BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMCP020B12 275 bp,

Length=230
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011086667.1|  PREDICTED: muscle M-line assembly protein un...  73.9    4e-13   Sesamum indicum [beniseed]
emb|CDP13239.1|  unnamed protein product                              68.9    1e-11   Coffea canephora [robusta coffee]
ref|XP_009793094.1|  PREDICTED: uncharacterized protein LOC104240013  67.8    4e-11   Nicotiana sylvestris
ref|XP_009607000.1|  PREDICTED: uncharacterized protein LOC104101254  66.2    1e-10   Nicotiana tomentosiformis
ref|XP_004239138.1|  PREDICTED: hepatoma-derived growth factor-re...  59.3    3e-08   Solanum lycopersicum
ref|XP_006357592.1|  PREDICTED: hepatoma-derived growth factor-re...  57.4    2e-07   Solanum tuberosum [potatoes]
gb|KHN06545.1|  hypothetical protein glysoja_010889                   54.3    3e-07   Glycine soja [wild soybean]
gb|KHN29022.1|  hypothetical protein glysoja_008357                   54.3    6e-07   Glycine soja [wild soybean]
ref|XP_010100369.1|  GDSL esterase/lipase                             55.5    8e-07   
ref|XP_010248678.1|  PREDICTED: uncharacterized protein LOC104591519  55.1    1e-06   Nelumbo nucifera [Indian lotus]
ref|XP_003531329.1|  PREDICTED: protein lingerer-like                 54.7    1e-06   Glycine max [soybeans]
ref|XP_010682280.1|  PREDICTED: uncharacterized protein LOC104897153  54.7    1e-06   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003525036.1|  PREDICTED: protein argonaute 2-like              54.3    2e-06   Glycine max [soybeans]
ref|XP_010251032.1|  PREDICTED: hepatoma-derived growth factor-re...  54.3    2e-06   Nelumbo nucifera [Indian lotus]
emb|CAN66291.1|  hypothetical protein VITISV_027030                   54.3    2e-06   Vitis vinifera
ref|XP_010659396.1|  PREDICTED: uncharacterized protein LOC104881315  54.3    2e-06   Vitis vinifera
gb|EYU22540.1|  hypothetical protein MIMGU_mgv1a004532mg              53.9    2e-06   Erythranthe guttata [common monkey flower]
gb|KDO82200.1|  hypothetical protein CISIN_1g009913mg                 53.5    3e-06   Citrus sinensis [apfelsine]
gb|KDO82199.1|  hypothetical protein CISIN_1g009913mg                 53.5    3e-06   Citrus sinensis [apfelsine]
ref|XP_007225782.1|  hypothetical protein PRUPE_ppa003820mg           52.8    6e-06   Prunus persica
ref|XP_010044554.1|  PREDICTED: uncharacterized protein LOC104433489  52.0    1e-05   Eucalyptus grandis [rose gum]
ref|XP_006483963.1|  PREDICTED: uncharacterized protein LOC102618...  51.2    2e-05   
ref|XP_006438236.1|  hypothetical protein CICLE_v10031235mg           51.2    2e-05   Citrus clementina [clementine]
ref|XP_002530045.1|  translation initiation factor, putative          50.8    2e-05   
ref|XP_004142962.1|  PREDICTED: uncharacterized protein LOC101206526  50.4    4e-05   
gb|KGN62328.1|  hypothetical protein Csa_2G349620                     50.1    4e-05   Cucumis sativus [cucumbers]
ref|XP_007159695.1|  hypothetical protein PHAVU_002G259400g           50.1    5e-05   Phaseolus vulgaris [French bean]
ref|XP_011464053.1|  PREDICTED: uncharacterized protein LOC101293198  49.3    1e-04   Fragaria vesca subsp. vesca
gb|KEH20765.1|  plant-specific eukaryotic initiation factor 4B        48.5    2e-04   Medicago truncatula
gb|EYU30622.1|  hypothetical protein MIMGU_mgv1a003991mg              48.1    3e-04   Erythranthe guttata [common monkey flower]
ref|XP_008221989.1|  PREDICTED: protein no-on-transient A             47.4    3e-04   Prunus mume [ume]
ref|XP_009359201.1|  PREDICTED: uncharacterized protein LOC103949...  47.0    6e-04   Pyrus x bretschneideri [bai li]
ref|XP_008444378.1|  PREDICTED: uncharacterized protein LOC103487...  46.6    7e-04   
ref|XP_008444377.1|  PREDICTED: uncharacterized protein LOC103487...  46.6    7e-04   Cucumis melo [Oriental melon]
ref|XP_007044834.1|  Eukaryotic translation initiation factor 4B1     46.6    9e-04   



>ref|XP_011086667.1| PREDICTED: muscle M-line assembly protein unc-89-like [Sesamum 
indicum]
Length=613

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 61/76 (80%), Gaps = 0/76 (0%)
 Frame = -2

Query  229  TDEEKNLKKEIEQLKKEALQDAGEDQAATHDLINQKerelellirdldDKVRFAEKTTES  50
            T+EEKNLK+EIE LKKE L  +G+D+ + HDLI+Q+E ELELL+R LDDKVR+++K  E 
Sbjct  375  TEEEKNLKEEIEHLKKELLLKSGDDKTSIHDLIHQREGELELLVRQLDDKVRYSQKNFER  434

Query  49   PGSGSNRVSSFAERPP  2
            PGSG+ R + F ERPP
Sbjct  435  PGSGAGRGAGFNERPP  450



>emb|CDP13239.1| unnamed protein product [Coffea canephora]
Length=537

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 49/75 (65%), Positives = 60/75 (80%), Gaps = 1/75 (1%)
 Frame = -2

Query  229  TDEEKNLKKEIEQLKKEALQDAGEDQAATHDLINQKerelellirdldDKVRFAEKTTES  50
            T+EEKNLK+EIE LKKE+LQ  G+DQ + HD I QKE++LELLIR+LDDKVRF  K TE 
Sbjct  403  TEEEKNLKEEIEHLKKESLQKPGDDQ-SLHDQILQKEKDLELLIRELDDKVRFGPKPTER  461

Query  49   PGSGSNRVSSFAERP  5
            PGSG+ R++   ERP
Sbjct  462  PGSGAGRLTGHPERP  476



>ref|XP_009793094.1| PREDICTED: uncharacterized protein LOC104240013 [Nicotiana sylvestris]
Length=632

 Score = 67.8 bits (164),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = -2

Query  220  EKNLKKEIEQLKKEALQDAGEDQAATHDLINQKerelellirdldDKVRFAEKTTESPGS  41
            E+NLK+EIEQL+KEA+Q +G+DQ    ++INQKERELELLIRDLDDKVRF++K  + PGS
Sbjct  463  ERNLKEEIEQLRKEAMQSSGQDQTNLQNVINQKERELELLIRDLDDKVRFSQKPIQRPGS  522

Query  40   GSNRVSSFAER  8
            GS R +  +ER
Sbjct  523  GSGRAAGLSER  533


 Score = 58.9 bits (141),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 56/73 (77%), Gaps = 3/73 (4%)
 Frame = -2

Query  229  TDEEKNLKKEIEQLKKEALQDAGEDQAATHDLINQKerelellirdldDKVRFAEKTTES  50
            T+EEKNLK+EIEQL+KEA+Q +G DQ    ++INQKERELELLIRDLDDKVRF +K    
Sbjct  399  TEEEKNLKEEIEQLRKEAMQSSGHDQTNLRNVINQKERELELLIRDLDDKVRFGQKR---  455

Query  49   PGSGSNRVSSFAE  11
            PGS S R  +  E
Sbjct  456  PGSASGRERNLKE  468



>ref|XP_009607000.1| PREDICTED: uncharacterized protein LOC104101254 [Nicotiana tomentosiformis]
Length=632

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = -2

Query  220  EKNLKKEIEQLKKEALQDAGEDQAATHDLINQKerelellirdldDKVRFAEKTTESPGS  41
            EKNLK++IEQL+KEA+Q +G+DQ    ++INQKE ELELLIRDLDDKVRF++K  + PGS
Sbjct  463  EKNLKEKIEQLRKEAMQSSGQDQTNLQNVINQKEWELELLIRDLDDKVRFSQKPIQRPGS  522

Query  40   GSNRVSSFAER  8
            GS R +   ER
Sbjct  523  GSGRATGLPER  533


 Score = 58.5 bits (140),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 56/74 (76%), Gaps = 3/74 (4%)
 Frame = -2

Query  229  TDEEKNLKKEIEQLKKEALQDAGEDQAATHDLINQKerelellirdldDKVRFAEKTTES  50
            T+EEKNLK+EIEQL+KEA+Q +G DQ    ++INQKER+LELL RDLDDKVRF +K    
Sbjct  399  TEEEKNLKEEIEQLRKEAMQSSGHDQTNLQNVINQKERDLELLFRDLDDKVRFGQK---R  455

Query  49   PGSGSNRVSSFAER  8
            PGS S R  +  E+
Sbjct  456  PGSASGREKNLKEK  469



>ref|XP_004239138.1| PREDICTED: hepatoma-derived growth factor-related protein 2 [Solanum 
lycopersicum]
Length=569

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = -2

Query  229  TDEEKNLKKEIEQLKKEALQDAGEDQAATHDLINQKerelellirdldDKVRFAEKTTES  50
            T+EEKNLK+EIEQL+KEA + + ED+    ++INQKE++LELLIR+LDDKVRF++K  + 
Sbjct  397  TEEEKNLKEEIEQLRKEATECSEEDKTNLQNVINQKEKDLELLIRELDDKVRFSQKPIQR  456

Query  49   PGSGSNRVSSFAER  8
            PGSGS R +   +R
Sbjct  457  PGSGSGRGAGHPDR  470



>ref|XP_006357592.1| PREDICTED: hepatoma-derived growth factor-related protein 2-like 
[Solanum tuberosum]
Length=569

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = -2

Query  226  DEEKNLKKEIEQLKKEALQDAGEDQAATHDLINQKerelellirdldDKVRFAEKTTESP  47
            +EEKNLK+EIEQL+KEA + + ED+    ++INQKE++LELLIRDLDDKVRF++K  + P
Sbjct  398  EEEKNLKEEIEQLRKEATECSEEDKTNLQNVINQKEKDLELLIRDLDDKVRFSQKPIQRP  457

Query  46   GSGSNRVSSFAER  8
            GSGS R +   +R
Sbjct  458  GSGSGRGAGHPDR  470



>gb|KHN06545.1| hypothetical protein glysoja_010889 [Glycine soja]
Length=148

 Score = 54.3 bits (129),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 59/85 (69%), Gaps = 12/85 (14%)
 Frame = -2

Query  223  EEKNLKKEIEQLKKE------------ALQDAGEDQAATHDLINQKerelellirdldDK  80
            EEK LK+EI+ LKKE            ++ +AG DQ +TH ++ QKE+ELELLIRDLDDK
Sbjct  2    EEKLLKEEIDNLKKELEKESTINSNKESVDEAGGDQTSTHAILQQKEKELELLIRDLDDK  61

Query  79   VRFAEKTTESPGSGSNRVSSFAERP  5
            VRF +K  E PGS + + S+F++RP
Sbjct  62   VRFGQKAIERPGSSAGKSSTFSDRP  86



>gb|KHN29022.1| hypothetical protein glysoja_008357 [Glycine soja]
Length=258

 Score = 54.3 bits (129),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 42/88 (48%), Positives = 58/88 (66%), Gaps = 12/88 (14%)
 Frame = -2

Query  229  TDEEKNLKKEIEQLKKE------------ALQDAGEDQAATHDLINQKerelellirdld  86
            T EE+ LK+EI+ LKKE            ++ +AG DQ + H ++ QKE+ELELLI DLD
Sbjct  110  TMEERLLKEEIDNLKKELEKESTINSNKESVDEAGGDQTSRHAILQQKEKELELLIHDLD  169

Query  85   DKVRFAEKTTESPGSGSNRVSSFAERPP  2
             KVRF +K  E PGS + + S+F++RPP
Sbjct  170  GKVRFGQKAVERPGSSAGKSSTFSDRPP  197



>ref|XP_010100369.1| GDSL esterase/lipase [Morus notabilis]
 gb|EXB82503.1| GDSL esterase/lipase [Morus notabilis]
Length=840

 Score = 55.5 bits (132),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 56/83 (67%), Gaps = 7/83 (8%)
 Frame = -2

Query  229  TDEEKNLKKEIEQLKKE-------ALQDAGEDQAATHDLINQKerelellirdldDKVRF  71
            T+EEK LK+EIE LKKE       + Q++  DQ +  D + Q+ERE E LIRDLDDKVRF
Sbjct  328  TEEEKMLKEEIEYLKKELEKESTESSQESAGDQPSLRDTLLQREREFEKLIRDLDDKVRF  387

Query  70   AEKTTESPGSGSNRVSSFAERPP  2
             +K  E PGSG+ R  ++ ERPP
Sbjct  388  GQKAVERPGSGAGRSGNYLERPP  410



>ref|XP_010248678.1| PREDICTED: uncharacterized protein LOC104591519 [Nelumbo nucifera]
Length=535

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 60/88 (68%), Gaps = 12/88 (14%)
 Frame = -2

Query  229  TDEEKNLKKEIEQLKKE-----------ALQDA-GEDQAATHDLINQKerelellirdld  86
            T+EEK LK+EI+ L+KE           +LQ+A G +Q    +LI  KER+LELLIRDLD
Sbjct  388  TEEEKMLKEEIDHLRKELEKVAIDANGESLQEASGGEQTTLRELILHKERDLELLIRDLD  447

Query  85   DKVRFAEKTTESPGSGSNRVSSFAERPP  2
            DK+RF +K  + PGSGS R +SF ERPP
Sbjct  448  DKIRFGQKVVDRPGSGSGRSASFPERPP  475



>ref|XP_003531329.1| PREDICTED: protein lingerer-like [Glycine max]
Length=551

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 58/88 (66%), Gaps = 12/88 (14%)
 Frame = -2

Query  229  TDEEKNLKKEIEQLKKE------------ALQDAGEDQAATHDLINQKerelellirdld  86
            T EEK LK+EI+ LKKE            ++ +AG DQ + H ++ QKE+ELELLI DLD
Sbjct  403  TMEEKLLKEEIDNLKKELEKESTINSNKESVDEAGGDQTSRHAILQQKEKELELLIHDLD  462

Query  85   DKVRFAEKTTESPGSGSNRVSSFAERPP  2
             KVRF +K  E PGS + + S+F++RPP
Sbjct  463  GKVRFGQKAVERPGSSAGKSSTFSDRPP  490



>ref|XP_010682280.1| PREDICTED: uncharacterized protein LOC104897153 [Beta vulgaris 
subsp. vulgaris]
Length=535

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 59/88 (67%), Gaps = 12/88 (14%)
 Frame = -2

Query  229  TDEEKNLKKEIEQLKKEALQDAGED--------QAATHDLINQKerelellirdldDKVR  74
            T+EEK LK+EIE L+K+  +D+G D        Q +  DL+  KER+LE+LIRDLDDKVR
Sbjct  386  TEEEKALKEEIENLRKDLEKDSGNDVPQETEVEQISVRDLLQSKERDLEVLIRDLDDKVR  445

Query  73   FAEKTTE----SPGSGSNRVSSFAERPP  2
            F +K  +     PGSG+ R +SF ERPP
Sbjct  446  FGQKAVDRPGSRPGSGAGRFTSFPERPP  473



>ref|XP_003525036.1| PREDICTED: protein argonaute 2-like [Glycine max]
Length=531

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 60/87 (69%), Gaps = 12/87 (14%)
 Frame = -2

Query  229  TDEEKNLKKEIEQLKKE------------ALQDAGEDQAATHDLINQKerelellirdld  86
            T EEK LK+EI+ LKKE            ++ +AG DQ +TH ++ QKE+ELELLIRDLD
Sbjct  383  TMEEKLLKEEIDNLKKELEKESTINSNKESVDEAGGDQTSTHAILQQKEKELELLIRDLD  442

Query  85   DKVRFAEKTTESPGSGSNRVSSFAERP  5
            DKVRF +K  E PGS + + S+F++RP
Sbjct  443  DKVRFGQKAIERPGSSAGKSSTFSDRP  469



>ref|XP_010251032.1| PREDICTED: hepatoma-derived growth factor-related protein 2-like 
[Nelumbo nucifera]
Length=530

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 59/88 (67%), Gaps = 13/88 (15%)
 Frame = -2

Query  229  TDEEKNLKKEIEQLKKE------------ALQDAGEDQAATHDLINQKerelellirdld  86
            T+EEK LK+EI QLKKE            +LQ A E+Q +  +LI+ KER+LELLIRDLD
Sbjct  384  TEEEKMLKEEINQLKKELEKEAVVDANGESLQ-ASEEQTSFRELIHSKERDLELLIRDLD  442

Query  85   DKVRFAEKTTESPGSGSNRVSSFAERPP  2
            DK+RF +K  + PGSGS R   F ERPP
Sbjct  443  DKIRFGQKAIDRPGSGSGRAVPFPERPP  470



>emb|CAN66291.1| hypothetical protein VITISV_027030 [Vitis vinifera]
Length=562

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 54/85 (64%), Gaps = 9/85 (11%)
 Frame = -2

Query  229  TDEEKNLKKEIEQLKKE---------ALQDAGEDQAATHDLINQKerelellirdldDKV  77
            T+EEKNL++EI  LK+E         +++ +GEDQ +  DLI  KER LE L  DLDDKV
Sbjct  418  TEEEKNLREEIWDLKRELQKESEKRQSMKGSGEDQISLQDLILSKERNLEQLNCDLDDKV  477

Query  76   RFAEKTTESPGSGSNRVSSFAERPP  2
            RF  K  E PGSG+ R +  +ER P
Sbjct  478  RFGRKVMEKPGSGAFRGAIISERLP  502



>ref|XP_010659396.1| PREDICTED: uncharacterized protein LOC104881315 [Vitis vinifera]
Length=522

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 54/85 (64%), Gaps = 9/85 (11%)
 Frame = -2

Query  229  TDEEKNLKKEIEQLKKE---------ALQDAGEDQAATHDLINQKerelellirdldDKV  77
            T+EEKNL++EI  LK+E         +++ +GEDQ +  DLI  KER LE L  DLDDKV
Sbjct  378  TEEEKNLREEIWDLKRELQKESEKRQSMKGSGEDQISLQDLILSKERNLEQLNCDLDDKV  437

Query  76   RFAEKTTESPGSGSNRVSSFAERPP  2
            RF  K  E PGSG+ R +  +ER P
Sbjct  438  RFGRKVMEKPGSGAFRGAIISERLP  462



>gb|EYU22540.1| hypothetical protein MIMGU_mgv1a004532mg [Erythranthe guttata]
Length=522

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 53/83 (64%), Gaps = 8/83 (10%)
 Frame = -2

Query  229  TDEEKNLKKEIEQLKKEALQDAGEDQAATHDLINQKerelellirdldDKVRFAEKTTE-  53
            T+EEKNLK+EIE LK E  Q +GE+Q +  DLI QK++ LE+L+  LDDKVR+++K  E 
Sbjct  355  TEEEKNLKEEIEHLKNELQQKSGEEQTSVQDLILQKQQHLEVLVHQLDDKVRYSQKIFER  414

Query  52   -------SPGSGSNRVSSFAERP  5
                    PGS     S F ERP
Sbjct  415  QNSRPPSRPGSHDGPRSGFPERP  437



>gb|KDO82200.1| hypothetical protein CISIN_1g009913mg [Citrus sinensis]
Length=515

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 52/70 (74%), Gaps = 2/70 (3%)
 Frame = -2

Query  211  LKKEIEQLKKEALQDAGEDQAATHDLINQKerelellirdldDKVRFAEKTTESPGSGSN  32
            LKKE+E L +E+LQ++G +Q   HD+I  KE+ELE+L+RDLD KVRF  K  E PGSG+ 
Sbjct  396  LKKELE-LNRESLQESGGEQPNLHDIILSKEQELEMLVRDLDSKVRFGPK-AERPGSGAG  453

Query  31   RVSSFAERPP  2
            R + F ERPP
Sbjct  454  RAAGFLERPP  463



>gb|KDO82199.1| hypothetical protein CISIN_1g009913mg [Citrus sinensis]
Length=522

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 52/70 (74%), Gaps = 2/70 (3%)
 Frame = -2

Query  211  LKKEIEQLKKEALQDAGEDQAATHDLINQKerelellirdldDKVRFAEKTTESPGSGSN  32
            LKKE+E L +E+LQ++G +Q   HD+I  KE+ELE+L+RDLD KVRF  K  E PGSG+ 
Sbjct  396  LKKELE-LNRESLQESGGEQPNLHDIILSKEQELEMLVRDLDSKVRFGPK-AERPGSGAG  453

Query  31   RVSSFAERPP  2
            R + F ERPP
Sbjct  454  RAAGFLERPP  463



>ref|XP_007225782.1| hypothetical protein PRUPE_ppa003820mg [Prunus persica]
 gb|EMJ26981.1| hypothetical protein PRUPE_ppa003820mg [Prunus persica]
Length=546

 Score = 52.8 bits (125),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 56/87 (64%), Gaps = 12/87 (14%)
 Frame = -2

Query  229  TDEEKNLKKEIEQLKKE------------ALQDAGEDQAATHDLINQKerelellirdld  86
            T+EE+ LK+EI+ LKKE              Q++G DQA+  D++ QKERELE LI DLD
Sbjct  385  TEEERKLKEEIDHLKKELEKESPDKTNSETGQESGGDQASLRDIVLQKERELETLIHDLD  444

Query  85   DKVRFAEKTTESPGSGSNRVSSFAERP  5
            DKVRF +K  + PGSG+ R  S A RP
Sbjct  445  DKVRFGQKAIDRPGSGAGRPGSGAGRP  471



>ref|XP_010044554.1| PREDICTED: uncharacterized protein LOC104433489 [Eucalyptus grandis]
 gb|KCW86640.1| hypothetical protein EUGRSUZ_B03270 [Eucalyptus grandis]
Length=527

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 57/88 (65%), Gaps = 12/88 (14%)
 Frame = -2

Query  229  TDEEKNLKKEIEQLKKE-----AL-------QDAGEDQAATHDLINQKerelellirdld  86
            T++EK LK+EIE LKKE     AL       Q +  DQ +  D I+ KERELE L RDLD
Sbjct  380  TEQEKMLKEEIENLKKEMEKELALKANNEHSQGSEADQPSLSDAISLKERELEALTRDLD  439

Query  85   DKVRFAEKTTESPGSGSNRVSSFAERPP  2
            DKVRF +K+ + PGSG  R  SF++RPP
Sbjct  440  DKVRFGQKSVDRPGSGYGRSGSFSDRPP  467



>ref|XP_006483963.1| PREDICTED: uncharacterized protein LOC102618826 isoform X2 [Citrus 
sinensis]
Length=515

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 52/70 (74%), Gaps = 2/70 (3%)
 Frame = -2

Query  211  LKKEIEQLKKEALQDAGEDQAATHDLINQKerelellirdldDKVRFAEKTTESPGSGSN  32
            LKKE+E + +E+LQ++G +Q + HD I  KE+ELE+L+RDLD KVRF  K  E PGSG+ 
Sbjct  396  LKKELE-INRESLQESGGEQPSLHDNILSKEQELEMLVRDLDSKVRFGPK-AERPGSGAG  453

Query  31   RVSSFAERPP  2
            R + F ERPP
Sbjct  454  RAAGFLERPP  463



>ref|XP_006438236.1| hypothetical protein CICLE_v10031235mg [Citrus clementina]
 ref|XP_006483962.1| PREDICTED: uncharacterized protein LOC102618826 isoform X1 [Citrus 
sinensis]
 gb|ESR51476.1| hypothetical protein CICLE_v10031235mg [Citrus clementina]
Length=522

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 52/70 (74%), Gaps = 2/70 (3%)
 Frame = -2

Query  211  LKKEIEQLKKEALQDAGEDQAATHDLINQKerelellirdldDKVRFAEKTTESPGSGSN  32
            LKKE+E + +E+LQ++G +Q + HD I  KE+ELE+L+RDLD KVRF  K  E PGSG+ 
Sbjct  396  LKKELE-INRESLQESGGEQPSLHDNILSKEQELEMLVRDLDSKVRFGPK-AERPGSGAG  453

Query  31   RVSSFAERPP  2
            R + F ERPP
Sbjct  454  RAAGFLERPP  463



>ref|XP_002530045.1| translation initiation factor, putative [Ricinus communis]
 gb|EEF32345.1| translation initiation factor, putative [Ricinus communis]
Length=484

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -2

Query  187  KKEALQDAGEDQAATHDLINQKerelellirdldDKVRFAEKTTESPGSGSNRVSSFAER  8
            K+E+LQ  G DQ +  ++I+QKE+ELE +IRD DDKVRF +K  E PGSG+ R ++ +ER
Sbjct  370  KEESLQSHGGDQPSLQEIISQKEKELEQIIRDFDDKVRFGQKAIERPGSGAGRAANLSER  429

Query  7    PP  2
            PP
Sbjct  430  PP  431



>ref|XP_004142962.1| PREDICTED: uncharacterized protein LOC101206526 [Cucumis sativus]
 ref|XP_004159568.1| PREDICTED: uncharacterized protein LOC101227271 [Cucumis sativus]
Length=518

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 55/87 (63%), Gaps = 12/87 (14%)
 Frame = -2

Query  229  TDEEKNLKKEIEQLKKE------------ALQDAGEDQAATHDLINQKerelellirdld  86
            T+EEK LK+EI+ L+KE            ++Q++  +     D IN+KE ELE L+ DLD
Sbjct  373  TEEEKMLKEEIDVLRKELEEGLSLNANKESVQESAGEMQNLRDRINKKEHELETLVLDLD  432

Query  85   DKVRFAEKTTESPGSGSNRVSSFAERP  5
            DKVRF +K TE PGSG+ R + F ERP
Sbjct  433  DKVRFGKKATERPGSGAGRAAVFPERP  459



>gb|KGN62328.1| hypothetical protein Csa_2G349620 [Cucumis sativus]
Length=531

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 55/87 (63%), Gaps = 12/87 (14%)
 Frame = -2

Query  229  TDEEKNLKKEIEQLKKE------------ALQDAGEDQAATHDLINQKerelellirdld  86
            T+EEK LK+EI+ L+KE            ++Q++  +     D IN+KE ELE L+ DLD
Sbjct  373  TEEEKMLKEEIDVLRKELEEGLSLNANKESVQESAGEMQNLRDRINKKEHELETLVLDLD  432

Query  85   DKVRFAEKTTESPGSGSNRVSSFAERP  5
            DKVRF +K TE PGSG+ R + F ERP
Sbjct  433  DKVRFGKKATERPGSGAGRAAVFPERP  459



>ref|XP_007159695.1| hypothetical protein PHAVU_002G259400g [Phaseolus vulgaris]
 gb|ESW31689.1| hypothetical protein PHAVU_002G259400g [Phaseolus vulgaris]
Length=559

 Score = 50.1 bits (118),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 61/86 (71%), Gaps = 10/86 (12%)
 Frame = -2

Query  229  TDEEKNLKKEIEQLKKE--------ALQDAGE--DQAATHDLINQKerelellirdldDK  80
            T EEK LK+EI+ LKKE        + +++G+  DQ +T+ ++ QKE+ELELL+RDLDDK
Sbjct  410  TMEEKLLKEEIDNLKKELEKESPINSNKESGDEADQTSTNGILQQKEKELELLVRDLDDK  469

Query  79   VRFAEKTTESPGSGSNRVSSFAERPP  2
            VRF +K  E PGS + R S +++RPP
Sbjct  470  VRFGQKAVERPGSSAGRSSGYSDRPP  495



>ref|XP_011464053.1| PREDICTED: uncharacterized protein LOC101293198 [Fragaria vesca 
subsp. vesca]
Length=582

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 55/85 (65%), Gaps = 10/85 (12%)
 Frame = -2

Query  229  TDEEKNLKKEIEQLKKE----------ALQDAGEDQAATHDLINQKerelellirdldDK  80
            T+EE+ LK EI+ LKKE           +Q++   Q   HD++ QKERELELLIRDLDDK
Sbjct  391  TEEERRLKDEIDGLKKELKSINNVNSETVQESSATQPRLHDIVAQKERELELLIRDLDDK  450

Query  79   VRFAEKTTESPGSGSNRVSSFAERP  5
            VRF +K  + PGSG+ R  S A RP
Sbjct  451  VRFGQKAIDRPGSGAGRPGSGAGRP  475



>gb|KEH20765.1| plant-specific eukaryotic initiation factor 4B [Medicago truncatula]
Length=529

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 57/88 (65%), Gaps = 12/88 (14%)
 Frame = -2

Query  229  TDEEKNLKKEIEQLKK------------EALQDAGEDQAATHDLINQKerelellirdld  86
            T EEK LK+EI+ LKK            E+   +G DQ  TH ++ +KERELELLIRDLD
Sbjct  381  TIEEKLLKEEIDNLKKQLENESTVNSNEESADGSGGDQTGTHAMLLEKERELELLIRDLD  440

Query  85   DKVRFAEKTTESPGSGSNRVSSFAERPP  2
            DKVRF +K  E PGS + + + F++RPP
Sbjct  441  DKVRFGQKAVERPGSSAGKTAGFSDRPP  468



>gb|EYU30622.1| hypothetical protein MIMGU_mgv1a003991mg [Erythranthe guttata]
Length=551

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 55/87 (63%), Gaps = 11/87 (13%)
 Frame = -2

Query  229  TDEEKNLKKEIEQLKKEALQDAGEDQAATHDLINQKerelellirdldDKVRFAEKTTES  50
            T+EE+ LK+EIEQLKKE L  + +DQ   +DLI QKERELELL+  LDDK+R+ +K  E 
Sbjct  365  TEEERKLKEEIEQLKKELLLKSDDDQTTINDLILQKERELELLVLQLDDKIRYTQKNFER  424

Query  49   PGSGS-----------NRVSSFAERPP  2
             GS +           +R  S  ERPP
Sbjct  425  QGSAAGGAYENPRAALDRPPSQGERPP  451



>ref|XP_008221989.1| PREDICTED: protein no-on-transient A [Prunus mume]
Length=477

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 52/79 (66%), Gaps = 12/79 (15%)
 Frame = -2

Query  229  TDEEKNLKKEIEQLKKE------------ALQDAGEDQAATHDLINQKerelellirdld  86
            T+EE+ LK+EI+ LKKE              Q++G DQA+  D++ QKERELE LI DLD
Sbjct  396  TEEERKLKEEIDHLKKELEKESPDKTNSETGQESGGDQASLRDIVLQKERELETLIHDLD  455

Query  85   DKVRFAEKTTESPGSGSNR  29
            DKVRF +K  + PGSG+ R
Sbjct  456  DKVRFGQKAIDRPGSGAGR  474



>ref|XP_009359201.1| PREDICTED: uncharacterized protein LOC103949810 isoform X4 [Pyrus 
x bretschneideri]
Length=553

 Score = 47.0 bits (110),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 51/75 (68%), Gaps = 5/75 (7%)
 Frame = -2

Query  214  NLKKEIEQ-----LKKEALQDAGEDQAATHDLINQKerelellirdldDKVRFAEKTTES  50
            +LKKE+E+     +  E +Q++G DQ +  D++ QKERELE LIR+ DDKVRF +K  + 
Sbjct  396  HLKKELEKESTDKVNSETVQESGGDQPSLRDIVLQKERELEALIREFDDKVRFGQKAIDR  455

Query  49   PGSGSNRVSSFAERP  5
            PGSG+ R  S A RP
Sbjct  456  PGSGAGRPGSGAGRP  470



>ref|XP_008444378.1| PREDICTED: uncharacterized protein LOC103487724 isoform X2 [Cucumis 
melo]
Length=549

 Score = 46.6 bits (109),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 55/87 (63%), Gaps = 12/87 (14%)
 Frame = -2

Query  229  TDEEKNLKKEIEQLKKE------------ALQDAGEDQAATHDLINQKerelellirdld  86
            T+EEK LK+EI+ L+KE            ++Q++  +     + IN+KE ELE LI DLD
Sbjct  377  TEEEKMLKEEIDVLRKELEEGLSLNANKESVQESAGEMQNLRERINKKEHELETLILDLD  436

Query  85   DKVRFAEKTTESPGSGSNRVSSFAERP  5
            DKVRF +K T+ PGSG+ R + F ERP
Sbjct  437  DKVRFGKKATDRPGSGAGRAAVFPERP  463



>ref|XP_008444377.1| PREDICTED: uncharacterized protein LOC103487724 isoform X1 [Cucumis 
melo]
Length=563

 Score = 46.6 bits (109),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 55/87 (63%), Gaps = 12/87 (14%)
 Frame = -2

Query  229  TDEEKNLKKEIEQLKKE------------ALQDAGEDQAATHDLINQKerelellirdld  86
            T+EEK LK+EI+ L+KE            ++Q++  +     + IN+KE ELE LI DLD
Sbjct  377  TEEEKMLKEEIDVLRKELEEGLSLNANKESVQESAGEMQNLRERINKKEHELETLILDLD  436

Query  85   DKVRFAEKTTESPGSGSNRVSSFAERP  5
            DKVRF +K T+ PGSG+ R + F ERP
Sbjct  437  DKVRFGKKATDRPGSGAGRAAVFPERP  463



>ref|XP_007044834.1| Eukaryotic translation initiation factor 4B1 [Theobroma cacao]
 gb|EOY00666.1| Eukaryotic translation initiation factor 4B1 [Theobroma cacao]
Length=524

 Score = 46.6 bits (109),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 49/70 (70%), Gaps = 1/70 (1%)
 Frame = -2

Query  214  NLKKEIEQLKKEALQDAGEDQAATHDLINQKerelellirdldDKVRFAEKTTESPGSGS  35
            NLKKEIE+     ++ AG DQ    D + +KERELE+LIRDLD+KVRF +K  E PGSG+
Sbjct  394  NLKKEIEKESISKVEPAG-DQPTLRDTLLRKERELEILIRDLDNKVRFGQKAVERPGSGA  452

Query  34   NRVSSFAERP  5
             R+ S  +RP
Sbjct  453  GRIGSLPDRP  462



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 568691099245