
lanigera]
Length=2563

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 78/156 (50%), Gaps = 17/156 (11%)
 Frame = -2

Query  668   PVLSKRVXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  501
             P     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG   
Sbjct  1093  PAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLGL--  1143

Query  500   QLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  327
              ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+  P
Sbjct  1144  WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPLDPP  1203

Query  326   -NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +    +R  RI   G    G   +   +   ELYG
Sbjct  1204  KDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_004467983.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform 3 [Dasypus 
novemcinctus]
Length=2563

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 78/156 (50%), Gaps = 17/156 (11%)
 Frame = -2

Query  668   PVLSKRVXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  501
             P     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG   
Sbjct  1093  PAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLGL--  1143

Query  500   QLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  327
              ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+  P
Sbjct  1144  WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPLDPP  1203

Query  326   -NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +    +R  RI   G    G   +   +   ELYG
Sbjct  1204  KDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_005881054.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X5 [Myotis 
brandtii]
Length=2563

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 78/156 (50%), Gaps = 17/156 (11%)
 Frame = -2

Query  668   PVLSKRVXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  501
             P     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG   
Sbjct  1093  PAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLGL--  1143

Query  500   QLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  327
              ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+  P
Sbjct  1144  WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPLDPP  1203

Query  326   -NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +    +R  RI   G    G   +   +   ELYG
Sbjct  1204  KDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_010586873.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Loxodonta 
africana]
Length=2563

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 78/156 (50%), Gaps = 17/156 (11%)
 Frame = -2

Query  668   PVLSKRVXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  501
             P     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG   
Sbjct  1093  PAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLGL--  1143

Query  500   QLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  327
              ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+  P
Sbjct  1144  WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPLDPP  1203

Query  326   -NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +    +R  RI   G    G   +   +   ELYG
Sbjct  1204  KDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_010961316.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Camelus 
bactrianus]
Length=2321

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 78/156 (50%), Gaps = 17/156 (11%)
 Frame = -2

Query  668   PVLSKRVXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  501
             P     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG   
Sbjct  1093  PAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLGL--  1143

Query  500   QLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  327
              ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+  P
Sbjct  1144  WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPLDPP  1203

Query  326   -NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +    +R  RI   G    G   +   +   ELYG
Sbjct  1204  KDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_004755203.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X6 [Mustela 
putorius furo]
Length=2331

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 78/156 (50%), Gaps = 17/156 (11%)
 Frame = -2

Query  668   PVLSKRVXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  501
             P     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG   
Sbjct  1093  PAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLGL--  1143

Query  500   QLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  327
              ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+  P
Sbjct  1144  WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPLDPP  1203

Query  326   -NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +    +R  RI   G    G   +   +   ELYG
Sbjct  1204  KDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_010961314.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Camelus 
bactrianus]
Length=2553

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 78/156 (50%), Gaps = 17/156 (11%)
 Frame = -2

Query  668   PVLSKRVXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  501
             P     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG   
Sbjct  1093  PAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLGL--  1143

Query  500   QLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  327
              ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+  P
Sbjct  1144  WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPLDPP  1203

Query  326   -NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +    +R  RI   G    G   +   +   ELYG
Sbjct  1204  KDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_004755201.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Mustela 
putorius furo]
Length=2563

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 78/156 (50%), Gaps = 17/156 (11%)
 Frame = -2

Query  668   PVLSKRVXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  501
             P     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG   
Sbjct  1093  PAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLGL--  1143

Query  500   QLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  327
              ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+  P
Sbjct  1144  WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPLDPP  1203

Query  326   -NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +    +R  RI   G    G   +   +   ELYG
Sbjct  1204  KDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_004801249.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 [Mustela putorius 
furo]
Length=2566

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 78/156 (50%), Gaps = 17/156 (11%)
 Frame = -2

Query  668   PVLSKRVXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  501
             P     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG   
Sbjct  1093  PAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLGL--  1143

Query  500   QLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  327
              ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+  P
Sbjct  1144  WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPLDPP  1203

Query  326   -NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +    +R  RI   G    G   +   +   ELYG
Sbjct  1204  KDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_010845303.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X5 [Bison 
bison bison]
Length=2331

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 78/156 (50%), Gaps = 17/156 (11%)
 Frame = -2

Query  668   PVLSKRVXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  501
             P     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG   
Sbjct  1093  PAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLGL--  1143

Query  500   QLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  327
              ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+  P
Sbjct  1144  WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPLDPP  1203

Query  326   -NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +    +R  RI   G    G   +   +   ELYG
Sbjct  1204  KDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_010372961.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X5 [Rhinopithecus 
roxellana]
Length=2331

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 78/156 (50%), Gaps = 17/156 (11%)
 Frame = -2

Query  668   PVLSKRVXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  501
             P     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG   
Sbjct  1093  PAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLGL--  1143

Query  500   QLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  327
              ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+  P
Sbjct  1144  WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPLDPP  1203

Query  326   -NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +    +R  RI   G    G   +   +   ELYG
Sbjct  1204  KDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_009004155.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X5 [Callithrix 
jacchus]
Length=2331

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 78/156 (50%), Gaps = 17/156 (11%)
 Frame = -2

Query  668   PVLSKRVXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  501
             P     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG   
Sbjct  1093  PAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLGL--  1143

Query  500   QLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  327
              ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+  P
Sbjct  1144  WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPLDPP  1203

Query  326   -NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +    +R  RI   G    G   +   +   ELYG
Sbjct  1204  KDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_006056670.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X5 [Bubalus 
bubalis]
Length=2331

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 78/156 (50%), Gaps = 17/156 (11%)
 Frame = -2

Query  668   PVLSKRVXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  501
             P     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG   
Sbjct  1093  PAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLGL--  1143

Query  500   QLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  327
              ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+  P
Sbjct  1144  WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPLDPP  1203

Query  326   -NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +    +R  RI   G    G   +   +   ELYG
Sbjct  1204  KDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_006116431.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Pelodiscus 
sinensis]
Length=2529

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 77/156 (49%), Gaps = 17/156 (11%)
 Frame = -2

Query  668   PVLSKRVXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  501
             P     V VT+S     P+ R  D   ++SR  + ++      +D N  +W+ IDLG   
Sbjct  1099  PAAYGLVVVTSSEGRNLPYGRLED---ILSR--ESSALNCHTNDDKN--AWFAIDLGL--  1149

Query  500   QLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  327
              ++ + YT+R  +   R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+WP+  P
Sbjct  1150  WVVPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTATWPVDPP  1209

Query  326   -NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +    +R  RI   G    G   +   +   ELYG
Sbjct  1210  KDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  1244



>ref|XP_006056668.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Bubalus 
bubalis]
Length=2561

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 78/156 (50%), Gaps = 17/156 (11%)
 Frame = -2

Query  668   PVLSKRVXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  501
             P     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG   
Sbjct  1093  PAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLGL--  1143

Query  500   QLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  327
              ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+  P
Sbjct  1144  WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPLDPP  1203

Query  326   -NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +    +R  RI   G    G   +   +   ELYG
Sbjct  1204  KDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_005695269.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Capra 
hircus]
Length=2561

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 78/156 (50%), Gaps = 17/156 (11%)
 Frame = -2

Query  668   PVLSKRVXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  501
             P     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG   
Sbjct  1093  PAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLGL--  1143

Query  500   QLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  327
              ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+  P
Sbjct  1144  WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPLDPP  1203

Query  326   -NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +    +R  RI   G    G   +   +   ELYG
Sbjct  1204  KDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_005377020.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Chinchilla 
lanigera]
Length=2561

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 78/156 (50%), Gaps = 17/156 (11%)
 Frame = -2

Query  668   PVLSKRVXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  501
             P     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG   
Sbjct  1093  PAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLGL--  1143

Query  500   QLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  327
              ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+  P
Sbjct  1144  WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPLDPP  1203

Query  326   -NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +    +R  RI   G    G   +   +   ELYG
Sbjct  1204  KDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_011222354.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Ailuropoda 
melanoleuca]
Length=2563

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 78/156 (50%), Gaps = 17/156 (11%)
 Frame = -2

Query  668   PVLSKRVXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  501
             P     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG   
Sbjct  1093  PAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLGL--  1143

Query  500   QLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  327
              ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+  P
Sbjct  1144  WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPLDPP  1203

Query  326   -NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +    +R  RI   G    G   +   +   ELYG
Sbjct  1204  KDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_010372959.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Rhinopithecus 
roxellana]
Length=2563

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 78/156 (50%), Gaps = 17/156 (11%)
 Frame = -2

Query  668   PVLSKRVXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  501
             P     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG   
Sbjct  1093  PAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLGL--  1143

Query  500   QLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  327
              ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+  P
Sbjct  1144  WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPLDPP  1203

Query  326   -NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +    +R  RI   G    G   +   +   ELYG
Sbjct  1204  KDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_005222130.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X8 [Bos 
taurus]
Length=2563

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 78/156 (50%), Gaps = 17/156 (11%)
 Frame = -2

Query  668   PVLSKRVXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  501
             P     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG   
Sbjct  1093  PAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLGL--  1143

Query  500   QLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  327
              ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+  P
Sbjct  1144  WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPLDPP  1203

Query  326   -NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +    +R  RI   G    G   +   +   ELYG
Sbjct  1204  KDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_005377022.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X5 [Chinchilla 
lanigera]
Length=2331

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 78/156 (50%), Gaps = 17/156 (11%)
 Frame = -2

Query  668   PVLSKRVXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  501
             P     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG   
Sbjct  1093  PAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLGL--  1143

Query  500   QLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  327
              ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+  P
Sbjct  1144  WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPLDPP  1203

Query  326   -NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +    +R  RI   G    G   +   +   ELYG
Sbjct  1204  KDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_006056669.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Bubalus 
bubalis]
Length=2502

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 78/156 (50%), Gaps = 17/156 (11%)
 Frame = -2

Query  668   PVLSKRVXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  501
             P     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG   
Sbjct  1093  PAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLGL--  1143

Query  500   QLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  327
              ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+  P
Sbjct  1144  WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPLDPP  1203

Query  326   -NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +    +R  RI   G    G   +   +   ELYG
Sbjct  1204  KDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_010845301.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Bison 
bison bison]
Length=2563

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 78/156 (50%), Gaps = 17/156 (11%)
 Frame = -2

Query  668   PVLSKRVXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  501
             P     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG   
Sbjct  1093  PAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLGL--  1143

Query  500   QLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  327
              ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+  P
Sbjct  1144  WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPLDPP  1203

Query  326   -NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +    +R  RI   G    G   +   +   ELYG
Sbjct  1204  KDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_009004153.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Callithrix 
jacchus]
Length=2563

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 78/156 (50%), Gaps = 17/156 (11%)
 Frame = -2

Query  668   PVLSKRVXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  501
             P     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG   
Sbjct  1093  PAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLGL--  1143

Query  500   QLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  327
              ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+  P
Sbjct  1144  WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPLDPP  1203

Query  326   -NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +    +R  RI   G    G   +   +   ELYG
Sbjct  1204  KDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_006056667.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Bubalus 
bubalis]
Length=2563

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 78/156 (50%), Gaps = 17/156 (11%)
 Frame = -2

Query  668   PVLSKRVXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  501
             P     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG   
Sbjct  1093  PAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLGL--  1143

Query  500   QLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  327
              ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+  P
Sbjct  1144  WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPLDPP  1203

Query  326   -NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +    +R  RI   G    G   +   +   ELYG
Sbjct  1204  KDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_005695268.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Capra 
hircus]
Length=2563

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 78/156 (50%), Gaps = 17/156 (11%)
 Frame = -2

Query  668   PVLSKRVXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  501
             P     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG   
Sbjct  1093  PAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLGL--  1143

Query  500   QLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  327
              ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+  P
Sbjct  1144  WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPLDPP  1203

Query  326   -NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +    +R  RI   G    G   +   +   ELYG
Sbjct  1204  KDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_011222356.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X5 [Ailuropoda 
melanoleuca]
Length=2331

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 78/156 (50%), Gaps = 17/156 (11%)
 Frame = -2

Query  668   PVLSKRVXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  501
             P     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG   
Sbjct  1093  PAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLGL--  1143

Query  500   QLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  327
              ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+  P
Sbjct  1144  WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPLDPP  1203

Query  326   -NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +    +R  RI   G    G   +   +   ELYG
Sbjct  1204  KDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_007984591.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X5 [Chlorocebus 
sabaeus]
 ref|XP_009425898.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X5 [Pan 
troglodytes]
Length=2331

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 78/156 (50%), Gaps = 17/156 (11%)
 Frame = -2

Query  668   PVLSKRVXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  501
             P     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG   
Sbjct  1093  PAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLGL--  1143

Query  500   QLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  327
              ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+  P
Sbjct  1144  WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPLDPP  1203

Query  326   -NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +    +R  RI   G    G   +   +   ELYG
Sbjct  1204  KDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_007098141.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Panthera 
tigris altaica]
Length=2331

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 78/156 (50%), Gaps = 17/156 (11%)
 Frame = -2

Query  668   PVLSKRVXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  501
             P     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG   
Sbjct  1093  PAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLGL--  1143

Query  500   QLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  327
              ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+  P
Sbjct  1144  WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPLDPP  1203

Query  326   -NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +    +R  RI   G    G   +   +   ELYG
Sbjct  1204  KDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_005222132.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X10 [Bos 
taurus]
Length=2331

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 78/156 (50%), Gaps = 17/156 (11%)
 Frame = -2

Query  668   PVLSKRVXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  501
             P     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG   
Sbjct  1093  PAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLGL--  1143

Query  500   QLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  327
              ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+  P
Sbjct  1144  WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPLDPP  1203

Query  326   -NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +    +R  RI   G    G   +   +   ELYG
Sbjct  1204  KDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  1238



>gb|ELK17058.1| E3 ubiquitin-protein ligase HECTD1 [Pteropus alecto]
Length=2489

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 78/156 (50%), Gaps = 17/156 (11%)
 Frame = -2

Query  668   PVLSKRVXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  501
             P     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG   
Sbjct  1056  PAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLGL--  1106

Query  500   QLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  327
              ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+  P
Sbjct  1107  WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPLDPP  1166

Query  326   -NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +    +R  RI   G    G   +   +   ELYG
Sbjct  1167  KDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  1201



>ref|XP_004055105.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 [Gorilla gorilla 
gorilla]
Length=2520

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 78/156 (50%), Gaps = 17/156 (11%)
 Frame = -2

Query  668   PVLSKRVXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  501
             P     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG   
Sbjct  1035  PAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLGL--  1085

Query  500   QLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  327
              ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+  P
Sbjct  1086  WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPLDPP  1145

Query  326   -NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +    +R  RI   G    G   +   +   ELYG
Sbjct  1146  KDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  1180



>ref|XP_008972942.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Pan 
paniscus]
Length=2563

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 78/156 (50%), Gaps = 17/156 (11%)
 Frame = -2

Query  668   PVLSKRVXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  501
             P     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG   
Sbjct  1093  PAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLGL--  1143

Query  500   QLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  327
              ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+  P
Sbjct  1144  WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPLDPP  1203

Query  326   -NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +    +R  RI   G    G   +   +   ELYG
Sbjct  1204  KDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_007098140.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Panthera 
tigris altaica]
Length=2563

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 78/156 (50%), Gaps = 17/156 (11%)
 Frame = -2

Query  668   PVLSKRVXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  501
             P     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG   
Sbjct  1093  PAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLGL--  1143

Query  500   QLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  327
              ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+  P
Sbjct  1144  WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPLDPP  1203

Query  326   -NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +    +R  RI   G    G   +   +   ELYG
Sbjct  1204  KDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_005267560.2| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Homo 
sapiens]
 ref|XP_007984589.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Chlorocebus 
sabaeus]
 ref|XP_009247279.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Pongo 
abelii]
 ref|XP_009425896.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Pan 
troglodytes]
Length=2563

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 78/156 (50%), Gaps = 17/156 (11%)
 Frame = -2

Query  668   PVLSKRVXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  501
             P     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG   
Sbjct  1093  PAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLGL--  1143

Query  500   QLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  327
              ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+  P
Sbjct  1144  WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPLDPP  1203

Query  326   -NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +    +R  RI   G    G   +   +   ELYG
Sbjct  1204  KDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_005285366.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Chrysemys 
picta bellii]
Length=2570

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 77/156 (49%), Gaps = 17/156 (11%)
 Frame = -2

Query  668   PVLSKRVXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  501
             P     V VT+S     P+ R  D   ++SR  + ++      +D N  +W+ IDLG   
Sbjct  1093  PAAYGLVVVTSSEGRNLPYGRLED---ILSR--ESSALNCHTNDDKN--AWFAIDLGL--  1143

Query  500   QLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  327
              ++ + YT+R  +   R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+WP+  P
Sbjct  1144  WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTATWPVDPP  1203

Query  326   -NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +    +R  RI   G    G   +   +   ELYG
Sbjct  1204  KDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_005285367.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Chrysemys 
picta bellii]
Length=2509

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 77/156 (49%), Gaps = 17/156 (11%)
 Frame = -2

Query  668   PVLSKRVXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  501
             P     V VT+S     P+ R  D   ++SR  + ++      +D N  +W+ IDLG   
Sbjct  1093  PAAYGLVVVTSSEGRNLPYGRLED---ILSR--ESSALNCHTNDDKN--AWFAIDLGL--  1143

Query  500   QLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  327
              ++ + YT+R  +   R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+WP+  P
Sbjct  1144  WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTATWPVDPP  1203

Query  326   -NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +    +R  RI   G    G   +   +   ELYG
Sbjct  1204  KDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_001844071.1| E3 ubiquitin-protein ligase HECTD1 [Culex quinquefasciatus]
 gb|EDS35740.1| E3 ubiquitin-protein ligase HECTD1 [Culex quinquefasciatus]
Length=2813

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 37/110 (34%), Positives = 56/110 (51%), Gaps = 6/110 (5%)
 Frame = -2

Query  542   NISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTI  369
             N  SW+ IDLG    ++   YT+R  +   R+ +R+W FQ S DGVNW  +  H DD+++
Sbjct  1327  NKKSWFAIDLGM--FIVPTAYTLRHARGYGRSALRNWMFQMSKDGVNWVTMLTHSDDKSL  1384

Query  368   CKPGQFASWPI-TGPNPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +PG   +WP+    +    FR  RI   G    G   +   +   E+YG
Sbjct  1385  AEPGSTCTWPLECSADEQQGFRHVRIHQNGRNASGQTHY-LSLSGFEIYG  1433



>ref|XP_008565372.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Galeopterus 
variegatus]
Length=2610

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 78/156 (50%), Gaps = 17/156 (11%)
 Frame = -2

Query  668   PVLSKRVXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  501
             P     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG   
Sbjct  1093  PAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLGL--  1143

Query  500   QLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  327
              ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+  P
Sbjct  1144  WIIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPLDPP  1203

Query  326   -NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +    +R  RI   G    G   +   +   ELYG
Sbjct  1204  KDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_010631865.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Fukomys 
damarensis]
Length=2608

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 78/156 (50%), Gaps = 17/156 (11%)
 Frame = -2

Query  668   PVLSKRVXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  501
             P     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG   
Sbjct  1093  PAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLGL--  1143

Query  500   QLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  327
              ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+  P
Sbjct  1144  WMVPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPLDPP  1203

Query  326   -NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +    +R  RI   G    G   +   +   ELYG
Sbjct  1204  KDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_010631864.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Fukomys 
damarensis]
 gb|KFO29273.1| E3 ubiquitin-protein ligase HECTD1 [Fukomys damarensis]
Length=2610

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 78/156 (50%), Gaps = 17/156 (11%)
 Frame = -2

Query  668   PVLSKRVXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  501
             P     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG   
Sbjct  1093  PAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLGL--  1143

Query  500   QLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  327
              ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+  P
Sbjct  1144  WMVPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPLDPP  1203

Query  326   -NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +    +R  RI   G    G   +   +   ELYG
Sbjct  1204  KDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_008101614.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X7 [Anolis 
carolinensis]
Length=2529

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 77/156 (49%), Gaps = 17/156 (11%)
 Frame = -2

Query  668   PVLSKRVXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  501
             P     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG   
Sbjct  1099  PAAYGLVVVTSSEGRNLPYGRLED---ILSRD--SSALNCHTNDDKN--AWFAIDLGL--  1149

Query  500   QLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  327
              ++ + YT+R  +   R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+WP+  P
Sbjct  1150  WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTATWPLDPP  1209

Query  326   -NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +    +R  RI   G    G   +   +   ELYG
Sbjct  1210  KDEKQGWRHIRIKQMGKNASGQTHY-LSLSGFELYG  1244



>ref|XP_007113428.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Physeter 
catodon]
Length=2563

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 78/156 (50%), Gaps = 17/156 (11%)
 Frame = -2

Query  668   PVLSKRVXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  501
             P     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG   
Sbjct  1093  PAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLGL--  1143

Query  500   QLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  327
              ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+  P
Sbjct  1144  WVVPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPLDPP  1203

Query  326   -NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +    +R  RI   G    G   +   +   ELYG
Sbjct  1204  KDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_008101615.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X8 [Anolis 
carolinensis]
Length=2523

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 77/156 (49%), Gaps = 17/156 (11%)
 Frame = -2

Query  668   PVLSKRVXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  501
             P     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG   
Sbjct  1093  PAAYGLVVVTSSEGRNLPYGRLED---ILSRD--SSALNCHTNDDKN--AWFAIDLGL--  1143

Query  500   QLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  327
              ++ + YT+R  +   R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+WP+  P
Sbjct  1144  WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTATWPLDPP  1203

Query  326   -NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +    +R  RI   G    G   +   +   ELYG
Sbjct  1204  KDEKQGWRHIRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_008101612.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X5 [Anolis 
carolinensis]
Length=2544

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 77/156 (49%), Gaps = 17/156 (11%)
 Frame = -2

Query  668   PVLSKRVXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  501
             P     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG   
Sbjct  1114  PAAYGLVVVTSSEGRNLPYGRLED---ILSRD--SSALNCHTNDDKN--AWFAIDLGL--  1164

Query  500   QLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  327
              ++ + YT+R  +   R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+WP+  P
Sbjct  1165  WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTATWPLDPP  1224

Query  326   -NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +    +R  RI   G    G   +   +   ELYG
Sbjct  1225  KDEKQGWRHIRIKQMGKNASGQTHY-LSLSGFELYG  1259



>ref|XP_007472588.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X5 [Monodelphis 
domestica]
Length=2331

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 77/156 (49%), Gaps = 17/156 (11%)
 Frame = -2

Query  668   PVLSKRVXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  501
             P     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG   
Sbjct  1093  PAAYGLVVVTSSEGRNLPYGRLED---ILSRD--SSALNCHSNDDKN--AWFAIDLGL--  1143

Query  500   QLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  327
              ++ + YT+R  +   R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+WP+  P
Sbjct  1144  WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTATWPLDPP  1203

Query  326   -NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +    +R  RI   G    G   +   +   ELYG
Sbjct  1204  KDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_007660828.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X6 [Ornithorhynchus 
anatinus]
Length=2522

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 77/156 (49%), Gaps = 17/156 (11%)
 Frame = -2

Query  668   PVLSKRVXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  501
             P     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG   
Sbjct  1093  PAAYGLVVVTSSEGRNLPYGRLED---ILSRD--SSALNCHSNDDKN--AWFAIDLGL--  1143

Query  500   QLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  327
              ++ + YT+R  +   R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+WP+  P
Sbjct  1144  WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTATWPLDPP  1203

Query  326   -NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +    +R  RI   G    G   +   +   ELYG
Sbjct  1204  KDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_010214811.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Tinamus 
guttatus]
Length=2523

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 77/156 (49%), Gaps = 17/156 (11%)
 Frame = -2

Query  668   PVLSKRVXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  501
             P     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG   
Sbjct  1093  PAAYGLVVVTSSEGRNLPYGRLED---ILSRD--SSALNCHTNDDKN--AWFAIDLGL--  1143

Query  500   QLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  327
              ++ + YT+R  +   R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+WP+  P
Sbjct  1144  WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTATWPLDPP  1203

Query  326   -NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +    +R  RI   G    G   +   +   ELYG
Sbjct  1204  KDEKQGWRHIRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_007660814.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Ornithorhynchus 
anatinus]
Length=2563

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 77/156 (49%), Gaps = 17/156 (11%)
 Frame = -2

Query  668   PVLSKRVXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  501
             P     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG   
Sbjct  1093  PAAYGLVVVTSSEGRNLPYGRLED---ILSRD--SSALNCHSNDDKN--AWFAIDLGL--  1143

Query  500   QLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  327
              ++ + YT+R  +   R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+WP+  P
Sbjct  1144  WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTATWPLDPP  1203

Query  326   -NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +    +R  RI   G    G   +   +   ELYG
Sbjct  1204  KDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_007472586.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Monodelphis 
domestica]
Length=2563

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 77/156 (49%), Gaps = 17/156 (11%)
 Frame = -2

Query  668   PVLSKRVXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  501
             P     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG   
Sbjct  1093  PAAYGLVVVTSSEGRNLPYGRLED---ILSRD--SSALNCHSNDDKN--AWFAIDLGL--  1143

Query  500   QLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  327
              ++ + YT+R  +   R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+WP+  P
Sbjct  1144  WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTATWPLDPP  1203

Query  326   -NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +    +R  RI   G    G   +   +   ELYG
Sbjct  1204  KDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_010333267.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Saimiri 
boliviensis boliviensis]
Length=2608

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 78/156 (50%), Gaps = 17/156 (11%)
 Frame = -2

Query  668   PVLSKRVXVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  501
             P     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ IDLG   
Sbjct  1093  PAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAIDLGL--  1143

Query  500   QLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  327
              ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+WP+  P
Sbjct  1144  WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPLDTP  1203

Query  326   -NPLLPFRFFRIVMTGPGTDGMNPWNCCICVLELYG  222
              +    +R  RI   G    G   +   +   ELYG
Sbjct  1204  KDEKQGWRHVRIKQMGKNASGQTHY-LSLSGFELYG  1238



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1064095936780