BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMCP005B12 555 bp,

Length=526
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002269340.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13           210   7e-61   Vitis vinifera
ref|XP_006357252.1|  PREDICTED: nitrate transporter 1.7-like            210   8e-61   Solanum tuberosum [potatoes]
ref|XP_009610610.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13 iso...    207   9e-60   Nicotiana tomentosiformis
ref|XP_009610611.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13 iso...    207   1e-59   Nicotiana tomentosiformis
ref|XP_004238760.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13           206   2e-59   Solanum lycopersicum
ref|XP_009775473.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13-like      206   3e-59   Nicotiana sylvestris
ref|XP_011006584.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13           203   2e-58   Populus euphratica
ref|XP_006378165.1|  proton-dependent oligopeptide transport fami...    202   4e-58   Populus trichocarpa [western balsam poplar]
ref|XP_011086410.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13-like      202   4e-58   Sesamum indicum [beniseed]
ref|XP_003551991.1|  PREDICTED: nitrate transporter 1.7-like            201   1e-57   Glycine max [soybeans]
emb|CDY53067.1|  BnaCnng24110D                                          199   5e-57   Brassica napus [oilseed rape]
emb|CDP00275.1|  unnamed protein product                                199   8e-57   Coffea canephora [robusta coffee]
gb|KDO39248.1|  hypothetical protein CISIN_1g007862mg                   196   1e-56   Citrus sinensis [apfelsine]
ref|XP_006438562.1|  hypothetical protein CICLE_v10030982mg             196   1e-56   
ref|XP_009127767.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13           197   2e-56   Brassica rapa
emb|CDY56086.1|  BnaA02g35730D                                          197   2e-56   Brassica napus [oilseed rape]
dbj|BAJ33974.1|  unnamed protein product                                198   2e-56   Eutrema halophilum
ref|XP_002520155.1|  nitrate transporter, putative                      197   3e-56   Ricinus communis
gb|KDO39247.1|  hypothetical protein CISIN_1g007862mg                   196   5e-56   Citrus sinensis [apfelsine]
emb|CDY11647.1|  BnaC06g30920D                                          197   5e-56   Brassica napus [oilseed rape]
ref|XP_006483256.1|  PREDICTED: nitrate transporter 1.7-like isof...    196   5e-56   Citrus sinensis [apfelsine]
gb|KDO39246.1|  hypothetical protein CISIN_1g007862mg                   196   5e-56   Citrus sinensis [apfelsine]
ref|XP_006390953.1|  hypothetical protein EUTSA_v10018285mg             197   5e-56   Eutrema salsugineum [saltwater cress]
ref|XP_006483255.1|  PREDICTED: nitrate transporter 1.7-like isof...    196   1e-55   Citrus sinensis [apfelsine]
ref|XP_006438561.1|  hypothetical protein CICLE_v10030982mg             196   1e-55   Citrus clementina [clementine]
gb|EYU28693.1|  hypothetical protein MIMGU_mgv1a004515mg                194   2e-55   Erythranthe guttata [common monkey flower]
ref|XP_004509940.1|  PREDICTED: nitrate transporter 1.7-like            194   3e-55   Cicer arietinum [garbanzo]
gb|KJB77129.1|  hypothetical protein B456_012G121800                    193   3e-55   Gossypium raimondii
ref|XP_010513693.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13-like      188   4e-55   Camelina sativa [gold-of-pleasure]
ref|XP_007153857.1|  hypothetical protein PHAVU_003G070500g             194   6e-55   Phaseolus vulgaris [French bean]
gb|KJB77128.1|  hypothetical protein B456_012G121800                    194   7e-55   Gossypium raimondii
ref|XP_007157410.1|  hypothetical protein PHAVU_002G067700g             194   8e-55   Phaseolus vulgaris [French bean]
emb|CDY38767.1|  BnaA07g28390D                                          194   8e-55   Brassica napus [oilseed rape]
ref|XP_009105659.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13           194   9e-55   Brassica rapa
gb|KHG14034.1|  Nitrate transporter 1.7 -like protein                   192   2e-54   Gossypium arboreum [tree cotton]
ref|XP_007044382.1|  Nitrate transporter 1.7, putative                  191   5e-54   
gb|KFK41407.1|  hypothetical protein AALP_AA2G126900                    191   8e-54   Arabis alpina [alpine rockcress]
ref|XP_010044698.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13-like      191   9e-54   Eucalyptus grandis [rose gum]
ref|XP_009360408.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13           190   2e-53   Pyrus x bretschneideri [bai li]
ref|XP_008367039.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13-like      190   2e-53   
emb|CDY48389.1|  BnaA07g24080D                                          189   2e-53   Brassica napus [oilseed rape]
gb|KEH19853.1|  peptide/nitrate transporter                             189   4e-53   Medicago truncatula
ref|XP_010470990.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13           189   5e-53   Camelina sativa [gold-of-pleasure]
ref|XP_006302005.1|  hypothetical protein CARUB_v10019982mg             188   7e-53   Capsella rubella
emb|CDY23545.1|  BnaC06g25140D                                          188   8e-53   Brassica napus [oilseed rape]
ref|XP_010512052.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13           188   1e-52   Camelina sativa [gold-of-pleasure]
ref|XP_007222023.1|  hypothetical protein PRUPE_ppa002984mg             188   1e-52   
gb|EPS62066.1|  hypothetical protein M569_12727                         187   1e-52   Genlisea aurea
gb|KHN01163.1|  Nitrate transporter 1.7                                 187   1e-52   Glycine soja [wild soybean]
ref|XP_004489968.1|  PREDICTED: nitrate transporter 1.7-like            187   2e-52   Cicer arietinum [garbanzo]
ref|XP_010551494.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13           187   2e-52   Tarenaya hassleriana [spider flower]
ref|XP_002863113.1|  proton-dependent oligopeptide transport fami...    187   2e-52   
dbj|BAB19759.1|  putative nitrate transporter NRT1-4                    177   4e-52   Glycine max [soybeans]
ref|XP_010415654.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13-like      186   6e-52   Camelina sativa [gold-of-pleasure]
ref|XP_010475864.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13-like      185   2e-51   Camelina sativa [gold-of-pleasure]
gb|KHN28716.1|  Nitrate transporter 1.7                                 184   2e-51   Glycine soja [wild soybean]
ref|NP_564979.1|  nitrate transporter 1.7                               184   2e-51   Arabidopsis thaliana [mouse-ear cress]
gb|AAG52567.1|AC010675_15  putative peptide transporter; 37139-33250    184   2e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003519778.1|  PREDICTED: nitrate transporter 1.7-like            184   3e-51   Glycine max [soybeans]
ref|XP_004297809.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13-like      184   3e-51   Fragaria vesca subsp. vesca
ref|XP_010256203.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13-like      184   4e-51   Nelumbo nucifera [Indian lotus]
ref|XP_010096325.1|  Nitrate transporter 1.7                            184   4e-51   Morus notabilis
ref|XP_010482935.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13-like      182   9e-51   Camelina sativa [gold-of-pleasure]
gb|KDP21241.1|  hypothetical protein JCGZ_21712                         182   1e-50   Jatropha curcas
ref|XP_010443122.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13-like      181   1e-50   Camelina sativa [gold-of-pleasure]
ref|XP_008221697.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13-like      182   2e-50   
ref|XP_003613558.1|  Peptide transporter PTR1                           181   2e-50   Medicago truncatula
emb|CDY40280.1|  BnaA07g09200D                                          180   6e-50   Brassica napus [oilseed rape]
ref|XP_004155325.1|  PREDICTED: LOW QUALITY PROTEIN: nitrate tran...    180   6e-50   
ref|XP_008446297.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...    180   6e-50   
ref|XP_004135202.1|  PREDICTED: nitrate transporter 1.7-like            180   6e-50   Cucumis sativus [cucumbers]
ref|XP_010498968.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.12-like      179   7e-50   Camelina sativa [gold-of-pleasure]
ref|XP_009103122.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.12           179   1e-49   Brassica rapa
emb|CDY28441.1|  BnaC07g12690D                                          179   1e-49   Brassica napus [oilseed rape]
ref|XP_010460223.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.12-like      178   2e-49   Camelina sativa [gold-of-pleasure]
ref|XP_006415996.1|  hypothetical protein EUTSA_v10007235mg             178   3e-49   Eutrema salsugineum [saltwater cress]
ref|XP_010477772.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.12           178   3e-49   Camelina sativa [gold-of-pleasure]
gb|KJB61233.1|  hypothetical protein B456_009G346900                    176   1e-48   Gossypium raimondii
gb|KHG01988.1|  hypothetical protein F383_22454                         175   3e-48   Gossypium arboreum [tree cotton]
emb|CDY25813.1|  BnaA07g09690D                                          174   1e-47   Brassica napus [oilseed rape]
gb|AAF79856.1|AC000348_9  T7N9.14                                       174   1e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010683278.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.12           174   1e-47   Beta vulgaris subsp. vulgaris [field beet]
gb|KFK44623.1|  hypothetical protein AALP_AA1G282800                    173   1e-47   Arabis alpina [alpine rockcress]
ref|NP_174028.2|  nitrate transporter 1.6                               173   1e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006304643.1|  hypothetical protein CARUB_v10011778mg             172   3e-47   Capsella rubella
ref|XP_002517461.1|  nitrate transporter, putative                      171   9e-47   Ricinus communis
ref|XP_008787832.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13-like      171   1e-46   
ref|XP_010933657.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13           171   1e-46   
ref|XP_010926623.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13-like      171   2e-46   Elaeis guineensis
ref|XP_008807862.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      170   3e-46   Phoenix dactylifera
ref|XP_008807860.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13-like      169   4e-46   Phoenix dactylifera
ref|XP_010932898.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      169   6e-46   Elaeis guineensis
ref|XP_010926624.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13-like      169   7e-46   Elaeis guineensis
ref|XP_007226812.1|  hypothetical protein PRUPE_ppa024795mg             168   9e-46   
ref|XP_009389042.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13-like      168   1e-45   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010678592.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      168   1e-45   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008796703.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13-like      168   1e-45   Phoenix dactylifera
ref|XP_002517462.1|  nitrate transporter, putative                      168   2e-45   
ref|XP_008221751.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13-like      167   2e-45   Prunus mume [ume]
ref|XP_009408470.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13-like      168   2e-45   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004510061.1|  PREDICTED: nitrate transporter 1.7-like            167   2e-45   Cicer arietinum [garbanzo]
gb|KJB48086.1|  hypothetical protein B456_008G052800                    166   2e-45   Gossypium raimondii
ref|XP_004971025.1|  PREDICTED: nitrate transporter 1.7-like isof...    167   3e-45   
gb|KJB48085.1|  hypothetical protein B456_008G052800                    167   4e-45   Gossypium raimondii
ref|XP_002517460.1|  nitrate transporter, putative                      167   4e-45   Ricinus communis
gb|AES96528.2|  peptide/nitrate transporter                             167   4e-45   Medicago truncatula
ref|XP_008353106.1|  PREDICTED: uncharacterized protein LOC103416653    170   4e-45   
ref|XP_007044381.1|  Nitrate transporter 1.7, putative                  167   5e-45   
ref|XP_004971024.1|  PREDICTED: nitrate transporter 1.7-like isof...    166   6e-45   Setaria italica
emb|CDP14879.1|  unnamed protein product                                166   1e-44   Coffea canephora [robusta coffee]
gb|AHV83614.1|  nitrate transporter                                     166   1e-44   Camellia sinensis [black tea]
ref|XP_006645212.1|  PREDICTED: nitrate transporter 1.7-like            164   2e-44   
gb|KHF99049.1|  Nitrate transporter 1.7 -like protein                   164   3e-44   Gossypium arboreum [tree cotton]
dbj|BAK04665.1|  predicted protein                                      164   3e-44   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010232727.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.12-like      164   6e-44   Brachypodium distachyon [annual false brome]
ref|XP_010933709.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.9-like       163   8e-44   
ref|XP_003553207.1|  PREDICTED: nitrate transporter 1.7-like            163   8e-44   Glycine max [soybeans]
ref|XP_002517459.1|  nitrate transporter, putative                      163   1e-43   
ref|XP_007153856.1|  hypothetical protein PHAVU_003G070400g             162   2e-43   Phaseolus vulgaris [French bean]
ref|XP_010256190.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.9-like       162   2e-43   Nelumbo nucifera [Indian lotus]
ref|NP_001045170.1|  Os01g0913300                                       162   2e-43   
emb|CDP14877.1|  unnamed protein product                                159   3e-43   Coffea canephora [robusta coffee]
emb|CDP14880.1|  unnamed protein product                                161   4e-43   Coffea canephora [robusta coffee]
emb|CBH32526.1|  peptide transporter, putative, expressed               160   6e-43   Triticum aestivum [Canadian hard winter wheat]
gb|KHN48151.1|  Nitrate transporter 1.7                                 160   9e-43   Glycine soja [wild soybean]
ref|XP_007037200.1|  Major facilitator superfamily protein, putative    160   9e-43   
ref|XP_009397036.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13-lik...    160   9e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009397037.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13-lik...    160   1e-42   
gb|KDP45468.1|  hypothetical protein JCGZ_09717                         160   1e-42   Jatropha curcas
ref|XP_010923294.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      160   1e-42   Elaeis guineensis
ref|XP_009103775.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...    160   1e-42   
ref|XP_006838790.1|  hypothetical protein AMTR_s00002p00259450          159   2e-42   
ref|XP_010923296.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-lik...    159   2e-42   Elaeis guineensis
ref|XP_006838787.1|  hypothetical protein AMTR_s00002p00259170          159   2e-42   
ref|XP_004489982.1|  PREDICTED: nitrate transporter 1.7-like            159   2e-42   Cicer arietinum [garbanzo]
ref|XP_010923295.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-lik...    159   2e-42   
ref|XP_006367062.1|  PREDICTED: probable peptide/nitrate transpor...    159   3e-42   Solanum tuberosum [potatoes]
gb|KDP45400.1|  hypothetical protein JCGZ_09649                         158   4e-42   Jatropha curcas
gb|KJB19308.1|  hypothetical protein B456_003G094400                    158   5e-42   Gossypium raimondii
ref|XP_008364618.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      158   7e-42   
ref|XP_002270558.3|  PREDICTED: uncharacterized protein LOC100263850    160   7e-42   
ref|XP_002517463.1|  nitrate transporter, putative                      157   7e-42   
ref|XP_004236179.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      157   1e-41   
ref|XP_002317993.2|  proton-dependent oligopeptide transport fami...    157   1e-41   
ref|XP_010242330.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.9-like       157   1e-41   Nelumbo nucifera [Indian lotus]
gb|KHN01164.1|  Nitrate transporter 1.7                                 155   1e-41   Glycine soja [wild soybean]
emb|CBI15285.3|  unnamed protein product                                159   1e-41   Vitis vinifera
ref|XP_010933675.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      157   2e-41   
ref|XP_009798934.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.10-lik...    156   2e-41   Nicotiana sylvestris
ref|XP_008453172.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      156   2e-41   Cucumis melo [Oriental melon]
gb|EMT16488.1|  Peptide transporter PTR1                                154   2e-41   
ref|XP_009798933.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.10-lik...    156   2e-41   Nicotiana sylvestris
ref|XP_007227399.1|  hypothetical protein PRUPE_ppb015207mg             156   2e-41   
ref|XP_010037631.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.9-like...    156   3e-41   Eucalyptus grandis [rose gum]
ref|XP_003613570.1|  Peptide transporter                                156   3e-41   
ref|XP_010037632.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-lik...    156   3e-41   Eucalyptus grandis [rose gum]
ref|XP_002276806.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11           156   3e-41   Vitis vinifera
emb|CDP14876.1|  unnamed protein product                                156   3e-41   Coffea canephora [robusta coffee]
ref|XP_009610425.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11           155   5e-41   Nicotiana tomentosiformis
ref|XP_008340336.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13-like      155   6e-41   
gb|ACN72639.1|  nitrate transporter                                     155   7e-41   Malus hupehensis
ref|XP_008804560.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      154   8e-41   
ref|XP_009413298.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      154   9e-41   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB50863.1|  hypothetical protein B456_008G190200                    153   9e-41   Gossypium raimondii
ref|XP_008221696.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13-like      155   9e-41   Prunus mume [ume]
ref|XP_009369361.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.9-like...    154   1e-40   Pyrus x bretschneideri [bai li]
ref|XP_008807861.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      154   1e-40   
ref|XP_009369363.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.9-like...    154   1e-40   Pyrus x bretschneideri [bai li]
ref|XP_009398399.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11           154   1e-40   Musa acuminata subsp. malaccensis [pisang utan]
gb|KEH19852.1|  peptide/nitrate transporter                             154   1e-40   Medicago truncatula
ref|XP_002511509.1|  nitrate transporter, putative                      154   1e-40   Ricinus communis
ref|XP_011042616.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      154   1e-40   Populus euphratica
gb|KJB50860.1|  hypothetical protein B456_008G190200                    153   2e-40   Gossypium raimondii
ref|XP_010678901.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      154   2e-40   Beta vulgaris subsp. vulgaris [field beet]
gb|KDP45469.1|  hypothetical protein JCGZ_09718                         154   2e-40   Jatropha curcas
ref|XP_004236178.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11           154   2e-40   Solanum lycopersicum
ref|XP_007032430.1|  Major facilitator superfamily protein              154   2e-40   
gb|KHG08723.1|  hypothetical protein F383_35629                         154   2e-40   Gossypium arboreum [tree cotton]
gb|KJB50859.1|  hypothetical protein B456_008G190200                    154   2e-40   Gossypium raimondii
ref|XP_011007525.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.9-like       153   2e-40   Populus euphratica
ref|XP_002317995.2|  proton-dependent oligopeptide transport fami...    153   2e-40   Populus trichocarpa [western balsam poplar]
gb|KJB50861.1|  hypothetical protein B456_008G190200                    153   2e-40   Gossypium raimondii
ref|XP_007155346.1|  hypothetical protein PHAVU_003G193400g             153   3e-40   Phaseolus vulgaris [French bean]
gb|KGN63647.1|  hypothetical protein Csa_1G008530                       153   4e-40   
ref|XP_004138148.1|  PREDICTED: probable peptide/nitrate transpor...    153   4e-40   Cucumis sativus [cucumbers]
ref|XP_006354833.1|  PREDICTED: probable peptide/nitrate transpor...    152   5e-40   Solanum tuberosum [potatoes]
ref|XP_002517444.1|  nitrate transporter, putative                      152   5e-40   Ricinus communis
ref|XP_009343431.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      152   6e-40   Pyrus x bretschneideri [bai li]
ref|XP_006367063.1|  PREDICTED: probable peptide/nitrate transpor...    152   8e-40   Solanum tuberosum [potatoes]
ref|XP_002300021.1|  hypothetical protein POPTR_0001s34640g             152   1e-39   Populus trichocarpa [western balsam poplar]
ref|XP_010546036.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      152   1e-39   
ref|XP_002517390.1|  nitrate transporter, putative                      151   1e-39   Ricinus communis
ref|XP_004241514.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      151   1e-39   
ref|XP_006347445.1|  PREDICTED: probable peptide/nitrate transpor...    151   1e-39   Solanum tuberosum [potatoes]
ref|XP_006373301.1|  hypothetical protein POPTR_0017s11320g             151   1e-39   
emb|CDP14878.1|  unnamed protein product                                154   1e-39   Coffea canephora [robusta coffee]
ref|XP_008374512.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.9            151   2e-39   
ref|XP_010037637.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.9-like       150   2e-39   Eucalyptus grandis [rose gum]
ref|XP_011013862.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.10-like      150   2e-39   Populus euphratica
ref|XP_007133916.1|  hypothetical protein PHAVU_010G003000g             150   2e-39   Phaseolus vulgaris [French bean]
ref|XP_009799219.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      150   3e-39   Nicotiana sylvestris
ref|XP_007037199.1|  Major facilitator superfamily protein isoform 4    149   4e-39   
dbj|BAC83856.1|  putative nitrate transporter NRT1-5                    150   5e-39   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010037636.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.9-like       149   6e-39   Eucalyptus grandis [rose gum]
ref|XP_007037198.1|  Major facilitator superfamily protein isoform 3    149   7e-39   
ref|XP_004508783.1|  PREDICTED: probable peptide/nitrate transpor...    149   8e-39   
emb|CDP10977.1|  unnamed protein product                                149   8e-39   Coffea canephora [robusta coffee]
gb|EMS49861.1|  Nitrate transporter 1.7                                 149   8e-39   Triticum urartu
ref|XP_010112576.1|  putative peptide/nitrate transporter               149   8e-39   Morus notabilis
ref|XP_004508781.1|  PREDICTED: probable peptide/nitrate transpor...    149   8e-39   Cicer arietinum [garbanzo]
ref|XP_008796643.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-lik...    149   1e-38   Phoenix dactylifera
ref|XP_007037196.1|  Major facilitator superfamily protein isoform 1    149   1e-38   
ref|XP_007037197.1|  Major facilitator superfamily protein isoform 2    149   1e-38   
ref|XP_006439664.1|  hypothetical protein CICLE_v10019319mg             147   1e-38   
ref|XP_008796644.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-lik...    148   1e-38   
gb|EAZ38982.1|  hypothetical protein OsJ_23400                          150   2e-38   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007210278.1|  hypothetical protein PRUPE_ppa003007mg             148   2e-38   Prunus persica
gb|KHN48656.1|  Putative peptide/nitrate transporter                    148   2e-38   Glycine soja [wild soybean]
ref|XP_003524995.1|  PREDICTED: probable peptide/nitrate transpor...    148   2e-38   Glycine max [soybeans]
ref|XP_006439663.1|  hypothetical protein CICLE_v10019319mg             148   2e-38   Citrus clementina [clementine]
emb|CDY00315.1|  BnaA06g22160D                                          147   3e-38   
gb|KHN48655.1|  Putative peptide/nitrate transporter                    147   3e-38   Glycine soja [wild soybean]
gb|AES91176.2|  peptide/nitrate transporter                             147   3e-38   Medicago truncatula
ref|XP_009151387.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      147   3e-38   Brassica rapa
gb|EAZ28180.1|  hypothetical protein OsJ_12153                          146   4e-38   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004138297.1|  PREDICTED: probable peptide/nitrate transpor...    147   4e-38   Cucumis sativus [cucumbers]
ref|XP_006476666.1|  PREDICTED: probable peptide/nitrate transpor...    147   4e-38   Citrus sinensis [apfelsine]
ref|XP_009626986.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      147   4e-38   Nicotiana tomentosiformis
ref|XP_003608979.1|  Nitrate transporter NRT1-2                         147   4e-38   
ref|XP_011465713.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.9-like       145   4e-38   Fragaria vesca subsp. vesca
ref|XP_003525480.1|  PREDICTED: probable peptide/nitrate transpor...    147   4e-38   Glycine max [soybeans]
ref|XP_006476665.1|  PREDICTED: probable peptide/nitrate transpor...    147   4e-38   
ref|XP_004508786.1|  PREDICTED: probable peptide/nitrate transpor...    147   5e-38   
ref|XP_002877586.1|  hypothetical protein ARALYDRAFT_323400             147   5e-38   Arabidopsis lyrata subsp. lyrata
gb|EEC75965.1|  hypothetical protein OsI_13072                          147   5e-38   Oryza sativa Indica Group [Indian rice]
gb|AAT85061.1|  nitrate transporter, putative                           147   5e-38   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008239650.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      147   6e-38   Prunus mume [ume]
ref|XP_002270812.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11           146   6e-38   Vitis vinifera
ref|XP_009764700.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      146   7e-38   Nicotiana sylvestris
ref|XP_008453175.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.10-like      146   9e-38   
ref|XP_010533412.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.9-like       146   1e-37   Tarenaya hassleriana [spider flower]
ref|XP_011087208.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      145   2e-37   Sesamum indicum [beniseed]
ref|XP_007210270.1|  hypothetical protein PRUPE_ppa003155mg             145   2e-37   Prunus persica
ref|XP_009623435.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      145   2e-37   Nicotiana tomentosiformis
ref|XP_008239651.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      145   2e-37   
tpg|DAA50699.1|  TPA: hypothetical protein ZEAMMB73_457708              144   3e-37   
gb|KEH31902.1|  peptide/nitrate transporter                             144   3e-37   Medicago truncatula
ref|NP_001130581.1|  uncharacterized protein LOC100191680               144   4e-37   Zea mays [maize]
gb|ABK95497.1|  unknown                                                 137   4e-37   Populus trichocarpa [western balsam poplar]
ref|XP_008670500.1|  PREDICTED: uncharacterized protein LOC100191...    144   6e-37   Zea mays [maize]
gb|KHN18518.1|  Putative peptide/nitrate transporter                    144   6e-37   Glycine soja [wild soybean]
emb|CDX81902.1|  BnaC08g36990D                                          144   6e-37   
gb|AAK44017.1|AF370202_1  putative peptide transporter protein          144   6e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011071716.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      144   7e-37   Sesamum indicum [beniseed]
ref|NP_566896.2|  glucosinolate transporter 1                           144   7e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003550765.1|  PREDICTED: probable peptide/nitrate transpor...    144   7e-37   Glycine max [soybeans]
gb|AAL16236.1|AF428467_1  AT3g47960/T17F15_170                          144   7e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003525007.2|  PREDICTED: probable peptide/nitrate transpor...    144   7e-37   Glycine max [soybeans]
gb|KHN48654.1|  Putative peptide/nitrate transporter                    143   7e-37   Glycine soja [wild soybean]
gb|KFK28007.1|  hypothetical protein AALP_AA8G459400                    144   8e-37   Arabis alpina [alpine rockcress]
ref|XP_010552600.1|  PREDICTED: putative protein NRT1/ PTR FAMILY...    143   8e-37   Tarenaya hassleriana [spider flower]
ref|XP_004508784.1|  PREDICTED: probable peptide/nitrate transpor...    143   9e-37   Cicer arietinum [garbanzo]
ref|XP_004508785.1|  PREDICTED: probable peptide/nitrate transpor...    143   9e-37   
ref|XP_009117579.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.9-like       143   1e-36   Brassica rapa
emb|CCN27386.1|  low affinity nitrate transporter                       136   1e-36   Triticum aestivum [Canadian hard winter wheat]
gb|KHN18517.1|  Putative peptide/nitrate transporter                    143   1e-36   Glycine soja [wild soybean]
ref|XP_003549658.1|  PREDICTED: probable peptide/nitrate transpor...    143   1e-36   Glycine max [soybeans]
ref|XP_007155348.1|  hypothetical protein PHAVU_003G193600g             143   1e-36   Phaseolus vulgaris [French bean]
emb|CDX68450.1|  BnaC01g25280D                                          143   2e-36   
ref|XP_011463116.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13-like      142   2e-36   Fragaria vesca subsp. vesca
ref|NP_173322.1|  probable peptide/nitrate transporter                  142   3e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010550650.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      142   3e-36   Tarenaya hassleriana [spider flower]
ref|XP_007226648.1|  hypothetical protein PRUPE_ppa022076mg             142   3e-36   
dbj|BAJ93857.1|  predicted protein                                      142   3e-36   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002464068.1|  hypothetical protein SORBIDRAFT_01g011700          142   3e-36   Sorghum bicolor [broomcorn]
ref|XP_009400863.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      141   4e-36   
ref|XP_011464561.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...    141   5e-36   Fragaria vesca subsp. vesca
gb|KEH31904.1|  peptide/nitrate transporter plant                       141   6e-36   Medicago truncatula
ref|XP_006378493.1|  hypothetical protein POPTR_0010s13620g             140   6e-36   
ref|XP_007222139.1|  hypothetical protein PRUPE_ppa004666mg             140   6e-36   
ref|XP_007155347.1|  hypothetical protein PHAVU_003G193500g             141   6e-36   
ref|XP_006394362.1|  hypothetical protein EUTSA_v10003849mg             141   6e-36   
ref|XP_004963332.1|  PREDICTED: probable peptide/nitrate transpor...    141   7e-36   
ref|XP_002890304.1|  proton-dependent oligopeptide transport fami...    141   7e-36   
gb|KHN18519.1|  Putative peptide/nitrate transporter                    140   7e-36   
ref|XP_006378491.1|  hypothetical protein POPTR_0010s13620g             140   7e-36   
ref|XP_006290269.1|  hypothetical protein CARUB_v10016825mg             141   7e-36   
gb|KDO76033.1|  hypothetical protein CISIN_1g007827mg                   140   7e-36   
dbj|BAB19756.1|  nitrate transporter NRT1-1                             140   8e-36   
gb|KDO76031.1|  hypothetical protein CISIN_1g007827mg                   140   8e-36   
gb|KDO76032.1|  hypothetical protein CISIN_1g007827mg                   140   9e-36   
ref|NP_001237970.1|  nitrate transporter NRT1-2                         140   9e-36   
ref|XP_009150736.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.10-like      140   1e-35   
emb|CDY30731.1|  BnaA02g33530D                                          140   1e-35   
ref|XP_002314866.2|  hypothetical protein POPTR_0010s13620g             140   1e-35   
ref|XP_006476663.1|  PREDICTED: probable peptide/nitrate transpor...    140   1e-35   
emb|CDY45756.1|  BnaC02g42260D                                          140   1e-35   
ref|XP_009112096.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      140   1e-35   
ref|XP_009130227.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11           140   1e-35   
ref|XP_006439661.1|  hypothetical protein CICLE_v10019426mg             139   1e-35   
gb|KDP29397.1|  hypothetical protein JCGZ_18318                         140   1e-35   
ref|XP_004982146.1|  PREDICTED: probable peptide/nitrate transpor...    139   1e-35   
dbj|BAJ85122.1|  predicted protein                                      140   1e-35   
ref|XP_010503417.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.10-like      140   2e-35   
ref|XP_006439662.1|  hypothetical protein CICLE_v10019426mg             140   2e-35   
ref|XP_006437677.1|  hypothetical protein CICLE_v10031060mg             139   2e-35   
gb|KDO69970.1|  hypothetical protein CISIN_1g008096mg                   139   2e-35   
emb|CDY16764.1|  BnaA09g06180D                                          139   2e-35   
ref|XP_006658355.1|  PREDICTED: probable peptide/nitrate transpor...    138   2e-35   
ref|XP_006484455.1|  PREDICTED: probable nitrite transporter At1g...    139   2e-35   
ref|XP_008221752.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13-like      139   2e-35   
ref|XP_008243217.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1            139   2e-35   
ref|XP_011008009.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1            139   2e-35   
ref|XP_009356281.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1-like       139   2e-35   
dbj|BAK08097.1|  predicted protein                                      139   2e-35   
gb|EYU24423.1|  hypothetical protein MIMGU_mgv1a003414mg                139   3e-35   
gb|KJB50862.1|  hypothetical protein B456_008G190200                    139   3e-35   
gb|KHG04001.1|  hypothetical protein F383_28667                         139   3e-35   
gb|ACN27476.1|  unknown                                                 139   3e-35   
gb|EPS61327.1|  hypothetical protein M569_13470                         139   3e-35   
ref|XP_004959036.1|  PREDICTED: LOW QUALITY PROTEIN: probable pep...    139   3e-35   
emb|CDY21692.1|  BnaA09g44430D                                          139   4e-35   
ref|XP_008389297.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1-like       139   4e-35   
ref|XP_010678590.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.9-like       139   4e-35   
ref|NP_177024.1|  putative nitrite transporter                          139   4e-35   
ref|XP_004489981.1|  PREDICTED: nitrate transporter 1.7-like            139   5e-35   
ref|XP_010044269.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...    138   5e-35   
ref|XP_010112577.1|  putative peptide/nitrate transporter               138   6e-35   
ref|XP_010426267.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.10           139   6e-35   
ref|XP_010265161.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1-like       138   7e-35   
gb|KJB80006.1|  hypothetical protein B456_013G077000                    138   7e-35   
dbj|BAJ91042.1|  predicted protein                                      137   8e-35   
ref|XP_010532196.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1-like       138   8e-35   
ref|NP_201074.1|  glucosinolate transporter-2                           138   8e-35   
ref|XP_010532304.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...    138   8e-35   
emb|CDX84344.1|  BnaC03g51560D                                          138   8e-35   
ref|XP_010263529.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1-like...    138   8e-35   
dbj|BAJ94405.1|  predicted protein                                      138   9e-35   
ref|XP_010263538.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1-like...    137   9e-35   
ref|XP_002866507.1|  proton-dependent oligopeptide transport fami...    138   9e-35   
dbj|BAJ91141.1|  predicted protein                                      138   1e-34   
dbj|BAJ96711.1|  predicted protein                                      138   1e-34   
ref|XP_009400862.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      137   1e-34   
gb|EPS71786.1|  nitrate transporter                                     137   1e-34   
dbj|BAJ34570.1|  unnamed protein product                                137   1e-34   
ref|XP_009149373.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.9-like       137   1e-34   
ref|XP_009110311.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.9            137   1e-34   
emb|CDY26715.1|  BnaA06g13070D                                          137   1e-34   
gb|KFK34096.1|  hypothetical protein AALP_AA5G101400                    137   1e-34   
ref|XP_006404313.1|  hypothetical protein EUTSA_v10010180mg             138   1e-34   
ref|XP_002887190.1|  proton-dependent oligopeptide transport fami...    137   2e-34   
ref|XP_011087209.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.10-like      137   2e-34   
gb|ADH21397.1|  nitrate transporter                                     137   2e-34   
ref|XP_003517977.1|  PREDICTED: probable nitrite transporter At1g...    137   2e-34   
ref|XP_004299089.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1            137   2e-34   
gb|EYU24424.1|  hypothetical protein MIMGU_mgv1a003540mg                137   2e-34   
dbj|BAB19760.1|  nitrate transporter NRT1-5                             136   2e-34   
ref|XP_010101985.1|  putative nitrite transporter                       136   2e-34   
gb|EMT08635.1|  Peptide transporter PTR1                                136   3e-34   
emb|CDX96690.1|  BnaA08g22330D                                          136   3e-34   
ref|XP_010678591.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.9-like       136   3e-34   
ref|XP_007153449.1|  hypothetical protein PHAVU_003G036200g             136   4e-34   
ref|XP_006391124.1|  hypothetical protein EUTSA_v10018310mg             136   4e-34   
ref|XP_008339682.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1            135   4e-34   
dbj|BAJ33669.1|  unnamed protein product                                136   5e-34   
ref|XP_006304758.1|  hypothetical protein CARUB_v10012216mg             135   5e-34   
ref|XP_002461612.1|  hypothetical protein SORBIDRAFT_02g005420          136   6e-34   
ref|XP_010459536.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.9            135   6e-34   
emb|CDX83801.1|  BnaC08g18440D                                          135   6e-34   
ref|XP_011459132.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like       134   6e-34   
emb|CDY69433.1|  BnaCnng63460D                                          136   7e-34   
gb|KJB48084.1|  hypothetical protein B456_008G052800                    135   7e-34   
gb|KJB48083.1|  hypothetical protein B456_008G052800                    135   7e-34   
gb|KCW86333.1|  hypothetical protein EUGRSUZ_B03025                     134   8e-34   
ref|XP_003561175.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      135   9e-34   
ref|XP_006282309.1|  hypothetical protein CARUB_v10028599mg             135   9e-34   
ref|XP_010681571.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1            135   1e-33   
ref|XP_006429209.1|  hypothetical protein CICLE_v10013496mg             135   1e-33   
ref|XP_008445656.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1            135   1e-33   
ref|XP_006481390.1|  PREDICTED: probable peptide/nitrate transpor...    135   1e-33   
ref|XP_010483980.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11           135   1e-33   
ref|XP_010459209.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      135   1e-33   
ref|XP_002280138.2|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       134   1e-33   
gb|KDO57946.1|  hypothetical protein CISIN_1g045410mg                   134   1e-33   
emb|CDY45754.1|  BnaC02g42280D                                          135   1e-33   
ref|XP_010444119.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      135   1e-33   
ref|XP_008239649.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.8-like       134   2e-33   
ref|XP_006302031.1|  hypothetical protein CARUB_v10020013mg             134   2e-33   
ref|XP_006573238.1|  PREDICTED: probable nitrite transporter At1g...    134   2e-33   
ref|NP_001130360.1|  uncharacterized protein LOC100191455               134   2e-33   
ref|XP_007226671.1|  hypothetical protein PRUPE_ppa021364mg             134   3e-33   
gb|KFK44035.1|  hypothetical protein AALP_AA1G207200                    134   3e-33   
ref|XP_007210703.1|  hypothetical protein PRUPE_ppa024635mg             134   3e-33   
ref|XP_009788955.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1-like...    133   3e-33   
emb|CDX83027.1|  BnaA01g20270D                                          134   3e-33   
ref|XP_010028698.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      133   5e-33   
ref|XP_009150212.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.10-like      133   6e-33   
gb|EMT03104.1|  Putative peptide transporter                            133   6e-33   
emb|CDY38595.1|  BnaC06g30180D                                          132   6e-33   
ref|XP_007037204.1|  Major facilitator superfamily protein, putative    134   6e-33   
ref|XP_004238938.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1            132   7e-33   
emb|CDY52480.1|  BnaC07g49410D                                          132   7e-33   
ref|XP_006344125.1|  PREDICTED: probable nitrite transporter At1g...    132   7e-33   
ref|XP_007046254.1|  Major facilitator superfamily protein              132   8e-33   
ref|XP_002443661.1|  hypothetical protein SORBIDRAFT_08g023060          132   8e-33   
emb|CBI19780.3|  unnamed protein product                                135   8e-33   
ref|XP_010551275.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1            132   9e-33   
gb|EMT01658.1|  hypothetical protein F775_52171                         134   9e-33   
gb|ADE76434.1|  unknown                                                 132   1e-32   
emb|CAE02899.1|  OSJNBa0015K02.16                                       132   1e-32   
gb|KFK41277.1|  hypothetical protein AALP_AA2G109200                    132   1e-32   
ref|XP_011048871.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like       132   1e-32   
ref|XP_002511510.1|  nitrate transporter, putative                      132   1e-32   
ref|XP_009356666.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1-like       132   1e-32   
gb|EMT03778.1|  Peptide transporter PTR1                                131   1e-32   
gb|KGN45953.1|  hypothetical protein Csa_6G037500                       132   1e-32   
ref|XP_004150669.1|  PREDICTED: probable nitrite transporter At1g...    132   1e-32   
ref|XP_003614522.1|  Peptide transporter PTR                            131   2e-32   
ref|XP_004164473.1|  PREDICTED: probable nitrite transporter At1g...    131   2e-32   
gb|EYU35890.1|  hypothetical protein MIMGU_mgv1a018347mg                128   2e-32   
ref|XP_002306899.1|  hypothetical protein POPTR_0005s25490g             132   2e-32   
ref|XP_007017666.1|  Peptide transporter 5                              132   2e-32   
emb|CDY36913.1|  BnaA06g16980D                                          132   2e-32   
ref|XP_009595746.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.7-like       131   2e-32   
ref|XP_009757138.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1            131   2e-32   
ref|XP_009151248.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.8-like       131   2e-32   
gb|KEH36217.1|  peptide transporter                                     131   2e-32   
ref|XP_009149857.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...    132   2e-32   
ref|XP_010028687.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      131   2e-32   
ref|NP_001054146.1|  Os04g0660900                                       131   2e-32   
ref|XP_006416555.1|  hypothetical protein EUTSA_v10007154mg             131   2e-32   
ref|XP_006437676.1|  hypothetical protein CICLE_v10031055mg             131   2e-32   
emb|CDP00609.1|  unnamed protein product                                130   3e-32   
ref|XP_004514500.1|  PREDICTED: probable nitrite transporter At1g...    130   3e-32   
ref|XP_009795522.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.6-like       130   3e-32   
ref|XP_008221413.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like       130   3e-32   
ref|XP_004500964.1|  PREDICTED: peptide transporter PTR1-like iso...    130   3e-32   
ref|XP_009134928.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1-like       130   3e-32   
ref|XP_002510466.1|  peptide transporter, putative                      130   4e-32   
ref|XP_004963333.1|  PREDICTED: probable peptide/nitrate transpor...    130   4e-32   
ref|XP_004500965.1|  PREDICTED: peptide transporter PTR1-like iso...    130   4e-32   
emb|CDY51783.1|  BnaC03g75950D                                          130   4e-32   
ref|XP_006301787.1|  hypothetical protein CARUB_v10022251mg             130   4e-32   
ref|XP_009401275.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1            130   4e-32   
ref|XP_009105401.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1            130   5e-32   
ref|XP_003578426.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.9            130   5e-32   
gb|KHG05907.1|  hypothetical protein F383_32480                         130   5e-32   
emb|CDY07377.1|  BnaA07g24560D                                          130   5e-32   
ref|XP_009610945.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1            130   5e-32   
ref|XP_009127655.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1-like       130   7e-32   
ref|XP_010415480.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1-like       130   8e-32   
ref|XP_010470810.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1            130   8e-32   
ref|XP_010511860.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1-like       130   8e-32   
ref|XP_002981698.1|  hypothetical protein SELMODRAFT_444972             129   1e-31   
ref|XP_002967819.1|  hypothetical protein SELMODRAFT_88337              129   1e-31   
ref|XP_010045567.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.8            129   1e-31   
ref|XP_002442576.1|  hypothetical protein SORBIDRAFT_08g022290          129   1e-31   
ref|XP_010112579.1|  putative peptide/nitrate transporter               128   1e-31   
emb|CDY04237.1|  BnaC06g25780D                                          129   1e-31   
gb|KCW83499.1|  hypothetical protein EUGRSUZ_B00403                     129   1e-31   
ref|XP_009105035.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1-like       129   1e-31   
ref|XP_010647749.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1            129   2e-31   
ref|XP_010477090.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.9-like       129   2e-31   
ref|XP_008388155.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       129   2e-31   
gb|EAY95911.1|  hypothetical protein OsI_17775                          130   2e-31   
gb|KJB59778.1|  hypothetical protein B456_009G271300                    127   2e-31   
emb|CDY09846.1|  BnaC09g43150D                                          127   3e-31   
ref|XP_006652957.1|  PREDICTED: nitrate transporter 1.7-like            128   3e-31   
emb|CBI27031.3|  unnamed protein product                                129   3e-31   
ref|XP_010910247.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1-like       128   4e-31   
ref|XP_007046252.1|  Major facilitator superfamily protein isoform 2    127   4e-31   
ref|XP_010548836.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      127   5e-31   
gb|AEW07576.1|  hypothetical protein 0_5610_01                          121   5e-31   
gb|AFG46847.1|  hypothetical protein 0_5610_01                          121   5e-31   
ref|XP_010262765.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       127   5e-31   
ref|XP_010558949.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.8            127   5e-31   
emb|CDY05592.1|  BnaC02g39450D                                          127   6e-31   
gb|KJB59777.1|  hypothetical protein B456_009G271300                    127   6e-31   
emb|CDY52504.1|  BnaAnng11510D                                          127   6e-31   
ref|XP_007046251.1|  Major facilitator superfamily protein isoform 1    127   6e-31   
emb|CDP14875.1|  unnamed protein product                                127   6e-31   
ref|NP_001147815.1|  ligA                                               127   7e-31   
ref|NP_001067378.1|  Os12g0638300                                       127   7e-31   
ref|XP_010498295.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.9-like       127   8e-31   
gb|EAY84046.1|  hypothetical protein OsI_39275                          127   8e-31   
dbj|BAJ53174.1|  JHL18I08.8                                             127   8e-31   
ref|XP_008437665.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.8-like       127   9e-31   
gb|EAZ21354.1|  hypothetical protein OsJ_37011                          127   9e-31   
ref|XP_002302005.2|  hypothetical protein POPTR_0002s03070g             126   9e-31   
gb|EPS57551.1|  hypothetical protein M569_17266                         123   1e-30   
ref|XP_011077006.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1 isof...    125   1e-30   
ref|XP_009129838.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.8-like       126   1e-30   
ref|XP_010269378.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4-like...    126   1e-30   
ref|XP_009336814.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       126   2e-30   
ref|XP_010269377.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4-like...    126   2e-30   
ref|XP_002969637.1|  hypothetical protein SELMODRAFT_91845              126   2e-30   
ref|XP_011076999.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1 isof...    125   2e-30   
ref|XP_010066730.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1            125   2e-30   
gb|ACN40168.1|  unknown                                                 126   2e-30   
ref|XP_011070816.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1-like       125   2e-30   



>ref|XP_002269340.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13 [Vitis vinifera]
 emb|CBI32029.3| unnamed protein product [Vitis vinifera]
Length=619

 Score =   210 bits (535),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 99/169 (59%), Positives = 130/169 (77%), Gaps = 1/169 (1%)
 Frame = +2

Query  20   SGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQE  199
             G   G YY+PPL  GS   KLP TK + +LNKAAV+ +E +   +G   N+WRLCSIQ+
Sbjct  300  EGEKEGAYYDPPLTKGSIVAKLPFTKRFRWLNKAAVI-LEGEKDANGCPSNQWRLCSIQQ  358

Query  200  TEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLFVVSLLT  379
             EEVKC++++IP+W +GI C  AI QQGTFT++QAL+M+RHLG +FQIPAGSL V+S+LT
Sbjct  359  VEEVKCLLKIIPVWASGIICFTAISQQGTFTVSQALKMDRHLGPKFQIPAGSLIVISMLT  418

Query  380  IAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            + + +PFYDR+LVP  +K T+  GGIT+LQRMGIG+ FSIL+M VSG V
Sbjct  419  VGIWVPFYDRILVPALQKITKHEGGITLLQRMGIGIVFSILSMVVSGLV  467



>ref|XP_006357252.1| PREDICTED: nitrate transporter 1.7-like [Solanum tuberosum]
Length=606

 Score =   210 bits (534),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 100/173 (58%), Positives = 132/173 (76%), Gaps = 3/173 (2%)
 Frame = +2

Query  2    RLPANDSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWR  181
            RLP  D   + GV+Y+P LP GS   KL LT  Y +LNKAA+V +E+++  DG C N+WR
Sbjct  281  RLP--DERESNGVFYDPLLPEGSIVKKLHLTHKYRWLNKAAIV-MEDEVNTDGTCTNKWR  337

Query  182  LCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLF  361
            LCSIQ+ EE+KCI+++IPIW AGI C  A+ QQGTFTI+QAL+M+RHLG  FQIP GSL 
Sbjct  338  LCSIQQIEELKCILKIIPIWSAGIICFTAMAQQGTFTISQALKMDRHLGPNFQIPPGSLS  397

Query  362  VVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSG  520
            V+S++T+ + LP YDR ++P   K TR+ GGIT+LQR+GIG+ FSIL+M V+G
Sbjct  398  VISMITVGIWLPVYDRFIMPSVTKITRIEGGITLLQRIGIGMVFSILSMVVAG  450



>ref|XP_009610610.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13 isoform X1 [Nicotiana 
tomentosiformis]
Length=612

 Score =   207 bits (526),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 97/173 (56%), Positives = 132/173 (76%), Gaps = 1/173 (1%)
 Frame = +2

Query  2    RLPANDSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWR  181
            +L   D   + GV+Y+PPLP GS   KLPLT  +  LNKAA+V +E ++  +G   N WR
Sbjct  285  KLKLFDERQSNGVFYDPPLPKGSIVKKLPLTNKFRSLNKAAIV-MEGEINTNGTPTNTWR  343

Query  182  LCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLF  361
            LCSIQ+ EEVKC++++IP+W  GI C  A+ QQGTFT++QAL+M+RHLG +FQIPAG+L 
Sbjct  344  LCSIQQIEEVKCLLKIIPVWATGIICFTAMAQQGTFTMSQALKMDRHLGPKFQIPAGTLS  403

Query  362  VVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSG  520
            V+S++TI + LP YDR++VP  RK TR+ GGIT+LQR+GIG+ FSIL+M V+G
Sbjct  404  VISMITIGIWLPIYDRLIVPSIRKITRIEGGITLLQRIGIGMVFSILSMVVAG  456



>ref|XP_009610611.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13 isoform X2 [Nicotiana 
tomentosiformis]
Length=612

 Score =   207 bits (526),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 97/173 (56%), Positives = 132/173 (76%), Gaps = 1/173 (1%)
 Frame = +2

Query  2    RLPANDSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWR  181
            +L   D   + GV+Y+PPLP GS   KLPLT  +  LNKAA+V +E ++  +G   N WR
Sbjct  285  KLKLFDERQSNGVFYDPPLPKGSIVKKLPLTNKFRSLNKAAIV-MEGEINTNGTPTNTWR  343

Query  182  LCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLF  361
            LCSIQ+ EEVKC++++IP+W  GI C  A+ QQGTFT++QAL+M+RHLG +FQIPAG+L 
Sbjct  344  LCSIQQIEEVKCLLKIIPVWATGIICFTAMAQQGTFTMSQALKMDRHLGPKFQIPAGTLS  403

Query  362  VVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSG  520
            V+S++TI + LP YDR++VP  RK TR+ GGIT+LQR+GIG+ FSIL+M V+G
Sbjct  404  VISMITIGIWLPIYDRLIVPSIRKITRIEGGITLLQRIGIGMVFSILSMVVAG  456



>ref|XP_004238760.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13 [Solanum lycopersicum]
Length=607

 Score =   206 bits (524),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 96/173 (55%), Positives = 134/173 (77%), Gaps = 2/173 (1%)
 Frame = +2

Query  2    RLPANDSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWR  181
            +LP ++  +   V+Y+P LP GS   KLPLT  + +LNKAA+V +++++  DG C N+WR
Sbjct  280  KLP-DERESNVTVFYDPLLPQGSIVNKLPLTHKHRWLNKAAIV-MKDEVNRDGDCTNKWR  337

Query  182  LCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLF  361
            LCSIQ+ EEVKC++++IPIW AG+ C  A+ QQGTFTI+QAL+M+RHLG  FQIP GSL 
Sbjct  338  LCSIQQIEEVKCVLKIIPIWSAGVICFTAMAQQGTFTISQALKMDRHLGPNFQIPPGSLS  397

Query  362  VVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSG  520
            V+S++T+ + LP YDR++VP   K TR+ GGIT+L R+GIG+AFSIL+M V+G
Sbjct  398  VISMITVGIWLPVYDRLIVPSLTKVTRIEGGITLLHRIGIGIAFSILSMVVAG  450



>ref|XP_009775473.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13-like [Nicotiana sylvestris]
Length=610

 Score =   206 bits (523),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 98/173 (57%), Positives = 131/173 (76%), Gaps = 1/173 (1%)
 Frame = +2

Query  2    RLPANDSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWR  181
            +L   D   + GV+ +PPLP GS   KLPLT  Y  LNKAA+V +E ++  DG   N WR
Sbjct  283  KLKLPDERESNGVFCDPPLPKGSIVKKLPLTNKYRSLNKAAMV-MEGEINTDGTPTNTWR  341

Query  182  LCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLF  361
            LCSIQ+ EEVKC++++IP+W  GI C  A+ QQGTFT++QAL+M+RHLG +FQIPAG+L 
Sbjct  342  LCSIQQIEEVKCLLKIIPVWATGIICFTAMAQQGTFTVSQALKMDRHLGPKFQIPAGTLS  401

Query  362  VVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSG  520
            V+S++TI + LP YDR++VP  RK TR+ GGIT+LQR+GIG+ FSIL+M V+G
Sbjct  402  VISMITIGIWLPIYDRLIVPSIRKITRIEGGITLLQRIGIGMIFSILSMVVAG  454



>ref|XP_011006584.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13 [Populus euphratica]
Length=605

 Score =   203 bits (517),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/177 (54%), Positives = 131/177 (74%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    RLPAN-DSGAAAGVYYNPPLPPG-SAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNR  175
            +LP N D     G++Y+PP+    +  +KLPLT    FLNKAA++  E DL  DG C  +
Sbjct  287  KLPDNCDGEQVDGIFYDPPIKDQLTILSKLPLTNQIRFLNKAAMIEKETDLKPDGSCAKQ  346

Query  176  WRLCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGS  355
            WRLCS+Q+ EEVKC++++ PIW + I    ++IQQGTFT++QA++M+RHLG +FQIPA S
Sbjct  347  WRLCSVQQVEEVKCLIKIGPIWASSIVSLTSMIQQGTFTVSQAMKMDRHLGEKFQIPASS  406

Query  356  LFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            + VVSL+TI + LPFYDR+LVP  RK T+  GGITILQR+GIG+ FS+L+M V+G V
Sbjct  407  IIVVSLITIGIWLPFYDRILVPAIRKVTKREGGITILQRIGIGIVFSVLSMVVAGLV  463



>ref|XP_006378165.1| proton-dependent oligopeptide transport family protein [Populus 
trichocarpa]
 gb|ERP55962.1| proton-dependent oligopeptide transport family protein [Populus 
trichocarpa]
Length=599

 Score =   202 bits (515),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 97/177 (55%), Positives = 130/177 (73%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    RLPAN-DSGAAAGVYYNPPLPPG-SAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNR  175
            +LP N D     G++Y+PP+    +  +KLPLT    FLNKAA++  E DL  DG C  +
Sbjct  287  KLPDNCDGEQVDGIFYDPPIKDQLTILSKLPLTNQIRFLNKAAMIEKETDLKPDGSCAKQ  346

Query  176  WRLCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGS  355
            WRLCS+Q+ EEVKC++++ PIW + I    +++QQGTFT++QAL+M+RHLG +FQIPA S
Sbjct  347  WRLCSVQQVEEVKCLIKIGPIWASSIVSLTSMVQQGTFTVSQALKMDRHLGEKFQIPASS  406

Query  356  LFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            + VVSL+TI + LPFYDRVLVP  RK T+  GGITILQR+GIG  FS+L+M V+G V
Sbjct  407  IIVVSLITIGIWLPFYDRVLVPAIRKVTKHEGGITILQRIGIGNVFSVLSMVVAGLV  463



>ref|XP_011086410.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13-like [Sesamum indicum]
Length=614

 Score =   202 bits (515),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 96/170 (56%), Positives = 126/170 (74%), Gaps = 1/170 (1%)
 Frame = +2

Query  17   DSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQ  196
            D     GVYY+PP   G+   KL LT  + FLNKAA++ +E ++  DG   N WRLCSIQ
Sbjct  292  DGDDVEGVYYDPPRLKGTIVKKLALTNQFRFLNKAALI-MEGEVLADGSKSNPWRLCSIQ  350

Query  197  ETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLFVVSLL  376
            + EE KC+ R++P+W +GI C  A+ QQGTFT++QA +M+RHLGR F+IP GSL V+S++
Sbjct  351  QVEETKCLFRIMPVWASGIICFTAMSQQGTFTVSQASKMDRHLGRNFKIPPGSLSVISMI  410

Query  377  TIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            TI + LPFYDRVLVP  RK TR+ GGI++LQRMGIG+ FSIL+M V+G V
Sbjct  411  TIGIWLPFYDRVLVPSLRKVTRLEGGISLLQRMGIGIVFSILSMIVAGLV  460



>ref|XP_003551991.1| PREDICTED: nitrate transporter 1.7-like [Glycine max]
 gb|KHN04835.1| Nitrate transporter 1.7 [Glycine soja]
Length=622

 Score =   201 bits (512),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 97/164 (59%), Positives = 131/164 (80%), Gaps = 1/164 (1%)
 Frame = +2

Query  35   GVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVK  214
            GV+Y+PPL   +  +KLPLTK++  LNKAA++ +E +L  DG   N+WRL SIQ+ EEVK
Sbjct  310  GVFYDPPLIGITVVSKLPLTKEFRALNKAALI-MEGELNPDGTRVNQWRLVSIQQVEEVK  368

Query  215  CIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLFVVSLLTIAVLL  394
            C+ R+IPIW AGI   +++ QQGTFT++QA++MNRHLG +FQIPAGS+ V+SL+TIA+ L
Sbjct  369  CLARIIPIWAAGILSLISMTQQGTFTVSQAMKMNRHLGAKFQIPAGSVSVISLITIALWL  428

Query  395  PFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            PFYDR+LVP  RK T+  GGIT+L R+GIG+ FSIL+M V+G+V
Sbjct  429  PFYDRILVPKLRKMTKHEGGITLLLRIGIGMVFSILSMVVAGYV  472



>emb|CDY53067.1| BnaCnng24110D [Brassica napus]
Length=594

 Score =   199 bits (507),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 99/175 (57%), Positives = 129/175 (74%), Gaps = 4/175 (2%)
 Frame = +2

Query  2    RLPANDSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWR  181
            +LPA D G     YY+PP+   S  +KL  +  Y FL+KAAV+ IE DLT +G   N+WR
Sbjct  267  KLPAEDDGTVT--YYDPPVKD-SVLSKLHHSNQYRFLDKAAVI-IEGDLTSEGVPANKWR  322

Query  182  LCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLF  361
            LCSIQE EEVKC++R++P+W AGI    A+ QQGTFT++QAL+M+RH+G  F+IPAGSL 
Sbjct  323  LCSIQEVEEVKCLIRIVPVWSAGIISLAAMTQQGTFTVSQALKMDRHIGPNFEIPAGSLS  382

Query  362  VVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            V+SLLTI V LP YDRVLVP+ R+ T    GIT+LQR+G G+ F+IL+M V+G V
Sbjct  383  VISLLTIGVFLPLYDRVLVPFFRRITSHKSGITLLQRIGTGIVFAILSMIVAGLV  437



>emb|CDP00275.1| unnamed protein product [Coffea canephora]
Length=626

 Score =   199 bits (506),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 99/176 (56%), Positives = 133/176 (76%), Gaps = 3/176 (2%)
 Frame = +2

Query  2    RLPAND-SGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRW  178
            +LP N       GVYY+PPL   + A KLPLT  + FLNKAA++  E DL  DG   ++W
Sbjct  297  KLPDNGREEINDGVYYDPPLSQ-TIAKKLPLTNQFRFLNKAAMIT-EGDLKADGSRADKW  354

Query  179  RLCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSL  358
             L SIQ+ EE+KCI+R+IP+W +GI C LA+ QQGTFT++QAL+M+R LG +FQIP GSL
Sbjct  355  NLSSIQQIEELKCILRIIPVWASGIICLLAMAQQGTFTLSQALKMDRRLGPKFQIPPGSL  414

Query  359  FVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
             V+S++TI + LP YDR++VP  R+ T+V GGIT+LQR+G+G+ FSIL+MAV+GFV
Sbjct  415  AVISMVTIGIWLPVYDRIVVPRLRRITKVEGGITLLQRLGVGMVFSILSMAVAGFV  470



>gb|KDO39248.1| hypothetical protein CISIN_1g007862mg [Citrus sinensis]
Length=478

 Score =   196 bits (498),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 126/164 (77%), Gaps = 1/164 (1%)
 Frame = +2

Query  35   GVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVK  214
            G++Y+PP P     +KLPLT  + FLNKAA++V   +L  DG   N+WRLCSIQ+ EEVK
Sbjct  169  GIFYDPP-PKLFVLSKLPLTHQFRFLNKAAMIVDNNELKPDGTPVNQWRLCSIQQVEEVK  227

Query  215  CIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLFVVSLLTIAVLL  394
            C++++IPIW AGI    +I QQGTFT++QA++MNRHLG +FQIP G++ V+S++TI + L
Sbjct  228  CLIKIIPIWAAGIISLTSISQQGTFTVSQAMKMNRHLGPKFQIPPGTVGVISMITIGLWL  287

Query  395  PFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            PFYD VLVP  RK T+  GGIT+LQR+GIG+ FSIL+M V+G V
Sbjct  288  PFYDTVLVPALRKITKHEGGITLLQRIGIGMIFSILSMIVAGLV  331



>ref|XP_006438562.1| hypothetical protein CICLE_v10030982mg [Citrus clementina]
 gb|ESR51802.1| hypothetical protein CICLE_v10030982mg [Citrus clementina]
Length=481

 Score =   196 bits (498),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 126/164 (77%), Gaps = 1/164 (1%)
 Frame = +2

Query  35   GVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVK  214
            G++Y+PP P     +KLPLT  + FLNKAA++V   +L  DG   N+WRLCSIQ+ EEVK
Sbjct  169  GIFYDPP-PKLFVLSKLPLTHQFRFLNKAAMIVDNNELKPDGTPVNQWRLCSIQQVEEVK  227

Query  215  CIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLFVVSLLTIAVLL  394
            C++++IPIW AGI    +I QQGTFT++QA++MNRHLG +FQIP G++ V+S++TI + L
Sbjct  228  CLIKIIPIWAAGIISLTSISQQGTFTVSQAMKMNRHLGPKFQIPPGTVGVISMITIGLWL  287

Query  395  PFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            PFYD VLVP  RK T+  GGIT+LQR+GIG+ FSIL+M V+G V
Sbjct  288  PFYDTVLVPALRKITKHEGGITLLQRIGIGMIFSILSMIVAGLV  331



>ref|XP_009127767.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13 [Brassica rapa]
Length=591

 Score =   197 bits (502),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 98/175 (56%), Positives = 129/175 (74%), Gaps = 4/175 (2%)
 Frame = +2

Query  2    RLPANDSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWR  181
            +LPA D G     YY+PP+   S  +KL  +  Y FL+KAAV+ IE DL+ +G   N+WR
Sbjct  264  KLPAEDDGTVT--YYDPPVKD-SVLSKLHHSNQYRFLDKAAVI-IEGDLSSEGVPANKWR  319

Query  182  LCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLF  361
            LCSIQE EEVKC++R++P+W AGI    A+ QQGTFT++QAL+M+RH+G  F+IPAGSL 
Sbjct  320  LCSIQEVEEVKCLIRIVPVWSAGIISLAAMTQQGTFTVSQALKMDRHIGPNFEIPAGSLS  379

Query  362  VVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            V+SLLTI V LP YDRVLVP+ R+ T    GIT+LQR+G G+ F+IL+M V+G V
Sbjct  380  VISLLTIGVFLPLYDRVLVPFFRRITGHKSGITLLQRIGTGIVFAILSMIVAGLV  434



>emb|CDY56086.1| BnaA02g35730D [Brassica napus]
Length=591

 Score =   197 bits (502),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 98/175 (56%), Positives = 129/175 (74%), Gaps = 4/175 (2%)
 Frame = +2

Query  2    RLPANDSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWR  181
            +LPA D G     YY+PP+   S  +KL  +  Y FL+KAAV+ IE DL+ +G   N+WR
Sbjct  264  KLPAEDDGTVT--YYDPPVKD-SVLSKLHHSNQYRFLDKAAVI-IEGDLSSEGVPANKWR  319

Query  182  LCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLF  361
            LCSIQE EEVKC++R++P+W AGI    A+ QQGTFT++QAL+M+RH+G  F+IPAGSL 
Sbjct  320  LCSIQEVEEVKCLIRIVPVWSAGIISLAAMTQQGTFTVSQALKMDRHIGPNFEIPAGSLS  379

Query  362  VVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            V+SLLTI V LP YDRVLVP+ R+ T    GIT+LQR+G G+ F+IL+M V+G V
Sbjct  380  VISLLTIGVFLPLYDRVLVPFFRRITGHKSGITLLQRIGTGIVFAILSMIVAGLV  434



>dbj|BAJ33974.1| unnamed protein product [Thellungiella halophila]
Length=622

 Score =   198 bits (503),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 129/175 (74%), Gaps = 4/175 (2%)
 Frame = +2

Query  2    RLPANDSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWR  181
            +LPA D G     YYNPP+   S  +KL  +  + FL+KAAV+V E DLT +G   N+WR
Sbjct  295  KLPAEDDGTVT--YYNPPVK-DSVLSKLHHSNQFRFLDKAAVIV-EGDLTSEGVPANKWR  350

Query  182  LCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLF  361
            LCS+QE EEVKC++R++P+W AGI    A+ QQGTFT++QAL+M+RH+G  F++PAGSL 
Sbjct  351  LCSVQEVEEVKCLIRIVPVWSAGIISQAAMSQQGTFTVSQALKMDRHMGPNFEVPAGSLS  410

Query  362  VVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            V+SLLTI V LP YDRVLVP+ R+ T    GIT+LQR+G G+ F+IL+M V+G V
Sbjct  411  VISLLTIGVFLPLYDRVLVPFLRRITGHKSGITLLQRIGTGIVFAILSMIVAGLV  465



>ref|XP_002520155.1| nitrate transporter, putative [Ricinus communis]
 gb|EEF42210.1| nitrate transporter, putative [Ricinus communis]
Length=621

 Score =   197 bits (502),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 130/176 (74%), Gaps = 3/176 (2%)
 Frame = +2

Query  2    RLPANDSGAAA-GVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRW  178
            RL   D G    G++Y+P +   +  +KLPLT  + FLNKAA++  + D+  DG C N W
Sbjct  297  RLKLPDHGEVVDGIFYDPTVKE-AVLSKLPLTNQFRFLNKAAMIE-KNDINPDGSCANEW  354

Query  179  RLCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSL  358
            RLCSIQ+ EEVKC+ ++ PIW +GI    AI+QQGTFT++QA++M+RHLG +FQIPAGS+
Sbjct  355  RLCSIQQIEEVKCLFKIGPIWASGIVSFTAILQQGTFTVSQAMKMDRHLGHKFQIPAGSI  414

Query  359  FVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
             V S++TIA+ LPFYDR+ VP  RK T+  GGIT+LQR+GIG+ FS+L+M V+G V
Sbjct  415  SVFSMITIAIWLPFYDRIAVPALRKITKHEGGITLLQRIGIGIVFSVLSMIVAGLV  470



>gb|KDO39247.1| hypothetical protein CISIN_1g007862mg [Citrus sinensis]
Length=575

 Score =   196 bits (499),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 126/164 (77%), Gaps = 1/164 (1%)
 Frame = +2

Query  35   GVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVK  214
            G++Y+PP P     +KLPLT  + FLNKAA++V   +L  DG   N+WRLCSIQ+ EEVK
Sbjct  266  GIFYDPP-PKLFVLSKLPLTHQFRFLNKAAMIVDNNELKPDGTPVNQWRLCSIQQVEEVK  324

Query  215  CIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLFVVSLLTIAVLL  394
            C++++IPIW AGI    +I QQGTFT++QA++MNRHLG +FQIP G++ V+S++TI + L
Sbjct  325  CLIKIIPIWAAGIISLTSISQQGTFTVSQAMKMNRHLGPKFQIPPGTVGVISMITIGLWL  384

Query  395  PFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            PFYD VLVP  RK T+  GGIT+LQR+GIG+ FSIL+M V+G V
Sbjct  385  PFYDTVLVPALRKITKHEGGITLLQRIGIGMIFSILSMIVAGLV  428



>emb|CDY11647.1| BnaC06g30920D [Brassica napus]
Length=619

 Score =   197 bits (501),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 98/175 (56%), Positives = 129/175 (74%), Gaps = 4/175 (2%)
 Frame = +2

Query  2    RLPANDSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWR  181
            +LP  D G     YY+PP+   S  +KL  +  + FL+KAAV+ IE DLT +G   N+WR
Sbjct  295  KLPEEDDGTVT--YYDPPVKE-SVLSKLHHSNQFRFLDKAAVI-IEGDLTPEGVPANKWR  350

Query  182  LCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLF  361
            LCSIQE EEVKC++R++P+W AGI    A+ QQGTFT++QAL+M+RH+GR F+IPAGSL 
Sbjct  351  LCSIQEVEEVKCLIRIVPVWSAGIISLAAMSQQGTFTVSQALKMDRHMGRNFEIPAGSLS  410

Query  362  VVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            V+SLLTI V LP YDRVLVP+ R+ T    GIT+LQR+G G+ F+IL+M V+G V
Sbjct  411  VISLLTIGVFLPLYDRVLVPFLRRITGHKSGITLLQRIGTGIVFAILSMIVAGLV  465



>ref|XP_006483256.1| PREDICTED: nitrate transporter 1.7-like isoform X2 [Citrus sinensis]
Length=578

 Score =   196 bits (499),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 126/164 (77%), Gaps = 1/164 (1%)
 Frame = +2

Query  35   GVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVK  214
            G++Y+PP P     +KLPLT  + FLNKAA++V   +L  DG   N+WRLCSIQ+ EEVK
Sbjct  266  GIFYDPP-PKLFVLSKLPLTHQFRFLNKAAMIVDNNELKPDGTPVNQWRLCSIQQVEEVK  324

Query  215  CIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLFVVSLLTIAVLL  394
            C++++IPIW AGI    +I QQGTFT++QA++MNRHLG +FQIP G++ V+S++TI + L
Sbjct  325  CLIKIIPIWAAGIISLTSISQQGTFTVSQAMKMNRHLGPKFQIPPGTVGVISMITIGLWL  384

Query  395  PFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            PFYD VLVP  RK T+  GGIT+LQR+GIG+ FSIL+M V+G V
Sbjct  385  PFYDTVLVPALRKITKHEGGITLLQRIGIGMIFSILSMIVAGLV  428



>gb|KDO39246.1| hypothetical protein CISIN_1g007862mg [Citrus sinensis]
Length=587

 Score =   196 bits (499),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 126/164 (77%), Gaps = 1/164 (1%)
 Frame = +2

Query  35   GVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVK  214
            G++Y+PP P     +KLPLT  + FLNKAA++V   +L  DG   N+WRLCSIQ+ EEVK
Sbjct  278  GIFYDPP-PKLFVLSKLPLTHQFRFLNKAAMIVDNNELKPDGTPVNQWRLCSIQQVEEVK  336

Query  215  CIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLFVVSLLTIAVLL  394
            C++++IPIW AGI    +I QQGTFT++QA++MNRHLG +FQIP G++ V+S++TI + L
Sbjct  337  CLIKIIPIWAAGIISLTSISQQGTFTVSQAMKMNRHLGPKFQIPPGTVGVISMITIGLWL  396

Query  395  PFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            PFYD VLVP  RK T+  GGIT+LQR+GIG+ FSIL+M V+G V
Sbjct  397  PFYDTVLVPALRKITKHEGGITLLQRIGIGMIFSILSMIVAGLV  440



>ref|XP_006390953.1| hypothetical protein EUTSA_v10018285mg [Eutrema salsugineum]
 gb|ESQ28239.1| hypothetical protein EUTSA_v10018285mg [Eutrema salsugineum]
Length=622

 Score =   197 bits (501),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 129/175 (74%), Gaps = 4/175 (2%)
 Frame = +2

Query  2    RLPANDSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWR  181
            +LPA D G     YYNPP+   S  +KL  +  + FL+KAAV+V E DLT +G   N+WR
Sbjct  295  KLPAEDDGTVT--YYNPPVK-DSVLSKLHHSNQFRFLDKAAVIV-EGDLTSEGVPANKWR  350

Query  182  LCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLF  361
            LCS+QE EEVKC++R++P+W AGI    A+ QQGTFT++QAL+M+RH+G  F++PAGSL 
Sbjct  351  LCSVQEVEEVKCLIRIVPVWSAGIISLAAMSQQGTFTVSQALKMDRHMGPNFEVPAGSLS  410

Query  362  VVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            V+SLLTI V LP YDRVLVP+ R+ T    GIT+LQR+G G+ F+IL+M V+G V
Sbjct  411  VISLLTIGVFLPLYDRVLVPFLRRITGHKSGITLLQRIGTGIVFAILSMIVAGLV  465



>ref|XP_006483255.1| PREDICTED: nitrate transporter 1.7-like isoform X1 [Citrus sinensis]
Length=614

 Score =   196 bits (498),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 126/164 (77%), Gaps = 1/164 (1%)
 Frame = +2

Query  35   GVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVK  214
            G++Y+PP P     +KLPLT  + FLNKAA++V   +L  DG   N+WRLCSIQ+ EEVK
Sbjct  302  GIFYDPP-PKLFVLSKLPLTHQFRFLNKAAMIVDNNELKPDGTPVNQWRLCSIQQVEEVK  360

Query  215  CIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLFVVSLLTIAVLL  394
            C++++IPIW AGI    +I QQGTFT++QA++MNRHLG +FQIP G++ V+S++TI + L
Sbjct  361  CLIKIIPIWAAGIISLTSISQQGTFTVSQAMKMNRHLGPKFQIPPGTVGVISMITIGLWL  420

Query  395  PFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            PFYD VLVP  RK T+  GGIT+LQR+GIG+ FSIL+M V+G V
Sbjct  421  PFYDTVLVPALRKITKHEGGITLLQRIGIGMIFSILSMIVAGLV  464



>ref|XP_006438561.1| hypothetical protein CICLE_v10030982mg [Citrus clementina]
 gb|ESR51801.1| hypothetical protein CICLE_v10030982mg [Citrus clementina]
Length=614

 Score =   196 bits (498),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 126/164 (77%), Gaps = 1/164 (1%)
 Frame = +2

Query  35   GVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVK  214
            G++Y+PP P     +KLPLT  + FLNKAA++V   +L  DG   N+WRLCSIQ+ EEVK
Sbjct  302  GIFYDPP-PKLFVLSKLPLTHQFRFLNKAAMIVDNNELKPDGTPVNQWRLCSIQQVEEVK  360

Query  215  CIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLFVVSLLTIAVLL  394
            C++++IPIW AGI    +I QQGTFT++QA++MNRHLG +FQIP G++ V+S++TI + L
Sbjct  361  CLIKIIPIWAAGIISLTSISQQGTFTVSQAMKMNRHLGPKFQIPPGTVGVISMITIGLWL  420

Query  395  PFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            PFYD VLVP  RK T+  GGIT+LQR+GIG+ FSIL+M V+G V
Sbjct  421  PFYDTVLVPALRKITKHEGGITLLQRIGIGMIFSILSMIVAGLV  464



>gb|EYU28693.1| hypothetical protein MIMGU_mgv1a004515mg [Erythranthe guttata]
Length=523

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 122/162 (75%), Gaps = 1/162 (1%)
 Frame = +2

Query  35   GVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVK  214
            G YY+PP   G+   KLPLT  Y FL+KAA++ IE D+  DG   N WRLC+IQ+ EE K
Sbjct  209  GAYYDPPPLKGTVVKKLPLTNQYRFLDKAALI-IEGDIRQDGSNSNPWRLCAIQQIEETK  267

Query  215  CIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLFVVSLLTIAVLL  394
            C+ R+IPIW +GI C +A+ QQGTFT++QAL+M+RHL   FQIPAGSL V+S++T+ + L
Sbjct  268  CLFRIIPIWGSGIICFMAMAQQGTFTLSQALKMDRHLSPNFQIPAGSLAVISMVTVGIWL  327

Query  395  PFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSG  520
            P YDR++VP  RK T + GGI++LQRMGIG+ FS+L+M  +G
Sbjct  328  PIYDRLIVPALRKITGLEGGISLLQRMGIGIVFSVLSMVAAG  369



>ref|XP_004509940.1| PREDICTED: nitrate transporter 1.7-like [Cicer arietinum]
Length=595

 Score =   194 bits (494),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 128/175 (73%), Gaps = 3/175 (2%)
 Frame = +2

Query  2    RLPANDSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWR  181
            +LP+ D      V Y+PPL   S ++KLPLT  +  LNKAA++ +E DL  +G   N+W+
Sbjct  281  KLPSEDK--LDEVLYDPPLVGTSISSKLPLTHQFRALNKAALI-LEGDLNSEGIIVNKWK  337

Query  182  LCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLF  361
            L SIQ+ EEVKC+ R+ PIW  GI    +I QQGTFT+ QAL+M+RH+G +FQIPAGS+ 
Sbjct  338  LASIQQVEEVKCLARIFPIWATGILSLTSIAQQGTFTVLQALKMDRHIGPKFQIPAGSMS  397

Query  362  VVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            V+SL+T+A+ LPFYDR LVP  RK T   GGIT+LQR+GIG+ FSIL+M V+GFV
Sbjct  398  VISLITVALCLPFYDRFLVPTLRKITNHEGGITLLQRIGIGMVFSILSMIVAGFV  452



>gb|KJB77129.1| hypothetical protein B456_012G121800 [Gossypium raimondii]
Length=531

 Score =   193 bits (491),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 99/173 (57%), Positives = 127/173 (73%), Gaps = 5/173 (3%)
 Frame = +2

Query  2    RLPANDSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWR  181
            RLPA   G   GV+Y+PPL      +KLPLT  + FLNKAA+   + DL  DG  + +W 
Sbjct  216  RLPAE--GQEFGVFYDPPLKE-YVLSKLPLTYQFRFLNKAAITT-KNDLEDDGSPK-KWW  270

Query  182  LCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLF  361
            LCSIQ+ EEVKC++R+IPIW +GI    A+ QQGTFT++QAL+MNRHLG +FQIPAGS+ 
Sbjct  271  LCSIQDVEEVKCLIRIIPIWASGIISFTAMAQQGTFTLSQALKMNRHLGPKFQIPAGSIS  330

Query  362  VVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSG  520
            V+S+LTI + LP YDR++VP  RK T+  GGIT+LQR+GIG  FSILAM  +G
Sbjct  331  VISMLTIGIFLPVYDRIMVPSLRKITKHEGGITLLQRIGIGNFFSILAMVAAG  383



>ref|XP_010513693.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13-like [Camelina sativa]
Length=329

 Score =   188 bits (478),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 125/175 (71%), Gaps = 4/175 (2%)
 Frame = +2

Query  2    RLPANDSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWR  181
            ++P  D G     YY+P +   S  +KL  +  + FL+KAAV+ IE DLT +G   ++WR
Sbjct  135  KVPVEDDGTVT--YYDPSIK-SSVLSKLHRSNQFRFLDKAAVI-IEGDLTPEGAPSDKWR  190

Query  182  LCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLF  361
            LCS+QE EEVKC++R++P+W AGI    A+  QGTFT++QAL+M+RHLG  F+IPAGSL 
Sbjct  191  LCSVQEVEEVKCLIRIVPVWSAGIISLAAMTTQGTFTVSQALKMDRHLGPNFEIPAGSLS  250

Query  362  VVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            V+SLLTI V LPFYDRV VP+ R+ T    GIT+LQR+G G+ F+I +M V+G V
Sbjct  251  VISLLTIGVFLPFYDRVFVPFMRRITGHKSGITLLQRIGTGIVFAIFSMIVAGIV  305



>ref|XP_007153857.1| hypothetical protein PHAVU_003G070500g [Phaseolus vulgaris]
 gb|ESW25851.1| hypothetical protein PHAVU_003G070500g [Phaseolus vulgaris]
Length=589

 Score =   194 bits (492),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 98/175 (56%), Positives = 125/175 (71%), Gaps = 2/175 (1%)
 Frame = +2

Query  2    RLPANDSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWR  181
            R P  +     G +Y+PPL   +  +KLPLTK +  LNK A++ +E +L  DG   N+WR
Sbjct  267  RFPTTEE-KPEGAFYDPPLLGTTVLSKLPLTKQFRALNKGALI-MEGELNPDGSIVNQWR  324

Query  182  LCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLF  361
            L SIQ+ EEVKC+ R+IPIW AGI    ++ QQGTFT++QAL+MNRHLG  FQIPAGSL 
Sbjct  325  LVSIQQVEEVKCLARIIPIWAAGILSLTSMAQQGTFTVSQALKMNRHLGPNFQIPAGSLM  384

Query  362  VVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            V+SL+TIA+ LPFYD  LVP  RK T+  GGIT+L R+GIG+ FSIL+M V G V
Sbjct  385  VISLITIALWLPFYDSFLVPKLRKITKHEGGITLLLRIGIGMVFSILSMVVVGMV  439



>gb|KJB77128.1| hypothetical protein B456_012G121800 [Gossypium raimondii]
Length=602

 Score =   194 bits (492),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 99/173 (57%), Positives = 127/173 (73%), Gaps = 5/173 (3%)
 Frame = +2

Query  2    RLPANDSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWR  181
            RLPA   G   GV+Y+PPL      +KLPLT  + FLNKAA+   + DL  DG  + +W 
Sbjct  287  RLPAE--GQEFGVFYDPPLKE-YVLSKLPLTYQFRFLNKAAITT-KNDLEDDGSPK-KWW  341

Query  182  LCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLF  361
            LCSIQ+ EEVKC++R+IPIW +GI    A+ QQGTFT++QAL+MNRHLG +FQIPAGS+ 
Sbjct  342  LCSIQDVEEVKCLIRIIPIWASGIISFTAMAQQGTFTLSQALKMNRHLGPKFQIPAGSIS  401

Query  362  VVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSG  520
            V+S+LTI + LP YDR++VP  RK T+  GGIT+LQR+GIG  FSILAM  +G
Sbjct  402  VISMLTIGIFLPVYDRIMVPSLRKITKHEGGITLLQRIGIGNFFSILAMVAAG  454



>ref|XP_007157410.1| hypothetical protein PHAVU_002G067700g [Phaseolus vulgaris]
 gb|ESW29404.1| hypothetical protein PHAVU_002G067700g [Phaseolus vulgaris]
Length=630

 Score =   194 bits (493),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 124/164 (76%), Gaps = 1/164 (1%)
 Frame = +2

Query  35   GVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVK  214
            GV+Y+PPL      +KLPLT  +  LNKAAV+ +E +L  DG   N+W+L SIQE EEVK
Sbjct  306  GVFYDPPLVGTRLLSKLPLTNQFRALNKAAVI-MEGELNPDGSIVNKWKLVSIQEVEEVK  364

Query  215  CIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLFVVSLLTIAVLL  394
            C+ RV PIW AGI    ++ QQGTFT++QA++M+RHLG +FQIPAGSL V+S LTI + +
Sbjct  365  CLARVFPIWAAGILGLTSMAQQGTFTVSQAMKMDRHLGPKFQIPAGSLGVISFLTIGLWV  424

Query  395  PFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            PFYDR++VP  RK T++ GGIT+LQR+GIG+ FSIL+M V+  V
Sbjct  425  PFYDRIMVPAVRKVTKLEGGITLLQRIGIGMVFSILSMVVAALV  468



>emb|CDY38767.1| BnaA07g28390D [Brassica napus]
Length=622

 Score =   194 bits (492),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 128/175 (73%), Gaps = 4/175 (2%)
 Frame = +2

Query  2    RLPANDSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWR  181
            +LP  D G     YY+PP+   S  +KL  +  + FL+KAAV+ IE DLT +G   N+WR
Sbjct  295  KLPEEDDGTVT--YYDPPVKE-SVLSKLHHSNQFRFLDKAAVI-IEGDLTPEGVPANKWR  350

Query  182  LCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLF  361
            LCSIQE EEVKC++R++P+W AGI    A+ QQGTFT++QAL+M+RH+G  F+IPAGSL 
Sbjct  351  LCSIQEVEEVKCLIRIVPVWSAGIISLAAMSQQGTFTVSQALKMDRHMGPNFEIPAGSLS  410

Query  362  VVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            V+SLLTI V LP YDRVLVP+ R+ T    GIT+LQR+G G+ F+IL+M V+G V
Sbjct  411  VISLLTIGVFLPLYDRVLVPFLRRITGHKSGITLLQRIGTGIVFAILSMIVAGLV  465



>ref|XP_009105659.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13 [Brassica rapa]
Length=622

 Score =   194 bits (492),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 128/175 (73%), Gaps = 4/175 (2%)
 Frame = +2

Query  2    RLPANDSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWR  181
            +LP  D G     YY+PP+   S  +KL  +  + FL+KAAV+ IE DLT +G   N+WR
Sbjct  295  KLPEEDDGTVT--YYDPPVKE-SVLSKLHHSNQFRFLDKAAVI-IEGDLTPEGVPANKWR  350

Query  182  LCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLF  361
            LCSIQE EEVKC++R++P+W AGI    A+ QQGTFT++QAL+M+RH+G  F+IPAGSL 
Sbjct  351  LCSIQEVEEVKCLIRIVPVWSAGIISLAAMSQQGTFTVSQALKMDRHMGPNFEIPAGSLS  410

Query  362  VVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            V+SLLTI V LP YDRVLVP+ R+ T    GIT+LQR+G G+ F+IL+M V+G V
Sbjct  411  VISLLTIGVFLPLYDRVLVPFLRRITGHKSGITLLQRIGTGIVFAILSMIVAGLV  465



>gb|KHG14034.1| Nitrate transporter 1.7 -like protein [Gossypium arboreum]
Length=602

 Score =   192 bits (488),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 98/173 (57%), Positives = 127/173 (73%), Gaps = 5/173 (3%)
 Frame = +2

Query  2    RLPANDSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWR  181
            +LPA   G   GV+Y+PPL      +KLPLT  + FLNKAA+   + DL  DG  + +W 
Sbjct  287  KLPAE--GQEFGVFYDPPLKE-YVLSKLPLTYQFRFLNKAAITT-KNDLEDDGSPK-KWW  341

Query  182  LCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLF  361
            LCSIQ+ EEVKC++R+IPIW +GI    A+ QQGTFT++QAL+MNRHLG +FQIPAGS+ 
Sbjct  342  LCSIQDVEEVKCLIRIIPIWASGIISFTAMAQQGTFTLSQALKMNRHLGPKFQIPAGSMG  401

Query  362  VVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSG  520
            V+S+LTI + LP YDR++VP  RK T+  GGIT+LQR+GIG  FSILAM  +G
Sbjct  402  VISMLTIGIFLPVYDRIMVPSLRKITKHEGGITLLQRIGIGNFFSILAMVAAG  454



>ref|XP_007044382.1| Nitrate transporter 1.7, putative [Theobroma cacao]
 gb|EOY00214.1| Nitrate transporter 1.7, putative [Theobroma cacao]
Length=610

 Score =   191 bits (486),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 93/173 (54%), Positives = 131/173 (76%), Gaps = 5/173 (3%)
 Frame = +2

Query  2    RLPANDSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWR  181
            +LPA   G   GV+Y+PP+   +  +KLP+T  + FLNKAA++ +E +L  DG   N+WR
Sbjct  293  KLPAQ--GEEIGVFYDPPVKE-NVLSKLPVTSQFRFLNKAAII-MENELQPDGS-PNKWR  347

Query  182  LCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLF  361
            LCS Q+ EEVKC++RVIPIW +G+    ++ QQGTFT++QAL+M+RHLG + QIPAGS+ 
Sbjct  348  LCSTQQVEEVKCLIRVIPIWASGVISFTSMAQQGTFTLSQALKMDRHLGSKIQIPAGSIV  407

Query  362  VVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSG  520
            ++S++TI + LP YDR++VP  RK T+  GGIT+LQR+GIG+ FSILAM V+G
Sbjct  408  IISMITIGIFLPVYDRIIVPGLRKFTKHEGGITLLQRIGIGIFFSILAMIVAG  460



>gb|KFK41407.1| hypothetical protein AALP_AA2G126900 [Arabis alpina]
Length=622

 Score =   191 bits (485),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 95/175 (54%), Positives = 128/175 (73%), Gaps = 4/175 (2%)
 Frame = +2

Query  2    RLPANDSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWR  181
            +LPA D G     YY+PP+   S  +KL  +  + FL+K AV+ IE DLT +G   N+WR
Sbjct  295  KLPAEDDGTVN--YYDPPVK-ASVLSKLHHSNQFRFLDKGAVI-IEGDLTPEGVPANKWR  350

Query  182  LCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLF  361
            LCSIQE EEVKC++R++P+W AGI    A+ QQGTFT++QAL+M+RHLG +F+IPAGSL 
Sbjct  351  LCSIQEVEEVKCLIRIVPVWSAGIISLAAMAQQGTFTVSQALKMDRHLGPKFEIPAGSLS  410

Query  362  VVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            V+SLLTI V LP Y+R+ VP+ R+ T    GIT+LQR+G G+ F+IL+M V+G V
Sbjct  411  VISLLTIGVFLPVYERLFVPFMRRITGHNSGITLLQRIGTGIVFAILSMIVAGLV  465



>ref|XP_010044698.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13-like [Eucalyptus grandis]
 gb|KCW86796.1| hypothetical protein EUGRSUZ_B03404 [Eucalyptus grandis]
Length=646

 Score =   191 bits (485),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 96/169 (57%), Positives = 124/169 (73%), Gaps = 1/169 (1%)
 Frame = +2

Query  20   SGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQE  199
            S  A   YY+PP+   +  +KLPLT ++  LNKAA++ +E D+T +G   + W LCS+Q+
Sbjct  331  SEVAKVAYYDPPVKDAALLSKLPLTDEFRCLNKAAMI-LENDVTAEGGPVSLWTLCSVQQ  389

Query  200  TEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLFVVSLLT  379
             EEVKC++RV PIW AGI    A+ QQGTFTI+QAL M+RHLG RFQIP+GSL V+S LT
Sbjct  390  VEEVKCLLRVGPIWAAGIISFTAMTQQGTFTISQALTMDRHLGPRFQIPSGSLVVISFLT  449

Query  380  IAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            I + LPFYDR+LVP  RK T   GGIT+LQR+GIG  FS+L+M V+G V
Sbjct  450  IGLWLPFYDRILVPALRKVTGHEGGITLLQRIGIGTVFSVLSMVVAGLV  498



>ref|XP_009360408.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13 [Pyrus x bretschneideri]
Length=622

 Score =   190 bits (482),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 122/162 (75%), Gaps = 1/162 (1%)
 Frame = +2

Query  41   YYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCI  220
            +Y+PP+  G  A+KLPLT    FLNKAAV+ ++ DL  DG   + WRLCS+Q+ EE+KC+
Sbjct  312  FYDPPIFKGHYASKLPLTNQLRFLNKAAVI-LDNDLKPDGCPVDNWRLCSVQQVEELKCV  370

Query  221  VRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLFVVSLLTIAVLLPF  400
            ++ IPIW   I    A+ QQGTFT++QAL+M+RHLG  F++PAGS+ V+S LTI + LP 
Sbjct  371  LKTIPIWSTAIVSLTAMTQQGTFTVSQALKMDRHLGANFEVPAGSISVISFLTIGLWLPI  430

Query  401  YDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            YDR++VP  RK T++ GGIT+LQR GIG+ FS+L+MAV+G +
Sbjct  431  YDRIIVPSLRKITKLEGGITVLQRCGIGIIFSVLSMAVAGVI  472



>ref|XP_008367039.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13-like [Malus domestica]
Length=620

 Score =   190 bits (482),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 122/162 (75%), Gaps = 1/162 (1%)
 Frame = +2

Query  41   YYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCI  220
            +Y+P +  G  A+KLPLT    FLNKAAV+ ++ DL  DG   + WRLCS+Q+ EE+KC+
Sbjct  310  FYDPRIFKGHYASKLPLTNQLRFLNKAAVI-LDNDLKPDGSPVDNWRLCSVQQVEELKCV  368

Query  221  VRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLFVVSLLTIAVLLPF  400
            ++ IPIW   I    A+IQQGTFT++QAL+M+RHLG  F++PAGS+ V+S LTI + LP 
Sbjct  369  LKTIPIWSTAIVSLTAMIQQGTFTVSQALKMDRHLGANFEVPAGSISVISFLTIGLWLPI  428

Query  401  YDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            YDR++VP  RK T++ GGIT+LQR GIG+ FS+L+MAV+G +
Sbjct  429  YDRIIVPSLRKFTKLEGGITVLQRCGIGIIFSVLSMAVAGVI  470



>emb|CDY48389.1| BnaA07g24080D [Brassica napus]
Length=607

 Score =   189 bits (481),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 127/175 (73%), Gaps = 4/175 (2%)
 Frame = +2

Query  2    RLPANDSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWR  181
            +L A D G     YY+PP+   S   KL  +  + FL+KAAV+  E DLT +G   N+WR
Sbjct  283  KLSAEDDGTVT--YYDPPVKD-SVLHKLHRSNQFRFLDKAAVIK-EGDLTPEGVPANKWR  338

Query  182  LCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLF  361
            LCSIQE EEVKC++R++P+W AGI   +A+ QQGTFT+ QAL+M+RH+G +F++PAGSL 
Sbjct  339  LCSIQEVEEVKCLIRIVPVWSAGIISLMAMSQQGTFTVYQALKMDRHMGPKFEVPAGSLS  398

Query  362  VVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            V+SLLTI V LP YDR+LVP+ R+ T    GIT+LQR+G G+ F+IL+M V+G V
Sbjct  399  VISLLTIGVFLPLYDRILVPFLRRITGHKSGITLLQRIGTGIVFAILSMIVAGLV  453



>gb|KEH19853.1| peptide/nitrate transporter [Medicago truncatula]
Length=602

 Score =   189 bits (480),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 128/175 (73%), Gaps = 3/175 (2%)
 Frame = +2

Query  2    RLPANDSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWR  181
            +LP+ +   A  V+Y+PPL   + ++KL LT+ +  LNKAA++V E +L  DG   N+W+
Sbjct  282  KLPSEEDSYA--VFYDPPLNGTTVSSKLSLTQQFRALNKAALIV-EGELNSDGSIVNKWK  338

Query  182  LCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLF  361
            L SIQ+ EEVKC+ R  PIW AGI    +I QQGTFT+ QAL+M+RHLG +FQIPAGS+ 
Sbjct  339  LASIQQVEEVKCLARTFPIWAAGILSLTSIAQQGTFTVLQALKMDRHLGPKFQIPAGSMG  398

Query  362  VVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            V+SL+TIA+ LP Y++ LVP  RK T    GIT+LQR+G+G+ FSIL+M V+GFV
Sbjct  399  VISLITIALWLPLYEKYLVPTLRKMTNKKEGITLLQRIGVGMLFSILSMIVAGFV  453



>ref|XP_010470990.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13 [Camelina sativa]
Length=621

 Score =   189 bits (479),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 125/175 (71%), Gaps = 4/175 (2%)
 Frame = +2

Query  2    RLPANDSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWR  181
            ++PA D G     YYNP +   S  +KL  +  + FL+KAAV+  E DLT +G   ++WR
Sbjct  294  KVPAEDDGTVT--YYNPTIK-SSVLSKLHRSNQFRFLDKAAVIT-EGDLTPEGAPADKWR  349

Query  182  LCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLF  361
            LCS+QE EEVKC++R++P+W AGI    A+  QGTFT++QAL+M+RHLG  F+IPAGSL 
Sbjct  350  LCSVQEVEEVKCLIRIVPVWSAGIISLAAMTTQGTFTVSQALKMDRHLGPNFEIPAGSLS  409

Query  362  VVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            V+SLLTI V LPFYDRV VP+ R+ T    GIT+LQR+G G+ F+I +M V+G V
Sbjct  410  VISLLTIGVFLPFYDRVFVPFMRRITGHKSGITLLQRIGTGIVFAIFSMIVAGIV  464



>ref|XP_006302005.1| hypothetical protein CARUB_v10019982mg [Capsella rubella]
 gb|EOA34903.1| hypothetical protein CARUB_v10019982mg [Capsella rubella]
Length=619

 Score =   188 bits (478),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 126/175 (72%), Gaps = 4/175 (2%)
 Frame = +2

Query  2    RLPANDSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWR  181
            ++PA D G     YY+P +   +  +KL  +  +  L+KAAVV  E DLT +G   N+WR
Sbjct  293  KVPAEDDGTVT--YYDPAIK-STVLSKLHRSNQFRCLDKAAVVT-EGDLTPEGAPANKWR  348

Query  182  LCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLF  361
            LCS+QE EEVKC++R++P+W AGI    A+ QQGTFT++QAL+M+RHLG  F+IPAGSL 
Sbjct  349  LCSVQEVEEVKCLIRIVPVWSAGIISLAAMTQQGTFTVSQALKMDRHLGPNFEIPAGSLS  408

Query  362  VVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            V+SLLTI + LPFYDRV VP+AR+ T    GIT+LQR+G G+ F+I +M V+G V
Sbjct  409  VISLLTIGIFLPFYDRVFVPFARRVTGHKSGITLLQRIGTGIVFAIFSMIVAGIV  463



>emb|CDY23545.1| BnaC06g25140D [Brassica napus]
Length=607

 Score =   188 bits (478),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 126/175 (72%), Gaps = 4/175 (2%)
 Frame = +2

Query  2    RLPANDSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWR  181
            +L A D G     YY+PP+   S   KL  +  + FL+KAAV+  E DLT +G   N+WR
Sbjct  283  KLSAEDDGTVT--YYDPPVKD-SVLHKLHRSNQFRFLDKAAVIK-EGDLTSEGVPANKWR  338

Query  182  LCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLF  361
            LCSIQE EEVKC++R++P+W AGI   +A+ QQGTFT++QAL+M+RH+G +F+ PAGSL 
Sbjct  339  LCSIQEVEEVKCLIRIVPVWSAGIISLMAMSQQGTFTVSQALKMDRHMGPKFEAPAGSLS  398

Query  362  VVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            V+SLLTI + LP YDRVLVP+ R+ T    GIT LQR+G G+ F+IL+M V+G V
Sbjct  399  VISLLTIGIFLPIYDRVLVPFLRRITGHKSGITRLQRIGTGIVFAILSMIVAGLV  453



>ref|XP_010512052.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13 [Camelina sativa]
Length=621

 Score =   188 bits (477),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 125/175 (71%), Gaps = 4/175 (2%)
 Frame = +2

Query  2    RLPANDSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWR  181
            ++P  D G     YY+P +   S  +KL  +  + FL+KAAV+ IE DLT +G   ++WR
Sbjct  294  KVPVEDDGTVT--YYDPSIK-SSVLSKLHRSNQFRFLDKAAVI-IEGDLTPEGAPSDKWR  349

Query  182  LCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLF  361
            LCS+QE EEVKC++R++P+W AGI    A+  QGTFT++QAL+M+RHLG  F+IPAGSL 
Sbjct  350  LCSVQEVEEVKCLIRIVPVWSAGIISLAAMTTQGTFTVSQALKMDRHLGPHFEIPAGSLS  409

Query  362  VVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            V+SLLTI V LPFYDRV VP+ R+ T    GIT+LQR+G G+ F+I +M V+G V
Sbjct  410  VISLLTIGVFLPFYDRVFVPFMRRITGHKSGITLLQRIGTGIVFAIFSMIVAGIV  464



>ref|XP_007222023.1| hypothetical protein PRUPE_ppa002984mg [Prunus persica]
 gb|EMJ23222.1| hypothetical protein PRUPE_ppa002984mg [Prunus persica]
Length=615

 Score =   188 bits (477),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 91/175 (52%), Positives = 127/175 (73%), Gaps = 3/175 (2%)
 Frame = +2

Query  2    RLPANDSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWR  181
            +LP  ++G   G +Y+PP+  G    KLPLT    FL+KAAV+ ++ DL  D    N WR
Sbjct  294  KLP-EEAGMVDGKFYDPPIK-GFFVPKLPLTNQLRFLSKAAVI-LDNDLKPDSSPINNWR  350

Query  182  LCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLF  361
            LCS+Q+ EE+KC+++ IP+W + I    ++ QQGTFT++QAL+M+RHLG  F++PAGSL 
Sbjct  351  LCSVQQVEELKCVIKTIPVWASAIVSFTSMTQQGTFTVSQALKMDRHLGPHFEVPAGSLS  410

Query  362  VVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            V+SLLTI + LPFYDR+LVP  RK T+  GGIT+LQR GIG+ FS+L+M V+G +
Sbjct  411  VISLLTIGLWLPFYDRLLVPALRKFTKHEGGITVLQRCGIGIIFSVLSMLVAGLI  465



>gb|EPS62066.1| hypothetical protein M569_12727, partial [Genlisea aurea]
Length=550

 Score =   187 bits (474),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/162 (55%), Positives = 116/162 (72%), Gaps = 8/162 (5%)
 Frame = +2

Query  41   YYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCI  220
            YY+PP    S   K PLT  Y FLNKAA +  EED    G   N WRLCS+Q  EE KC+
Sbjct  262  YYDPP----SERKKFPLTNRYRFLNKAATLTEEED----GSSPNPWRLCSVQVVEETKCL  313

Query  221  VRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLFVVSLLTIAVLLPF  400
            + V+PIW +GI   +A  QQGTFT++Q  +M+RH+G  FQIPAGSL ++S+LTIAV LP 
Sbjct  314  LDVVPIWASGIIGFVATTQQGTFTLSQTQKMDRHMGPHFQIPAGSLLIISMLTIAVWLPI  373

Query  401  YDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            YD  +VP+ RKRT+++ GIT+LQRMGIGL FS+++M V+G +
Sbjct  374  YDLTIVPYLRKRTKIVSGITLLQRMGIGLVFSVISMVVAGLI  415



>gb|KHN01163.1| Nitrate transporter 1.7 [Glycine soja]
Length=560

 Score =   187 bits (474),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 123/164 (75%), Gaps = 1/164 (1%)
 Frame = +2

Query  35   GVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVK  214
            GV+Y+PPL   +  +KLPLT  +  LNKAAV+ +E +L  D    N+W+L SIQ+ EEVK
Sbjct  247  GVFYDPPLIGTNVLSKLPLTNQFRGLNKAAVI-MEGELNPDRSRANKWKLVSIQQVEEVK  305

Query  215  CIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLFVVSLLTIAVLL  394
            C+ R+ PIW AGI    ++ QQGTFT++QAL+M+RHLG +FQIPAGSL V+S +TI V +
Sbjct  306  CLARIFPIWAAGILGFTSMAQQGTFTVSQALKMDRHLGPKFQIPAGSLGVISFITIGVWV  365

Query  395  PFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            PFYDR++VP  R+ T+  GGIT+LQR+GIG+ FSIL+M V+  V
Sbjct  366  PFYDRIMVPTLRRVTKHEGGITLLQRIGIGMVFSILSMVVAALV  409



>ref|XP_004489968.1| PREDICTED: nitrate transporter 1.7-like [Cicer arietinum]
Length=610

 Score =   187 bits (475),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 93/172 (54%), Positives = 123/172 (72%), Gaps = 1/172 (1%)
 Frame = +2

Query  11   ANDSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCS  190
            +N+     GV+Y+PPL   +  +KLP T  + FL+KAA++ +E +L  DG   N+W L S
Sbjct  278  SNEKEVVDGVFYDPPLNGKAILSKLPSTNQFRFLDKAALI-MEGELNPDGSIVNQWNLVS  336

Query  191  IQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLFVVS  370
            IQ+ EEVKC+ R  PIW AGI    A+ QQGTF ++QAL+M+RHLG  FQIPAGSL V+S
Sbjct  337  IQQVEEVKCLARTFPIWAAGILGFTAMAQQGTFIVSQALKMDRHLGPNFQIPAGSLGVIS  396

Query  371  LLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            L+ I + +PFYDRV VP  RK T+  GGIT+LQR+GIG+ FSIL+M V+G V
Sbjct  397  LIIIGLWVPFYDRVCVPSLRKITKHEGGITLLQRIGIGMVFSILSMIVAGLV  448



>ref|XP_010551494.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13 [Tarenaya hassleriana]
Length=596

 Score =   187 bits (474),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 91/175 (52%), Positives = 130/175 (74%), Gaps = 5/175 (3%)
 Frame = +2

Query  2    RLPANDSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWR  181
            ++PA+D   AA  +Y+PP+   +  +KLP T  + FL+KAA++ +  DL  DG   N+ R
Sbjct  270  KIPADD---AAVEFYDPPVK-ATVLSKLPHTDQFRFLDKAALITVG-DLNVDGVPTNQRR  324

Query  182  LCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLF  361
            LCS+Q+ EEVKC++R+IP+W AGI   + + QQGTFT++QAL+M+RH+GR FQ+PAGS+ 
Sbjct  325  LCSVQQVEEVKCLIRIIPVWSAGIIALVTMSQQGTFTVSQALKMDRHIGRNFQVPAGSMS  384

Query  362  VVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            V+SLLTI + LPFYDR+ VP  RK T    GIT+LQR+G+G+ F+IL+M V+G V
Sbjct  385  VISLLTIGIWLPFYDRIFVPSIRKITGHKSGITLLQRVGVGIVFAILSMVVAGLV  439



>ref|XP_002863113.1| proton-dependent oligopeptide transport family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH39372.1| proton-dependent oligopeptide transport family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=619

 Score =   187 bits (475),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 125/175 (71%), Gaps = 4/175 (2%)
 Frame = +2

Query  2    RLPANDSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWR  181
            ++PA D G     YY+P +   S  +KL  +  + FL+KAAV+ IE DLT +G   ++WR
Sbjct  292  KVPAEDDGTVN--YYDPAIK-SSVLSKLHRSNQFRFLDKAAVI-IEGDLTPEGAPADKWR  347

Query  182  LCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLF  361
            LCS+QE EEVKC++R++P+W AGI    A+  QGTFT++QAL+M RHLG  F+IPAGSL 
Sbjct  348  LCSVQEVEEVKCLIRIVPVWSAGIISLAAMTTQGTFTVSQALKMERHLGPHFEIPAGSLS  407

Query  362  VVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            V+SLLTI + LPFYDRV VP+ R+ T    GIT+LQR+G G+ F+I +M V+G V
Sbjct  408  VISLLTIGIFLPFYDRVFVPFMRRITGHKSGITLLQRIGTGIIFAIFSMIVAGIV  462



>dbj|BAB19759.1| putative nitrate transporter NRT1-4 [Glycine max]
Length=228

 Score =   177 bits (450),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 113/139 (81%), Gaps = 1/139 (1%)
 Frame = +2

Query  110  LNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTF  289
            LNKAA++ +E +L  DG   N+WRL SIQ+ EEVKC+ R+IPIW AGI   +++ QQGTF
Sbjct  3    LNKAALI-MEGELNPDGTRVNQWRLVSIQQVEEVKCLARIIPIWAAGILSLISMTQQGTF  61

Query  290  TINQALQMNRHLGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQ  469
            T++QA++MNRHLG +FQIPAGS+ V+SL+TIA+ LPFYDR+LVP  RK T+  GGIT+L 
Sbjct  62   TVSQAMKMNRHLGAKFQIPAGSVSVISLITIALWLPFYDRILVPKLRKMTKHEGGITLLL  121

Query  470  RMGIGLAFSILAMAVSGFV  526
            R+GIG+ FSIL+M V+G+V
Sbjct  122  RIGIGMVFSILSMVVAGYV  140



>ref|XP_010415654.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13-like [Camelina sativa]
Length=621

 Score =   186 bits (472),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 124/175 (71%), Gaps = 4/175 (2%)
 Frame = +2

Query  2    RLPANDSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWR  181
            ++PA D G     YY+P     S  +KL  +  + FL+KAAV+  E DLT +G   ++WR
Sbjct  294  KVPAEDDGTVT--YYDPS-NKSSVLSKLHRSNQFRFLDKAAVIS-EGDLTPEGAPADKWR  349

Query  182  LCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLF  361
            LCS+QE EEVKC++RV+P+W AGI    A+  QGTFT++QAL+M+RHLG  F+IPAGSL 
Sbjct  350  LCSVQEVEEVKCLIRVVPVWSAGIISLAAMTTQGTFTVSQALKMDRHLGPNFEIPAGSLS  409

Query  362  VVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            V+SLLTI V LPFYDRV VP+ R+ T    GIT+LQR+G G+ F+I +M V+G V
Sbjct  410  VISLLTIGVFLPFYDRVFVPFMRRITGHKSGITLLQRIGTGIVFAIFSMIVAGIV  464



>ref|XP_010475864.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13-like [Camelina sativa]
Length=624

 Score =   185 bits (469),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/175 (51%), Positives = 125/175 (71%), Gaps = 4/175 (2%)
 Frame = +2

Query  2    RLPANDSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWR  181
            ++PA D G     YY+P +   S  +KLP +  + FL+KA V+  E DLT +G   ++WR
Sbjct  294  KVPAEDDGTVT--YYDPSIK-SSVLSKLPRSNQFRFLDKATVIS-EGDLTPEGAPADKWR  349

Query  182  LCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLF  361
            LCS+QE EEVKC++R++P+W AGI    A+  + TFT++QAL+M+RHLG  F+IPAGSL 
Sbjct  350  LCSVQEVEEVKCLIRIVPVWSAGIISLAAMTTEATFTVSQALKMDRHLGPNFEIPAGSLS  409

Query  362  VVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            V+SLLTI V+LPFYDRV VP+ R+ T    GIT+LQR+G G+ F+I +M V+G V
Sbjct  410  VISLLTICVILPFYDRVFVPFMRRITGHKSGITLLQRIGTGIVFAIFSMIVAGIV  464



>gb|KHN28716.1| Nitrate transporter 1.7 [Glycine soja]
Length=571

 Score =   184 bits (467),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 121/164 (74%), Gaps = 1/164 (1%)
 Frame = +2

Query  35   GVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVK  214
            GV+Y+PPL      +KLPLT  +  LNKAAV+ +E +   DG   N+W++ SIQ+ E+VK
Sbjct  247  GVFYDPPLTGTQVFSKLPLTNQFRCLNKAAVI-MEGEQNPDGSRANKWKVVSIQQVEDVK  305

Query  215  CIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLFVVSLLTIAVLL  394
            C+ R+ PIW AGI    ++ QQGTFT++QAL+M+RHLG +FQIPAGSL V+S +T+ V +
Sbjct  306  CLARIFPIWAAGILGFTSMAQQGTFTVSQALKMDRHLGAKFQIPAGSLGVISFITVGVWV  365

Query  395  PFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            PFYDR++VP  R+ T+  GGIT+LQR+GIG+ FSIL+M  +  V
Sbjct  366  PFYDRIMVPTLRRITKHEGGITLLQRIGIGMVFSILSMVAAALV  409



>ref|NP_564979.1| nitrate transporter 1.7 [Arabidopsis thaliana]
 sp|Q8RX77.1|PTR21_ARATH RecName: Full=Protein NRT1/ PTR FAMILY 2.13; Short=AtNPF2.13; 
AltName: Full=Nitrate transporter 1.7 [Arabidopsis thaliana]
 gb|AAL90918.1| At1g69870/T17F3_10 [Arabidopsis thaliana]
 gb|AAM78041.1| At1g69870/T17F3_10 [Arabidopsis thaliana]
 gb|AEE34993.1| nitrate transporter 1.7 [Arabidopsis thaliana]
Length=620

 Score =   184 bits (468),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 126/175 (72%), Gaps = 4/175 (2%)
 Frame = +2

Query  2    RLPANDSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWR  181
            +LPA D G     YY+P +   S  +KL  +  +  L+KAAVV IE DLT +G   ++WR
Sbjct  293  KLPAEDDGTVT--YYDPAIK-SSVLSKLHRSNQFRCLDKAAVV-IEGDLTPEGPPADKWR  348

Query  182  LCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLF  361
            LCS+QE EEVKC++R++PIW AGI    A+  QGTFT++QAL+M+R+LG +F+IPAGSL 
Sbjct  349  LCSVQEVEEVKCLIRIVPIWSAGIISLAAMTTQGTFTVSQALKMDRNLGPKFEIPAGSLS  408

Query  362  VVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            V+SLLTI + LPFYDRV VP+ R+ T    GIT+LQR+G G+ F+I +M V+G V
Sbjct  409  VISLLTIGIFLPFYDRVFVPFMRRITGHKSGITLLQRIGTGIVFAIFSMIVAGIV  463



>gb|AAG52567.1|AC010675_15 putative peptide transporter; 37139-33250 [Arabidopsis thaliana]
Length=644

 Score =   184 bits (468),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 126/175 (72%), Gaps = 4/175 (2%)
 Frame = +2

Query  2    RLPANDSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWR  181
            +LPA D G     YY+P +   S  +KL  +  +  L+KAAVV IE DLT +G   ++WR
Sbjct  317  KLPAEDDGTVT--YYDPAIK-SSVLSKLHRSNQFRCLDKAAVV-IEGDLTPEGPPADKWR  372

Query  182  LCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLF  361
            LCS+QE EEVKC++R++PIW AGI    A+  QGTFT++QAL+M+R+LG +F+IPAGSL 
Sbjct  373  LCSVQEVEEVKCLIRIVPIWSAGIISLAAMTTQGTFTVSQALKMDRNLGPKFEIPAGSLS  432

Query  362  VVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            V+SLLTI + LPFYDRV VP+ R+ T    GIT+LQR+G G+ F+I +M V+G V
Sbjct  433  VISLLTIGIFLPFYDRVFVPFMRRITGHKSGITLLQRIGTGIVFAIFSMIVAGIV  487



>ref|XP_003519778.1| PREDICTED: nitrate transporter 1.7-like [Glycine max]
Length=629

 Score =   184 bits (467),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 121/164 (74%), Gaps = 1/164 (1%)
 Frame = +2

Query  35   GVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVK  214
            GV+Y+PPL      +KLPLT  +  LNKAAV+ +E +   DG   N+W++ SIQ+ E+VK
Sbjct  305  GVFYDPPLTGTQVFSKLPLTNQFRCLNKAAVI-MEGEQNPDGSRANKWKVVSIQQVEDVK  363

Query  215  CIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLFVVSLLTIAVLL  394
            C+ R+ PIW AGI    ++ QQGTFT++QAL+M+RHLG +FQIPAGSL V+S +T+ V +
Sbjct  364  CLARIFPIWAAGILGFTSMAQQGTFTVSQALKMDRHLGAKFQIPAGSLGVISFITVGVWV  423

Query  395  PFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            PFYDR++VP  R+ T+  GGIT+LQR+GIG+ FSIL+M  +  V
Sbjct  424  PFYDRIMVPTLRRITKHEGGITLLQRIGIGMVFSILSMVAAALV  467



>ref|XP_004297809.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13-like [Fragaria vesca 
subsp. vesca]
Length=622

 Score =   184 bits (467),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 90/175 (51%), Positives = 125/175 (71%), Gaps = 3/175 (2%)
 Frame = +2

Query  2    RLPANDSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWR  181
            +LP +D        Y+PP+       KLP T    FLNKAA++ +E D+  DG   N+WR
Sbjct  301  KLP-DDKAIDGSKLYDPPVK-DLLIQKLPPTNQIRFLNKAAII-LENDIKPDGCPVNKWR  357

Query  182  LCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLF  361
            LCS+Q+ E++KC+++ +PIW + I    A+ QQ TFT++QAL++NRHLG++F+IPAGSL 
Sbjct  358  LCSVQQVEDLKCVIKTMPIWASAIVSFTAMTQQATFTVSQALKLNRHLGQKFEIPAGSLI  417

Query  362  VVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            V+SLLTI + LP YDR+LVP  RK T+  GGIT+LQR+GIG  FS+LAM V+GF+
Sbjct  418  VISLLTIGIFLPVYDRLLVPALRKVTKDEGGITVLQRIGIGCIFSVLAMLVAGFI  472



>ref|XP_010256203.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13-like [Nelumbo nucifera]
Length=626

 Score =   184 bits (466),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 127/175 (73%), Gaps = 4/175 (2%)
 Frame = +2

Query  2    RLPANDSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWR  181
            RLP+  S    G  Y+PP+  G+  +KLPLT+ +  LNKAA++    ++  DG   N+W 
Sbjct  295  RLPS--SQEQPGALYDPPMK-GTLISKLPLTQQFRVLNKAAIIA-HGEVQPDGSRSNQWS  350

Query  182  LCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLF  361
            LCSIQ+ EEVKC++RV+PIW + I C  A+ QQ TFT  QAL+M+RHLG +FQIPAGSL 
Sbjct  351  LCSIQQVEEVKCLIRVVPIWASCIICFTAMAQQWTFTTVQALKMDRHLGPKFQIPAGSLM  410

Query  362  VVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            ++S++TI + LPFYDRVLVP  R+ T+  GGIT+LQR+GIG+ F+ ++M V+G V
Sbjct  411  IISMITIGLWLPFYDRVLVPALRRVTKQEGGITLLQRIGIGMVFAPVSMVVAGLV  465



>ref|XP_010096325.1| Nitrate transporter 1.7 [Morus notabilis]
 gb|EXB63800.1| Nitrate transporter 1.7 [Morus notabilis]
Length=616

 Score =   184 bits (466),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 93/172 (54%), Positives = 121/172 (70%), Gaps = 2/172 (1%)
 Frame = +2

Query  11   ANDSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCS  190
            A+D      V+Y PP+  GS  +KL  T  Y FL+KAAV+  E DL  +    N+WRLCS
Sbjct  296  ADDHHDHKVVFYEPPVK-GSVLSKLSRTNQYRFLDKAAVIT-ENDLQPNSTPTNKWRLCS  353

Query  191  IQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLFVVS  370
            IQ+ EEVKC+VR+ PIW  G+    +++QQ TFTI+QAL+M+RHLG  F +PAGS+ V+S
Sbjct  354  IQQVEEVKCLVRITPIWVCGMISLTSMVQQWTFTISQALKMDRHLGPTFLVPAGSISVIS  413

Query  371  LLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            LLTIA+ LPFYDR LVP  R+ T    GIT+LQRMGIG+ FS L+M V+G +
Sbjct  414  LLTIALFLPFYDRFLVPALRRITGHDTGITLLQRMGIGIVFSTLSMVVAGLI  465



>ref|XP_010482935.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13-like [Camelina sativa]
Length=619

 Score =   182 bits (463),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 90/175 (51%), Positives = 124/175 (71%), Gaps = 4/175 (2%)
 Frame = +2

Query  2    RLPANDSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWR  181
            ++PA D G     YY+P +   S  +KL  +  + FL+KAAV+  E DLT +G   ++WR
Sbjct  293  KVPAEDDGTVT--YYDPSVK-SSVLSKLHRSNQFRFLDKAAVIS-EGDLTPEGAPADKWR  348

Query  182  LCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLF  361
            LCS+QE EEVKC++R++P+W AGI    A+  + TFT++QAL+M+RHLG  F+IPAGSL 
Sbjct  349  LCSVQEVEEVKCLIRIVPVWSAGIISLAAMTTEATFTVSQALKMDRHLGPNFEIPAGSLS  408

Query  362  VVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            V+SLLTI V LPFYDRV VP+ R+ T    GIT+LQR+G G+ F+I +M V+G V
Sbjct  409  VISLLTICVFLPFYDRVFVPFMRRITGHKSGITLLQRIGTGIVFAIFSMIVAGIV  463



>gb|KDP21241.1| hypothetical protein JCGZ_21712 [Jatropha curcas]
Length=615

 Score =   182 bits (462),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/163 (53%), Positives = 122/163 (75%), Gaps = 2/163 (1%)
 Frame = +2

Query  38   VYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKC  217
            V+Y+PP    +  +KLPLT  + FLNKAAV+  + DL  DG C N+WRL S+Q+ EE+K 
Sbjct  304  VFYDPPTKV-NELSKLPLTNQFRFLNKAAVIE-KNDLNPDGSCANQWRLSSVQQVEELKS  361

Query  218  IVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLFVVSLLTIAVLLP  397
            ++++ P+W  GI    ++ QQGTFT+ QA++M+RHLG  FQIPAGS+ V+S++TIA+ LP
Sbjct  362  VLKIGPVWATGIISFTSVSQQGTFTVIQAMKMDRHLGSNFQIPAGSMGVISMITIAIWLP  421

Query  398  FYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
             YDR+LVP  RK T+  GGIT+LQR+GIG+ FS+L+M V+G V
Sbjct  422  IYDRILVPALRKITKHEGGITLLQRIGIGIIFSLLSMVVAGLV  464



>ref|XP_010443122.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13-like [Camelina sativa]
Length=553

 Score =   181 bits (460),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 90/175 (51%), Positives = 124/175 (71%), Gaps = 4/175 (2%)
 Frame = +2

Query  2    RLPANDSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWR  181
            ++PA D G     YY+P +   S  +KL  +K + FL+K AVV  E DLT +G   ++WR
Sbjct  226  KVPAEDDGTVT--YYDPSIK-SSVLSKLHRSKQFRFLDKVAVVS-EGDLTPEGAPADKWR  281

Query  182  LCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLF  361
            LCS+QE EEVKC++R++P+W AGI    A+  + TFT++QAL+M+RHLG  F+IPAGSL 
Sbjct  282  LCSVQEVEEVKCLIRIVPVWSAGIISLAAMTTESTFTVSQALKMDRHLGPNFEIPAGSLS  341

Query  362  VVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            V+SLLTI V+LPFYDRV VP+ R+ T    GIT+LQR+G G+ F+I +  V+G V
Sbjct  342  VISLLTICVILPFYDRVFVPFMRRITGHKSGITLLQRIGTGIVFAIFSTIVAGIV  396



>ref|XP_008221697.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13-like [Prunus mume]
Length=613

 Score =   182 bits (462),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 122/162 (75%), Gaps = 2/162 (1%)
 Frame = +2

Query  41   YYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCI  220
            +Y+PP+  G   +KLPLT    FL+KAAV+ ++ DL  DG   ++WRLCS+Q+ E++KC+
Sbjct  304  FYDPPIK-GFFVSKLPLTNQLRFLSKAAVI-LDNDLKPDGSPIDKWRLCSVQQVEDLKCV  361

Query  221  VRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLFVVSLLTIAVLLPF  400
            +R IP+W + I    ++ QQGTFT++QAL+M+RHLG  F+IPAGSL V+SLLTI + LP 
Sbjct  362  IRTIPVWASAIVSFTSMTQQGTFTVSQALKMDRHLGPHFEIPAGSLGVISLLTIGLWLPA  421

Query  401  YDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            YDR+LVP  RK T+  GGIT+LQR GIG+ FS+++M V+G +
Sbjct  422  YDRLLVPALRKFTKHEGGITVLQRCGIGIVFSVMSMLVAGLI  463



>ref|XP_003613558.1| Peptide transporter PTR1 [Medicago truncatula]
 gb|AES96516.1| peptide/nitrate transporter [Medicago truncatula]
Length=608

 Score =   181 bits (460),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 91/175 (52%), Positives = 125/175 (71%), Gaps = 3/175 (2%)
 Frame = +2

Query  2    RLPANDSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWR  181
            +LP  +     G++Y+PPL   +  +KLP T  +  L+KAA+V +E DL  DG   N+W 
Sbjct  275  KLP--NEKHVDGIFYDPPLIGKAILSKLPPTNQFRVLDKAALV-MEGDLNPDGTIVNQWN  331

Query  182  LCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLF  361
            L SIQ+ EEVKC+ R +PIW AGI    A+ QQGTF ++QA++M+RHLG +FQIPAGSL 
Sbjct  332  LVSIQQVEEVKCLARTLPIWAAGILGFTAMAQQGTFIVSQAMKMDRHLGPKFQIPAGSLG  391

Query  362  VVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            V+SL+ I + +PFYDR+ VP  RK T+  GGIT+LQR+GIG+ FSI++M V+G V
Sbjct  392  VISLIVIGLWVPFYDRICVPSLRKITKNEGGITLLQRIGIGMVFSIISMIVAGLV  446



>emb|CDY40280.1| BnaA07g09200D [Brassica napus]
Length=568

 Score =   180 bits (456),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 90/177 (51%), Positives = 122/177 (69%), Gaps = 10/177 (6%)
 Frame = +2

Query  2    RLPANDSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWR  181
            +LP  D G     YY+PPL PG   +KLPLT  Y FL+KAAV+  E+DLT  G   N+WR
Sbjct  259  KLPVEDDGTVE--YYDPPLKPG-VLSKLPLTNQYKFLDKAAVIT-EDDLTSAGVPVNKWR  314

Query  182  LCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLF  361
            LCS+QE EEVKC++R+IP+W AGI   + +  Q TF + QA++M+RH+G  F+IPAGS+ 
Sbjct  315  LCSVQEVEEVKCLIRIIPVWSAGIISVVTMSTQVTFIVPQAMKMDRHMGPHFEIPAGSVS  374

Query  362  VVSLLTIAVLLPFYDRVLVP--WARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            V+S +TI + LP YDRV+VP  W  ++ RV    T+LQRMGIG+ F I++M  +  V
Sbjct  375  VISFITIGIWLPIYDRVIVPSLWRIRKFRV----TLLQRMGIGIVFGIVSMFTAAIV  427



>ref|XP_004155325.1| PREDICTED: LOW QUALITY PROTEIN: nitrate transporter 1.7-like 
[Cucumis sativus]
Length=598

 Score =   180 bits (457),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 90/176 (51%), Positives = 117/176 (66%), Gaps = 7/176 (4%)
 Frame = +2

Query  2    RLPANDSGAAAGVYYNPPLPPGSAA-TKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRW  178
            +LP +  G     +Y+PPL P S   +KLPLT  + FLNKAA+   E D+  DG+  N+W
Sbjct  278  KLPDDRKG-----FYDPPLDPASVVLSKLPLTNQFSFLNKAAIKT-ENDINPDGRRVNKW  331

Query  179  RLCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSL  358
             L SIQ+ EE+KC+ RV PIW  GI     IIQQ TF+I+QAL+MNRH+G  FQIP  S+
Sbjct  332  NLSSIQQVEELKCLFRVFPIWVTGILSLTPIIQQSTFSISQALKMNRHMGSNFQIPPASI  391

Query  359  FVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
             V+S LTI   +PFYD+ LVP  RK T    GIT LQRM IG+ F++L+M V+G +
Sbjct  392  IVISFLTITFFIPFYDQFLVPTLRKFTGHPNGITELQRMAIGIVFAVLSMVVAGLI  447



>ref|XP_008446297.1| PREDICTED: LOW QUALITY PROTEIN: protein NRT1/ PTR FAMILY 2.13-like 
[Cucumis melo]
Length=598

 Score =   180 bits (457),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 116/176 (66%), Gaps = 7/176 (4%)
 Frame = +2

Query  2    RLPANDSGAAAGVYYNPPLPPGSAA-TKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRW  178
            +LP +  G     +Y+PPL P S   +KLPLT  + FLNKAA+V  E ++  DG   N+W
Sbjct  278  KLPDDRKG-----FYDPPLDPASVVLSKLPLTNQFSFLNKAAIVT-ENEIKPDGTRLNKW  331

Query  179  RLCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSL  358
             L SIQ+ EE+KC+ RV PIW  GI     IIQQ TF+I+QALQMNRH+G  FQIP  S+
Sbjct  332  NLSSIQQVEELKCLFRVFPIWVTGILSLTPIIQQSTFSISQALQMNRHMGSNFQIPPASI  391

Query  359  FVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
             V+S LTI   +P YDR LVP  RK T    GIT LQRM IG+ F++L+M V+G V
Sbjct  392  IVISFLTITFFIPLYDRFLVPTLRKFTGHPNGITELQRMAIGIIFAVLSMVVAGLV  447



>ref|XP_004135202.1| PREDICTED: nitrate transporter 1.7-like [Cucumis sativus]
 gb|KGN51872.1| hypothetical protein Csa_5G604170 [Cucumis sativus]
Length=598

 Score =   180 bits (457),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 90/176 (51%), Positives = 117/176 (66%), Gaps = 7/176 (4%)
 Frame = +2

Query  2    RLPANDSGAAAGVYYNPPLPPGSAA-TKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRW  178
            +LP +  G     +Y+PPL P S   +KLPLT  + FLNKAA+   E D+  DG+  N+W
Sbjct  278  KLPDDRKG-----FYDPPLDPASVVLSKLPLTNQFSFLNKAAIKT-ENDINPDGRRVNKW  331

Query  179  RLCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSL  358
             L SIQ+ EE+KC+ RV PIW  GI     IIQQ TF+I+QAL+MNRH+G  FQIP  S+
Sbjct  332  NLSSIQQVEELKCLFRVFPIWVTGILSLTPIIQQSTFSISQALKMNRHMGSNFQIPPASI  391

Query  359  FVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
             V+S LTI   +PFYD+ LVP  RK T    GIT LQRM IG+ F++L+M V+G +
Sbjct  392  IVISFLTITFFIPFYDQFLVPTLRKFTGHPNGITELQRMAIGIVFAVLSMVVAGLI  447



>ref|XP_010498968.1| PREDICTED: protein NRT1/ PTR FAMILY 2.12-like [Camelina sativa]
Length=568

 Score =   179 bits (455),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 89/175 (51%), Positives = 122/175 (70%), Gaps = 6/175 (3%)
 Frame = +2

Query  2    RLPANDSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWR  181
             +PA D G     YY+PP+ PG   +KLPLT ++ FL+K AV+  E DLT +G   +RWR
Sbjct  258  EIPAVDDGTVE--YYDPPVKPG-VLSKLPLTSEFKFLDKGAVIT-EGDLTSEGAPADRWR  313

Query  182  LCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLF  361
            LCS+QE EEVKC++RV+PIW AGI   +A+  QGTF + QA++M+RH+G  F+IPA S+ 
Sbjct  314  LCSVQEVEEVKCLIRVVPIWSAGIISIVAMTTQGTFIVFQAVKMDRHMGPHFEIPAASVV  373

Query  362  VVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            V+S +TI + LP YDR+LVP   +        T+LQRMGIG+ F+IL+M  +GFV
Sbjct  374  VISYITIGIWLPIYDRLLVPSLSRIQEF--RFTLLQRMGIGIIFAILSMFTAGFV  426



>ref|XP_009103122.1| PREDICTED: protein NRT1/ PTR FAMILY 2.12 [Brassica rapa]
Length=568

 Score =   179 bits (454),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 91/177 (51%), Positives = 121/177 (68%), Gaps = 10/177 (6%)
 Frame = +2

Query  2    RLPANDSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWR  181
            +LP  D G     YY+PPL PG   +KLPLT  Y FL+KAAV+  E DLT  G   N+WR
Sbjct  259  KLPVEDDGTVE--YYDPPLKPG-VLSKLPLTNQYKFLDKAAVIT-EGDLTSAGVPVNKWR  314

Query  182  LCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLF  361
            LCS+QE EEVKC++R+IP+W AGI   + +  Q TF + QA++M+RH+G  F+IPAGS+ 
Sbjct  315  LCSVQEVEEVKCLIRIIPVWSAGIISVVTMSTQVTFIVPQAMKMDRHMGPHFEIPAGSVS  374

Query  362  VVSLLTIAVLLPFYDRVLVP--WARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            V+S +TI + LP YDRVLVP  W  ++ RV    T+LQRMGIG+ F I++M  +  V
Sbjct  375  VISFITIGIWLPIYDRVLVPSLWRIRKFRV----TLLQRMGIGIVFGIVSMFTAAIV  427



>emb|CDY28441.1| BnaC07g12690D [Brassica napus]
Length=568

 Score =   179 bits (454),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 90/177 (51%), Positives = 121/177 (68%), Gaps = 10/177 (6%)
 Frame = +2

Query  2    RLPANDSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWR  181
            +LP  D G     YY+PPL PG   +KLPLT  Y FL+KAAV+  E DLT  G   N+WR
Sbjct  259  KLPVEDDGTVE--YYDPPLKPG-VLSKLPLTNQYKFLDKAAVIT-EGDLTSAGVPVNKWR  314

Query  182  LCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLF  361
            LCS+QE EEVKC++R+IP+W AGI   + +  Q TF + QA++M+RH+G  F+IPAGS+ 
Sbjct  315  LCSVQEVEEVKCLIRIIPVWSAGIISVVTMSTQVTFIVPQAMKMDRHMGPHFEIPAGSVS  374

Query  362  VVSLLTIAVLLPFYDRVLVP--WARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            V+S +TI + LP YDRVLVP  W  ++ R    +T+LQRMGIG+ F I++M  +  V
Sbjct  375  VISFITIGIWLPIYDRVLVPSLWRIRKFR----LTLLQRMGIGIVFGIMSMFTAAIV  427



>ref|XP_010460223.1| PREDICTED: protein NRT1/ PTR FAMILY 2.12-like [Camelina sativa]
Length=568

 Score =   178 bits (452),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 89/177 (50%), Positives = 123/177 (69%), Gaps = 10/177 (6%)
 Frame = +2

Query  2    RLPANDSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWR  181
             +PA D G     YY+PP+ PG   +KLPLT  + FL+K AV+  E DLT +G   ++WR
Sbjct  258  EIPAVDDGTVE--YYDPPVKPG-VLSKLPLTSQFKFLDKGAVIA-EGDLTSEGVPAHKWR  313

Query  182  LCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLF  361
            LCS+QE EEVKC++RV+PIW AGI   +A+  Q TF + QA++M+RH+G  F+IPA S+ 
Sbjct  314  LCSVQEVEEVKCLIRVVPIWSAGIISIVAMSTQATFIVFQAMKMDRHMGPHFEIPAASVV  373

Query  362  VVSLLTIAVLLPFYDRVLVP--WARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            V+S +TI + LP YDR+LVP  W  ++ R     T+LQRMGIG+ F+IL+M  +GFV
Sbjct  374  VISYITIGIWLPIYDRLLVPSLWRIRKFR----FTLLQRMGIGIIFAILSMFTAGFV  426



>ref|XP_006415996.1| hypothetical protein EUTSA_v10007235mg [Eutrema salsugineum]
 gb|ESQ34349.1| hypothetical protein EUTSA_v10007235mg [Eutrema salsugineum]
Length=566

 Score =   178 bits (451),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 90/177 (51%), Positives = 121/177 (68%), Gaps = 10/177 (6%)
 Frame = +2

Query  2    RLPANDSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWR  181
             +P  D G     YYNPP  P    +KL LT  + FL+KAAV+  E DLT DG   N+WR
Sbjct  260  EIPMEDDGTVE--YYNPPSKP-DVLSKLHLTNQFKFLDKAAVIA-EGDLTLDGVQANKWR  315

Query  182  LCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLF  361
            LCS+QE EEVKC++RV+P+W AGI   +A+  Q  F I QA +M+RH+G+ F+IPAGS+ 
Sbjct  316  LCSVQEVEEVKCLMRVVPVWSAGIVSIVAMSTQAAFIIPQATKMDRHMGQHFEIPAGSVS  375

Query  362  VVSLLTIAVLLPFYDRVLVP--WARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            V++ +TI + +P YDRVLVP  W  ++ R    +T+LQRMGIG+ F+ILAM  +GFV
Sbjct  376  VITFITIGIWVPIYDRVLVPSLWRIRKFR----LTLLQRMGIGIVFAILAMFTAGFV  428



>ref|XP_010477772.1| PREDICTED: protein NRT1/ PTR FAMILY 2.12 [Camelina sativa]
Length=568

 Score =   178 bits (451),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 89/177 (50%), Positives = 122/177 (69%), Gaps = 10/177 (6%)
 Frame = +2

Query  2    RLPANDSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWR  181
             +PA D G     YY+PP+ PG   +KLPLT  + FL+K AV+  E DLT +G   ++WR
Sbjct  258  EIPAVDDGTVE--YYDPPVKPG-VLSKLPLTSQFKFLDKGAVIT-EGDLTSEGAPAHKWR  313

Query  182  LCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLF  361
            LCS+QE EEVKC++RV+PIW AGI   +A+  Q TF + QA++M+RH+G  F+IPA S+ 
Sbjct  314  LCSVQEVEEVKCLIRVVPIWSAGIISIVAMSTQATFIVFQAMKMDRHMGPHFEIPAASVV  373

Query  362  VVSLLTIAVLLPFYDRVLVP--WARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            V+S +TI + LP YDR+LVP  W  +  R     T+LQRMGIG+ F+IL+M  +GFV
Sbjct  374  VISYITIGIWLPIYDRLLVPSLWRIREFR----FTLLQRMGIGIIFAILSMFTAGFV  426



>gb|KJB61233.1| hypothetical protein B456_009G346900 [Gossypium raimondii]
Length=588

 Score =   176 bits (447),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 88/165 (53%), Positives = 119/165 (72%), Gaps = 2/165 (1%)
 Frame = +2

Query  35   GVYYNPPLPPGSAATK-LPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEV  211
            G +Y+PPL       + L LT  Y FLNKAA+V I++++  DG C+N W LC+IQ+ E+V
Sbjct  289  GQFYDPPLTTSLLCVRELHLTTQYRFLNKAALV-IDDEVNPDGSCKNPWMLCTIQQVEDV  347

Query  212  KCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLFVVSLLTIAVL  391
            KC++ +IPIW   I   LA+ QQGTFT++QAL+M+   G   +IPAGS+ V++L+ IAV 
Sbjct  348  KCLLNIIPIWVTSILGFLAMNQQGTFTVSQALKMDLQFGSTIKIPAGSVGVITLIAIAVW  407

Query  392  LPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            LPFYDRVLVP   K T++ GGIT+LQR+G+G  FSIL M VSGF+
Sbjct  408  LPFYDRVLVPALEKITKLEGGITVLQRIGVGNLFSILTMLVSGFI  452



>gb|KHG01988.1| hypothetical protein F383_22454 [Gossypium arboreum]
Length=585

 Score =   175 bits (444),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 118/164 (72%), Gaps = 2/164 (1%)
 Frame = +2

Query  35   GVYYNPPLPPGSAATK-LPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEV  211
            G +Y+PPL       + L LT  Y FLNKAA+V I++++  DG C+N W LC+IQ+ E+V
Sbjct  289  GQFYDPPLTTSLLCVRELHLTTQYRFLNKAALV-IDDEVNPDGSCKNPWTLCTIQQVEDV  347

Query  212  KCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLFVVSLLTIAVL  391
            KC++ +IPIW   I   LA+ QQGTFT++QAL+M+   G   +IPAGS+ V++L+ IAV 
Sbjct  348  KCLLNIIPIWVTSILGFLAMNQQGTFTVSQALKMDLQFGSTIKIPAGSVGVITLIAIAVW  407

Query  392  LPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGF  523
            LPFYDRVLVP   K T++ GGIT+LQR+G+G  FSIL M VSGF
Sbjct  408  LPFYDRVLVPALEKITKLEGGITVLQRIGVGNLFSILTMLVSGF  451



>emb|CDY25813.1| BnaA07g09690D [Brassica napus]
Length=568

 Score =   174 bits (440),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 90/177 (51%), Positives = 119/177 (67%), Gaps = 10/177 (6%)
 Frame = +2

Query  2    RLPANDSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWR  181
            +LP  D G     YY+PPL PG   +KLPLT  Y FL+KAAV   E DLT      N+WR
Sbjct  259  KLPVEDDGTVE--YYDPPLKPG-VLSKLPLTNQYKFLDKAAVNT-EGDLTSAVVPVNKWR  314

Query  182  LCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLF  361
            LCS+QE EEVKC++R+IP+W AGI   + +  Q TF + QA++M+RH+G  F+IPAGS+ 
Sbjct  315  LCSVQEVEEVKCLIRIIPVWSAGIISVVTMSTQVTFIVPQAMKMDRHMGPHFEIPAGSVS  374

Query  362  VVSLLTIAVLLPFYDRVLVP--WARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            V+S +TI + LP YDRVLVP  W  ++ RV    T+LQRMGIG+ F I++M  +  V
Sbjct  375  VISFITIGIWLPIYDRVLVPSLWRIRKFRV----TLLQRMGIGIVFGIVSMFTAAIV  427



>gb|AAF79856.1|AC000348_9 T7N9.14 [Arabidopsis thaliana]
Length=700

 Score =   174 bits (442),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 86/172 (50%), Positives = 120/172 (70%), Gaps = 10/172 (6%)
 Frame = +2

Query  17   DSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQ  196
            D G     YY PP+ PG   +KLPLT  + FL+KAAV+ ++ DLT +G   N+WRLCSIQ
Sbjct  384  DDGTEE--YYEPPVKPG-VLSKLPLTDQFKFLDKAAVI-LDGDLTSEGVPANKWRLCSIQ  439

Query  197  ETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLFVVSLL  376
            E EEVKC++RV+P+W AGI   +A+  Q TF + QA +M+RH+G  F+IPA S+ V+S +
Sbjct  440  EVEEVKCLIRVVPVWSAGIISIVAMTTQATFMVFQATKMDRHMGPHFEIPAASITVISYI  499

Query  377  TIAVLLPFYDRVLVP--WARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            TI + +P Y+ +LVP  W  ++ RV    T+LQRMGIG+ F+IL+M  +GFV
Sbjct  500  TIGIWVPIYEHLLVPFLWRMRKFRV----TLLQRMGIGIVFAILSMFTAGFV  547



>ref|XP_010683278.1| PREDICTED: protein NRT1/ PTR FAMILY 2.12 [Beta vulgaris subsp. 
vulgaris]
Length=621

 Score =   174 bits (441),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 88/172 (51%), Positives = 118/172 (69%), Gaps = 4/172 (2%)
 Frame = +2

Query  17   DSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGK--CRNRWRLCS  190
             +    GV+++PP P G   + LPLT  + FLNKAA++  E +L  D      +RW LCS
Sbjct  304  HAAVEKGVFHDPP-PSGVLESILPLTHQFSFLNKAAIIR-EGELNIDATPTLASRWSLCS  361

Query  191  IQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLFVVS  370
            IQE EEVKC++RV+PIW +GI C  A  QQ TF ++QA+ MNR++G +FQIP GS+ ++S
Sbjct  362  IQEVEEVKCVIRVLPIWASGIICFTAAAQQSTFAVSQAMIMNRNIGPKFQIPPGSIGIIS  421

Query  371  LLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            +L I V +P YDR LVP  RK T+   G T+LQRMGIGL FSI++M V+G V
Sbjct  422  MLAIGVWVPIYDRFLVPSLRKITKHEHGFTLLQRMGIGLVFSIISMIVAGLV  473



>gb|KFK44623.1| hypothetical protein AALP_AA1G282800 [Arabis alpina]
Length=569

 Score =   173 bits (439),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 116/164 (71%), Gaps = 8/164 (5%)
 Frame = +2

Query  41   YYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCI  220
            YY+PP+ PG   +KLPLT  + FL+KAAV+  E DL  DG   N+WRLCS+Q+ EEVKC+
Sbjct  271  YYDPPVKPG-VLSKLPLTNQFKFLDKAAVIA-EGDLRSDGIPANKWRLCSVQDVEEVKCL  328

Query  221  VRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLFVVSLLTIAVLLPF  400
            +R++P+W AGI C +A+  Q TF I QA +M+RH+G  F+IP GS+ V++ +TI++ LP 
Sbjct  329  IRIVPVWSAGIICIVAMTAQTTFIIPQATKMDRHMGPHFEIPPGSVSVITFITISIWLPI  388

Query  401  YDRVLVP--WARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            YDR+L+P  W   + R     T+LQRMGIG+ F IL+   +GFV
Sbjct  389  YDRILIPSLWRIHKFR----FTLLQRMGIGIVFGILSTFTAGFV  428



>ref|NP_174028.2| nitrate transporter 1.6 [Arabidopsis thaliana]
 sp|Q9LFX9.2|PTR13_ARATH RecName: Full=Protein NRT1/ PTR FAMILY 2.12; Short=AtNPF2.12; 
AltName: Full=Nitrate transporter 1.6 [Arabidopsis thaliana]
 gb|ABX61048.1| nitrate transporter [Arabidopsis thaliana]
 gb|AEE30777.1| nitrate transporter 1.6 [Arabidopsis thaliana]
Length=576

 Score =   173 bits (439),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 118/164 (72%), Gaps = 8/164 (5%)
 Frame = +2

Query  41   YYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCI  220
            YY PP+ PG   +KLPLT  + FL+KAAV+ ++ DLT +G   N+WRLCSIQE EEVKC+
Sbjct  266  YYEPPVKPG-VLSKLPLTDQFKFLDKAAVI-LDGDLTSEGVPANKWRLCSIQEVEEVKCL  323

Query  221  VRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLFVVSLLTIAVLLPF  400
            +RV+P+W AGI   +A+  Q TF + QA +M+RH+G  F+IPA S+ V+S +TI + +P 
Sbjct  324  IRVVPVWSAGIISIVAMTTQATFMVFQATKMDRHMGPHFEIPAASITVISYITIGIWVPI  383

Query  401  YDRVLVP--WARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            Y+ +LVP  W  ++ RV    T+LQRMGIG+ F+IL+M  +GFV
Sbjct  384  YEHLLVPFLWRMRKFRV----TLLQRMGIGIVFAILSMFTAGFV  423



>ref|XP_006304643.1| hypothetical protein CARUB_v10011778mg [Capsella rubella]
 gb|EOA37541.1| hypothetical protein CARUB_v10011778mg [Capsella rubella]
Length=579

 Score =   172 bits (437),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 122/177 (69%), Gaps = 10/177 (6%)
 Frame = +2

Query  2    RLPANDSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWR  181
             +PA D       YY+PP+ PG   +KLPL+  + FL+K AV+V E DLT +G   N+W 
Sbjct  258  EIPAVDDATVE--YYDPPVKPG-VLSKLPLSSQFKFLDKGAVIV-EGDLTSEGVPANKWW  313

Query  182  LCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLF  361
            LCSIQE EEVKC++RV+P+W +GI   +A+  Q TF + QA++M+RH+G  F+IPA S+ 
Sbjct  314  LCSIQEVEEVKCLIRVVPVWSSGIISIVAMTSQVTFIVFQAMKMDRHMGPHFEIPAASVT  373

Query  362  VVSLLTIAVLLPFYDRVLVP--WARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            V+S +TI + LP YDR+LVP  W  ++ R     T+LQRMGIG+ F+IL+M  +GFV
Sbjct  374  VISYITIGIWLPIYDRLLVPSLWRIQKFR----FTLLQRMGIGIIFAILSMFTAGFV  426



>ref|XP_002517461.1| nitrate transporter, putative [Ricinus communis]
 gb|EEF45003.1| nitrate transporter, putative [Ricinus communis]
Length=582

 Score =   171 bits (434),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 80/158 (51%), Positives = 111/158 (70%), Gaps = 1/158 (1%)
 Frame = +2

Query  56   LPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIP  235
            +P  S  +KLP T  + +L+K+A++  E+ +  DG   N WRLCSIQ+ EE KC++RVIP
Sbjct  273  MPTNSVNSKLPYTNQFRWLDKSAIITSEDQINSDGSAANPWRLCSIQQVEEAKCVLRVIP  332

Query  236  IWPAGIACSLAIIQQGTFTINQALQMNRHLGRR-FQIPAGSLFVVSLLTIAVLLPFYDRV  412
            IW +GI   + ++QQ T+ + QALQ +R LG   F++PA S+ V S+LT+ + +P YDR+
Sbjct  333  IWASGILYYVPVVQQNTYAVLQALQTDRRLGDSGFEVPAASIIVFSMLTLTIFIPIYDRM  392

Query  413  LVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            LVP+ RK T   GGITILQRMGIG+ FSI+ M VSG V
Sbjct  393  LVPFLRKLTGKEGGITILQRMGIGIIFSIVTMIVSGLV  430



>ref|XP_008787832.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13-like [Phoenix dactylifera]
Length=569

 Score =   171 bits (433),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 86/171 (50%), Positives = 117/171 (68%), Gaps = 3/171 (2%)
 Frame = +2

Query  14   NDSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSI  193
            +D+     V YNPP  P +   KLPL+  + FLNKAAV     ++  DG   N WRLCSI
Sbjct  267  DDAQQQESVLYNPP-TPSARIMKLPLSLQFRFLNKAAVKC-NGEIKPDGTI-NSWRLCSI  323

Query  194  QETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLFVVSL  373
            Q+ EEVKC++R++PIW +GI C +A+ QQ TF + QA++M+RHLG  FQIP GS+  ++L
Sbjct  324  QQIEEVKCLMRIVPIWFSGIICFVAMAQQWTFLVLQAMKMDRHLGSHFQIPPGSVVTINL  383

Query  374  LTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            L +A+ LP YD+V VP AR+ T++  GIT+LQR GIGL  S L+M V+  V
Sbjct  384  LALALFLPIYDKVFVPMARRITKIETGITLLQRQGIGLVISSLSMVVAALV  434



>ref|XP_010933657.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13 [Elaeis guineensis]
 ref|XP_010933665.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13 [Elaeis guineensis]
Length=614

 Score =   171 bits (433),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 117/176 (66%), Gaps = 3/176 (2%)
 Frame = +2

Query  2    RLPANDSGAAAG-VYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRW  178
             LPA D       + Y+PP        KLPLT  + FLNKAAV+  E D   DG   N W
Sbjct  284  ELPAKDDVVGQERMLYDPP-TVSHGVMKLPLTPQFSFLNKAAVIC-EGDTKEDGTPANSW  341

Query  179  RLCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSL  358
            RLCS+Q+ EE KC++R++PIWPAG++C +A+ QQ TF I Q L+M+RHLG RFQIP+ S+
Sbjct  342  RLCSVQQIEEAKCLIRILPIWPAGLSCFVALAQQWTFVILQCLKMDRHLGPRFQIPSASV  401

Query  359  FVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
             +V+LL + + +P YD++ VP AR+ T +  GIT+LQR G G+  + L+M V+G V
Sbjct  402  PIVALLALTLFIPIYDQLFVPLARRFTGIESGITLLQRQGAGIVMAALSMVVAGVV  457



>ref|XP_010926623.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13-like [Elaeis guineensis]
Length=592

 Score =   171 bits (432),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 85/171 (50%), Positives = 118/171 (69%), Gaps = 3/171 (2%)
 Frame = +2

Query  14   NDSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSI  193
            +D+     V +NPP    +   KLPL+  + FLNKAA+   + ++  DG   N WRLCS+
Sbjct  290  DDAQQQESVLHNPP-TRSARILKLPLSLQFRFLNKAAIKC-DGEIKPDGTI-NSWRLCSV  346

Query  194  QETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLFVVSL  373
            Q+ EEVKC++R++PIW +GI C +A+ QQ TF + QA+QM+RHLG  FQIP GS+  +SL
Sbjct  347  QQIEEVKCLMRIVPIWFSGIICFVAMAQQWTFLVLQAMQMDRHLGSHFQIPPGSVGTISL  406

Query  374  LTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            L +A+ LP YD+V VP AR+ TR+  GIT+LQR G+GL FS L+M V+  V
Sbjct  407  LALALFLPIYDKVFVPMARRITRIETGITLLQRQGVGLVFSTLSMVVAALV  457



>ref|XP_008807862.1| PREDICTED: protein NRT1/ PTR FAMILY 2.11-like [Phoenix dactylifera]
Length=595

 Score =   170 bits (431),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 84/162 (52%), Positives = 114/162 (70%), Gaps = 2/162 (1%)
 Frame = +2

Query  44   YNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIV  223
            +NPP    S  TKLP T  + FL+KAA+V   +++  +G   N WRLCSIQ+ EEVKC+ 
Sbjct  273  FNPP-HLSSLVTKLPHTDQFRFLDKAAIVTPADEIKPNGYAANLWRLCSIQQVEEVKCLA  331

Query  224  RVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGR-RFQIPAGSLFVVSLLTIAVLLPF  400
            R+IPIW  GI   LAI+Q+ T+ I QALQ +RH GR +FQIPA S+ V ++L + + +P 
Sbjct  332  RIIPIWSTGIIFYLAIVQETTYVIFQALQADRHFGRSKFQIPAASITVFAMLALTIWVPI  391

Query  401  YDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            YDR+LVP  R+ T   GG+T+LQRMG+G+  SI+AM +SGFV
Sbjct  392  YDRILVPRLRRITGREGGLTLLQRMGVGIILSIVAMIISGFV  433



>ref|XP_008807860.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13-like [Phoenix dactylifera]
Length=601

 Score =   169 bits (429),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 86/176 (49%), Positives = 117/176 (66%), Gaps = 3/176 (2%)
 Frame = +2

Query  2    RLPANDSGAAAG-VYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRW  178
             LPA D       + Y+PP        KLPLT  + FLNKAAVV  E D   DG   + W
Sbjct  284  ELPAKDDVVEQERMLYDPP-TVSHRVMKLPLTLQFSFLNKAAVVC-EGDRKEDGTPASSW  341

Query  179  RLCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSL  358
            RLCS+Q+ EEVKC++R++PIWPAG+AC +A+ QQ TF + Q LQM+RH+G  FQIP+ S+
Sbjct  342  RLCSVQQIEEVKCLIRILPIWPAGLACFVALSQQWTFVVLQCLQMDRHIGPHFQIPSASV  401

Query  359  FVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
             +V+LL + + +P YD+V +P AR+ T +  GIT+LQR G G+  S L+M V+G V
Sbjct  402  PIVALLALTLFIPVYDQVFIPLARRLTGMESGITVLQRQGAGIVISALSMVVAGLV  457



>ref|XP_010932898.1| PREDICTED: protein NRT1/ PTR FAMILY 2.11-like [Elaeis guineensis]
Length=590

 Score =   169 bits (428),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 79/162 (49%), Positives = 113/162 (70%), Gaps = 2/162 (1%)
 Frame = +2

Query  44   YNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIV  223
            +NPP    S  TKLP +  + FL+KAA++   +++  DG   N WRLCS+Q+ E+VKC+V
Sbjct  273  FNPP-HLSSLVTKLPYSDQFKFLDKAAIITPVDEIKPDGHAANPWRLCSLQQVEQVKCLV  331

Query  224  RVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGR-RFQIPAGSLFVVSLLTIAVLLPF  400
            R+IPIW  GI   ++IIQ+ TF + QALQ +RH G+ +F+IPA S  V ++L + + +P 
Sbjct  332  RIIPIWATGIILHISIIQETTFIVFQALQADRHFGKSKFEIPAASFNVFAMLALTIWIPI  391

Query  401  YDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            YDR+++PW R+ T   GG T+LQRMGIG+  SI+AM VSG V
Sbjct  392  YDRIVLPWLRRITGKEGGFTLLQRMGIGIFLSIVAMVVSGLV  433



>ref|XP_010926624.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13-like [Elaeis guineensis]
Length=597

 Score =   169 bits (428),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 84/171 (49%), Positives = 118/171 (69%), Gaps = 3/171 (2%)
 Frame = +2

Query  14   NDSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSI  193
            +D+     V YNPP    +   KLPL+  + FLNKAA+   + ++  DG   N WRLCS+
Sbjct  295  DDAQQQESVLYNPP-TRSARILKLPLSLQFRFLNKAAIKC-DGEIKPDGTI-NSWRLCSV  351

Query  194  QETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLFVVSL  373
            Q+ EEVKC++R++PIW +GI C +A+ QQ TF + QA++M+RHLG  FQIP GS+  ++L
Sbjct  352  QQIEEVKCLMRIVPIWFSGIICFVAMAQQWTFLVLQAMKMDRHLGSHFQIPPGSVGTINL  411

Query  374  LTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            L +A+ LP YD+V VP AR+ TR+  GIT+LQR G+GL FS L+M V+  V
Sbjct  412  LALALFLPIYDKVFVPMARRITRIETGITLLQRQGVGLVFSSLSMVVAALV  462



>ref|XP_007226812.1| hypothetical protein PRUPE_ppa024795mg, partial [Prunus persica]
 gb|EMJ28011.1| hypothetical protein PRUPE_ppa024795mg, partial [Prunus persica]
Length=550

 Score =   168 bits (426),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 80/150 (53%), Positives = 109/150 (73%), Gaps = 1/150 (1%)
 Frame = +2

Query  77   TKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIPIWPAGIA  256
            +K  LT  + FL KAA+VV + DL  DG C N WRLCS+Q+ EEV C ++++PIW +G  
Sbjct  256  SKHSLTTKFSFLKKAALVV-DNDLKDDGSCSNPWRLCSMQQVEEVICFMKILPIWASGGI  314

Query  257  CSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKR  436
            C +A  Q+GTF ++QAL+M+RH+G  F++PAGS+ ++SL+T+ + LPFYDRVL P  RK 
Sbjct  315  CVMAYAQEGTFVVSQALKMDRHIGPNFEMPAGSVKMMSLITLCICLPFYDRVLQPALRKI  374

Query  437  TRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            T+   GIT LQR+GIG  FSIL M V+G V
Sbjct  375  TKHENGITPLQRIGIGYLFSILFMVVAGLV  404



>ref|XP_009389042.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13-like [Musa acuminata 
subsp. malaccensis]
Length=585

 Score =   168 bits (426),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 84/176 (48%), Positives = 117/176 (66%), Gaps = 2/176 (1%)
 Frame = +2

Query  2    RLPA-NDSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRW  178
            RLPA ND+     + Y       +   KLPLT  + FLNKAA+V  E D+  DG+  + W
Sbjct  264  RLPAPNDAAEQETLLYGNHARKSTVVMKLPLTLQFRFLNKAAIVC-EGDMKEDGRSADPW  322

Query  179  RLCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSL  358
            +LCS+Q+ EEVKC+ R++PIW +GI C +A+ QQ T    Q+++M+RHLG  FQIP GSL
Sbjct  323  KLCSVQQIEEVKCLTRIVPIWASGIICFVALTQQWTLAALQSMKMDRHLGPSFQIPPGSL  382

Query  359  FVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
             ++ L+ I + +P YD++LVP A   T V GGIT+LQR G G+A +IL+M V+G V
Sbjct  383  GIICLMAIVLFIPVYDQILVPMATSITGVEGGITLLQRQGAGMAIAILSMVVAGLV  438



>ref|XP_010678592.1| PREDICTED: protein NRT1/ PTR FAMILY 2.11-like [Beta vulgaris 
subsp. vulgaris]
Length=591

 Score =   168 bits (426),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/158 (49%), Positives = 110/158 (70%), Gaps = 1/158 (1%)
 Frame = +2

Query  56   LPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIP  235
            LP  S  + LP T  + FL+KAA++  ++ +  DG   N W+LC++Q+ EEVKCI+RV+P
Sbjct  270  LPTDSVNSNLPHTNQFRFLDKAAIITPDDQIKADGSAANAWKLCTVQQVEEVKCILRVLP  329

Query  236  IWPAGIACSLAIIQQGTFTINQALQMNRHLGR-RFQIPAGSLFVVSLLTIAVLLPFYDRV  412
            IW +GI   + I+Q  T+ I QALQ +RHLG+ +F++PA S  V  ++++ + +P YDR+
Sbjct  330  IWASGIIYHVPIVQMHTYVIFQALQSDRHLGKTKFEVPASSYIVFMMISLTIWIPIYDRI  389

Query  413  LVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            LVP+  K  R  GGITILQRMGIG+ FSIL M V+G V
Sbjct  390  LVPFLEKFKRKEGGITILQRMGIGIVFSILTMLVAGLV  427



>ref|XP_008796703.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13-like [Phoenix dactylifera]
Length=613

 Score =   168 bits (426),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 82/176 (47%), Positives = 120/176 (68%), Gaps = 3/176 (2%)
 Frame = +2

Query  2    RLPANDSGAAAG-VYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRW  178
            RLPA D       + Y+PP    +  TKLPLT  +  LNKAA++  E D+  DG   N W
Sbjct  285  RLPAADGAVEQERMLYDPP-TASNRVTKLPLTLQFSLLNKAAIIC-EGDMKEDGSPANLW  342

Query  179  RLCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSL  358
            RLCS+Q+ EEVKC++R++PIWPAG+AC +A+ QQ TF + Q L M+RHLG  F+IP+ S+
Sbjct  343  RLCSVQQIEEVKCLIRIMPIWPAGLACFVAMSQQTTFVVFQCLSMDRHLGPGFEIPSASV  402

Query  359  FVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
             +V+LL +A+ +P YD++ VP AR+ + +  GI++LQR G+G+  +  +M V+G V
Sbjct  403  PIVALLALALFIPIYDQIFVPVARRLSGMESGISLLQRQGVGIVIAASSMVVAGLV  458



>ref|XP_002517462.1| nitrate transporter, putative [Ricinus communis]
 gb|EEF45004.1| nitrate transporter, putative [Ricinus communis]
Length=625

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 111/158 (70%), Gaps = 1/158 (1%)
 Frame = +2

Query  56   LPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIP  235
            +P  S  +KLP T  + +++KAA++  E+++  DG   N W+LC IQ+ EE KC++RVIP
Sbjct  315  IPKDSINSKLPYTNQFRWVDKAAIITDEDEINSDGSPANPWKLCGIQQVEETKCVMRVIP  374

Query  236  IWPAGIACSLAIIQQGTFTINQALQMNRHLGR-RFQIPAGSLFVVSLLTIAVLLPFYDRV  412
            +W +GI   + ++QQ T+ + QALQ +R LG   FQIPA S+ V S+LT+ + +P YDR+
Sbjct  375  VWASGIIYYVPVVQQNTYAVLQALQADRKLGSGGFQIPAASIIVFSMLTLTIFIPIYDRI  434

Query  413  LVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            +VP+ RK T   GGITILQRMGIG+ FSI+ M VSG V
Sbjct  435  IVPFLRKMTGKDGGITILQRMGIGIIFSIITMIVSGLV  472



>ref|XP_008221751.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13-like [Prunus mume]
Length=586

 Score =   167 bits (424),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/175 (47%), Positives = 115/175 (66%), Gaps = 1/175 (1%)
 Frame = +2

Query  2    RLPANDSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWR  181
             L  ++     GV+ +         +K  LT  + FL KAA+VV + DL  DG C N WR
Sbjct  267  HLKLHNDKRVCGVFLDVSSDGNLVLSKHSLTTKFSFLKKAALVV-DNDLKDDGSCSNPWR  325

Query  182  LCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLF  361
            LCS+Q+ EEV C ++++PIW +G  C +A  Q+GTF ++QAL+M+RH+G  F++PAGS+ 
Sbjct  326  LCSMQQVEEVICFMKILPIWASGGICVMAYAQEGTFVVSQALKMDRHIGPNFEMPAGSVK  385

Query  362  VVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            ++SL+T+ + LPFYDRVL P  RK T+   GIT LQR+GIG  FS L M V+G V
Sbjct  386  MMSLITLCISLPFYDRVLQPALRKITKHENGITPLQRIGIGYLFSFLFMVVAGLV  440



>ref|XP_009408470.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13-like [Musa acuminata 
subsp. malaccensis]
Length=615

 Score =   168 bits (425),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/176 (49%), Positives = 118/176 (67%), Gaps = 2/176 (1%)
 Frame = +2

Query  2    RLPA-NDSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRW  178
            RLPA +D+       YN         TKLPLT  + FLNKAA++  E +   DG   N W
Sbjct  287  RLPAPDDAVEQESSLYNTLARETERMTKLPLTLQFRFLNKAAIIC-EGETKEDGLPVNPW  345

Query  179  RLCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSL  358
            RLCS+Q+ EEVKC++R++PIW +GI C +A+IQQ + T+ QAL+M+RHLGR FQIP GSL
Sbjct  346  RLCSVQQIEEVKCLIRIVPIWASGIICFVALIQQWSLTVLQALKMDRHLGRSFQIPPGSL  405

Query  359  FVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
              ++++ + + +P YDRVLVP AR+ T    GITILQR G G+  ++ +M V+G V
Sbjct  406  ATIAMVALTLFIPVYDRVLVPVARRITGNESGITILQRQGAGMVIAVASMVVAGLV  461



>ref|XP_004510061.1| PREDICTED: nitrate transporter 1.7-like [Cicer arietinum]
Length=583

 Score =   167 bits (424),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 83/175 (47%), Positives = 118/175 (67%), Gaps = 2/175 (1%)
 Frame = +2

Query  2    RLPANDSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWR  181
             LP+++       +Y+PP    S   KLPLTK++ FLNKAA+VV E++L  DG  ++ WR
Sbjct  275  HLPSSEDKHIEA-FYDPPFHHDSER-KLPLTKEFRFLNKAALVVEEKELNSDGSSKDPWR  332

Query  182  LCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLF  361
            LCSIQ+ EE+KC++++IPIW   I  S+ I Q   F+I+QAL+M RH+   F+I AGS+ 
Sbjct  333  LCSIQQVEELKCMLKIIPIWLTSIIVSIPIGQLSIFSISQALKMERHIVPNFEIHAGSVT  392

Query  362  VVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            V+SL+ I + LPFYDRV+ P   K T+   G+T LQR+G+G    ILA+ V+G V
Sbjct  393  VISLIAIGIFLPFYDRVISPLLEKITKHEQGLTTLQRIGVGHVSGILAVVVAGLV  447



>gb|KJB48086.1| hypothetical protein B456_008G052800 [Gossypium raimondii]
Length=512

 Score =   166 bits (421),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 89/175 (51%), Positives = 118/175 (67%), Gaps = 5/175 (3%)
 Frame = +2

Query  2    RLPANDSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWR  181
             LPA++     G +YNPP    S   +L LT+ Y  LNKAA++V +E +  DG C N WR
Sbjct  207  NLPADE---VDGQFYNPPFSR-SLLPELHLTRQYSCLNKAALIVGDE-VKQDGLCENPWR  261

Query  182  LCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLF  361
            LCS Q+ E VKC++ +IPIW   +   LA+ QQGTFT+ QAL+M+   G   +IPAGS+ 
Sbjct  262  LCSGQQVENVKCLINIIPIWLTSVLGFLAMNQQGTFTVAQALKMDLQFGPSIKIPAGSVG  321

Query  362  VVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            V++L+ IA+ LPFYDRV+V    K T+  GGIT+LQR+GIG  FSIL M VSGF+
Sbjct  322  VITLIAIAIWLPFYDRVVVAALEKVTKQEGGITLLQRIGIGNLFSILTMLVSGFI  376



>ref|XP_004971025.1| PREDICTED: nitrate transporter 1.7-like isoform X2 [Setaria italica]
Length=570

 Score =   167 bits (423),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 81/161 (50%), Positives = 112/161 (70%), Gaps = 2/161 (1%)
 Frame = +2

Query  44   YNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIV  223
            YNPP   G+   +LPLT  + FLNK A++  ++D+  DG  RN W LCSIQ+ EEVKC++
Sbjct  253  YNPP-TRGNRIFRLPLTSQFRFLNKGAIMR-DDDINDDGSARNSWELCSIQQIEEVKCLI  310

Query  224  RVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLFVVSLLTIAVLLPFY  403
            R+ PI  +GI C +A+ QQ TF I QA  M+ HLG  F+IPAGS+  +SL+ + V +P Y
Sbjct  311  RIAPICFSGILCFVAMAQQFTFIILQAFTMDSHLGPHFEIPAGSVVSISLIALTVFIPIY  370

Query  404  DRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            D+++VP ARK T + GGIT+LQR G+GL  S ++M V+G V
Sbjct  371  DQLMVPLARKLTGLEGGITLLQRQGVGLVISPISMVVAGLV  411



>gb|KJB48085.1| hypothetical protein B456_008G052800 [Gossypium raimondii]
Length=578

 Score =   167 bits (422),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 89/175 (51%), Positives = 118/175 (67%), Gaps = 5/175 (3%)
 Frame = +2

Query  2    RLPANDSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWR  181
             LPA++     G +YNPP    S   +L LT+ Y  LNKAA++V +E +  DG C N WR
Sbjct  273  NLPADE---VDGQFYNPPFSR-SLLPELHLTRQYSCLNKAALIVGDE-VKQDGLCENPWR  327

Query  182  LCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLF  361
            LCS Q+ E VKC++ +IPIW   +   LA+ QQGTFT+ QAL+M+   G   +IPAGS+ 
Sbjct  328  LCSGQQVENVKCLINIIPIWLTSVLGFLAMNQQGTFTVAQALKMDLQFGPSIKIPAGSVG  387

Query  362  VVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            V++L+ IA+ LPFYDRV+V    K T+  GGIT+LQR+GIG  FSIL M VSGF+
Sbjct  388  VITLIAIAIWLPFYDRVVVAALEKVTKQEGGITLLQRIGIGNLFSILTMLVSGFI  442



>ref|XP_002517460.1| nitrate transporter, putative [Ricinus communis]
 gb|EEF45002.1| nitrate transporter, putative [Ricinus communis]
Length=583

 Score =   167 bits (422),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 108/158 (68%), Gaps = 1/158 (1%)
 Frame = +2

Query  56   LPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIP  235
            +P  S  +KLP T  + +L+KAA+V  E+    DG   N W+LCSIQ+ EE KC++RVIP
Sbjct  275  MPANSINSKLPYTNQFRWLDKAAIVTDEDQFNSDGSAANPWKLCSIQQVEEAKCVLRVIP  334

Query  236  IWPAGIACSLAIIQQGTFTINQALQMNRHLGRR-FQIPAGSLFVVSLLTIAVLLPFYDRV  412
            IW  GI   + ++QQ T+ + Q+LQ +R +G   F+IPA S+ V ++LT+ + +P YDR+
Sbjct  335  IWATGIIYYVPVVQQNTYAVLQSLQADRRIGNNGFEIPAASIIVFAMLTLTIFIPIYDRI  394

Query  413  LVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            +VP  RK T   GGITILQRMGIGL FSIL M VSG +
Sbjct  395  IVPSLRKITGKEGGITILQRMGIGLIFSILTMIVSGLI  432



>gb|AES96528.2| peptide/nitrate transporter [Medicago truncatula]
Length=577

 Score =   167 bits (422),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 78/170 (46%), Positives = 118/170 (69%), Gaps = 3/170 (2%)
 Frame = +2

Query  17   DSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQ  196
            D G  +GV+Y+PP+   +   K PLTK++  LNKAA++V E +L  DG   N WRLCSIQ
Sbjct  271  DKGDTSGVFYDPPIE--NMEPKFPLTKEFRCLNKAAIMV-ENELNDDGSNNNPWRLCSIQ  327

Query  197  ETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLFVVSLL  376
            + EE+KCI++++PIW  GI   +   Q   F ++QA++M++HL + F+IP G + +V++L
Sbjct  328  QVEELKCILKMMPIWVTGIITYIPTGQLSIFPMSQAMKMDKHLTQNFEIPPGWMIIVTML  387

Query  377  TIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            TIA+++PFYD+V+ P   K T   GG+T LQR+G+G  F+IL M ++G V
Sbjct  388  TIAIVIPFYDKVISPTLTKMTNQDGGLTNLQRIGLGHFFAILTMVIAGLV  437



>ref|XP_008353106.1| PREDICTED: uncharacterized protein LOC103416653 [Malus domestica]
Length=1143

 Score =   170 bits (430),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 77/140 (55%), Positives = 107/140 (76%), Gaps = 1/140 (1%)
 Frame = +2

Query  107  FLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGT  286
            FLNKAAV+ ++ DL  DG   + WRLCS+Q+ EE+KC+++ IPIW + I    A+ QQGT
Sbjct  861  FLNKAAVI-LDNDLKPDGSPVDNWRLCSVQQVEELKCVLKTIPIWASAIVSLTAMTQQGT  919

Query  287  FTINQALQMNRHLGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITIL  466
            FT++QAL+M+RHLG  F++PAGS+ V+S LTI + LP YDR+LVP  RK T+  GG+T+L
Sbjct  920  FTVSQALKMDRHLGANFEVPAGSISVISFLTIGLWLPIYDRILVPSLRKITKREGGVTVL  979

Query  467  QRMGIGLAFSILAMAVSGFV  526
            QR GIG+ FS+L+M V+G +
Sbjct  980  QRCGIGIIFSVLSMTVAGVI  999



>ref|XP_007044381.1| Nitrate transporter 1.7, putative [Theobroma cacao]
 gb|EOY00213.1| Nitrate transporter 1.7, putative [Theobroma cacao]
Length=587

 Score =   167 bits (422),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 115/162 (71%), Gaps = 2/162 (1%)
 Frame = +2

Query  41   YYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCI  220
            +Y+PPL  G    +L LT+ Y   NKAA++  +E +  +G C N WRLCS+Q+ ++VKC+
Sbjct  291  FYDPPLKRG-LLLELHLTRRYSCFNKAALIEGDE-VNSEGVCVNPWRLCSVQQVQDVKCL  348

Query  221  VRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLFVVSLLTIAVLLPF  400
            V +IPIW   I   LA+ QQGTFT++QAL+M+ H G   +IPAGS+ V++L+ IAV LPF
Sbjct  349  VNIIPIWLTSILGFLAMNQQGTFTVSQALKMDLHFGPYIKIPAGSVGVITLIAIAVWLPF  408

Query  401  YDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            YDRVLVP   K T+  GGIT+LQR+GIG  FSIL M VSG +
Sbjct  409  YDRVLVPALEKITKQEGGITLLQRIGIGNLFSILTMLVSGLI  450



>ref|XP_004971024.1| PREDICTED: nitrate transporter 1.7-like isoform X1 [Setaria italica]
Length=610

 Score =   166 bits (421),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 81/161 (50%), Positives = 112/161 (70%), Gaps = 2/161 (1%)
 Frame = +2

Query  44   YNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIV  223
            YNPP   G+   +LPLT  + FLNK A++  ++D+  DG  RN W LCSIQ+ EEVKC++
Sbjct  293  YNPP-TRGNRIFRLPLTSQFRFLNKGAIMR-DDDINDDGSARNSWELCSIQQIEEVKCLI  350

Query  224  RVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLFVVSLLTIAVLLPFY  403
            R+ PI  +GI C +A+ QQ TF I QA  M+ HLG  F+IPAGS+  +SL+ + V +P Y
Sbjct  351  RIAPICFSGILCFVAMAQQFTFIILQAFTMDSHLGPHFEIPAGSVVSISLIALTVFIPIY  410

Query  404  DRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            D+++VP ARK T + GGIT+LQR G+GL  S ++M V+G V
Sbjct  411  DQLMVPLARKLTGLEGGITLLQRQGVGLVISPISMVVAGLV  451



>emb|CDP14879.1| unnamed protein product [Coffea canephora]
Length=584

 Score =   166 bits (419),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/154 (50%), Positives = 108/154 (70%), Gaps = 1/154 (1%)
 Frame = +2

Query  68   SAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIPIWPA  247
            S   +L  T  + FLNKAA++  E+ +  DG   N WRLC IQ+ EEVKC++RVIP+W A
Sbjct  272  SINARLAYTDQFRFLNKAAIITSEDQINPDGSAANPWRLCDIQQVEEVKCLLRVIPVWIA  331

Query  248  GIACSLAIIQQGTFTINQALQMNRHLGR-RFQIPAGSLFVVSLLTIAVLLPFYDRVLVPW  424
            GI   ++++QQ  + + QALQ +R  G+ +F+IPA S  V ++L++ + +P +DR++VPW
Sbjct  332  GIIYFVSVVQQQNYAVFQALQADRRFGKSKFKIPAASYIVFAMLSLTIWIPIWDRIVVPW  391

Query  425  ARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
             RKRT   GG+TILQRMGIG+A SIL M VSG V
Sbjct  392  LRKRTGHEGGLTILQRMGIGMALSILTMVVSGLV  425



>gb|AHV83614.1| nitrate transporter [Camellia sinensis]
Length=605

 Score =   166 bits (419),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 111/158 (70%), Gaps = 1/158 (1%)
 Frame = +2

Query  56   LPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIP  235
            +PP S  +KLP T+ + FL+KAA+   ++ +  +G   N WRLC++Q+ EEVKC++RVIP
Sbjct  279  MPPKSINSKLPYTQQFRFLDKAAIRTPDDQINPNGSSANLWRLCTMQQVEEVKCVLRVIP  338

Query  236  IWPAGIACSLAIIQQGTFTINQALQMNRHLGR-RFQIPAGSLFVVSLLTIAVLLPFYDRV  412
            IW + I   +A++QQ TF + QALQ NRH G+ +FQIPA S  V S+LT+++ +P YDR+
Sbjct  339  IWASAILYFVALVQQQTFVVFQALQSNRHFGKTKFQIPAASYPVFSMLTLSLWIPIYDRI  398

Query  413  LVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            LVP  R+ T   GGITILQRMGIG+  S L   V+ F+
Sbjct  399  LVPTLRRFTGKEGGITILQRMGIGIGLSALTSLVAAFI  436



>ref|XP_006645212.1| PREDICTED: nitrate transporter 1.7-like [Oryza brachyantha]
Length=490

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/176 (45%), Positives = 115/176 (65%), Gaps = 3/176 (2%)
 Frame = +2

Query  2    RLPA-NDSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRW  178
            +LP  +D        YNPP   G+   +LPLT  + FLN+AA++    D+  DG  RN W
Sbjct  159  KLPCPHDINQQELTLYNPP-SRGNRMFRLPLTSQFRFLNRAAIIR-NGDINADGSARNSW  216

Query  179  RLCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSL  358
             LC+IQ+ EEVKC++R++PI+ +G+ C +A+ QQ T+ I Q   M+ H G  F+IPAGS+
Sbjct  217  ELCNIQQIEEVKCLIRIVPIYVSGVLCFVALAQQFTYIILQTFTMDCHFGMHFEIPAGSV  276

Query  359  FVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
              +SL+ + + +P YDR+LVP AR+ T V  GIT+LQR GIGL  S ++M V+G V
Sbjct  277  VSISLIALTIFIPIYDRILVPIARRFTGVESGITLLQRQGIGLVISSISMVVAGLV  332



>gb|KHF99049.1| Nitrate transporter 1.7 -like protein [Gossypium arboreum]
Length=578

 Score =   164 bits (416),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 118/175 (67%), Gaps = 5/175 (3%)
 Frame = +2

Query  2    RLPANDSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWR  181
             LP ++     G +YNPP    S   +L  T+ Y  LNKAA++V +E +  DG C N W+
Sbjct  273  NLPVDE---VDGQFYNPPFSR-SLLPELHPTRQYSCLNKAALIVGDE-VKQDGLCENPWK  327

Query  182  LCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLF  361
            LCS+Q+ E+VKC++ +IPIW   +   LA+ QQGTFT+ QAL+M+ H G   +IPAGS+ 
Sbjct  328  LCSVQQVEDVKCLINIIPIWLTSVLGFLAMNQQGTFTVAQALKMDLHFGPSIKIPAGSVG  387

Query  362  VVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            V++L+ IA+ LPFYD V+V    K T+  GGIT+LQR+GIG  FSIL M VSGF+
Sbjct  388  VITLIAIAIWLPFYDGVVVAALEKVTKQEGGITLLQRIGIGNLFSILTMLVSGFI  442



>dbj|BAK04665.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=607

 Score =   164 bits (416),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 82/161 (51%), Positives = 111/161 (69%), Gaps = 2/161 (1%)
 Frame = +2

Query  44   YNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIV  223
            ++PP+  G    +LPLT  + FLNK A+V  + D+  DG  RN W LCSIQ+ EEVKC++
Sbjct  290  FSPPIG-GRRIFRLPLTSQFRFLNKGAIVR-DGDINDDGSARNSWELCSIQQIEEVKCLL  347

Query  224  RVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLFVVSLLTIAVLLPFY  403
            R++PI  +GI C +A+ QQ T+ I Q L M+ HLG  F+IPAGS+  +SL+ +   LP Y
Sbjct  348  RIVPICISGIICFVALAQQFTYIILQTLTMDCHLGTHFEIPAGSVISISLIALTAFLPIY  407

Query  404  DRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            DR+LVP AR+ TRV  GIT+LQR GIGL  S ++M V+G V
Sbjct  408  DRILVPIARRFTRVESGITLLQRQGIGLVISPISMVVAGLV  448



>ref|XP_010232727.1| PREDICTED: protein NRT1/ PTR FAMILY 2.12-like [Brachypodium distachyon]
Length=600

 Score =   164 bits (414),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 82/170 (48%), Positives = 111/170 (65%), Gaps = 2/170 (1%)
 Frame = +2

Query  17   DSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQ  196
            D+     + YNPP   G+   +LPLT  + FLNK  +V  E D+  DG  RN W LCSIQ
Sbjct  279  DTNQQELLLYNPP-TRGNRIFRLPLTSQFRFLNKGTIVR-EGDINSDGSARNPWELCSIQ  336

Query  197  ETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLFVVSLL  376
            + EEVKC++R++PI  +GI C +A+ QQ T+ I Q L M+ HLG  F+IPA S+  +S +
Sbjct  337  QIEEVKCLIRIVPICISGIMCFVALAQQYTYIILQILTMDCHLGPHFEIPAASVITISFI  396

Query  377  TIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
             + V +P YDR+LVP AR+ T V  GIT+LQR GIGL  S ++M V+G V
Sbjct  397  ALTVFMPIYDRILVPMARRFTGVESGITLLQRQGIGLVISPISMVVAGLV  446



>ref|XP_010933709.1| PREDICTED: protein NRT1/ PTR FAMILY 2.9-like [Elaeis guineensis]
Length=597

 Score =   163 bits (413),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 84/176 (48%), Positives = 118/176 (67%), Gaps = 6/176 (3%)
 Frame = +2

Query  2    RLPANDSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWR  181
            +LPA+   +     +NPP    +  TKLP T+   FL+KAA+V   +++  +G   N WR
Sbjct  266  KLPADSKTS----LFNPP-HLSALVTKLPHTEQLRFLDKAAIVTTADEIKPNGYAANPWR  320

Query  182  LCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGR-RFQIPAGSL  358
            LCSIQ+ EEVKC+ R+IPIW  GI   LAI+Q+ T+ I QALQ +R  G+ +FQIPA S+
Sbjct  321  LCSIQQVEEVKCLARIIPIWSTGIIFYLAIVQETTYVIFQALQADRRFGKSKFQIPAASI  380

Query  359  FVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
             V ++L + + +P YDR+LVP  R+ T   GG+T+LQRMGIG+  SI+AM +SG V
Sbjct  381  NVFAMLALTIWVPIYDRILVPQLRRITGRGGGLTLLQRMGIGIILSIIAMVISGLV  436



>ref|XP_003553207.1| PREDICTED: nitrate transporter 1.7-like [Glycine max]
Length=574

 Score =   163 bits (412),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 80/175 (46%), Positives = 120/175 (69%), Gaps = 4/175 (2%)
 Frame = +2

Query  2    RLPANDSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWR  181
             +PA +     G +Y+PPL   S  TKLPLT ++  LNKAA+V  E +L  DG  ++ WR
Sbjct  268  HVPAAED--TEGAFYDPPLHDDSE-TKLPLTNEFRCLNKAAIVE-ENELNNDGSSKDPWR  323

Query  182  LCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLF  361
            LCS+Q+ EE+KC+++++PI+   I  ++ I QQ  F ++QAL+M+R+LG  F+I AGS+ 
Sbjct  324  LCSVQQIEELKCLLKIMPIFITSIIVNIPIGQQAIFGVSQALKMDRNLGHNFEIHAGSVN  383

Query  362  VVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            V+ +L+I V LP YD+++ P   K T+  GG+T LQR+G+G AF +L+M VSG V
Sbjct  384  VIMMLSIGVFLPIYDQIIAPALEKITKQEGGLTTLQRIGLGHAFGVLSMVVSGLV  438



>ref|XP_002517459.1| nitrate transporter, putative [Ricinus communis]
 gb|EEF45001.1| nitrate transporter, putative [Ricinus communis]
Length=615

 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 105/158 (66%), Gaps = 1/158 (1%)
 Frame = +2

Query  56   LPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIP  235
            +P  S  TKLP T  + +L+KAA++  E+    DG   N WRLC  Q+ EE KCI+RVIP
Sbjct  306  VPTNSINTKLPKTNQFRWLDKAAIITDEDQFNSDGSAANPWRLCGTQQVEEAKCIMRVIP  365

Query  236  IWPAGIACSLAIIQQGTFTINQALQMNRHLGRR-FQIPAGSLFVVSLLTIAVLLPFYDRV  412
            IW +GI   + ++QQ T+ + QALQ +R LG   F++P  S  V ++LT+ + +P YDR+
Sbjct  366  IWASGIIYYIPVVQQNTYAVLQALQADRRLGSSGFEVPGASFIVFAMLTLTIFIPIYDRI  425

Query  413  LVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            +VP  RK T   GGI+ILQRMGIG+ FSIL M VSG V
Sbjct  426  IVPSLRKITGKEGGISILQRMGIGIIFSILTMIVSGLV  463



>ref|XP_007153856.1| hypothetical protein PHAVU_003G070400g [Phaseolus vulgaris]
 gb|ESW25850.1| hypothetical protein PHAVU_003G070400g [Phaseolus vulgaris]
Length=591

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 81/175 (46%), Positives = 117/175 (67%), Gaps = 4/175 (2%)
 Frame = +2

Query  2    RLPANDSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWR  181
             LPA +     G +Y+PPL   S   K+ LTK++G LNKAA+V +E +L  DG  +N WR
Sbjct  285  HLPAAED--TQGAFYDPPLQHDSE-RKMLLTKEFGHLNKAALV-LENELEDDGSNKNPWR  340

Query  182  LCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLF  361
            L SIQ  EE+KC+ +++PI+   I  ++ + QQ  F ++QA++M+RHLG  F+I  GS+ 
Sbjct  341  LSSIQRVEELKCLFKIMPIFVTSIIVNIPLGQQAIFGVSQAMKMDRHLGHNFEIHPGSVN  400

Query  362  VVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            V+ L+ I ++LPFYDR++VP   K T+  GG+T LQR+G G AF  L+M VSG V
Sbjct  401  VIMLVAIGIVLPFYDRIVVPALEKVTKQEGGLTTLQRIGFGHAFGFLSMVVSGLV  455



>ref|XP_010256190.1| PREDICTED: protein NRT1/ PTR FAMILY 2.9-like [Nelumbo nucifera]
Length=591

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 109/158 (69%), Gaps = 1/158 (1%)
 Frame = +2

Query  56   LPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIP  235
            LP  S  + LP TK + FL+KAA+  +++++  DG   + WRLC +Q+ EEVKC+VRVIP
Sbjct  271  LPANSLTSNLPYTKQFRFLDKAAIKTVDDEVNPDGSAVDPWRLCRMQQVEEVKCLVRVIP  330

Query  236  IWPAGIACSLAIIQQGTFTINQALQMNRHL-GRRFQIPAGSLFVVSLLTIAVLLPFYDRV  412
            IW +GI    AI+QQ T+ I QALQ +R L G  F++PA S  V ++L++ + LP YDR+
Sbjct  331  IWVSGILYYAAIVQQHTYVIFQALQSDRRLPGSNFRVPAASYIVFAMLSLTLWLPIYDRI  390

Query  413  LVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            +VP  R+ T   GGIT+LQRMGIG+A S+L M VS  V
Sbjct  391  IVPVLRRFTGKEGGITLLQRMGIGMALSVLTMVVSALV  428



>ref|NP_001045170.1| Os01g0913300 [Oryza sativa Japonica Group]
 dbj|BAD82445.1| putative nitrate transporter NRT1-5 [Oryza sativa Japonica Group]
 dbj|BAF07084.1| Os01g0913300 [Oryza sativa Japonica Group]
 dbj|BAG94725.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE55874.1| hypothetical protein OsJ_04516 [Oryza sativa Japonica Group]
Length=600

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/176 (45%), Positives = 116/176 (66%), Gaps = 3/176 (2%)
 Frame = +2

Query  2    RLPA-NDSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRW  178
            +LP  +D      + YNPP   G+   +LPLT  + FLNK A+V + +D+  DG  RN W
Sbjct  268  KLPCPHDINQQGLMLYNPP-SKGNRVFRLPLTSQFRFLNKGAIV-MGDDINVDGSARNSW  325

Query  179  RLCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSL  358
             LC++Q+ EEVKC++R++P+  +G+ C +A+ QQ T+ I Q   M+ H G  F+IPAGS+
Sbjct  326  ELCNVQQIEEVKCLIRIVPVCISGVLCFVALAQQFTYIILQTFTMDCHFGTHFEIPAGSV  385

Query  359  FVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
              +SL+ + + +P YDR+LVP AR  T V  GIT+LQR GIGLA S ++M V+G V
Sbjct  386  VSISLIALTLFIPIYDRILVPIARGFTGVESGITLLQRQGIGLAISPISMVVAGLV  441



>emb|CDP14877.1| unnamed protein product [Coffea canephora]
Length=437

 Score =   159 bits (403),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 105/156 (67%), Gaps = 1/156 (1%)
 Frame = +2

Query  56   LPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIP  235
            + P S  +KLP T  +GFLNKAA++  E+ +  DG   N WRLCSIQ+ EEVKCI+RV+P
Sbjct  273  ISPNSINSKLPYTDQFGFLNKAAIITPEDHINADGSAHNPWRLCSIQQVEEVKCIIRVVP  332

Query  236  IWPAGIACSLAIIQQGTFTINQALQMNRHLGR-RFQIPAGSLFVVSLLTIAVLLPFYDRV  412
            IW AGI  S+ +    T+ + QA+Q +R LG  RF+IPA S  +  +L++   +P YDR+
Sbjct  333  IWIAGIIYSIVLNLMQTYGVFQAIQADRRLGNTRFKIPAASYTIFQMLSLTAWIPIYDRI  392

Query  413  LVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSG  520
            +VP+ RK T+   GIT+LQ+MG+G+  ++  M VS 
Sbjct  393  IVPYLRKITKKEDGITVLQKMGVGMVIAVATMVVSA  428



>emb|CDP14880.1| unnamed protein product [Coffea canephora]
Length=588

 Score =   161 bits (408),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 107/157 (68%), Gaps = 1/157 (1%)
 Frame = +2

Query  59   PPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIPI  238
            PP S  +KL  T  + FL+KAA++  E+++  DG   N WRLCSIQ+ EE KC+ RVIPI
Sbjct  274  PPKSINSKLSYTHQFRFLDKAAIITPEDEIKSDGTAANPWRLCSIQQVEEAKCVFRVIPI  333

Query  239  WPAGIACSLAIIQQGTFTINQALQMNRHLGR-RFQIPAGSLFVVSLLTIAVLLPFYDRVL  415
            W A I   +AIIQQ  + + QALQ NRHLG+  FQIPA +  + S+L++ + +P YDR +
Sbjct  334  WAAAIIYHVAIIQQQQYVVFQALQSNRHLGKSSFQIPASTYTIFSMLSLTLWVPIYDRFV  393

Query  416  VPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            VP+ R+ T   GGITILQR+GIGL   +++  ++ F+
Sbjct  394  VPFLRRLTGKEGGITILQRIGIGLFLVVISSLIAAFI  430



>emb|CBH32526.1| peptide transporter, putative, expressed [Triticum aestivum]
Length=609

 Score =   160 bits (406),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 115/176 (65%), Gaps = 3/176 (2%)
 Frame = +2

Query  2    RLPANDS-GAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRW  178
            +LP +D+      + +NPP   G    +LPLT  + FLNK AV+  + D+  DG  RN W
Sbjct  277  KLPNSDNISQQELLLFNPP-TRGHRIFRLPLTSQFRFLNKGAVLR-DGDINDDGSARNSW  334

Query  179  RLCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSL  358
             LCSIQ+ EEVKC++R++PI  +GI C +A++QQ T T  QAL M+ HLG  F+IP GS+
Sbjct  335  ELCSIQQIEEVKCLIRIVPICISGIVCFVALVQQYTSTSFQALTMDCHLGTHFEIPPGSV  394

Query  359  FVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
              +S + +   LP YD++LVP AR+ T V  GIT+LQR GIGL  S ++M V+G V
Sbjct  395  ISISFIALTAFLPIYDQILVPIARRFTGVESGITLLQRQGIGLVISPISMVVAGLV  450



>gb|KHN48151.1| Nitrate transporter 1.7 [Glycine soja]
Length=553

 Score =   160 bits (405),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 79/175 (45%), Positives = 119/175 (68%), Gaps = 4/175 (2%)
 Frame = +2

Query  2    RLPANDSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWR  181
             +PA +     G +Y+ PL   S  TKLPLT ++  LNKAA+V  E +L  DG  ++ WR
Sbjct  247  HVPAAEE--TEGAFYDHPLHDDSE-TKLPLTNEFRCLNKAAIVE-ENELNNDGSSKDPWR  302

Query  182  LCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLF  361
            LCS+Q+ EE+KC+++++PI+   I  ++ I QQ  F ++QAL+M+R+LG  F+I AGS+ 
Sbjct  303  LCSVQQIEELKCLLKIMPIFITSIIVNIPIGQQAIFGVSQALKMDRNLGHNFEIHAGSVN  362

Query  362  VVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            V+ +L+I V LP YD+++ P   K T+  GG+T LQR+G+G AF +L+M VSG V
Sbjct  363  VIMMLSIGVFLPIYDQIIAPALEKITKQEGGLTTLQRIGLGHAFGVLSMVVSGLV  417



>ref|XP_007037200.1| Major facilitator superfamily protein, putative [Theobroma cacao]
 gb|EOY21701.1| Major facilitator superfamily protein, putative [Theobroma cacao]
Length=588

 Score =   160 bits (405),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 108/158 (68%), Gaps = 1/158 (1%)
 Frame = +2

Query  56   LPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIP  235
            +P  S  +KL  +    FLNKAA++  E+++  DG   N WRLCS+Q+ EE+KC++RV+P
Sbjct  274  IPKSSINSKLSYSDQLRFLNKAAILTPEDEINSDGSAANPWRLCSLQKVEEIKCVIRVVP  333

Query  236  IWPAGIACSLAIIQQGTFTINQALQMNRHLGRR-FQIPAGSLFVVSLLTIAVLLPFYDRV  412
            +W AGI   +A++QQ T+ + QALQ NRHLG   F IPA S  +  ++ + + +P YDR+
Sbjct  334  VWAAGIIYYVAMVQQQTYVVFQALQSNRHLGNTGFNIPAASYGIFIMIGLTIWIPIYDRI  393

Query  413  LVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            +VPW ++ T+  GGIT+LQ+MGIG+  +I+ M +S  V
Sbjct  394  IVPWLQRYTKKEGGITLLQKMGIGMVLAIVTMLLSAIV  431



>ref|XP_009397036.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=587

 Score =   160 bits (405),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 82/176 (47%), Positives = 116/176 (66%), Gaps = 2/176 (1%)
 Frame = +2

Query  2    RLPA-NDSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRW  178
            RLP+ ND+     + Y+      +   KLPLT  + FLNKAA++  E +   DG+  + W
Sbjct  266  RLPSPNDAVQQESLLYSNLAQESAEEMKLPLTLQFRFLNKAAIIC-EGERKEDGQPADPW  324

Query  179  RLCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSL  358
            RLCS+ + E+VKC +RVIPIW +GI C +A+ QQ TF   Q+L+M+RHLG  F++P GSL
Sbjct  325  RLCSVHQIEQVKCAMRVIPIWASGIICFVALSQQWTFAALQSLKMDRHLGPSFEVPPGSL  384

Query  359  FVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
             ++SLL I + +P YDR LVP AR  T +  GIT+LQR G G+  +I++M V+G V
Sbjct  385  GIISLLAIILFIPVYDRALVPMARSLTGIESGITLLQRQGAGMVVAIISMVVAGLV  440



>ref|XP_009397037.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=564

 Score =   160 bits (404),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 82/176 (47%), Positives = 116/176 (66%), Gaps = 2/176 (1%)
 Frame = +2

Query  2    RLPA-NDSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRW  178
            RLP+ ND+     + Y+      +   KLPLT  + FLNKAA++  E +   DG+  + W
Sbjct  243  RLPSPNDAVQQESLLYSNLAQESAEEMKLPLTLQFRFLNKAAIIC-EGERKEDGQPADPW  301

Query  179  RLCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSL  358
            RLCS+ + E+VKC +RVIPIW +GI C +A+ QQ TF   Q+L+M+RHLG  F++P GSL
Sbjct  302  RLCSVHQIEQVKCAMRVIPIWASGIICFVALSQQWTFAALQSLKMDRHLGPSFEVPPGSL  361

Query  359  FVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
             ++SLL I + +P YDR LVP AR  T +  GIT+LQR G G+  +I++M V+G V
Sbjct  362  GIISLLAIILFIPVYDRALVPMARSLTGIESGITLLQRQGAGMVVAIISMVVAGLV  417



>gb|KDP45468.1| hypothetical protein JCGZ_09717 [Jatropha curcas]
Length=547

 Score =   160 bits (404),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 108/158 (68%), Gaps = 1/158 (1%)
 Frame = +2

Query  56   LPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIP  235
            +   S  ++L  T  +G+L+KAA++  E+++  +G   N W+LCSIQ+ EE KC+VRVIP
Sbjct  240  ISSNSLNSRLLHTDQFGWLDKAAIISPEDEIDSNGSSTNPWKLCSIQQVEEAKCVVRVIP  299

Query  236  IWPAGIACSLAIIQQGTFTINQALQMNRHLGRR-FQIPAGSLFVVSLLTIAVLLPFYDRV  412
            IW +GI   LAIIQQ TF + QALQ +R LG + FQIPA S  + ++L + + +P YDR+
Sbjct  300  IWLSGIIYFLAIIQQHTFVVLQALQSDRRLGNKGFQIPAASFVIFTMLGLTIWIPVYDRI  359

Query  413  LVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            LVP+ RK T+   GIT+LQRMGIGL  SIL M  S  V
Sbjct  360  LVPFLRKLTKNEVGITLLQRMGIGLVLSILCMLTSALV  397



>ref|XP_010923294.1| PREDICTED: protein NRT1/ PTR FAMILY 2.11-like [Elaeis guineensis]
Length=597

 Score =   160 bits (404),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/162 (46%), Positives = 109/162 (67%), Gaps = 2/162 (1%)
 Frame = +2

Query  44   YNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIV  223
            +NPP    S  +KLP +  +  ++KAA+    +++  +G   N WRLCS+Q+ E+VKC+ 
Sbjct  275  FNPP-HHSSLVSKLPYSDQFRLVDKAAIRTPMDEVKPNGDAANPWRLCSLQQVEQVKCLA  333

Query  224  RVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGR-RFQIPAGSLFVVSLLTIAVLLPF  400
            R+IPIW  GI   +AI+Q+ TF + Q LQ +RH G+ +FQIPA S  V ++L + + +P 
Sbjct  334  RIIPIWATGIILYVAIVQETTFVVFQGLQADRHFGKSKFQIPAASFTVFAMLALTIWIPV  393

Query  401  YDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            YDR+LVPW R+ T   GG T+LQRMGIG+  S++AM VSG V
Sbjct  394  YDRILVPWLRRVTGKEGGFTLLQRMGIGIVLSVVAMIVSGLV  435



>ref|XP_009103775.1| PREDICTED: LOW QUALITY PROTEIN: protein NRT1/ PTR FAMILY 2.12-like 
[Brassica rapa]
Length=562

 Score =   160 bits (404),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 113/177 (64%), Gaps = 16/177 (9%)
 Frame = +2

Query  2    RLPANDSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWR  181
            +LP  D G     YY+PPL PG   +KLPLT         A V  E DLT      N+WR
Sbjct  259  KLPVEDDGTVE--YYDPPLKPG-VLSKLPLTXK-------AAVNTEGDLTSAVVPVNKWR  308

Query  182  LCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLF  361
            LCS+QE EEVKC++R+IP+W AGI   + +  Q TF + QA++M+RH+G  F+IPAGS+ 
Sbjct  309  LCSVQEVEEVKCLIRIIPVWSAGIISVVTMSTQVTFIVPQAMKMDRHMGPHFEIPAGSVS  368

Query  362  VVSLLTIAVLLPFYDRVLVP--WARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            V+S +TI + LP YDRVLVP  W  ++ RV    T+LQRMGIG+ F I++M  +  V
Sbjct  369  VISFITIGIWLPIYDRVLVPSLWRIRKFRV----TLLQRMGIGIVFGIVSMFTAAIV  421



>ref|XP_006838790.1| hypothetical protein AMTR_s00002p00259450 [Amborella trichopoda]
 gb|ERN01359.1| hypothetical protein AMTR_s00002p00259450 [Amborella trichopoda]
Length=560

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 109/158 (69%), Gaps = 9/158 (6%)
 Frame = +2

Query  59   PPGSAA--TKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVI  232
            PPG+     KL LT  + FL KAA+       T      +RWRLC++Q+ EEVKC++RV+
Sbjct  265  PPGTNVLNVKLQLTNQFSFLTKAAIQ------TSSDSAVDRWRLCNVQQVEEVKCLLRVV  318

Query  233  PIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLFVVSLLTIAVLLPFYDRV  412
            PIW +GI  ++A++QQ T+ I QA++MNRHLG RF+IP GS  V S+L + + LP YDR+
Sbjct  319  PIWASGIIYNVAVVQQTTYAILQAMKMNRHLG-RFEIPPGSFNVFSMLMLTLWLPVYDRL  377

Query  413  LVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            ++PWAR+ T    GIT+LQRMG G+  +ILAM V+G V
Sbjct  378  VMPWARRATGKEEGITLLQRMGTGMVIAILAMVVAGLV  415



>ref|XP_010923296.1| PREDICTED: protein NRT1/ PTR FAMILY 2.11-like isoform X2 [Elaeis 
guineensis]
Length=593

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/162 (45%), Positives = 109/162 (67%), Gaps = 2/162 (1%)
 Frame = +2

Query  44   YNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIV  223
            +NPP    S  +KLP T  + FL+KAA++   + +  +G   N WRLCS+Q+ E+VKC+ 
Sbjct  276  FNPP-HLSSLVSKLPFTNQFRFLDKAAIMTPMDAIKPNGHAANPWRLCSLQQVEQVKCLA  334

Query  224  RVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGR-RFQIPAGSLFVVSLLTIAVLLPF  400
            R+IPIW +G    +A++Q+ +F + Q LQ +RH G+ +F+IPA S  V S+L + + +P 
Sbjct  335  RIIPIWASGTILFVALVQESSFVVFQGLQADRHFGKSKFEIPAASFTVFSMLALTIWIPV  394

Query  401  YDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            YDR+LVPW R+ T    G T+LQRMGIG+  +++AM VSG V
Sbjct  395  YDRILVPWLRRATGKEAGFTLLQRMGIGIVLTVVAMVVSGLV  436



>ref|XP_006838787.1| hypothetical protein AMTR_s00002p00259170 [Amborella trichopoda]
 gb|ERN01356.1| hypothetical protein AMTR_s00002p00259170 [Amborella trichopoda]
Length=597

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/155 (48%), Positives = 105/155 (68%), Gaps = 0/155 (0%)
 Frame = +2

Query  62   PGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIPIW  241
            P    TKL LT  + FL+KAA++   ++L  DG   + WRLC +Q+ EE KC++RV P+W
Sbjct  282  PEPVGTKLKLTDQFRFLSKAAIITDADELNPDGSPVDPWRLCPVQQVEEAKCLLRVAPVW  341

Query  242  PAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVP  421
             +G+ C  A++Q GTF+INQA +M+RH+G  F+IP GSL V ++LT+   +P YDRV+VP
Sbjct  342  ASGVICFTAVVQMGTFSINQATKMDRHIGPNFKIPPGSLTVFAMLTLTFWIPIYDRVIVP  401

Query  422  WARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
              R  T    GIT+LQRMGIGL  SI++M  +  V
Sbjct  402  ALRPITMKETGITLLQRMGIGLFISIISMLAAAIV  436



>ref|XP_004489982.1| PREDICTED: nitrate transporter 1.7-like [Cicer arietinum]
Length=570

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 78/175 (45%), Positives = 120/175 (69%), Gaps = 5/175 (3%)
 Frame = +2

Query  2    RLPANDSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWR  181
            RLPA  +G    V+Y+PPL       KLPLTK++  LNKAA++V E +L  D    + WR
Sbjct  264  RLPA--TGETGRVFYDPPLE--KMEPKLPLTKEFRCLNKAALMV-ENELNDDESNNDPWR  318

Query  182  LCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLF  361
            LCSIQ+ EE+KC+++++PIW  GI   +   Q   F ++QA++M++HL + F+IP G L 
Sbjct  319  LCSIQQIEELKCLLKIMPIWLTGIITYIPTGQLAIFPMSQAMKMDKHLTKNFEIPPGWLI  378

Query  362  VVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            ++++LTIA+++P Y++V+ P   K T+  GG+T LQR+GIG  F+I+ M ++GFV
Sbjct  379  ILTMLTIAIIIPIYEKVISPILTKVTKQEGGLTTLQRIGIGHFFAIVTMVIAGFV  433



>ref|XP_010923295.1| PREDICTED: protein NRT1/ PTR FAMILY 2.11-like isoform X1 [Elaeis 
guineensis]
Length=617

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/162 (45%), Positives = 109/162 (67%), Gaps = 2/162 (1%)
 Frame = +2

Query  44   YNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIV  223
            +NPP    S  +KLP T  + FL+KAA++   + +  +G   N WRLCS+Q+ E+VKC+ 
Sbjct  300  FNPP-HLSSLVSKLPFTNQFRFLDKAAIMTPMDAIKPNGHAANPWRLCSLQQVEQVKCLA  358

Query  224  RVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGR-RFQIPAGSLFVVSLLTIAVLLPF  400
            R+IPIW +G    +A++Q+ +F + Q LQ +RH G+ +F+IPA S  V S+L + + +P 
Sbjct  359  RIIPIWASGTILFVALVQESSFVVFQGLQADRHFGKSKFEIPAASFTVFSMLALTIWIPV  418

Query  401  YDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            YDR+LVPW R+ T    G T+LQRMGIG+  +++AM VSG V
Sbjct  419  YDRILVPWLRRATGKEAGFTLLQRMGIGIVLTVVAMVVSGLV  460



>ref|XP_006367062.1| PREDICTED: probable peptide/nitrate transporter At5g62680-like 
[Solanum tuberosum]
Length=591

 Score =   159 bits (401),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 105/157 (67%), Gaps = 1/157 (1%)
 Frame = +2

Query  59   PPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIPI  238
            P  S  +KLP T  + FL+KAA+V  E+ +  DG   N W LCS+Q+ +E KC++RVIPI
Sbjct  276  PLKSINSKLPYTHQFRFLDKAAIVTPEDQIKSDGSVVNPWNLCSVQQVQEAKCVIRVIPI  335

Query  239  WPAGIACSLAIIQQGTFTINQALQMNRHLG-RRFQIPAGSLFVVSLLTIAVLLPFYDRVL  415
            W A I   +AI++Q  F + QALQ NRHLG   FQIPA +  + S+L++ + +P YDR++
Sbjct  336  WAAAIIYHVAIVEQQQFVVYQALQSNRHLGTSNFQIPAATYTIFSMLSLTLWIPIYDRIV  395

Query  416  VPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            VP  R+ T   GGITILQRMG G+  ++L+  VS F+
Sbjct  396  VPLLRRITGKEGGITILQRMGFGIFLTVLSSLVSAFI  432



>gb|KDP45400.1| hypothetical protein JCGZ_09649 [Jatropha curcas]
Length=591

 Score =   158 bits (400),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 108/158 (68%), Gaps = 1/158 (1%)
 Frame = +2

Query  56   LPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIP  235
            +P  S  +KLP T  + FL+KAA++  + ++  DG  +N WRLCSIQ+ EEVKC VR+ P
Sbjct  276  IPSKSLNSKLPHTNQFRFLDKAAIITSDSEINLDGSAKNPWRLCSIQQVEEVKCWVRIFP  335

Query  236  IWPAGIACSLAIIQQGTFTINQALQMNRHLGRR-FQIPAGSLFVVSLLTIAVLLPFYDRV  412
            +W + I   L +IQQ T+ + QALQ++R LG   F+IPA +  + ++LT+ V +P YDR+
Sbjct  336  LWASAIIFHLPLIQQQTYPVLQALQLDRRLGTSGFKIPAATYTIFTMLTLTVWIPIYDRI  395

Query  413  LVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            +VP+ ++ T   GG T+LQRMGIG+  SIL M VSG V
Sbjct  396  VVPYLQRLTGKEGGFTLLQRMGIGIILSILCMLVSGLV  433



>gb|KJB19308.1| hypothetical protein B456_003G094400 [Gossypium raimondii]
Length=590

 Score =   158 bits (400),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 109/158 (69%), Gaps = 1/158 (1%)
 Frame = +2

Query  56   LPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIP  235
            +P  S  +KL  +  + FLNKAA++  E+ +  DG   N W+LCS+Q+ EE+KC++RV+P
Sbjct  274  IPKASINSKLAYSDQFRFLNKAAILTPEDKINSDGSAMNPWKLCSLQKVEEIKCLIRVVP  333

Query  236  IWPAGIACSLAIIQQGTFTINQALQMNRHLGRR-FQIPAGSLFVVSLLTIAVLLPFYDRV  412
            IW +GI  S+A++QQ T+ + QA+Q +R+LG   F IPA S  + +++ + + +P YDR+
Sbjct  334  IWASGIIYSVAMVQQQTYVVFQAIQSDRYLGHTGFNIPAASFGIFTMIGVTIWIPIYDRL  393

Query  413  LVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            +VPW +K T+  GGIT+LQ+M IG+  +I+ M +S  V
Sbjct  394  IVPWLQKYTKKEGGITLLQKMSIGMVLAIITMFISAIV  431



>ref|XP_008364618.1| PREDICTED: protein NRT1/ PTR FAMILY 2.11-like [Malus domestica]
Length=590

 Score =   158 bits (399),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 109/158 (69%), Gaps = 1/158 (1%)
 Frame = +2

Query  56   LPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIP  235
            LPP S  + LP T  +  L+KAA++  E+ +  DG   + WRLCS+Q+ EEVKC++RV+P
Sbjct  284  LPPDSINSNLPYTDQFRCLDKAAILTPEDKINPDGSAADPWRLCSMQQVEEVKCLLRVLP  343

Query  236  IWPAGIACSLAIIQQGTFTINQALQMNRHLGR-RFQIPAGSLFVVSLLTIAVLLPFYDRV  412
            IW A +   +AI+QQ T+ + QALQ NR LG+  FQIPA S  +  +L + + +P YDR+
Sbjct  344  IWAAALIYHIAIVQQQTYVVFQALQSNRRLGKTNFQIPAASYSIFLMLGMTIWIPIYDRL  403

Query  413  LVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            LVP+ ++ T  +GGIT+LQR+GIG+  S++ M VS FV
Sbjct  404  LVPFLQRLTGKVGGITLLQRIGIGIFLSVITMLVSAFV  441



>ref|XP_002270558.3| PREDICTED: uncharacterized protein LOC100263850 [Vitis vinifera]
Length=1166

 Score =   160 bits (406),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 80/158 (51%), Positives = 108/158 (68%), Gaps = 1/158 (1%)
 Frame = +2

Query  56    LPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIP  235
             +PP S  +KLP T  + FL+KAAV+  E+ L  DG     WRLCS+Q+ EEVKCI+RVIP
Sbjct  869   IPPNSINSKLPYTDQFRFLDKAAVLSPEDQLNPDGSAAYPWRLCSMQQVEEVKCIMRVIP  928

Query  236   IWPAGIACSLAIIQQGTFTINQALQMNRHLGR-RFQIPAGSLFVVSLLTIAVLLPFYDRV  412
             IW + I    AI+QQ T+ + QALQ NR++G  +FQIPA S  V S+L++ + +P YDR+
Sbjct  929   IWSSAIIYHCAIVQQHTYAVFQALQSNRYVGNSKFQIPAASYTVFSMLSLTIWVPIYDRI  988

Query  413   LVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
             +VP+ R+ T    GITILQR+GIG+  S+L   VS  V
Sbjct  989   VVPFLRRITGKEAGITILQRIGIGIFLSVLTSLVSALV  1026


 Score =   152 bits (384),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 107/158 (68%), Gaps = 1/158 (1%)
 Frame = +2

Query  56   LPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIP  235
            +P  S  +KLP T  + FL+K A++  E+ +  +G   + WRL SIQ+ EEVKC++RVIP
Sbjct  271  VPSNSINSKLPYTDQFRFLDKGAIITPEDQINSEGLAADPWRLSSIQQVEEVKCLMRVIP  330

Query  236  IWPAGIACSLAIIQQGTFTINQALQMNRHLGR-RFQIPAGSLFVVSLLTIAVLLPFYDRV  412
            IW + I   +A+ QQ T+T+ Q+LQ +RHLG   F+IPA S  + S+L + + +P YDR+
Sbjct  331  IWASAIIYYVALAQQQTYTVFQSLQSDRHLGHSNFKIPAASYSIFSMLGLIIWIPIYDRI  390

Query  413  LVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            +VP  ++ T   GGIT+LQ+MG+G+  SI+ M VS FV
Sbjct  391  MVPLLQRFTGKEGGITVLQKMGVGMFLSIVTMLVSAFV  428



>ref|XP_002517463.1| nitrate transporter, putative [Ricinus communis]
 gb|EEF45005.1| nitrate transporter, putative [Ricinus communis]
Length=532

 Score =   157 bits (397),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 103/145 (71%), Gaps = 1/145 (1%)
 Frame = +2

Query  95   KDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIPIWPAGIACSLAII  274
            K   +L+K+A++  E+ +  DG   N W+LCSIQ+ EE KC++RVIPIW +GI   + ++
Sbjct  235  KKQRWLDKSAIITSEDQINSDGSAANPWKLCSIQQVEEAKCVLRVIPIWASGILYYVPVV  294

Query  275  QQGTFTINQALQMNRHLGRR-FQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIG  451
            QQ T+ + QALQ +R LG   F+IPA S+ V S+LT+ + +PFYDR++VP+ RK T   G
Sbjct  295  QQNTYAVLQALQSDRRLGENGFEIPAASIIVFSMLTLTLFIPFYDRIIVPFLRKLTGKEG  354

Query  452  GITILQRMGIGLAFSILAMAVSGFV  526
            GITILQRMGIG+  SI+ M VSG +
Sbjct  355  GITILQRMGIGVVLSIVTMVVSGLI  379



>ref|XP_004236179.1| PREDICTED: protein NRT1/ PTR FAMILY 2.11-like [Solanum lycopersicum]
Length=587

 Score =   157 bits (397),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 105/157 (67%), Gaps = 1/157 (1%)
 Frame = +2

Query  59   PPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIPI  238
            P  S  +KLP T  + FL+KAA+V  E+ +  DG   N W LCS+Q+ +E KC++RVIPI
Sbjct  276  PLKSINSKLPYTHQFRFLDKAAIVTPEDQIKSDGSAVNPWNLCSLQQVQEAKCVIRVIPI  335

Query  239  WPAGIACSLAIIQQGTFTINQALQMNRHLG-RRFQIPAGSLFVVSLLTIAVLLPFYDRVL  415
            W A I   +AI++Q  F + QALQ NRH+G   FQIPA +  + S+L++ + +P YDR++
Sbjct  336  WAAAIIYHVAIVEQQQFVVYQALQSNRHVGTSNFQIPAATYTIFSMLSLTLWIPIYDRIV  395

Query  416  VPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            VP  R+ T   GGITILQRMG G+  ++L+  VS F+
Sbjct  396  VPLLRRITGKEGGITILQRMGFGIFLTVLSSLVSAFI  432



>ref|XP_002317993.2| proton-dependent oligopeptide transport family protein [Populus 
trichocarpa]
 gb|EEE96213.2| proton-dependent oligopeptide transport family protein [Populus 
trichocarpa]
Length=583

 Score =   157 bits (397),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 106/158 (67%), Gaps = 1/158 (1%)
 Frame = +2

Query  56   LPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIP  235
            +P  S  + LP T  + FL+KAA++  E+ +  +G     WRLCS+Q+ EEVKC++RVIP
Sbjct  269  IPARSINSNLPYTDQFRFLDKAAILTTEDQIMPNGSTATPWRLCSLQQVEEVKCLLRVIP  328

Query  236  IWPAGIACSLAIIQQGTFTINQALQMNRHLGR-RFQIPAGSLFVVSLLTIAVLLPFYDRV  412
            IW + +   + +IQQ T+ + QALQ NR LG   F+IPA S  + S+L + + +P YDR+
Sbjct  329  IWASALLYYIGLIQQQTYVVFQALQSNRGLGNTNFKIPAASYAIFSMLGLTIWIPIYDRL  388

Query  413  LVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            +VPW  K T+  GGITILQ+MG+G+A  I+ M +SG V
Sbjct  389  IVPWLAKHTKKEGGITILQKMGVGMALGIVTMLISGIV  426



>ref|XP_010242330.1| PREDICTED: protein NRT1/ PTR FAMILY 2.9-like [Nelumbo nucifera]
Length=591

 Score =   157 bits (397),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 107/158 (68%), Gaps = 1/158 (1%)
 Frame = +2

Query  56   LPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIP  235
            LP GS  + LP T+ + FL+KAA++ +++ +  DG   + WRLC +Q+ EEVKC++R+ P
Sbjct  273  LPAGSLNSHLPHTEQFSFLDKAAIITLDDQINSDGSAMDPWRLCRMQQVEEVKCLIRIFP  332

Query  236  IWPAGIACSLAIIQQGTFTINQALQMNRHL-GRRFQIPAGSLFVVSLLTIAVLLPFYDRV  412
            IW +GI    AI+QQ T+ + QALQ +R L G  F++PA S  V +++++ + LP YDR+
Sbjct  333  IWASGILYYAAIVQQHTYGVIQALQSDRRLRGTHFEVPAASYIVFAMISLTIWLPLYDRI  392

Query  413  LVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            +VP  R+ T   GGIT LQRMG+G+  S+L M +S  V
Sbjct  393  IVPTLRRFTGKEGGITQLQRMGVGVVLSVLTMVLSALV  430



>gb|KHN01164.1| Nitrate transporter 1.7 [Glycine soja]
Length=434

 Score =   155 bits (392),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 77/173 (45%), Positives = 111/173 (64%), Gaps = 5/173 (3%)
 Frame = +2

Query  8    PANDSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLC  187
            P+N+  A    YY+P L       K+PLTK    LNKAA++  + +L   G+  N WR+C
Sbjct  160  PSNEENA----YYDPLLEDDETVLKMPLTKQLSCLNKAALIQ-DNELDAQGRVTNSWRIC  214

Query  188  SIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLFVV  367
            SIQ+ EEVKC+++++PIW +GI C + I QQ  F ++QA ++NRHLG  F+IP+ S  VV
Sbjct  215  SIQQVEEVKCLIKIMPIWASGILCFIPIAQQNIFPVSQATKLNRHLGPHFEIPSASCSVV  274

Query  368  SLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            SL+TI + LPFY+  + P   K T+   G+T LQ++ +G  FS LAM  +G V
Sbjct  275  SLITIGIWLPFYELFVQPALAKITKQKEGLTSLQKIILGNMFSNLAMVTAGLV  327



>emb|CBI15285.3| unnamed protein product [Vitis vinifera]
Length=1053

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 79/156 (51%), Positives = 107/156 (69%), Gaps = 1/156 (1%)
 Frame = +2

Query  56    LPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIP  235
             +PP S  +KLP T  + FL+KAAV+  E+ L  DG     WRLCS+Q+ EEVKCI+RVIP
Sbjct  894   IPPNSINSKLPYTDQFRFLDKAAVLSPEDQLNPDGSAAYPWRLCSMQQVEEVKCIMRVIP  953

Query  236   IWPAGIACSLAIIQQGTFTINQALQMNRHLGR-RFQIPAGSLFVVSLLTIAVLLPFYDRV  412
             IW + I    AI+QQ T+ + QALQ NR++G  +FQIPA S  V S+L++ + +P YDR+
Sbjct  954   IWSSAIIYHCAIVQQHTYAVFQALQSNRYVGNSKFQIPAASYTVFSMLSLTIWVPIYDRI  1013

Query  413   LVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSG  520
             +VP+ R+ T    GITILQR+GIG+  S+L   VS 
Sbjct  1014  VVPFLRRITGKEAGITILQRIGIGIFLSVLTSLVSA  1049


 Score =   152 bits (385),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 107/158 (68%), Gaps = 1/158 (1%)
 Frame = +2

Query  56   LPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIP  235
            +P  S  +KLP T  + FL+K A++  E+ +  +G   + WRL SIQ+ EEVKC++RVIP
Sbjct  314  VPSNSINSKLPYTDQFRFLDKGAIITPEDQINSEGLAADPWRLSSIQQVEEVKCLMRVIP  373

Query  236  IWPAGIACSLAIIQQGTFTINQALQMNRHLGR-RFQIPAGSLFVVSLLTIAVLLPFYDRV  412
            IW + I   +A+ QQ T+T+ Q+LQ +RHLG   F+IPA S  + S+L + + +P YDR+
Sbjct  374  IWASAIIYYVALAQQQTYTVFQSLQSDRHLGHSNFKIPAASYSIFSMLGLIIWIPIYDRI  433

Query  413  LVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            +VP  ++ T   GGIT+LQ+MG+G+  SI+ M VS FV
Sbjct  434  MVPLLQRFTGKEGGITVLQKMGVGMFLSIVTMLVSAFV  471



>ref|XP_010933675.1| PREDICTED: protein NRT1/ PTR FAMILY 2.11-like [Elaeis guineensis]
Length=580

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/162 (49%), Positives = 107/162 (66%), Gaps = 2/162 (1%)
 Frame = +2

Query  44   YNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIV  223
            +NPP    S  +KLP T  + FL+KAA+V   +++  +G   N WRLCSIQ+ EEVKC++
Sbjct  265  FNPP-HASSLVSKLPYTNQFNFLDKAAIVSHTDEVGPNGLASNPWRLCSIQQVEEVKCVL  323

Query  224  RVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGR-RFQIPAGSLFVVSLLTIAVLLPF  400
            RVIPIW  GI   +A  QQ T+ I QALQ +RHL R  F+IPA S  +  +L + + +P 
Sbjct  324  RVIPIWSTGIIYYVAFSQQHTYIILQALQFDRHLWRGSFEIPAASFTIFPMLALTIWIPL  383

Query  401  YDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            YDRV+V    K T   GGIT+LQRMGIG+ FS++AM +S  +
Sbjct  384  YDRVIVSRLEKFTGKEGGITLLQRMGIGIIFSVVAMIISAVI  425



>ref|XP_009798934.1| PREDICTED: protein NRT1/ PTR FAMILY 2.10-like isoform X2 [Nicotiana 
sylvestris]
Length=511

 Score =   156 bits (394),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/154 (49%), Positives = 101/154 (66%), Gaps = 1/154 (1%)
 Frame = +2

Query  68   SAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIPIWPA  247
            S  +KL  T  + FLNKAA+   E+++  DG   + WRLCSIQ+ EEVKC++RV+PIW A
Sbjct  212  SLNSKLCYTDQFRFLNKAAIRTPEDEINSDGSAADPWRLCSIQQVEEVKCLLRVVPIWVA  271

Query  248  GIACSLAIIQQGTFTINQALQMNRHLGR-RFQIPAGSLFVVSLLTIAVLLPFYDRVLVPW  424
            G    ++++QQ  + I QA Q NR LG   F+IP  S  V   L I++ LP YDR+L+PW
Sbjct  272  GTVYYVSVVQQQNYVIFQAFQSNRQLGHNHFRIPPASFIVFPFLCISIWLPIYDRILLPW  331

Query  425  ARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
             RK TR   GIT+LQ+MGIG+  SI+ M +S  V
Sbjct  332  LRKFTRKEDGITLLQKMGIGMFISIITMIISAIV  365



>ref|XP_008453172.1| PREDICTED: protein NRT1/ PTR FAMILY 2.11-like [Cucumis melo]
Length=585

 Score =   156 bits (395),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 107/156 (69%), Gaps = 1/156 (1%)
 Frame = +2

Query  59   PPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIPI  238
            PPGS  +KL  +  + FL+KAA++  E+ +  DG   + WRLCS+Q+ EEVKC+VRV+P+
Sbjct  273  PPGSINSKLSYSDQFRFLDKAAIITAEDQIKEDGSAADPWRLCSMQQVEEVKCLVRVLPV  332

Query  239  WPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLV  418
            W AG+   +   QQ T+ I QALQ NR +G  F IPA S  V ++L++++ LP YDR++V
Sbjct  333  WLAGVLFFVTQSQQNTYAIFQALQSNRRIG-NFTIPAASYTVFAMLSLSIWLPIYDRIVV  391

Query  419  PWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            P+  K T+  GGITILQR GIG+  + +AM +SG V
Sbjct  392  PFLLKFTKKEGGITILQRQGIGIFLTTMAMLLSGLV  427



>gb|EMT16488.1| Peptide transporter PTR1 [Aegilops tauschii]
Length=425

 Score =   154 bits (390),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/176 (45%), Positives = 115/176 (65%), Gaps = 3/176 (2%)
 Frame = +2

Query  2    RLP-ANDSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRW  178
            +LP ++D      + ++PP+  G    +LPLT  + FLNK A++  + D+  DG  RN W
Sbjct  93   KLPNSDDISQQELLLFSPPMR-GHRIFRLPLTSQFRFLNKGAILR-DGDINDDGSARNSW  150

Query  179  RLCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSL  358
             LCSIQ+ EEVKC++R++PI  +GI C +A++QQ +    QAL M+ +LG  F+IPAGS+
Sbjct  151  ELCSIQQIEEVKCLIRIVPICISGIVCFVALVQQYSSASFQALTMDCNLGTHFEIPAGSV  210

Query  359  FVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
              +S + +   LP YDR+LVP AR+ T V  GIT+LQR GIGL  S ++  V+G V
Sbjct  211  ISISFIALTAFLPIYDRILVPIARRFTGVESGITLLQRQGIGLVISPISTVVAGLV  266



>ref|XP_009798933.1| PREDICTED: protein NRT1/ PTR FAMILY 2.10-like isoform X1 [Nicotiana 
sylvestris]
Length=573

 Score =   156 bits (394),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/154 (49%), Positives = 101/154 (66%), Gaps = 1/154 (1%)
 Frame = +2

Query  68   SAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIPIWPA  247
            S  +KL  T  + FLNKAA+   E+++  DG   + WRLCSIQ+ EEVKC++RV+PIW A
Sbjct  274  SLNSKLCYTDQFRFLNKAAIRTPEDEINSDGSAADPWRLCSIQQVEEVKCLLRVVPIWVA  333

Query  248  GIACSLAIIQQGTFTINQALQMNRHLGR-RFQIPAGSLFVVSLLTIAVLLPFYDRVLVPW  424
            G    ++++QQ  + I QA Q NR LG   F+IP  S  V   L I++ LP YDR+L+PW
Sbjct  334  GTVYYVSVVQQQNYVIFQAFQSNRQLGHNHFRIPPASFIVFPFLCISIWLPIYDRILLPW  393

Query  425  ARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
             RK TR   GIT+LQ+MGIG+  SI+ M +S  V
Sbjct  394  LRKFTRKEDGITLLQKMGIGMFISIITMIISAIV  427



>ref|XP_007227399.1| hypothetical protein PRUPE_ppb015207mg [Prunus persica]
 gb|EMJ28598.1| hypothetical protein PRUPE_ppb015207mg [Prunus persica]
Length=615

 Score =   156 bits (395),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 82/175 (47%), Positives = 115/175 (66%), Gaps = 1/175 (1%)
 Frame = +2

Query  2    RLPANDSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWR  181
             L  +D     GV+ +  L      +KLPLT     L KAA+VV ++    DG C N WR
Sbjct  284  HLKLHDDERVLGVFSDVSLDGNVVLSKLPLTAQLSSLKKAALVVDDDLKD-DGSCANPWR  342

Query  182  LCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLF  361
            LCSIQ+ EEV C ++++PIW +G  C +   Q+GTF ++QAL+M+RH+G  FQ+PAGS+ 
Sbjct  343  LCSIQQVEEVICFMKILPIWASGGICFMTYAQEGTFVVSQALKMDRHIGPNFQMPAGSIK  402

Query  362  VVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            ++SL+++ + LPFYDRVL P  +K T+   GIT LQR+G+G  FSIL  AV+G V
Sbjct  403  MMSLISLCICLPFYDRVLQPALKKITKHENGITTLQRIGLGYLFSILFAAVAGLV  457



>ref|XP_010037631.1| PREDICTED: protein NRT1/ PTR FAMILY 2.9-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW49370.1| hypothetical protein EUGRSUZ_K02915 [Eucalyptus grandis]
Length=589

 Score =   156 bits (394),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 105/158 (66%), Gaps = 1/158 (1%)
 Frame = +2

Query  56   LPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIP  235
            +P  S  +KLP T  + FL+KAA++  E+ +  DG   N W LCSIQ+ EEVKC+VR++P
Sbjct  274  IPHSSLNSKLPSTNQFRFLDKAAIITAEDRINQDGSAVNPWGLCSIQQVEEVKCVVRILP  333

Query  236  IWPAGIACSLAIIQQGTFTINQALQMNRHLGR-RFQIPAGSLFVVSLLTIAVLLPFYDRV  412
            IW + +  ++ IIQQ T+ + QALQ NR LG   F+IPA S  + +++ + + +PFYDRV
Sbjct  334  IWVSAMVYNIVIIQQQTYVVFQALQSNRRLGNTSFKIPAASYSIFNMIGLTIWIPFYDRV  393

Query  413  LVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            LVP  RK T   GGITILQ+MG G+   I+ M VS  V
Sbjct  394  LVPRLRKITGKDGGITILQKMGFGMVLGIVTMIVSAIV  431



>ref|XP_003613570.1| Peptide transporter [Medicago truncatula]
Length=599

 Score =   156 bits (394),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 78/192 (41%), Positives = 119/192 (62%), Gaps = 25/192 (13%)
 Frame = +2

Query  17   DSGAAAGVYYNPPLPPGSAATKLPLTKDYGFL----------------------NKAAVV  130
            D G  +GV+Y+PP+   +   K PLTK++ +L                      NKAA++
Sbjct  271  DKGDTSGVFYDPPIE--NMEPKFPLTKEFSWLRRRLWKGAPRLQEPFWKAPKCLNKAAIM  328

Query  131  VIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQ  310
            V E +L  DG   N WRLCSIQ+ EE+KCI++++PIW  GI   +   Q   F ++QA++
Sbjct  329  V-ENELNDDGSNNNPWRLCSIQQVEELKCILKMMPIWVTGIITYIPTGQLSIFPMSQAMK  387

Query  311  MNRHLGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLA  490
            M++HL + F+IP G + +V++LTIA+++PFYD+V+ P   K T   GG+T LQR+G+G  
Sbjct  388  MDKHLTQNFEIPPGWMIIVTMLTIAIVIPFYDKVISPTLTKMTNQDGGLTNLQRIGLGHF  447

Query  491  FSILAMAVSGFV  526
            F+IL M ++G V
Sbjct  448  FAILTMVIAGLV  459



>ref|XP_010037632.1| PREDICTED: protein NRT1/ PTR FAMILY 2.11-like isoform X2 [Eucalyptus 
grandis]
Length=587

 Score =   156 bits (394),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 105/158 (66%), Gaps = 1/158 (1%)
 Frame = +2

Query  56   LPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIP  235
            +P  S  +KLP T  + FL+KAA++  E+ +  DG   N W LCSIQ+ EEVKC+VR++P
Sbjct  272  IPHSSLNSKLPSTNQFRFLDKAAIITAEDRINQDGSAVNPWGLCSIQQVEEVKCVVRILP  331

Query  236  IWPAGIACSLAIIQQGTFTINQALQMNRHLGR-RFQIPAGSLFVVSLLTIAVLLPFYDRV  412
            IW + +  ++ IIQQ T+ + QALQ NR LG   F+IPA S  + +++ + + +PFYDRV
Sbjct  332  IWVSAMVYNIVIIQQQTYVVFQALQSNRRLGNTSFKIPAASYSIFNMIGLTIWIPFYDRV  391

Query  413  LVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            LVP  RK T   GGITILQ+MG G+   I+ M VS  V
Sbjct  392  LVPRLRKITGKDGGITILQKMGFGMVLGIVTMIVSAIV  429



>ref|XP_002276806.1| PREDICTED: protein NRT1/ PTR FAMILY 2.11 [Vitis vinifera]
 emb|CBI35037.3| unnamed protein product [Vitis vinifera]
Length=585

 Score =   156 bits (394),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 106/157 (68%), Gaps = 1/157 (1%)
 Frame = +2

Query  56   LPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIP  235
            +P     +KLP T  + FL+K+A++ +E+ +  DG   N WRLCS+Q+ EEVKC++RVIP
Sbjct  273  VPTNYMNSKLPHTDQFRFLDKSAIITMEDQINTDGSASNPWRLCSMQQVEEVKCLMRVIP  332

Query  236  IWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLFVVSLLTIAVLLPFYDRVL  415
            IW + I   +AI+QQ T+ + QALQ +RHLG  F++PA S  + S+L++ + +P YDR++
Sbjct  333  IWASSIIYHVAIVQQHTYAVLQALQSDRHLG-SFEVPAASYSIFSMLSLTIWIPIYDRIV  391

Query  416  VPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            +P+  K T    GIT+LQRMG G+  S+  M VS  +
Sbjct  392  IPFLHKLTGKEDGITLLQRMGTGIVLSVATMLVSAVI  428



>emb|CDP14876.1| unnamed protein product [Coffea canephora]
Length=595

 Score =   156 bits (394),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 103/158 (65%), Gaps = 1/158 (1%)
 Frame = +2

Query  56   LPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIP  235
            + P S  +KLP T  +GFLNKAA++  E+ +  DG   N WRLCSIQ+ EEVKCIV V+P
Sbjct  279  MSPNSINSKLPYTDQFGFLNKAAIITPEDHINADGSAHNPWRLCSIQQVEEVKCIVSVVP  338

Query  236  IWPAGIACSLAIIQQGTFTINQALQMNRHLGR-RFQIPAGSLFVVSLLTIAVLLPFYDRV  412
            IW AGI   + +    T+ + QA+Q +R LG   F+IPA S  +  +L++   +P YDR+
Sbjct  339  IWIAGIIYYIVLNLMQTYAVFQAMQADRRLGNTSFKIPAASYTIFQMLSLTAWIPIYDRI  398

Query  413  LVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            +VP+ RK T+   GIT+LQ+MG+G+  ++  M VS  V
Sbjct  399  IVPYLRKITKKEDGITVLQKMGVGMVIAVATMVVSALV  436



>ref|XP_009610425.1| PREDICTED: protein NRT1/ PTR FAMILY 2.11 [Nicotiana tomentosiformis]
Length=569

 Score =   155 bits (392),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 79/160 (49%), Positives = 105/160 (66%), Gaps = 4/160 (3%)
 Frame = +2

Query  56   LPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTG--DGKCRNRWRLCSIQETEEVKCIVRV  229
            +P  S  + LP T  + FL+KAAV+  +EDL    DG   N WRLCSIQ+ EEVKC++RV
Sbjct  267  MPSNSLNSMLPYTDQFRFLSKAAVIT-QEDLINSVDGSAVNPWRLCSIQQVEEVKCLLRV  325

Query  230  IPIWPAGIACSLAIIQQGTFTINQALQMNRHLGR-RFQIPAGSLFVVSLLTIAVLLPFYD  406
            IPIW AG    ++++Q   + I QA+Q +  LG   F IP  S  V+S+L+I + LP YD
Sbjct  326  IPIWVAGTIYYVSVVQSQNYVIFQAIQTDSQLGHINFHIPPASFIVISMLSITIWLPIYD  385

Query  407  RVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            RVL+PW RK T    GIT+LQ+MGIG+  SI+ M +SG V
Sbjct  386  RVLLPWLRKLTGKEDGITLLQKMGIGIFHSIITMIISGIV  425



>ref|XP_008340336.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13-like [Malus domestica]
Length=609

 Score =   155 bits (392),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 73/150 (49%), Positives = 109/150 (73%), Gaps = 1/150 (1%)
 Frame = +2

Query  77   TKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIPIWPAGIA  256
            +KL L+ ++ FL KAA+VV + +++ DG C N WRLCSIQ+ EEV C+V+ +PIW +G  
Sbjct  315  SKLLLSTEFRFLKKAALVV-DNEVSDDGSCANPWRLCSIQQVEEVICVVKTLPIWASGAI  373

Query  257  CSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKR  436
              +A  Q+GTF ++QAL+M+RH+G  F++PAGS+ ++S++T+ + LP Y+RVL P  RK 
Sbjct  374  FLIAYAQEGTFVVSQALRMDRHIGLNFEMPAGSIKLMSMMTVIISLPLYNRVLQPAIRKI  433

Query  437  TRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            T+   G+  LQR+GIG  FSIL M V+G +
Sbjct  434  TKHEDGLPALQRIGIGYFFSILCMMVAGLI  463



>gb|ACN72639.1| nitrate transporter [Malus hupehensis]
Length=583

 Score =   155 bits (391),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 108/158 (68%), Gaps = 1/158 (1%)
 Frame = +2

Query  56   LPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIP  235
            +PP S  + LP T  +  L+KAA++  E+ +  DG   + WRLCS+Q+ EEVKC++RV+P
Sbjct  277  MPPDSINSNLPYTNQFRCLDKAAILTPEDKINPDGSAADPWRLCSMQQVEEVKCLLRVLP  336

Query  236  IWPAGIACSLAIIQQGTFTINQALQMNRHLGR-RFQIPAGSLFVVSLLTIAVLLPFYDRV  412
            IW A +   +AI+QQ T+ + QALQ NR LG+  FQIPA S  +  +L + + +P YDR+
Sbjct  337  IWAAALIYHIAIVQQQTYVVFQALQSNRRLGKTSFQIPAASYTIFLMLGMTIWIPIYDRL  396

Query  413  LVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            LVP+ ++ T   GGIT+LQR+GIG+  S++ M VS FV
Sbjct  397  LVPFLQRLTGKEGGITLLQRIGIGIFLSVITMLVSAFV  434



>ref|XP_008804560.1| PREDICTED: protein NRT1/ PTR FAMILY 2.11-like [Phoenix dactylifera]
Length=528

 Score =   154 bits (390),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 75/162 (46%), Positives = 108/162 (67%), Gaps = 2/162 (1%)
 Frame = +2

Query  44   YNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIV  223
            +NPP    S  TKLP T  +  L+KAA+    +++  DG   +  RLCS+Q+ E+VKC+ 
Sbjct  265  FNPP-HFSSLVTKLPYTDQFRCLDKAAITTPMDEIKPDGHAADPRRLCSLQQVEQVKCLA  323

Query  224  RVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGR-RFQIPAGSLFVVSLLTIAVLLPF  400
            R+IPIW  GI   ++ IQ+ TF + QALQ +RH G+ +F+IPA S  V ++L + V +P 
Sbjct  324  RIIPIWATGIIFHVSTIQETTFIVFQALQADRHFGKSKFEIPAASFNVFAMLALTVWIPI  383

Query  401  YDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            YDR+L PW ++ T   GG+T+LQRMGIG+  S++AM VSG V
Sbjct  384  YDRILAPWLQRATGKEGGLTLLQRMGIGIVLSVVAMIVSGLV  425



>ref|XP_009413298.1| PREDICTED: protein NRT1/ PTR FAMILY 2.11-like [Musa acuminata 
subsp. malaccensis]
Length=568

 Score =   154 bits (390),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 106/159 (67%), Gaps = 3/159 (2%)
 Frame = +2

Query  59   PP--GSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVI  232
            PP   S  +KL  T  +  L+KAA+V  E+++  DG   N W+LC++Q+ E+VKCIVR+I
Sbjct  280  PPHLSSLISKLSYTNQFRILDKAAIVTPEDEIKPDGFAANPWQLCTLQQVEQVKCIVRII  339

Query  233  PIWPAGIACSLAIIQQGTFTINQALQMNRHLGR-RFQIPAGSLFVVSLLTIAVLLPFYDR  409
            P+W  GI   LA  QQ T+ I QALQ NRHLGR  FQIPA S  V  +L +++ +P YDR
Sbjct  340  PVWSTGILYQLAATQQQTYVIFQALQSNRHLGRSNFQIPAASFVVFPMLAMSLWIPIYDR  399

Query  410  VLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            ++ P   + T+  GG+T+LQRMGIGL  S++ MA +G +
Sbjct  400  IVAPRLERITKKEGGLTLLQRMGIGLVLSVVVMATAGVI  438



>gb|KJB50863.1| hypothetical protein B456_008G190200 [Gossypium raimondii]
Length=449

 Score =   153 bits (387),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 106/158 (67%), Gaps = 1/158 (1%)
 Frame = +2

Query  56   LPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIP  235
            +PP S  +KLP T  + FL+KAA+V  ++++ GDG   + WRLCS+Q+ EEVKC+ RV+P
Sbjct  132  IPPNSINSKLPYTDQFRFLDKAAIVTPQDEIKGDGSPADPWRLCSLQQVEEVKCLFRVLP  191

Query  236  IWPAGIACSLAIIQQGTFTINQALQMNRHLGR-RFQIPAGSLFVVSLLTIAVLLPFYDRV  412
            IW + I   + ++Q  T+ + QA+Q +R LG   F+IPA S  V  +L++ + +P YDR 
Sbjct  192  IWASQIMYCVTLVQLHTYAVFQAVQSDRRLGNSNFKIPAASYVVFMMLSLTIFIPVYDRA  251

Query  413  LVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            +VP+ RK     GGITILQR+GIG+  SI  M VSG V
Sbjct  252  VVPFLRKIRGKEGGITILQRIGIGMFVSIFTMLVSGMV  289



>ref|XP_008221696.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13-like [Prunus mume]
Length=605

 Score =   155 bits (391),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 81/175 (46%), Positives = 115/175 (66%), Gaps = 1/175 (1%)
 Frame = +2

Query  2    RLPANDSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWR  181
             L  +D+    GV+ +  L      +KLPL      L KAA+VV ++    DG C N WR
Sbjct  284  HLKLHDNERVLGVFSDVSLDGNVVLSKLPLAAQLSSLKKAALVVDDDLKD-DGSCANPWR  342

Query  182  LCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLF  361
            LCSIQ+ EEV C ++++PIW +G  C +   Q+GTF ++QAL+M+RH+G  FQ+PAGS+ 
Sbjct  343  LCSIQQVEEVICFMKILPIWASGGICFMTYAQEGTFVVSQALKMDRHIGPNFQMPAGSIK  402

Query  362  VVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            ++SL+++ + LPFYDRVL P  +K T+   GIT LQR+G+G  FSIL  AV+G V
Sbjct  403  MMSLISLCICLPFYDRVLQPALKKITKHENGITTLQRIGLGYLFSILFAAVAGLV  457



>ref|XP_009369361.1| PREDICTED: protein NRT1/ PTR FAMILY 2.9-like isoform X1 [Pyrus 
x bretschneideri]
Length=599

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 109/158 (69%), Gaps = 1/158 (1%)
 Frame = +2

Query  56   LPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIP  235
            +PP S  +KLP T  +  L+KAA++  ++ +  DG   + W+LCS+Q+ EEVKC++RV+P
Sbjct  284  MPPDSINSKLPYTNQFRCLDKAAILTPDDKINPDGSAADPWKLCSMQQVEEVKCLLRVLP  343

Query  236  IWPAGIACSLAIIQQGTFTINQALQMNRHLGR-RFQIPAGSLFVVSLLTIAVLLPFYDRV  412
            IW A +   +AI+QQ T+ + QALQ NR LG+  FQIPA S  +  +L + + +P YDR+
Sbjct  344  IWAAALIYHIAIVQQHTYVVFQALQSNRRLGKTSFQIPAASYSIFLMLGMTIWIPIYDRL  403

Query  413  LVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            LVP+ ++ T   GGIT+LQR+GIG+  S++ M VS FV
Sbjct  404  LVPFLQRLTGKEGGITLLQRIGIGIFLSVITMLVSAFV  441



>ref|XP_008807861.1| PREDICTED: protein NRT1/ PTR FAMILY 2.11-like [Phoenix dactylifera]
Length=583

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/162 (48%), Positives = 107/162 (66%), Gaps = 2/162 (1%)
 Frame = +2

Query  44   YNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIV  223
            +NPP    S  +KLP T  + FL+KA++V   +++  +G   N WRLCSIQ+ EEVKC++
Sbjct  265  FNPP-HASSLVSKLPYTNQFNFLDKASIVSHTDEVGPNGFASNPWRLCSIQQVEEVKCVL  323

Query  224  RVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGR-RFQIPAGSLFVVSLLTIAVLLPF  400
            RVIPIW   I   +A  QQ T+ I QALQ +RHL R  F+IPA S  +  +L +A+ +P 
Sbjct  324  RVIPIWSTAIIYYVAFSQQSTYIILQALQSDRHLWRGGFEIPAASFTIFPMLALAIWIPL  383

Query  401  YDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            YDRV+V    K T   GGIT+LQRMGIG+ FS++AM +S  +
Sbjct  384  YDRVIVSKLEKFTGKEGGITLLQRMGIGIIFSVVAMIISAVI  425



>ref|XP_009369363.1| PREDICTED: protein NRT1/ PTR FAMILY 2.9-like isoform X2 [Pyrus 
x bretschneideri]
Length=595

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 109/158 (69%), Gaps = 1/158 (1%)
 Frame = +2

Query  56   LPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIP  235
            +PP S  +KLP T  +  L+KAA++  ++ +  DG   + W+LCS+Q+ EEVKC++RV+P
Sbjct  280  MPPDSINSKLPYTNQFRCLDKAAILTPDDKINPDGSAADPWKLCSMQQVEEVKCLLRVLP  339

Query  236  IWPAGIACSLAIIQQGTFTINQALQMNRHLGR-RFQIPAGSLFVVSLLTIAVLLPFYDRV  412
            IW A +   +AI+QQ T+ + QALQ NR LG+  FQIPA S  +  +L + + +P YDR+
Sbjct  340  IWAAALIYHIAIVQQHTYVVFQALQSNRRLGKTSFQIPAASYSIFLMLGMTIWIPIYDRL  399

Query  413  LVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            LVP+ ++ T   GGIT+LQR+GIG+  S++ M VS FV
Sbjct  400  LVPFLQRLTGKEGGITLLQRIGIGIFLSVITMLVSAFV  437



>ref|XP_009398399.1| PREDICTED: protein NRT1/ PTR FAMILY 2.11 [Musa acuminata subsp. 
malaccensis]
Length=570

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 106/161 (66%), Gaps = 1/161 (1%)
 Frame = +2

Query  44   YNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIV  223
            +NPP    +   KL  T  + FL+KA+++   +++  +G   N W+LCSIQ+ EEVKC+ 
Sbjct  267  FNPP-HVSTLVAKLSYTDQFKFLDKASIIYSADEINPNGSAANPWKLCSIQQVEEVKCVA  325

Query  224  RVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLFVVSLLTIAVLLPFY  403
            R+IPIW  GI   +A+ QQ T+ + QALQ +RH+ +  +IP  S  + S + + V +P Y
Sbjct  326  RIIPIWSTGILYYIAVAQQTTYVVFQALQSDRHVSKNLEIPGASFTIFSSIALTVWIPLY  385

Query  404  DRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            DR++VP  ++ T+  GGI++LQRMGIG+  SI+AM VSG V
Sbjct  386  DRIVVPLLQRITKKDGGISLLQRMGIGIVLSIVAMFVSGLV  426



>gb|KEH19852.1| peptide/nitrate transporter [Medicago truncatula]
Length=587

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/165 (47%), Positives = 114/165 (69%), Gaps = 4/165 (2%)
 Frame = +2

Query  41   YYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCI  220
            +Y+PP    S   KLPLTK++  LNKAA+V+ E +L  DG  +N WRLCSIQ+ EE+KC+
Sbjct  287  FYDPPFMNDSEG-KLPLTKEFRCLNKAALVIEENELNNDGTSKNPWRLCSIQQIEELKCM  345

Query  221  VRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGR---RFQIPAGSLFVVSLLTIAVL  391
            ++++PIW   I  ++ I Q   F+I+QAL+M+R++G     F+I AGS+ V+SL+ I + 
Sbjct  346  LKIMPIWVTSIIVNIPIGQLTIFSISQALKMDRNIGLFNFNFEIHAGSVTVISLIAIGIF  405

Query  392  LPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            LPFYD+V+ P   K T+   G+T LQR+G+G   +ILA+ V+G V
Sbjct  406  LPFYDQVISPLLEKITKQEQGLTSLQRIGLGHGAAILAVVVAGLV  450



>ref|XP_002511509.1| nitrate transporter, putative [Ricinus communis]
 gb|EEF52111.1| nitrate transporter, putative [Ricinus communis]
Length=602

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 107/158 (68%), Gaps = 1/158 (1%)
 Frame = +2

Query  56   LPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIP  235
            +PP S   +L  T  + FL+KAA+  + +++  DG   N W+LCS+Q+ EEVKC++RV+P
Sbjct  287  IPPKSINAQLSYTDQFRFLDKAAIKTLRDEINPDGSPVNPWKLCSLQQVEEVKCLIRVLP  346

Query  236  IWPAGIACSLAIIQQGTFTINQALQMNRHLG-RRFQIPAGSLFVVSLLTIAVLLPFYDRV  412
            IW AG+   +AI+QQ T+ + QA+Q +R LG   F+IPA S  V  +L++ + +P YDR+
Sbjct  347  IWVAGVIFYMAIVQQNTYAVFQAVQSDRRLGSSEFEIPAASYTVFLMLSLTIFIPIYDRI  406

Query  413  LVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            LVP+ +K T   GGIT+LQR+GIG  FS  +M VS  V
Sbjct  407  LVPFVQKVTGKEGGITLLQRIGIGTVFSTASMIVSALV  444



>ref|XP_011042616.1| PREDICTED: protein NRT1/ PTR FAMILY 2.11-like [Populus euphratica]
Length=607

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 107/158 (68%), Gaps = 1/158 (1%)
 Frame = +2

Query  56   LPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIP  235
            +PP S  +KL  T  + FL+KAA++  ++ +  DG   N W+LCS+Q+ EEVKC+ RVIP
Sbjct  296  IPPKSINSKLSYTDQFRFLDKAAIMTHQDQVNPDGSPANPWKLCSLQQVEEVKCLFRVIP  355

Query  236  IWPAGIACSLAIIQQGTFTINQALQMNRHLGR-RFQIPAGSLFVVSLLTIAVLLPFYDRV  412
            +W A I   +A++QQ T+ + QA+Q NR LG   F IPA S  V  +L++++ +P YDR+
Sbjct  356  VWTAAIIYYVAVVQQHTYVVFQAVQSNRRLGNSNFAIPAASYIVFLMLSMSIFIPIYDRI  415

Query  413  LVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            LVP+ R+ T    GITILQR+GIG+  +I+ M VSG V
Sbjct  416  LVPFLRRITGKESGITILQRIGIGIFLTIVTMLVSGLV  453



>gb|KJB50860.1| hypothetical protein B456_008G190200 [Gossypium raimondii]
Length=516

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 106/158 (67%), Gaps = 1/158 (1%)
 Frame = +2

Query  56   LPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIP  235
            +PP S  +KLP T  + FL+KAA+V  ++++ GDG   + WRLCS+Q+ EEVKC+ RV+P
Sbjct  199  IPPNSINSKLPYTDQFRFLDKAAIVTPQDEIKGDGSPADPWRLCSLQQVEEVKCLFRVLP  258

Query  236  IWPAGIACSLAIIQQGTFTINQALQMNRHLGR-RFQIPAGSLFVVSLLTIAVLLPFYDRV  412
            IW + I   + ++Q  T+ + QA+Q +R LG   F+IPA S  V  +L++ + +P YDR 
Sbjct  259  IWASQIMYCVTLVQLHTYAVFQAVQSDRRLGNSNFKIPAASYVVFMMLSLTIFIPVYDRA  318

Query  413  LVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            +VP+ RK     GGITILQR+GIG+  SI  M VSG V
Sbjct  319  VVPFLRKIRGKEGGITILQRIGIGMFVSIFTMLVSGMV  356



>ref|XP_010678901.1| PREDICTED: protein NRT1/ PTR FAMILY 2.11-like [Beta vulgaris 
subsp. vulgaris]
Length=596

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 107/159 (67%), Gaps = 2/159 (1%)
 Frame = +2

Query  56   LPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIP  235
            +PPGS  +KL  T  + FL+KAA++  ++D+  DG     W+LCSIQ+ EEVKC+ +V+P
Sbjct  280  VPPGSLNSKLLQTHQFRFLDKAAIITPDDDINSDGSATCPWKLCSIQQVEEVKCLFKVLP  339

Query  236  IWPAGIACSLAIIQQGTFTINQALQMNRHLGRR--FQIPAGSLFVVSLLTIAVLLPFYDR  409
            +W + I  ++AI+Q  TF + QALQ +RHL  +  FQ+PA S  +  +L + + L  YDR
Sbjct  340  VWASAITFNVAILQHYTFAVFQALQSDRHLTGKSSFQVPAASYVIFFMLAVTLCLAIYDR  399

Query  410  VLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            VLVP  ++ T    GITILQRMG G++FS+L+M VS  V
Sbjct  400  VLVPLLQRITGKECGITILQRMGTGISFSVLSMIVSALV  438



>gb|KDP45469.1| hypothetical protein JCGZ_09718 [Jatropha curcas]
Length=590

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 107/158 (68%), Gaps = 1/158 (1%)
 Frame = +2

Query  56   LPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIP  235
            +P     +KL  +  + FL+KAA++  ++ +  DG   N W+LCSIQ+ EEVKC+VR+IP
Sbjct  274  VPAKFINSKLAHSDQFRFLDKAAIITEDDQINSDGSATNPWKLCSIQQIEEVKCLVRIIP  333

Query  236  IWPAGIACSLAIIQQGTFTINQALQMNRHLG-RRFQIPAGSLFVVSLLTIAVLLPFYDRV  412
            IW + I   + +IQQ T+ + QALQ++R LG   FQIPA +  + +++T+ + +P YDR+
Sbjct  334  IWASAIIYHVPLIQQQTYVVFQALQLDRSLGTSNFQIPAATYIIFTMVTLTIWIPIYDRI  393

Query  413  LVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            LVP+ +K T   GG T+LQRMGIG+  +IL M +SG V
Sbjct  394  LVPFLQKITGKEGGFTLLQRMGIGIILAILCMVISGLV  431



>ref|XP_004236178.1| PREDICTED: protein NRT1/ PTR FAMILY 2.11 [Solanum lycopersicum]
Length=585

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/155 (47%), Positives = 105/155 (68%), Gaps = 2/155 (1%)
 Frame = +2

Query  68   SAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIPIWPA  247
            S  ++LP T  + FLNKA+++  E+    DG   N WRLCSIQ+ EEVKC+VRV PIW A
Sbjct  272  SINSELPYTDQFRFLNKASILSPEDKTNEDGSAANPWRLCSIQQVEEVKCVVRVFPIWTA  331

Query  248  GIACSLAIIQQGTFTINQALQMNRHL--GRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVP  421
            G+   + ++Q  T+ + QALQ +R +  G  F+IPA S  V S+L++++ +P YDR++VP
Sbjct  332  GLVYYVVLVQMQTYLVFQALQSDRRIFSGSEFKIPAASYSVFSMLSLSIWIPIYDRIIVP  391

Query  422  WARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            + RK T+   GIT+LQ+MGIGL  ++L M VS  V
Sbjct  392  FLRKITKKEAGITVLQKMGIGLVIAVLTMLVSAVV  426



>ref|XP_007032430.1| Major facilitator superfamily protein [Theobroma cacao]
 gb|EOY03356.1| Major facilitator superfamily protein [Theobroma cacao]
Length=593

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 106/158 (67%), Gaps = 1/158 (1%)
 Frame = +2

Query  56   LPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIP  235
            +P  S  +KLP T  + FL+K+A++  E+ +  DG   N W+LCSIQ+ EEVKC+ RVIP
Sbjct  278  MPDDSINSKLPHTDQFRFLDKSAILTPEDQINSDGSAANAWKLCSIQQVEEVKCLARVIP  337

Query  236  IWPAGIACSLAIIQQGTFTINQALQMNRHLGR-RFQIPAGSLFVVSLLTIAVLLPFYDRV  412
            +W + I    +++QQ T+ + Q LQ +R LG   F++PA S  V  +L++ + +P YDRV
Sbjct  338  VWASSIIFLTSLVQQNTYVVFQVLQSDRGLGSGGFKVPAASYTVFQMLSLTLWIPLYDRV  397

Query  413  LVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            LVP  R+ T   GGIT+LQRMGIG+ FS++ M +SG V
Sbjct  398  LVPSLRRLTGKQGGITLLQRMGIGIIFSLITMLLSGLV  435



>gb|KHG08723.1| hypothetical protein F383_35629 [Gossypium arboreum]
Length=602

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 105/158 (66%), Gaps = 1/158 (1%)
 Frame = +2

Query  56   LPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIP  235
             PP S  +KLP T  + FL+KAA+V  ++++ GDG   + WRLCS+Q+ EEVKC+ RV+P
Sbjct  285  FPPKSINSKLPYTDQFRFLDKAAIVTPQDEIKGDGSPADPWRLCSLQQVEEVKCLFRVLP  344

Query  236  IWPAGIACSLAIIQQGTFTINQALQMNRHLGR-RFQIPAGSLFVVSLLTIAVLLPFYDRV  412
            IW + I   + ++Q  T+ + QA+Q +R LG   F+IPA S  V  +L++ + +P YDR 
Sbjct  345  IWASQIMYCVTLVQLHTYAVFQAVQSDRRLGNSNFKIPAASYVVFMMLSLTIFIPVYDRA  404

Query  413  LVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            +VP+ RK     GGITILQR+GIG+  SI  M VSG V
Sbjct  405  IVPFLRKIRAKEGGITILQRIGIGMFVSIFTMLVSGMV  442



>gb|KJB50859.1| hypothetical protein B456_008G190200 [Gossypium raimondii]
Length=601

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 106/158 (67%), Gaps = 1/158 (1%)
 Frame = +2

Query  56   LPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIP  235
            +PP S  +KLP T  + FL+KAA+V  ++++ GDG   + WRLCS+Q+ EEVKC+ RV+P
Sbjct  284  IPPNSINSKLPYTDQFRFLDKAAIVTPQDEIKGDGSPADPWRLCSLQQVEEVKCLFRVLP  343

Query  236  IWPAGIACSLAIIQQGTFTINQALQMNRHLGR-RFQIPAGSLFVVSLLTIAVLLPFYDRV  412
            IW + I   + ++Q  T+ + QA+Q +R LG   F+IPA S  V  +L++ + +P YDR 
Sbjct  344  IWASQIMYCVTLVQLHTYAVFQAVQSDRRLGNSNFKIPAASYVVFMMLSLTIFIPVYDRA  403

Query  413  LVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            +VP+ RK     GGITILQR+GIG+  SI  M VSG V
Sbjct  404  VVPFLRKIRGKEGGITILQRIGIGMFVSIFTMLVSGMV  441



>ref|XP_011007525.1| PREDICTED: protein NRT1/ PTR FAMILY 2.9-like [Populus euphratica]
Length=601

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 106/158 (67%), Gaps = 1/158 (1%)
 Frame = +2

Query  56   LPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIP  235
            +P  S  +KLP T+ +  L+KAA++  E  +  DG   N W+LCS+Q+ EEVKC+ R+IP
Sbjct  288  IPAKSINSKLPRTEQFRCLDKAAIITDENQINLDGTANNPWKLCSVQQVEEVKCLFRIIP  347

Query  236  IWPAGIACSLAIIQQGTFTINQALQMNRHLGR-RFQIPAGSLFVVSLLTIAVLLPFYDRV  412
            IW   I   + ++QQ T+ + QALQM+R LG   F++PA +  + ++LT+ + +P YDR+
Sbjct  348  IWSTSILYHIPLLQQQTYAVFQALQMDRRLGSTSFKVPAATYIIFTMLTLTIWIPLYDRI  407

Query  413  LVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            +VP+ +K T   GGIT+LQRMGIG+  +IL   VSG V
Sbjct  408  IVPFLQKLTGKDGGITLLQRMGIGMILAILCTVVSGLV  445



>ref|XP_002317995.2| proton-dependent oligopeptide transport family protein [Populus 
trichocarpa]
 gb|EEE96215.2| proton-dependent oligopeptide transport family protein [Populus 
trichocarpa]
Length=607

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 107/158 (68%), Gaps = 1/158 (1%)
 Frame = +2

Query  56   LPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIP  235
            +PP S  +KL  T  + FL+KAA++  ++ +  DG   N W+LCS+Q+ EEVKC+ RVIP
Sbjct  296  IPPKSINSKLSYTDQFRFLDKAAIMTHQDQVNPDGSPANPWKLCSLQQVEEVKCLFRVIP  355

Query  236  IWPAGIACSLAIIQQGTFTINQALQMNRHLGR-RFQIPAGSLFVVSLLTIAVLLPFYDRV  412
            +W A I   +A++QQ T+ + QA+Q NR LG   F IPA S  V  +L++++ +P YDR+
Sbjct  356  VWTAAIIYYVAVVQQHTYVVFQAVQSNRRLGNSNFAIPAASYIVFLMLSMSIFIPIYDRI  415

Query  413  LVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            LVP+ R+ T    GITILQR+G+G+  +I+ M VSG V
Sbjct  416  LVPFLRRITGKEAGITILQRIGVGIFLTIVTMLVSGLV  453



>gb|KJB50861.1| hypothetical protein B456_008G190200 [Gossypium raimondii]
Length=563

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 106/158 (67%), Gaps = 1/158 (1%)
 Frame = +2

Query  56   LPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIP  235
            +PP S  +KLP T  + FL+KAA+V  ++++ GDG   + WRLCS+Q+ EEVKC+ RV+P
Sbjct  246  IPPNSINSKLPYTDQFRFLDKAAIVTPQDEIKGDGSPADPWRLCSLQQVEEVKCLFRVLP  305

Query  236  IWPAGIACSLAIIQQGTFTINQALQMNRHLGR-RFQIPAGSLFVVSLLTIAVLLPFYDRV  412
            IW + I   + ++Q  T+ + QA+Q +R LG   F+IPA S  V  +L++ + +P YDR 
Sbjct  306  IWASQIMYCVTLVQLHTYAVFQAVQSDRRLGNSNFKIPAASYVVFMMLSLTIFIPVYDRA  365

Query  413  LVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            +VP+ RK     GGITILQR+GIG+  SI  M VSG V
Sbjct  366  VVPFLRKIRGKEGGITILQRIGIGMFVSIFTMLVSGMV  403



>ref|XP_007155346.1| hypothetical protein PHAVU_003G193400g [Phaseolus vulgaris]
 gb|ESW27340.1| hypothetical protein PHAVU_003G193400g [Phaseolus vulgaris]
Length=600

 Score =   153 bits (387),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 105/157 (67%), Gaps = 1/157 (1%)
 Frame = +2

Query  56   LPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIP  235
            + P S  +KLP T  + FL+KAA++  ++D+  DG   + W LCS+Q+ EE+KC+VRVIP
Sbjct  281  ISPHSLNSKLPHTSQFRFLDKAAIITPKDDINPDGSASDPWNLCSMQQVEELKCLVRVIP  340

Query  236  IWPAGIACSLAIIQQGTFTINQALQMNRH-LGRRFQIPAGSLFVVSLLTIAVLLPFYDRV  412
            IW +GI   + I+QQ T  + Q LQ +R  L   F+IPA S  +  ++++ + LP YDR+
Sbjct  341  IWVSGIFFFVVIVQQNTMLVLQTLQADRRVLNSNFEIPAASYTIFQMMSLTIWLPIYDRI  400

Query  413  LVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGF  523
            +VP  +K T+  GGIT+LQRMGIG+  S+L   VSGF
Sbjct  401  IVPLLQKFTKKEGGITVLQRMGIGMFLSVLCAMVSGF  437



>gb|KGN63647.1| hypothetical protein Csa_1G008530 [Cucumis sativus]
Length=560

 Score =   153 bits (386),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 107/156 (69%), Gaps = 1/156 (1%)
 Frame = +2

Query  59   PPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIPI  238
            PPGS  +KL  +  + FL+KAA++  E+ +  DG   + W+LCS+Q+ EEVKC+VRV+P+
Sbjct  248  PPGSINSKLSYSDQFRFLDKAAIITAEDQIKEDGSAADPWKLCSMQQVEEVKCLVRVLPV  307

Query  239  WPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLV  418
            W AG+       QQ T+ I QALQ NR +G  F IPA S  + ++L++++ LP YDR++V
Sbjct  308  WLAGVLFFATQAQQNTYAIFQALQSNRRIG-NFTIPAASYTIFAMLSLSIWLPIYDRIVV  366

Query  419  PWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            P+  K T+  GGITILQR+GIG+  + +A+ +SG V
Sbjct  367  PFLLKFTKKEGGITILQRLGIGIFLTTMAVLLSGLV  402



>ref|XP_004138148.1| PREDICTED: probable peptide/nitrate transporter At5g62680-like 
[Cucumis sativus]
 ref|XP_004173215.1| PREDICTED: probable peptide/nitrate transporter At5g62680-like 
[Cucumis sativus]
Length=585

 Score =   153 bits (386),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 107/156 (69%), Gaps = 1/156 (1%)
 Frame = +2

Query  59   PPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIPI  238
            PPGS  +KL  +  + FL+KAA++  E+ +  DG   + W+LCS+Q+ EEVKC+VRV+P+
Sbjct  273  PPGSINSKLSYSDQFRFLDKAAIITAEDQIKEDGSAADPWKLCSMQQVEEVKCLVRVLPV  332

Query  239  WPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLV  418
            W AG+       QQ T+ I QALQ NR +G  F IPA S  + ++L++++ LP YDR++V
Sbjct  333  WLAGVLFFATQAQQNTYAIFQALQSNRRIG-NFTIPAASYTIFAMLSLSIWLPIYDRIVV  391

Query  419  PWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            P+  K T+  GGITILQR+GIG+  + +A+ +SG V
Sbjct  392  PFLLKFTKKEGGITILQRLGIGIFLTTMAVLLSGLV  427



>ref|XP_006354833.1| PREDICTED: probable peptide/nitrate transporter At3g47960-like 
[Solanum tuberosum]
Length=562

 Score =   152 bits (385),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 104/159 (65%), Gaps = 2/159 (1%)
 Frame = +2

Query  56   LPPGSAATKLPLTKDYGFLNKAAVVVIEEDL-TGDGKCRNRWRLCSIQETEEVKCIVRVI  232
            +P  S ++ LP T  + FL+KAAV   E+ + + DG   N WRLCSIQ+ EEVKC++RVI
Sbjct  269  VPSNSLSSLLPYTDQFRFLSKAAVKTPEDQINSSDGSAVNPWRLCSIQQVEEVKCLLRVI  328

Query  233  PIWPAGIACSLAIIQQGTFTINQALQMNRHLGRR-FQIPAGSLFVVSLLTIAVLLPFYDR  409
            PIW AG    ++++Q   + I QALQ +  LG   F IP  S  V+S+L+I + LP YDR
Sbjct  329  PIWVAGTIYYVSVVQSQNYVIFQALQSDNQLGHNNFHIPPASFIVISMLSITIWLPIYDR  388

Query  410  VLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            VL+PW RK T    G ++LQ+MGIG+  SI+ M +SG V
Sbjct  389  VLLPWLRKFTGKEDGFSLLQKMGIGIFLSIVTMIISGIV  427



>ref|XP_002517444.1| nitrate transporter, putative [Ricinus communis]
 gb|EEF44986.1| nitrate transporter, putative [Ricinus communis]
Length=589

 Score =   152 bits (385),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 103/158 (65%), Gaps = 1/158 (1%)
 Frame = +2

Query  56   LPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIP  235
            +P  S  T+L  T  + +L K+A+V  E+    +G   N W+LCSIQ+ EE KC++RVIP
Sbjct  272  MPIDSLNTRLLYTNQFRWLEKSAIVTCEDQTKSNGSAANPWKLCSIQQVEEAKCVLRVIP  331

Query  236  IWPAGIACSLAIIQQGTFTINQALQMNRHLGRR-FQIPAGSLFVVSLLTIAVLLPFYDRV  412
            IW + I    AI+QQ T+ + QALQ +R LG   F++PA S  + S+LT+ + +P YDR+
Sbjct  332  IWASAIIYFAAIVQQQTYVVFQALQSDRRLGNNGFKVPAASFIIFSMLTLTIWIPIYDRI  391

Query  413  LVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            L+P  RK T   GGIT+LQRMGIG+  SIL M VS  V
Sbjct  392  LMPLLRKLTGNEGGITLLQRMGIGIVLSILTMLVSALV  429



>ref|XP_009343431.1| PREDICTED: protein NRT1/ PTR FAMILY 2.11-like [Pyrus x bretschneideri]
Length=581

 Score =   152 bits (384),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 106/158 (67%), Gaps = 1/158 (1%)
 Frame = +2

Query  56   LPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIP  235
            +P  S  +K+P T  +  LNKAA++  E+ +  DG   N W LCS+Q+ EE+KC+VRV+P
Sbjct  273  VPKSSINSKIPYTDQFRILNKAAIMTNEDKINPDGSAANPWGLCSMQQVEEIKCLVRVVP  332

Query  236  IWPAGIACSLAIIQQGTFTINQALQMNRHLGRR-FQIPAGSLFVVSLLTIAVLLPFYDRV  412
            IW + +   +  +QQ T+T+ QALQ +RHLG   F+IPA S  + ++L + + +P YDR+
Sbjct  333  IWISQVIYYVTHVQQQTYTVFQALQSDRHLGNTGFKIPAASYTIFTMLALTLWIPIYDRL  392

Query  413  LVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            +VP  RK T   GGIT+LQ+MGIG+  +I+ M VSG V
Sbjct  393  IVPKLRKITGKEGGITVLQKMGIGMVLAIITMLVSGLV  430



>ref|XP_006367063.1| PREDICTED: probable peptide/nitrate transporter At5g62680-like 
[Solanum tuberosum]
Length=585

 Score =   152 bits (383),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 104/155 (67%), Gaps = 2/155 (1%)
 Frame = +2

Query  68   SAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIPIWPA  247
            S  ++LP T  + FLNKA+++  E+    DG   N WRLCSIQ+ EEVKC+VRV PIW A
Sbjct  272  SINSELPYTDQFRFLNKASILSPEDKTNEDGSAANPWRLCSIQQVEEVKCVVRVFPIWTA  331

Query  248  GIACSLAIIQQGTFTINQALQMNRHL--GRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVP  421
            G+   + ++Q  T+ + Q LQ +R L    +F+IPA S  V S+L++++ +P YDR++VP
Sbjct  332  GLIYYVVLVQMQTYVVFQTLQSDRSLYSASKFKIPAASYSVFSMLSLSIWIPIYDRIIVP  391

Query  422  WARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            + RK T+   GIT+LQ+MGIGL  ++L M VS  V
Sbjct  392  FLRKITKKEAGITVLQKMGIGLVIAVLTMLVSAVV  426



>ref|XP_002300021.1| hypothetical protein POPTR_0001s34640g [Populus trichocarpa]
 gb|EEE84826.1| hypothetical protein POPTR_0001s34640g [Populus trichocarpa]
Length=596

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 107/158 (68%), Gaps = 1/158 (1%)
 Frame = +2

Query  56   LPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIP  235
            +P  S  +KLP T+ +  L+KAA++  E  +  DG   N W+LCS+Q+ EEVKC++R+IP
Sbjct  288  IPAKSINSKLPSTEQFRCLDKAAIITDENQINLDGTAANPWKLCSVQQVEEVKCLLRIIP  347

Query  236  IWPAGIACSLAIIQQGTFTINQALQMNRHLGR-RFQIPAGSLFVVSLLTIAVLLPFYDRV  412
            +W   I   + ++QQ T+ + QALQM+R LG   F++PA +  + ++LT+ + +P YDR+
Sbjct  348  VWSTSILYQIPLLQQQTYAVFQALQMDRRLGSTSFKVPAATYIIFTMLTLTIWIPLYDRI  407

Query  413  LVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            +VP+ ++ T   GGIT+LQRMGIG+  +IL   VSG V
Sbjct  408  IVPFLQRLTGKDGGITLLQRMGIGMILAILCTVVSGLV  445



>ref|XP_010546036.1| PREDICTED: protein NRT1/ PTR FAMILY 2.11-like [Tarenaya hassleriana]
Length=601

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 77/158 (49%), Positives = 107/158 (68%), Gaps = 1/158 (1%)
 Frame = +2

Query  56   LPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIP  235
            +PP  A ++L  T  + FL+KAA++  E+ L  DG   + W+LC++Q+ EEVKCIVRV+P
Sbjct  289  IPPKYANSRLGYTGQFTFLDKAAILTPEDKLNPDGSPADPWKLCTMQQVEEVKCIVRVLP  348

Query  236  IWPAGIACSLAIIQQGTFTINQALQMNRHLGR-RFQIPAGSLFVVSLLTIAVLLPFYDRV  412
            IW A     LAI QQ T+ + QALQ +R LG   F+IPA +  V  +  + V +  YDR+
Sbjct  349  IWFAAAIYYLAITQQMTYPVFQALQSDRRLGSGSFEIPAATYVVFLMTGMTVFIIIYDRL  408

Query  413  LVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            LVP+ R+ T    GITILQRMGIG+AF++L+M VSGF+
Sbjct  409  LVPFLRRFTGKDTGITILQRMGIGMAFAVLSMVVSGFI  446



>ref|XP_002517390.1| nitrate transporter, putative [Ricinus communis]
 gb|EEF44932.1| nitrate transporter, putative [Ricinus communis]
Length=584

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 1/157 (1%)
 Frame = +2

Query  59   PPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIPI  238
            P  S  +KL  T    FL+KAA+V  E+ +  DG   N WRLCSIQ+ EE KC VR+IPI
Sbjct  273  PSSSMNSKLRHTSQLSFLDKAAIVTSEDKINLDGSATNPWRLCSIQQVEEAKCWVRIIPI  332

Query  239  WPAGIACSLAIIQQGTFTINQALQMNRHL-GRRFQIPAGSLFVVSLLTIAVLLPFYDRVL  415
            W + I   + +IQQ T+ + QALQ++R L    F +PA +  +  ++T+ V +P YDR+L
Sbjct  333  WASAIIFHIPLIQQNTYAVLQALQLDRRLDATDFTVPAATYVIFIMITLTVWIPIYDRLL  392

Query  416  VPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            VP+  + T   GG+T+LQRMGIG+A SI+ M VSG V
Sbjct  393  VPYLERLTGKDGGLTLLQRMGIGIALSIICMLVSGLV  429



>ref|XP_004241514.1| PREDICTED: protein NRT1/ PTR FAMILY 2.11-like [Solanum lycopersicum]
Length=578

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 103/159 (65%), Gaps = 2/159 (1%)
 Frame = +2

Query  56   LPPGSAATKLPLTKDYGFLNKAAVVVIEEDL-TGDGKCRNRWRLCSIQETEEVKCIVRVI  232
            +P  S  + LP T  + FL+KAAV   E+ + + DG   + WRLCSIQ+ EEVKC++RVI
Sbjct  270  VPSNSLNSMLPYTNQFRFLSKAAVKTPEDHINSSDGSAVDPWRLCSIQQVEEVKCLLRVI  329

Query  233  PIWPAGIACSLAIIQQGTFTINQALQMNRHLGR-RFQIPAGSLFVVSLLTIAVLLPFYDR  409
            PIW AG    ++++Q   + I QALQ +  LG   F IP  S  V+S+L+I + LP YDR
Sbjct  330  PIWVAGTIYYVSVVQSQNYVIFQALQSDNQLGHINFHIPPASFIVISMLSITIWLPIYDR  389

Query  410  VLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            VL+PW RK T    GIT+LQ+MGIG+  SI  M +SG V
Sbjct  390  VLLPWLRKFTGKEDGITLLQKMGIGIFLSIATMILSGIV  428



>ref|XP_006347445.1| PREDICTED: probable peptide/nitrate transporter At5g62680-like 
[Solanum tuberosum]
Length=578

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 104/159 (65%), Gaps = 2/159 (1%)
 Frame = +2

Query  56   LPPGSAATKLPLTKDYGFLNKAAVVVIEEDL-TGDGKCRNRWRLCSIQETEEVKCIVRVI  232
            +P  S  + LP T  + FL+KAAV   E+ + + DG   + WRLCSIQ+ EEVKC++RV+
Sbjct  270  VPSNSLNSILPYTNQFRFLSKAAVKTPEDHINSSDGSAVDPWRLCSIQQVEEVKCLLRVM  329

Query  233  PIWPAGIACSLAIIQQGTFTINQALQMNRHLGR-RFQIPAGSLFVVSLLTIAVLLPFYDR  409
            PIW AG    ++++Q   + I QALQ +  LG   F IP  S  V+S+L+I + LP YDR
Sbjct  330  PIWVAGTIYYVSVVQSQNYVIFQALQSDNQLGHINFHIPPASFIVISMLSITIWLPIYDR  389

Query  410  VLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            VL+PW RK T    GIT+LQ+MGIG+  SI+ M +SG V
Sbjct  390  VLLPWLRKFTGKEDGITLLQKMGIGIFLSIVTMIISGIV  428



>ref|XP_006373301.1| hypothetical protein POPTR_0017s11320g [Populus trichocarpa]
 gb|ERP51098.1| hypothetical protein POPTR_0017s11320g [Populus trichocarpa]
Length=598

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/175 (41%), Positives = 113/175 (65%), Gaps = 5/175 (3%)
 Frame = +2

Query  2    RLPANDSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWR  181
            +LP N +     V     +P  S  +KLP T+ + FL+KAA++   + +  DG   N  +
Sbjct  273  KLPENST-----VSLFSYIPAKSINSKLPRTEQFRFLDKAAIITDGDQINLDGSATNPSK  327

Query  182  LCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLF  361
            LCSIQ+ EEVKC++R+IPIW   I   + +IQQ T+ + QALQM+R LG  F++PA +  
Sbjct  328  LCSIQQVEEVKCLLRIIPIWSTSILYHIPLIQQQTYAVFQALQMDRRLGTSFEVPAATYV  387

Query  362  VVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            + +++T+ + +P YDR++VP+ ++ T   GG+T+LQRMGIG+  ++L   VSG V
Sbjct  388  IFTMITLTIWIPLYDRIIVPFLQRLTGKEGGLTLLQRMGIGMVLAMLCTIVSGLV  442



>emb|CDP14878.1| unnamed protein product [Coffea canephora]
Length=1132

 Score =   154 bits (389),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 106/158 (67%), Gaps = 1/158 (1%)
 Frame = +2

Query  56   LPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIP  235
            +P  S  +++  TK + FLNKAAV+   + +  DG   + W+LCSIQ+ EEVKC+VR+IP
Sbjct  271  VPSNSINSRIAYTKQFRFLNKAAVITSNDSIKADGSTADPWKLCSIQQVEEVKCVVRLIP  330

Query  236  IWPAGIACSLAIIQQGTFTINQALQMNRHLGR-RFQIPAGSLFVVSLLTIAVLLPFYDRV  412
            +W  G+   ++++QQ  + + QALQ +R LG+  F IPA S  + ++L I + LP YDR+
Sbjct  331  MWAVGLIYYVSVVQQQNYAVFQALQSDRRLGKSNFHIPAASYIIFAMLAITIWLPIYDRI  390

Query  413  LVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            LVPW  + T    G+T+LQ++GIGL  S+ A+ +SGF+
Sbjct  391  LVPWLGRLTGKEDGLTLLQKVGIGLIISVFALLISGFI  428


 Score =   150 bits (378),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 71/162 (44%), Positives = 106/162 (65%), Gaps = 1/162 (1%)
 Frame = +2

Query  44   YNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIV  223
            +N      S  ++LP T  + FL+KAA++  E+++  DG   N WRLC++Q+ E VKCI+
Sbjct  813  FNSFSTASSINSRLPYTDQFRFLDKAAIITPEDEINSDGSPANPWRLCNVQQVERVKCIL  872

Query  224  RVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLG-RRFQIPAGSLFVVSLLTIAVLLPF  400
            RVIPIW A I   ++++Q   + + +ALQ +R  G   F+IPA S  VV++L + + +P 
Sbjct  873  RVIPIWVACIVYFISVVQIQNYVVFEALQADRRFGTSEFKIPAASYIVVAMLALTIWVPI  932

Query  401  YDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            YDR++VPW R+      G+TILQR+GIG AFS++ M VSG V
Sbjct  933  YDRLIVPWLRRVAGKEDGLTILQRIGIGFAFSVVTMIVSGLV  974



>ref|XP_008374512.1| PREDICTED: protein NRT1/ PTR FAMILY 2.9 [Malus domestica]
Length=630

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 105/157 (67%), Gaps = 1/157 (1%)
 Frame = +2

Query  59   PPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIPI  238
            PP S  + LP T  +  L+KAA++  E+ +  DG   + WRLCS+Q+ EEVKC++RV+PI
Sbjct  325  PPDSINSNLPYTNQFRCLDKAAILTPEDKINPDGSAADPWRLCSMQQVEEVKCLLRVLPI  384

Query  239  WPAGIACSLAIIQQGTFTINQALQMNRHLGR-RFQIPAGSLFVVSLLTIAVLLPFYDRVL  415
            W A +   +AI+QQ T+   QALQ NR LG+  FQIPA S  +  +L + + +P YDR+L
Sbjct  385  WAAALIYHIAIVQQQTYVXFQALQSNRRLGKTXFQIPAASYXIFLMLGMTIWIPIYDRLL  444

Query  416  VPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            VP+ ++ T    GIT+LQR+GIG+  S++ M VS FV
Sbjct  445  VPFLQRLTGKXXGITLLQRIGIGIFLSVITMLVSAFV  481



>ref|XP_010037637.1| PREDICTED: protein NRT1/ PTR FAMILY 2.9-like [Eucalyptus grandis]
 gb|KCW49375.1| hypothetical protein EUGRSUZ_K02918 [Eucalyptus grandis]
Length=597

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 67/158 (42%), Positives = 106/158 (67%), Gaps = 1/158 (1%)
 Frame = +2

Query  56   LPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIP  235
            +P  +  +KLP T  + F+NKA ++  ++ +  DG   N WRLCSIQ+ EEVKC+VRV+P
Sbjct  281  VPSSTINSKLPHTDQFRFINKATIITPQDQINRDGSAANPWRLCSIQQVEEVKCLVRVVP  340

Query  236  IWPAGIACSLAIIQQGTFTINQALQMNRHLGR-RFQIPAGSLFVVSLLTIAVLLPFYDRV  412
            IW + +   +A++QQ T+ + QALQ +R LG   F+IPA +  + S++ + + +P YDR+
Sbjct  341  IWTSAMIYYIALVQQQTYVVFQALQSDRRLGSLNFKIPAATYIIFSMIALTIWIPIYDRM  400

Query  413  LVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            ++P  RK T   GGIT+LQ+MGIG+  +++ M +S  V
Sbjct  401  IIPQLRKLTGKEGGITLLQKMGIGMFLAVITMLISAIV  438



>ref|XP_011013862.1| PREDICTED: protein NRT1/ PTR FAMILY 2.10-like [Populus euphratica]
Length=480

 Score =   150 bits (378),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 71/175 (41%), Positives = 113/175 (65%), Gaps = 5/175 (3%)
 Frame = +2

Query  2    RLPANDSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWR  181
            +LP N +     V     +P  S  +KLP T+ + +L+KAA++   + +  DG   N  +
Sbjct  155  KLPENST-----VSLFSYIPAKSINSKLPRTEQFRYLDKAAIITDGDQINLDGSATNPSK  209

Query  182  LCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLF  361
            LCSIQ+ EEVKC++R+IPIW   I   + +IQQ T+ + QALQM+R LG  F++PA +  
Sbjct  210  LCSIQQVEEVKCLLRIIPIWSTSILYHIPLIQQQTYAVFQALQMDRRLGTSFEVPAATYV  269

Query  362  VVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            + +++T+ + +P YDR++VP+ ++ T   GG+T+LQRMGIG+  ++L   VSG V
Sbjct  270  IFTMITLTIWIPLYDRIIVPFLQRLTGKEGGLTLLQRMGIGMVLAMLCTIVSGLV  324



>ref|XP_007133916.1| hypothetical protein PHAVU_010G003000g [Phaseolus vulgaris]
 gb|ESW05910.1| hypothetical protein PHAVU_010G003000g [Phaseolus vulgaris]
Length=563

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/164 (45%), Positives = 110/164 (67%), Gaps = 2/164 (1%)
 Frame = +2

Query  35   GVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVK  214
            G+YY+PP    +   K+PLT     LNKAA++  +++L   G  +N WRLCSIQ+ EEVK
Sbjct  251  GLYYDPPADEKTP-LKMPLTNQLRCLNKAALIR-DDELNEGGSVKNPWRLCSIQQVEEVK  308

Query  215  CIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLFVVSLLTIAVLL  394
            C+++++PIW +GI C + I+QQGTF ++QAL+M+RH+G  F++P  S   VSL+TI + L
Sbjct  309  CLIKMLPIWASGILCFIPIVQQGTFPVSQALKMDRHIGAHFKLPPASYSAVSLITICIFL  368

Query  395  PFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            P ++  L P   K T+   G+T LQ++ IG  FS+L M  +G V
Sbjct  369  PCFELFLQPALAKVTKKEEGLTSLQKIVIGDIFSVLTMVSAGLV  412



>ref|XP_009799219.1| PREDICTED: protein NRT1/ PTR FAMILY 2.11-like [Nicotiana sylvestris]
Length=601

 Score =   150 bits (379),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 80/157 (51%), Positives = 105/157 (67%), Gaps = 1/157 (1%)
 Frame = +2

Query  59   PPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIPI  238
            PP S  +KL  T  + FL+KAA+V  E+ +  DG   N+W LCS+Q+ EE KC+VRVIPI
Sbjct  286  PPKSINSKLSYTHQFRFLDKAAIVTPEDQIKSDGSAANQWNLCSLQQVEEAKCVVRVIPI  345

Query  239  WPAGIACSLAIIQQGTFTINQALQMNRHLGR-RFQIPAGSLFVVSLLTIAVLLPFYDRVL  415
            W A I   + IIQQ  F + QALQ NRHLG   FQIPA +  + S+L++ + LP YDR++
Sbjct  346  WAAAIVYHVGIIQQQQFVVFQALQSNRHLGNSNFQIPAATYTIFSMLSLTLWLPIYDRII  405

Query  416  VPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            VP  R+ T   GGITILQRMGIG+   +L+  VS F+
Sbjct  406  VPLLRRLTGKEGGITILQRMGIGIFLIVLSSLVSAFI  442



>ref|XP_007037199.1| Major facilitator superfamily protein isoform 4 [Theobroma cacao]
 gb|EOY21700.1| Major facilitator superfamily protein isoform 4 [Theobroma cacao]
Length=455

 Score =   149 bits (375),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 106/157 (68%), Gaps = 1/157 (1%)
 Frame = +2

Query  59   PPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIPI  238
            PP S  +KLP T  + FL+KAA++  ++ +  DG   + WRLCS+Q+ EEVKC++RV+PI
Sbjct  138  PPKSINSKLPYTDQFKFLDKAAIMTPQDQINPDGSPADPWRLCSMQQVEEVKCLLRVLPI  197

Query  239  WPAGIACSLAIIQQGTFTINQALQMNRHLGR-RFQIPAGSLFVVSLLTIAVLLPFYDRVL  415
            W + I   +AI+QQ T+ + QA+Q +R LG   F+IPA +  V  +L++   +P YDRV+
Sbjct  198  WASQIIYFVAIVQQQTYAVFQAVQSDRRLGNSNFKIPAATYVVFLMLSLTCFIPIYDRVI  257

Query  416  VPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            VP+ R+     GGITILQR+GIG+  S++ M VS  V
Sbjct  258  VPFLRRVRGKEGGITILQRIGIGMFLSVITMLVSAVV  294



>dbj|BAC83856.1| putative nitrate transporter NRT1-5 [Oryza sativa Japonica Group]
 gb|EAZ03071.1| hypothetical protein OsI_25216 [Oryza sativa Indica Group]
Length=618

 Score =   150 bits (378),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 75/153 (49%), Positives = 103/153 (67%), Gaps = 6/153 (4%)
 Frame = +2

Query  77   TKLPLTKDYGFLNKAAVVV-IEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIPIWPAGI  253
            ++LP T  + FL+KAAVVV  + ++ GDG  +N WRLCS+Q+ EE KCI+RV+P+W   I
Sbjct  302  SRLPYTDQFRFLDKAAVVVDAKSEVGGDGHPKNPWRLCSLQQVEEAKCILRVVPVWLTCI  361

Query  254  ACSLAIIQQGTFTINQALQMNRHL-----GRRFQIPAGSLFVVSLLTIAVLLPFYDRVLV  418
               +A  Q  T+ I QA Q +RHL        F++P GS  V  +L +AV +P YDR++V
Sbjct  362  VYYVAFAQTNTYVILQAAQSDRHLGGGGGAGSFEVPPGSFTVFPMLALAVWIPLYDRLVV  421

Query  419  PWARKRTRVIGGITILQRMGIGLAFSILAMAVS  517
            PWAR+ T   GGIT LQRMG+G+A S+LAM V+
Sbjct  422  PWARRLTGREGGITPLQRMGVGMALSVLAMLVA  454



>ref|XP_010037636.1| PREDICTED: protein NRT1/ PTR FAMILY 2.9-like [Eucalyptus grandis]
 gb|KCW49374.1| hypothetical protein EUGRSUZ_K02917 [Eucalyptus grandis]
Length=617

 Score =   149 bits (377),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 103/157 (66%), Gaps = 1/157 (1%)
 Frame = +2

Query  59   PPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIPI  238
            PP +  +KLP T  +  L+KAA+V  E+    DG   + WRLCS+Q+ EEVKCI+RV+PI
Sbjct  303  PPKTINSKLPYTDQFRCLDKAAIVTAEDKKKPDGSSVDPWRLCSLQQVEEVKCIIRVMPI  362

Query  239  WPAGIACSLAIIQQGTFTINQALQMNRHL-GRRFQIPAGSLFVVSLLTIAVLLPFYDRVL  415
            W AG+   L I+QQ T+ + QA QM+R L    F IPA S  V  +L++ + +P YDR++
Sbjct  363  WVAGVFYYLVIVQQNTYGVFQATQMDRRLRNTGFSIPAASYGVFLMLSMTIFIPIYDRLI  422

Query  416  VPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            V + R+ T   GGIT+LQR+GIGL F +L M VS  V
Sbjct  423  VSFLRRLTGKEGGITLLQRLGIGLFFGVLTMLVSAIV  459



>ref|XP_007037198.1| Major facilitator superfamily protein isoform 3 [Theobroma cacao]
 gb|EOY21699.1| Major facilitator superfamily protein isoform 3 [Theobroma cacao]
Length=506

 Score =   149 bits (375),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 106/157 (68%), Gaps = 1/157 (1%)
 Frame = +2

Query  59   PPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIPI  238
            PP S  +KLP T  + FL+KAA++  ++ +  DG   + WRLCS+Q+ EEVKC++RV+PI
Sbjct  189  PPKSINSKLPYTDQFKFLDKAAIMTPQDQINPDGSPADPWRLCSMQQVEEVKCLLRVLPI  248

Query  239  WPAGIACSLAIIQQGTFTINQALQMNRHLGR-RFQIPAGSLFVVSLLTIAVLLPFYDRVL  415
            W + I   +AI+QQ T+ + QA+Q +R LG   F+IPA +  V  +L++   +P YDRV+
Sbjct  249  WASQIIYFVAIVQQQTYAVFQAVQSDRRLGNSNFKIPAATYVVFLMLSLTCFIPIYDRVI  308

Query  416  VPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            VP+ R+     GGITILQR+GIG+  S++ M VS  V
Sbjct  309  VPFLRRVRGKEGGITILQRIGIGMFLSVITMLVSAVV  345



>ref|XP_004508783.1| PREDICTED: probable peptide/nitrate transporter At1g18880-like 
isoform X3 [Cicer arietinum]
Length=594

 Score =   149 bits (376),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 74/154 (48%), Positives = 106/154 (69%), Gaps = 1/154 (1%)
 Frame = +2

Query  68   SAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIPIWPA  247
            S  +KLP T  + FL+KAA++  ++++  DG   + W LCSIQ+ EEVKC+VRV+PIW +
Sbjct  280  SINSKLPRTLQFRFLDKAAIITPQDNINPDGSASDPWSLCSIQQVEEVKCLVRVLPIWVS  339

Query  248  GIACSLAIIQQGTFTINQALQMNRHL-GRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPW  424
            GI   +A++QQ T  + QALQ +R +    F+IPA S  + ++L++ + LP YDR++VP 
Sbjct  340  GILYYVALVQQSTMLVFQALQSDRTIFNTDFKIPAASYTIFAMLSLTIFLPIYDRIIVPT  399

Query  425  ARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
             R+ T   GGITILQR+GIG+  SIL M VSG V
Sbjct  400  LRRFTGKEGGITILQRIGIGMFVSILCMLVSGVV  433



>emb|CDP10977.1| unnamed protein product [Coffea canephora]
Length=597

 Score =   149 bits (376),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 102/158 (65%), Gaps = 1/158 (1%)
 Frame = +2

Query  56   LPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIP  235
            + P S  +KLP T  + FLN+AA++  E+ +  DG   N W+LCSIQ+ EE+KC+VRV+P
Sbjct  273  ISPNSTNSKLPYTDQFKFLNRAAIITSEDRINSDGSASNPWKLCSIQQVEEMKCVVRVLP  332

Query  236  IWPAGIACSLAIIQQGTFTINQALQMNRHLGR-RFQIPAGSLFVVSLLTIAVLLPFYDRV  412
            IW AGI   + + Q  TF + QA Q +R +G   F+IPA S  +  +L++ + +P YDR+
Sbjct  333  IWIAGIIYYVVLNQLQTFVVFQATQADRRVGHANFKIPAASYQIFQMLSLTIWIPIYDRI  392

Query  413  LVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            ++P  RK T+   GIT+LQRMG G+   I  M +SG V
Sbjct  393  MIPCLRKITKEENGITVLQRMGFGIIVGIATMILSGAV  430



>gb|EMS49861.1| Nitrate transporter 1.7 [Triticum urartu]
Length=622

 Score =   149 bits (377),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 79/174 (45%), Positives = 109/174 (63%), Gaps = 15/174 (9%)
 Frame = +2

Query  44   YNPPLPPGSAATKLPLTKDYGF-------------LNKAAVVVIEEDLTGDGKCRNRWRL  184
            ++PP+  G    +LPLT  +               LNK A+V  + D+  DG  RN W L
Sbjct  292  FSPPIG-GHRIFRLPLTSQFRHSCAGKCKSFFCKCLNKGAIVR-DGDINDDGSARNSWEL  349

Query  185  CSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLFV  364
            CSIQ+ EEVKC++R++PI  +GI C +A+ QQ T+ I Q L M+ HLG  F+IPAGS+  
Sbjct  350  CSIQQIEEVKCLLRIVPICISGIICFVALAQQFTYIILQTLTMDCHLGTHFEIPAGSVIS  409

Query  365  VSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            +SL+ +   +P YDR+LVP AR+ T V  GIT+LQR GIGL  S ++M V+G V
Sbjct  410  ISLIALTAFMPIYDRILVPIARRFTGVESGITLLQRQGIGLVISPISMVVAGLV  463



>ref|XP_010112576.1| putative peptide/nitrate transporter [Morus notabilis]
 gb|EXC34211.1| putative peptide/nitrate transporter [Morus notabilis]
Length=588

 Score =   149 bits (376),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 104/158 (66%), Gaps = 1/158 (1%)
 Frame = +2

Query  56   LPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIP  235
            +PP S  + L  T  + F++KAA+   ++ +  DG   N WRLCS+Q+ EEVKC++RVI 
Sbjct  272  IPPNSTNSNLSYTAQFRFVDKAAITEADDKINPDGSTANPWRLCSMQQVEEVKCLMRVIS  331

Query  236  IWPAGIACSLAIIQQGTFTINQALQMNRHLGRR-FQIPAGSLFVVSLLTIAVLLPFYDRV  412
            IW + +   ++I Q   + + Q LQ +RHLG   F+IPA S  V +++T+ + +P YDR+
Sbjct  332  IWASFVLFYVSITQLHNYVVFQVLQADRHLGNSGFKIPAASYSVFTMITVTIWIPIYDRI  391

Query  413  LVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            LVP  RK T +  GITILQR+G+GL  SI+AM +SG +
Sbjct  392  LVPRLRKYTGIDSGITILQRIGVGLVLSIVAMILSGLI  429



>ref|XP_004508781.1| PREDICTED: probable peptide/nitrate transporter At1g18880-like 
isoform X1 [Cicer arietinum]
 ref|XP_004508782.1| PREDICTED: probable peptide/nitrate transporter At1g18880-like 
isoform X2 [Cicer arietinum]
Length=598

 Score =   149 bits (376),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 74/154 (48%), Positives = 106/154 (69%), Gaps = 1/154 (1%)
 Frame = +2

Query  68   SAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIPIWPA  247
            S  +KLP T  + FL+KAA++  ++++  DG   + W LCSIQ+ EEVKC+VRV+PIW +
Sbjct  284  SINSKLPRTLQFRFLDKAAIITPQDNINPDGSASDPWSLCSIQQVEEVKCLVRVLPIWVS  343

Query  248  GIACSLAIIQQGTFTINQALQMNRHL-GRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPW  424
            GI   +A++QQ T  + QALQ +R +    F+IPA S  + ++L++ + LP YDR++VP 
Sbjct  344  GILYYVALVQQSTMLVFQALQSDRTIFNTDFKIPAASYTIFAMLSLTIFLPIYDRIIVPT  403

Query  425  ARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
             R+ T   GGITILQR+GIG+  SIL M VSG V
Sbjct  404  LRRFTGKEGGITILQRIGIGMFVSILCMLVSGVV  437



>ref|XP_008796643.1| PREDICTED: protein NRT1/ PTR FAMILY 2.11-like isoform X1 [Phoenix 
dactylifera]
Length=595

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/162 (44%), Positives = 107/162 (66%), Gaps = 2/162 (1%)
 Frame = +2

Query  44   YNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIV  223
            ++PP    S  +KLP T  +  L+KAA+    +++  +G   N WRLCS+Q+ E+VKC+ 
Sbjct  277  FDPP-HLSSLVSKLPYTDQFRCLDKAAIRTPMDEIKPNGHAANPWRLCSLQQVEQVKCLA  335

Query  224  RVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGR-RFQIPAGSLFVVSLLTIAVLLPF  400
            R+IPIW  GI   +A++Q+ TF + Q LQ +R  G+ +F+IPA S  V ++L + + +P 
Sbjct  336  RIIPIWTTGIIFYVAVVQETTFVVFQGLQADRRFGKTKFEIPAASFNVFAMLALTIWIPV  395

Query  401  YDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            YDR+LVPW R+ T   GG T+LQRMGIG+  S++AM V+  V
Sbjct  396  YDRILVPWLRRVTGREGGFTLLQRMGIGIVLSVVAMIVARLV  437



>ref|XP_007037196.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY21697.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
Length=593

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 106/157 (68%), Gaps = 1/157 (1%)
 Frame = +2

Query  59   PPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIPI  238
            PP S  +KLP T  + FL+KAA++  ++ +  DG   + WRLCS+Q+ EEVKC++RV+PI
Sbjct  276  PPKSINSKLPYTDQFKFLDKAAIMTPQDQINPDGSPADPWRLCSMQQVEEVKCLLRVLPI  335

Query  239  WPAGIACSLAIIQQGTFTINQALQMNRHLGR-RFQIPAGSLFVVSLLTIAVLLPFYDRVL  415
            W + I   +AI+QQ T+ + QA+Q +R LG   F+IPA +  V  +L++   +P YDRV+
Sbjct  336  WASQIIYFVAIVQQQTYAVFQAVQSDRRLGNSNFKIPAATYVVFLMLSLTCFIPIYDRVI  395

Query  416  VPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            VP+ R+     GGITILQR+GIG+  S++ M VS  V
Sbjct  396  VPFLRRVRGKEGGITILQRIGIGMFLSVITMLVSAVV  432



>ref|XP_007037197.1| Major facilitator superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY21698.1| Major facilitator superfamily protein isoform 2 [Theobroma cacao]
Length=598

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 106/157 (68%), Gaps = 1/157 (1%)
 Frame = +2

Query  59   PPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIPI  238
            PP S  +KLP T  + FL+KAA++  ++ +  DG   + WRLCS+Q+ EEVKC++RV+PI
Sbjct  281  PPKSINSKLPYTDQFKFLDKAAIMTPQDQINPDGSPADPWRLCSMQQVEEVKCLLRVLPI  340

Query  239  WPAGIACSLAIIQQGTFTINQALQMNRHLGR-RFQIPAGSLFVVSLLTIAVLLPFYDRVL  415
            W + I   +AI+QQ T+ + QA+Q +R LG   F+IPA +  V  +L++   +P YDRV+
Sbjct  341  WASQIIYFVAIVQQQTYAVFQAVQSDRRLGNSNFKIPAATYVVFLMLSLTCFIPIYDRVI  400

Query  416  VPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            VP+ R+     GGITILQR+GIG+  S++ M VS  V
Sbjct  401  VPFLRRVRGKEGGITILQRIGIGMFLSVITMLVSAVV  437



>ref|XP_006439664.1| hypothetical protein CICLE_v10019319mg [Citrus clementina]
 gb|ESR52904.1| hypothetical protein CICLE_v10019319mg [Citrus clementina]
Length=457

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 80/158 (51%), Positives = 106/158 (67%), Gaps = 1/158 (1%)
 Frame = +2

Query  56   LPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIP  235
            +PPGS   KL  T  + FL+KAA++  E+ +  DG   NRWRLCS+Q+ EEVKC++RVIP
Sbjct  137  IPPGSINCKLRHTDQFRFLDKAAMLTPEDHINPDGSAANRWRLCSVQQVEEVKCVLRVIP  196

Query  236  IWPAGIACSLAIIQQGTFTINQALQMNRHLGR-RFQIPAGSLFVVSLLTIAVLLPFYDRV  412
             W A +   L I QQ T+ + QA Q NR LG   F+IPA S  V  +L++ + +P YDR+
Sbjct  197  TWFAAVIFHLMINQQHTYAVFQAQQSNRRLGNTSFKIPAASYVVFMMLSMTIWIPIYDRI  256

Query  413  LVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
             VP+ R+ T   GGIT+LQRMGIG+  SI+AM VSG V
Sbjct  257  FVPFLRRLTGKEGGITLLQRMGIGIGISIIAMLVSGVV  294



>ref|XP_008796644.1| PREDICTED: protein NRT1/ PTR FAMILY 2.11-like isoform X2 [Phoenix 
dactylifera]
Length=562

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/162 (44%), Positives = 107/162 (66%), Gaps = 2/162 (1%)
 Frame = +2

Query  44   YNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIV  223
            ++PP    S  +KLP T  +  L+KAA+    +++  +G   N WRLCS+Q+ E+VKC+ 
Sbjct  277  FDPP-HLSSLVSKLPYTDQFRCLDKAAIRTPMDEIKPNGHAANPWRLCSLQQVEQVKCLA  335

Query  224  RVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGR-RFQIPAGSLFVVSLLTIAVLLPF  400
            R+IPIW  GI   +A++Q+ TF + Q LQ +R  G+ +F+IPA S  V ++L + + +P 
Sbjct  336  RIIPIWTTGIIFYVAVVQETTFVVFQGLQADRRFGKTKFEIPAASFNVFAMLALTIWIPV  395

Query  401  YDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            YDR+LVPW R+ T   GG T+LQRMGIG+  S++AM V+  V
Sbjct  396  YDRILVPWLRRVTGREGGFTLLQRMGIGIVLSVVAMIVARLV  437



>gb|EAZ38982.1| hypothetical protein OsJ_23400 [Oryza sativa Japonica Group]
Length=760

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/153 (49%), Positives = 103/153 (67%), Gaps = 6/153 (4%)
 Frame = +2

Query  77   TKLPLTKDYGFLNKAAVVV-IEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIPIWPAGI  253
            ++LP T  + FL+KAAVVV  + ++ GDG  +N WRLCS+Q+ EE KCI+RV+P+W   I
Sbjct  302  SRLPYTDQFRFLDKAAVVVDAKSEVGGDGHPKNPWRLCSLQQVEEAKCILRVVPVWLTCI  361

Query  254  ACSLAIIQQGTFTINQALQMNRHL-----GRRFQIPAGSLFVVSLLTIAVLLPFYDRVLV  418
               +A  Q  T+ I QA Q +RHL        F++P GS  V  +L +AV +P YDR++V
Sbjct  362  VYYVAFAQTNTYVILQAAQSDRHLGGGGGAGSFEVPPGSFTVFPMLALAVWIPLYDRLVV  421

Query  419  PWARKRTRVIGGITILQRMGIGLAFSILAMAVS  517
            PWAR+ T   GGIT LQRMG+G+A S+LAM V+
Sbjct  422  PWARRLTGREGGITPLQRMGVGMALSVLAMLVA  454



>ref|XP_007210278.1| hypothetical protein PRUPE_ppa003007mg [Prunus persica]
 gb|EMJ11477.1| hypothetical protein PRUPE_ppa003007mg [Prunus persica]
Length=612

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 108/158 (68%), Gaps = 1/158 (1%)
 Frame = +2

Query  56   LPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIP  235
            +PP S  +KLP T  + +L+KAA++  ++++  DG   N WRLCS+Q+ EE+KC++RV+P
Sbjct  296  MPPNSINSKLPNTNQFRYLDKAAILTPQDEILPDGSAANPWRLCSMQQVEELKCLLRVLP  355

Query  236  IWPAGIACSLAIIQQGTFTINQALQMNRHLGR-RFQIPAGSLFVVSLLTIAVLLPFYDRV  412
            IW A + C +AI+Q  T+ + QA+Q +R LG   F IP  S  V  +L++ + +P YD++
Sbjct  356  IWAAALVCHVAIVQLQTYVVFQAIQSDRRLGNTNFDIPPASYSVFLMLSMTIWIPIYDQL  415

Query  413  LVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            +VP+ ++ T   GGIT+LQR+GIG   +++ M VS FV
Sbjct  416  VVPFLQRLTGKEGGITLLQRIGIGTFLTVICMIVSAFV  453



>gb|KHN48656.1| Putative peptide/nitrate transporter [Glycine soja]
Length=568

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 104/158 (66%), Gaps = 1/158 (1%)
 Frame = +2

Query  56   LPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIP  235
            + P S  +KLP T  +  L+KAA++  ++ +  DG   + W LCS+Q+ EE+KC++RVIP
Sbjct  249  ISPQSINSKLPHTSQFRLLDKAAIITPQDGINPDGSASDPWSLCSMQQVEELKCLLRVIP  308

Query  236  IWPAGIACSLAIIQQGTFTINQALQMNRH-LGRRFQIPAGSLFVVSLLTIAVLLPFYDRV  412
            IW AGI   +AI+QQ T  + QALQ +R  L   F+IPA S  +  +L++ + LP YDR+
Sbjct  309  IWVAGIIFYVAIVQQNTMLVFQALQSDRRVLNTNFKIPAASYTIFQMLSLTIWLPIYDRI  368

Query  413  LVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            LVP  ++ T+  GGIT+LQRMG G+  SIL   VSG V
Sbjct  369  LVPSLQRVTKKEGGITVLQRMGFGMFLSILCTMVSGVV  406



>ref|XP_003524995.1| PREDICTED: probable peptide/nitrate transporter At3g47960-like 
[Glycine max]
Length=596

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 104/158 (66%), Gaps = 1/158 (1%)
 Frame = +2

Query  56   LPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIP  235
            + P S  +KLP T  +  L+KAA++  ++ +  DG   + W LCS+Q+ EE+KC++RVIP
Sbjct  277  ISPQSINSKLPHTSQFRLLDKAAIITPQDGINPDGSASDPWSLCSMQQVEELKCLLRVIP  336

Query  236  IWPAGIACSLAIIQQGTFTINQALQMNRH-LGRRFQIPAGSLFVVSLLTIAVLLPFYDRV  412
            IW AGI   +AI+QQ T  + QALQ +R  L   F+IPA S  +  +L++ + LP YDR+
Sbjct  337  IWVAGIIFYVAIVQQNTMLVFQALQSDRRVLNTNFKIPAASYTIFQMLSLTIWLPIYDRI  396

Query  413  LVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            LVP  ++ T+  GGIT+LQRMG G+  SIL   VSG V
Sbjct  397  LVPSLQRVTKKEGGITVLQRMGFGMFLSILCTMVSGVV  434



>ref|XP_006439663.1| hypothetical protein CICLE_v10019319mg [Citrus clementina]
 gb|ESR52903.1| hypothetical protein CICLE_v10019319mg [Citrus clementina]
Length=621

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 80/158 (51%), Positives = 106/158 (67%), Gaps = 1/158 (1%)
 Frame = +2

Query  56   LPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIP  235
            +PPGS   KL  T  + FL+KAA++  E+ +  DG   NRWRLCS+Q+ EEVKC++RVIP
Sbjct  301  IPPGSINCKLRHTDQFRFLDKAAMLTPEDHINPDGSAANRWRLCSVQQVEEVKCVLRVIP  360

Query  236  IWPAGIACSLAIIQQGTFTINQALQMNRHLGR-RFQIPAGSLFVVSLLTIAVLLPFYDRV  412
             W A +   L I QQ T+ + QA Q NR LG   F+IPA S  V  +L++ + +P YDR+
Sbjct  361  TWFAAVIFHLMINQQHTYAVFQAQQSNRRLGNTSFKIPAASYVVFMMLSMTIWIPIYDRI  420

Query  413  LVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
             VP+ R+ T   GGIT+LQRMGIG+  SI+AM VSG V
Sbjct  421  FVPFLRRLTGKEGGITLLQRMGIGIGISIIAMLVSGVV  458



>emb|CDY00315.1| BnaA06g22160D [Brassica napus]
Length=612

 Score =   147 bits (372),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 104/157 (66%), Gaps = 1/157 (1%)
 Frame = +2

Query  59   PPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIPI  238
            PP  A +KL  T  + FL+KAA++  E+ L  DGK  + W+LC++Q+ EEVKCIVRV+PI
Sbjct  295  PPKYANSKLKYTDQFRFLDKAAILAPEDKLEADGKPADPWKLCTMQQVEEVKCIVRVLPI  354

Query  239  WPAGIACSLAIIQQGTFTINQALQMNRHLGRR-FQIPAGSLFVVSLLTIAVLLPFYDRVL  415
            W A     L I QQ T+ + QALQ +R LG R F IPA +  V  +  + V + FYDRVL
Sbjct  355  WFAASIYYLTITQQMTYPVFQALQSDRRLGSRGFVIPAATYVVFLMTGMTVFIIFYDRVL  414

Query  416  VPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            VP  R+ T +  GIT+LQR+G G+ F+ +++ VSGFV
Sbjct  415  VPTLRRITGIDTGITLLQRIGTGIFFAFVSLIVSGFV  451



>gb|KHN48655.1| Putative peptide/nitrate transporter [Glycine soja]
Length=568

 Score =   147 bits (371),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 72/154 (47%), Positives = 105/154 (68%), Gaps = 1/154 (1%)
 Frame = +2

Query  62   PGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIPIW  241
            P S  +KLP T  + FL+KAA++  ++ +  +G   + W LCS+Q+ EEVKC++RV+PIW
Sbjct  249  PKSVNSKLPYTYQFRFLDKAAIMTPQDQINPNGSATDPWNLCSMQQVEEVKCLLRVLPIW  308

Query  242  PAGIACSLAIIQQGTFTINQALQMNRHLGRR-FQIPAGSLFVVSLLTIAVLLPFYDRVLV  418
             +GI   + I+QQ T  + QAL  +R +G+  F IP  S +V  ++++A+ LP YDR +V
Sbjct  309  VSGILYFVVIVQQHTILVFQALLSDRRIGQSGFLIPGASYYVFLMISVAIWLPVYDRKVV  368

Query  419  PWARKRTRVIGGITILQRMGIGLAFSILAMAVSG  520
            P  +K TR  GGIT+LQRMGIG+ FSIL+M VS 
Sbjct  369  PLLQKLTRKEGGITLLQRMGIGIFFSILSMLVSA  402



>gb|AES91176.2| peptide/nitrate transporter [Medicago truncatula]
Length=601

 Score =   147 bits (372),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 77/176 (44%), Positives = 110/176 (63%), Gaps = 4/176 (2%)
 Frame = +2

Query  2    RLPANDSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWR  181
             LP ++    +   Y   + P S  +KL  T  + FL+KAA++  ++ +  DG   + W 
Sbjct  265  NLPEDEYSLVSLFSY---ISPHSINSKLLHTPQFRFLDKAAIITQQDKINPDGSASDPWN  321

Query  182  LCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNR-HLGRRFQIPAGSL  358
            LCSIQ+ EEVKC+VRV+PIW +GI   +AIIQQ T  + QA+Q +R      F+IPA S 
Sbjct  322  LCSIQQVEEVKCLVRVLPIWVSGILYYVAIIQQNTVLVFQAIQSDRTFFNTNFKIPAASY  381

Query  359  FVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
             + ++L++ + LP YDR +VP  RK T   GGIT+LQRMG+G+  +IL M VSG V
Sbjct  382  TIFTMLSLTIWLPIYDRKIVPTMRKLTGKEGGITLLQRMGVGMFIAILCMLVSGVV  437



>ref|XP_009151387.1| PREDICTED: protein NRT1/ PTR FAMILY 2.11-like [Brassica rapa]
Length=612

 Score =   147 bits (372),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 104/157 (66%), Gaps = 1/157 (1%)
 Frame = +2

Query  59   PPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIPI  238
            PP  A +KL  T  + FL+KAA++  E+ L  DGK  + W+LC++Q+ EEVKCIVRV+PI
Sbjct  295  PPKYANSKLKYTDQFRFLDKAAILAPEDKLEADGKPADPWKLCTMQQVEEVKCIVRVLPI  354

Query  239  WPAGIACSLAIIQQGTFTINQALQMNRHLGRR-FQIPAGSLFVVSLLTIAVLLPFYDRVL  415
            W A     L I QQ T+ + QALQ +R LG R F IPA +  V  +  + V + FYDRVL
Sbjct  355  WFAASIYYLTITQQMTYPVFQALQSDRRLGSRGFVIPAATYVVFLMTGMTVFIIFYDRVL  414

Query  416  VPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            VP  R+ T +  GIT+LQR+G G+ F+ +++ VSGFV
Sbjct  415  VPTLRRITGIDTGITLLQRIGTGIFFAFVSLIVSGFV  451



>gb|EAZ28180.1| hypothetical protein OsJ_12153 [Oryza sativa Japonica Group]
Length=460

 Score =   146 bits (369),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 105/159 (66%), Gaps = 3/159 (2%)
 Frame = +2

Query  59   PPGSAA--TKLPLTKDYGFLNKAAVVVIEEDLTGDGKC-RNRWRLCSIQETEEVKCIVRV  229
            PP ++A  TKL  T  +  L+KAA+V   +D+   G    N WRLCS+Q+ EEVKC++R+
Sbjct  162  PPHTSAIVTKLAHTDQFRCLDKAAIVSGPDDVRAGGAAPSNPWRLCSVQQVEEVKCLIRI  221

Query  230  IPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLFVVSLLTIAVLLPFYDR  409
            +P+W  GI   +A++QQ T+ +  ALQ +RHLGR FQIPA S  V ++L   + +P YDR
Sbjct  222  VPVWSTGIIYYVAVVQQSTYVVLSALQSDRHLGRSFQIPAASFTVFAMLAQTLWIPIYDR  281

Query  410  VLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            +LVP  R+ T    G+T+LQR GIG+A S +AM +S  V
Sbjct  282  LLVPRLRRVTGKDEGLTLLQRQGIGIALSTVAMVMSAVV  320



>ref|XP_004138297.1| PREDICTED: probable peptide/nitrate transporter At5g62680-like 
[Cucumis sativus]
 ref|XP_004155066.1| PREDICTED: probable peptide/nitrate transporter At5g62680-like 
[Cucumis sativus]
 gb|KGN63648.1| hypothetical protein Csa_1G008540 [Cucumis sativus]
Length=589

 Score =   147 bits (371),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 100/161 (62%), Gaps = 4/161 (2%)
 Frame = +2

Query  56   LPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIP  235
            +P  S  +KLP T  + F +KAA++  E+    DG   + W LCS Q+ EEVKC+VRVIP
Sbjct  273  IPSNSINSKLPYTNQFSFFDKAAIITSEDKFKSDGSAADPWTLCSTQQVEEVKCLVRVIP  332

Query  236  IWPAGIACSLAIIQQGTFTINQALQMNRHL----GRRFQIPAGSLFVVSLLTIAVLLPFY  403
            IW A I   +A  QQ T+ + QALQ +R L       F+IPA S  + +++ + + +PFY
Sbjct  333  IWGAAIIYHVATTQQQTYAVFQALQSDRRLFFGNTHYFKIPAASYTIFTMIGLTIWIPFY  392

Query  404  DRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            DR+LVP  R+ T   GGIT+LQ+MG G+  +I+ M +S  V
Sbjct  393  DRILVPSLRRITAREGGITLLQKMGFGMGIAIITMFISALV  433



>ref|XP_006476666.1| PREDICTED: probable peptide/nitrate transporter At5g62680-like 
isoform X2 [Citrus sinensis]
Length=594

 Score =   147 bits (371),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 106/158 (67%), Gaps = 1/158 (1%)
 Frame = +2

Query  56   LPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIP  235
            +PPGS  +KL  T  + FL+KAA++  E+ +  DG   NRWRLCS+Q+ EEVKC++RVIP
Sbjct  274  IPPGSINSKLRHTDQFRFLDKAAMLTPEDHINPDGSAANRWRLCSVQQVEEVKCVLRVIP  333

Query  236  IWPAGIACSLAIIQQGTFTINQALQMNRHLGR-RFQIPAGSLFVVSLLTIAVLLPFYDRV  412
             W A +   L I QQ T+ + QA Q NR LG   F+IPA S  V  +L++ + +P YDR+
Sbjct  334  TWFAAVIFHLMINQQHTYAVFQAQQSNRRLGNISFKIPAASYVVFMMLSMTIWIPIYDRI  393

Query  413  LVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
             VP+ R+ T   GGIT+LQRMGIG+  SI+ M VSG V
Sbjct  394  FVPFLRRLTGKEGGITLLQRMGIGIGISIITMLVSGVV  431



>ref|XP_009626986.1| PREDICTED: protein NRT1/ PTR FAMILY 2.11-like [Nicotiana tomentosiformis]
Length=602

 Score =   147 bits (371),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 104/157 (66%), Gaps = 1/157 (1%)
 Frame = +2

Query  59   PPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIPI  238
            PP S  +KL  T  + FL+KAA+V  E+ +  DG   N W LCS+Q+ EE KC+VRVIPI
Sbjct  287  PPNSINSKLSYTHQFRFLDKAAIVTPEDQIKSDGSAANPWNLCSLQQVEEAKCVVRVIPI  346

Query  239  WPAGIACSLAIIQQGTFTINQALQMNRHLGR-RFQIPAGSLFVVSLLTIAVLLPFYDRVL  415
            W A I   + IIQQ  F + QALQ +RHLG   FQIPA +  + S+L++ + LP YDR++
Sbjct  347  WAAAIVYHVGIIQQQQFVVFQALQSDRHLGNSNFQIPAATYTIFSMLSLTLWLPIYDRIV  406

Query  416  VPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            VP  R+ T   GGITILQRMGIG+   +L+  VS F+
Sbjct  407  VPLLRRLTGKEGGITILQRMGIGIFLIVLSSLVSAFI  443



>ref|XP_003608979.1| Nitrate transporter NRT1-2 [Medicago truncatula]
Length=597

 Score =   147 bits (371),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 77/176 (44%), Positives = 110/176 (63%), Gaps = 4/176 (2%)
 Frame = +2

Query  2    RLPANDSGAAAGVYYNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWR  181
             LP ++    +   Y   + P S  +KL  T  + FL+KAA++  ++ +  DG   + W 
Sbjct  261  NLPEDEYSLVSLFSY---ISPHSINSKLLHTPQFRFLDKAAIITQQDKINPDGSASDPWN  317

Query  182  LCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTFTINQALQMNR-HLGRRFQIPAGSL  358
            LCSIQ+ EEVKC+VRV+PIW +GI   +AIIQQ T  + QA+Q +R      F+IPA S 
Sbjct  318  LCSIQQVEEVKCLVRVLPIWVSGILYYVAIIQQNTVLVFQAIQSDRTFFNTNFKIPAASY  377

Query  359  FVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
             + ++L++ + LP YDR +VP  RK T   GGIT+LQRMG+G+  +IL M VSG V
Sbjct  378  TIFTMLSLTIWLPIYDRKIVPTMRKLTGKEGGITLLQRMGVGMFIAILCMLVSGVV  433



>ref|XP_011465713.1| PREDICTED: protein NRT1/ PTR FAMILY 2.9-like [Fragaria vesca 
subsp. vesca]
Length=418

 Score =   145 bits (367),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 64/139 (46%), Positives = 99/139 (71%), Gaps = 0/139 (0%)
 Frame = +2

Query  110  LNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGTF  289
            L+KAA++  E+ L  DG   N WRLCS+Q+ EE+KC+VR++PIW A +   + I+QQ ++
Sbjct  130  LDKAAILTPEDKLNTDGSAANPWRLCSMQQVEEMKCLVRLLPIWAAALVYYIVIVQQHSY  189

Query  290  TINQALQMNRHLGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITILQ  469
            T  QALQ +R L + F+IPA S +V  ++ + + +P YDR++VP+ ++RT + GGIT+LQ
Sbjct  190  TTYQALQCDRRLTKHFEIPAASYYVFLMIAMTIWIPIYDRLVVPFLQRRTGIEGGITVLQ  249

Query  470  RMGIGLAFSILAMAVSGFV  526
            R+G G+  SI++M VS  V
Sbjct  250  RIGAGIFLSIVSMLVSAIV  268



>ref|XP_003525480.1| PREDICTED: probable peptide/nitrate transporter At5g62680 [Glycine 
max]
Length=611

 Score =   147 bits (371),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 72/154 (47%), Positives = 105/154 (68%), Gaps = 1/154 (1%)
 Frame = +2

Query  62   PGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIPIW  241
            P S  +KLP T  + FL+KAA++  ++ +  +G   + W LCS+Q+ EEVKC++RV+PIW
Sbjct  292  PKSVNSKLPYTYQFRFLDKAAIMTPQDQINPNGSATDPWNLCSMQQVEEVKCLLRVLPIW  351

Query  242  PAGIACSLAIIQQGTFTINQALQMNRHLGRR-FQIPAGSLFVVSLLTIAVLLPFYDRVLV  418
             +GI   + I+QQ T  + QAL  +R +G+  F IP  S +V  ++++A+ LP YDR +V
Sbjct  352  VSGILYFVVIVQQHTILVFQALLSDRRIGQSGFLIPGASYYVFLMISVAIWLPVYDRKVV  411

Query  419  PWARKRTRVIGGITILQRMGIGLAFSILAMAVSG  520
            P  +K TR  GGIT+LQRMGIG+ FSIL+M VS 
Sbjct  412  PLLQKLTRKEGGITLLQRMGIGIFFSILSMLVSA  445



>ref|XP_006476665.1| PREDICTED: probable peptide/nitrate transporter At5g62680-like 
isoform X1 [Citrus sinensis]
Length=621

 Score =   147 bits (371),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 106/158 (67%), Gaps = 1/158 (1%)
 Frame = +2

Query  56   LPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIP  235
            +PPGS  +KL  T  + FL+KAA++  E+ +  DG   NRWRLCS+Q+ EEVKC++RVIP
Sbjct  301  IPPGSINSKLRHTDQFRFLDKAAMLTPEDHINPDGSAANRWRLCSVQQVEEVKCVLRVIP  360

Query  236  IWPAGIACSLAIIQQGTFTINQALQMNRHLGR-RFQIPAGSLFVVSLLTIAVLLPFYDRV  412
             W A +   L I QQ T+ + QA Q NR LG   F+IPA S  V  +L++ + +P YDR+
Sbjct  361  TWFAAVIFHLMINQQHTYAVFQAQQSNRRLGNISFKIPAASYVVFMMLSMTIWIPIYDRI  420

Query  413  LVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
             VP+ R+ T   GGIT+LQRMGIG+  SI+ M VSG V
Sbjct  421  FVPFLRRLTGKEGGITLLQRMGIGIGISIITMLVSGVV  458



>ref|XP_004508786.1| PREDICTED: probable peptide/nitrate transporter At1g18880-like 
[Cicer arietinum]
Length=580

 Score =   147 bits (370),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 104/158 (66%), Gaps = 1/158 (1%)
 Frame = +2

Query  56   LPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIP  235
            +PP S  +KL  T  +  L+KAA++  E+ +  D K  + W LCS+Q+ EE+KC++RV+P
Sbjct  277  VPPKSINSKLLYTYQFRVLDKAAMITQEDKINPDVKPTDPWSLCSMQQVEELKCLLRVLP  336

Query  236  IWPAGIACSLAIIQQGTFTINQALQMNRHLGR-RFQIPAGSLFVVSLLTIAVLLPFYDRV  412
            IW + I  SL ++QQ T  + QALQ NR +G   F+IP  S  V  +L++ + LPFYDR+
Sbjct  337  IWFSAILYSLVVVQQNTLLVFQALQSNRRIGNSNFKIPGASYSVFLMLSMTLWLPFYDRI  396

Query  413  LVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            +VP  RK T    GITILQRMG+G+  SI+ M VS FV
Sbjct  397  VVPLLRKITGKDSGITILQRMGVGMFLSIICMLVSAFV  434



>ref|XP_002877586.1| hypothetical protein ARALYDRAFT_323400 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53845.1| hypothetical protein ARALYDRAFT_323400 [Arabidopsis lyrata subsp. 
lyrata]
Length=644

 Score =   147 bits (371),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 77/162 (48%), Positives = 105/162 (65%), Gaps = 2/162 (1%)
 Frame = +2

Query  44   YNPPLPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIV  223
            YN  +PP  A T L  T  + FL+KAA++  EE L  DG   + W+LC++Q+ EEVKCIV
Sbjct  319  YNH-IPPNYANTTLKYTDQFRFLDKAAIMTPEEKLNSDGAASDPWKLCTLQQVEEVKCIV  377

Query  224  RVIPIWPAGIACSLAIIQQGTFTINQALQMNRHLGR-RFQIPAGSLFVVSLLTIAVLLPF  400
            RVIPIW A     LAI  Q T+ + QA+Q +R LG   F+IPA +  V  +  + V + F
Sbjct  378  RVIPIWFASTIYYLAITIQMTYPVFQAIQSDRRLGSGGFRIPAATYVVFLMTGMTVFIIF  437

Query  401  YDRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            YDRVLVP  R+ T +  GI++LQR+G G  F+IL++ VSGF+
Sbjct  438  YDRVLVPSLRRVTGIETGISLLQRIGAGFTFAILSLLVSGFI  479



>gb|EEC75965.1| hypothetical protein OsI_13072 [Oryza sativa Indica Group]
Length=585

 Score =   147 bits (370),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 105/159 (66%), Gaps = 3/159 (2%)
 Frame = +2

Query  59   PPGSAA--TKLPLTKDYGFLNKAAVVVIEEDLTGDGKC-RNRWRLCSIQETEEVKCIVRV  229
            PP ++A  TKL  T  +  L+KAA+V   +D+   G    N WRLCS+Q+ EEVKC++R+
Sbjct  287  PPHTSAIVTKLAHTDQFRCLDKAAIVSGPDDVRAGGAAPSNPWRLCSVQQVEEVKCLIRI  346

Query  230  IPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLFVVSLLTIAVLLPFYDR  409
            +P+W  GI   +A++QQ T+ +  ALQ +RHLGR FQIPA S  V ++L   + +P YDR
Sbjct  347  VPVWSTGIIYYVAVVQQSTYVVLSALQSDRHLGRSFQIPAASFTVFAMLAQTLWIPIYDR  406

Query  410  VLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            +LVP  R+ T    G+T+LQR GIG+A S +AM +S  V
Sbjct  407  LLVPRLRRVTGKDEGLTLLQRQGIGIALSTVAMVMSAVV  445



>gb|AAT85061.1| nitrate transporter, putative [Oryza sativa Japonica Group]
 gb|ABF98263.1| POT family protein, expressed [Oryza sativa Japonica Group]
 dbj|BAG89436.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94017.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94064.1| unnamed protein product [Oryza sativa Japonica Group]
Length=587

 Score =   147 bits (370),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 105/159 (66%), Gaps = 3/159 (2%)
 Frame = +2

Query  59   PPGSAA--TKLPLTKDYGFLNKAAVVVIEEDLTGDGKC-RNRWRLCSIQETEEVKCIVRV  229
            PP ++A  TKL  T  +  L+KAA+V   +D+   G    N WRLCS+Q+ EEVKC++R+
Sbjct  289  PPHTSAIVTKLAHTDQFRCLDKAAIVSGPDDVRAGGAAPSNPWRLCSVQQVEEVKCLIRI  348

Query  230  IPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRRFQIPAGSLFVVSLLTIAVLLPFYDR  409
            +P+W  GI   +A++QQ T+ +  ALQ +RHLGR FQIPA S  V ++L   + +P YDR
Sbjct  349  VPVWSTGIIYYVAVVQQSTYVVLSALQSDRHLGRSFQIPAASFTVFAMLAQTLWIPIYDR  408

Query  410  VLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            +LVP  R+ T    G+T+LQR GIG+A S +AM +S  V
Sbjct  409  LLVPRLRRVTGKDEGLTLLQRQGIGIALSTVAMVMSAVV  447



>ref|XP_008239650.1| PREDICTED: protein NRT1/ PTR FAMILY 2.11-like [Prunus mume]
Length=597

 Score =   147 bits (370),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 105/158 (66%), Gaps = 1/158 (1%)
 Frame = +2

Query  56   LPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIP  235
            +P GS  +K+  T  +  L+KAA++  E+ +  DG     W+LCS+QE E+VKC+ RV+P
Sbjct  283  VPSGSINSKISHTDQFRILDKAAIITNEDKINLDGSTATPWKLCSLQEVEQVKCLFRVVP  342

Query  236  IWPAGIACSLAIIQQGTFTINQALQMNRHLGRR-FQIPAGSLFVVSLLTIAVLLPFYDRV  412
            IW + I  ++A++QQ T+T+ QALQ +R LG   F+IPA S  V ++L + + +P YDR+
Sbjct  343  IWISTIIYNVAMVQQQTYTVFQALQSDRRLGNTGFKIPAASYIVFNMLALTIWIPIYDRL  402

Query  413  LVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            +VP  R+ T   GGITILQ+MG G+  +I+ M VS  V
Sbjct  403  IVPALRRMTGKEGGITILQKMGFGMVLAIITMLVSAVV  440



>ref|XP_002270812.1| PREDICTED: protein NRT1/ PTR FAMILY 2.11 [Vitis vinifera]
Length=586

 Score =   146 bits (369),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 105/158 (66%), Gaps = 1/158 (1%)
 Frame = +2

Query  56   LPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIP  235
            +P  S  +KLP T  + FL+K A++  E  +  DG   N WRL S+Q+ EEVKC++RVIP
Sbjct  271  IPANSINSKLPHTDQFRFLSKGAILTPEVQINSDGSAANPWRLSSMQKVEEVKCVIRVIP  330

Query  236  IWPAGIACSLAIIQQGTFTINQALQMNRHLGRR-FQIPAGSLFVVSLLTIAVLLPFYDRV  412
            IW AGI   +A++QQ T+ + QALQ +R LG   F+IPA S  V ++L++ + +P YD++
Sbjct  331  IWAAGIIYYVALVQQSTYVVFQALQSDRRLGSTGFKIPAASYTVFTMLSLTIWIPIYDQI  390

Query  413  LVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            +VP  R+ T    GIT+LQ+MGIG+  +++ M +S  V
Sbjct  391  IVPLLRRLTGKEVGITLLQKMGIGMVLAVITMILSALV  428



>ref|XP_009764700.1| PREDICTED: protein NRT1/ PTR FAMILY 2.11-like [Nicotiana sylvestris]
Length=585

 Score =   146 bits (369),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 69/152 (45%), Positives = 101/152 (66%), Gaps = 2/152 (1%)
 Frame = +2

Query  77   TKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIPIWPAGIA  256
            T+LP T  + FLNKA+++  E+ +  DG   N W+LCSIQ+ EEVKC+VRV PIW AG+ 
Sbjct  275  TELPYTDQFRFLNKASIITPEDRIKEDGSAANPWKLCSIQQVEEVKCVVRVFPIWIAGLI  334

Query  257  CSLAIIQQGTFTINQALQMNRHL--GRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWAR  430
              + ++Q  T+ + QALQ +R L     F+IPA S  V  +L++ + +P YDR++VP+ +
Sbjct  335  YYIVLVQMQTYVVFQALQSDRRLRNTSTFKIPAASYAVFQMLSMTIWIPIYDRIIVPFLQ  394

Query  431  KRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            K T+   GIT+LQ+MGIGL  ++  M VS  V
Sbjct  395  KITKKEAGITVLQKMGIGLFIAVFTMLVSAVV  426



>ref|XP_008453175.1| PREDICTED: protein NRT1/ PTR FAMILY 2.10-like [Cucumis melo]
Length=589

 Score =   146 bits (368),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 101/161 (63%), Gaps = 4/161 (2%)
 Frame = +2

Query  56   LPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIP  235
            +P  S  +KLP T    FL+KAA++  ++    DG   + W LCS Q+ EEVKC+VRVIP
Sbjct  273  IPSNSINSKLPYTNQLSFLDKAAIITSDDKFKSDGSAADPWTLCSTQQVEEVKCLVRVIP  332

Query  236  IWPAGIACSLAIIQQGTFTINQALQMNRHL----GRRFQIPAGSLFVVSLLTIAVLLPFY  403
            IW A I   +A  QQ T+ + QALQ +R L       F+IPA S  + +++ + + +PFY
Sbjct  333  IWCAAIIYHVATTQQQTYAVFQALQSDRRLFFGNTHYFKIPAASYTIFTMIGLTIWIPFY  392

Query  404  DRVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            DR+LVP  R+ T   GGIT+LQ+MG+GL  +I+ M +S  V
Sbjct  393  DRILVPSLRRITAREGGITLLQKMGLGLGIAIITMFISALV  433



>ref|XP_010533412.1| PREDICTED: protein NRT1/ PTR FAMILY 2.9-like [Tarenaya hassleriana]
Length=585

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 103/158 (65%), Gaps = 1/158 (1%)
 Frame = +2

Query  56   LPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIP  235
            +P   A +KL  T  +  L+KAA++  ++ +  DG   + WRLCS+Q+ EEVKC+VRV+P
Sbjct  273  IPQDFANSKLAHTDQFRCLDKAAILTPDDKVAPDGSPADPWRLCSMQQVEEVKCVVRVLP  332

Query  236  IWPAGIACSLAIIQQGTFTINQALQMNRHLGR-RFQIPAGSLFVVSLLTIAVLLPFYDRV  412
            IW +     LA IQQ T+TI QALQ +RHLG   FQIPA +  V  +L + V +P YDRV
Sbjct  333  IWISASFFYLAYIQQTTYTIFQALQSDRHLGSGSFQIPAATYTVFLMLGLTVFIPIYDRV  392

Query  413  LVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            LVP+  + T   GGIT+LQR+GIGL   I  M VS FV
Sbjct  393  LVPFLTRITGKEGGITLLQRVGIGLVLCIGGMLVSAFV  430



>ref|XP_011087208.1| PREDICTED: protein NRT1/ PTR FAMILY 2.11-like [Sesamum indicum]
Length=580

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 104/158 (66%), Gaps = 3/158 (2%)
 Frame = +2

Query  56   LPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIP  235
            LPP S  +KLP T+ + FL+KAA++  E+ +  DG   + W LCS+Q+ EE KC+VR+IP
Sbjct  273  LPPKSINSKLPHTEQFCFLDKAAIITPEDQIKPDGTAADPWNLCSMQQVEEAKCVVRLIP  332

Query  236  IWPAGIACSLAIIQQGTFTINQALQMNRHLGR-RFQIPAGSLFVVSLLTIAVLLPFYDRV  412
            I    I   + + QQ  + + QALQ +RHLG  +FQIPA S  V ++L +A  +P YDR+
Sbjct  333  ISLTSILYHIGVQQQ--YIVFQALQSDRHLGNTKFQIPAASYVVFAMLGLAFWVPIYDRL  390

Query  413  LVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
             VP+AR+ T+  GGITILQRMG+GL  +I+   V   V
Sbjct  391  FVPFARRITKKEGGITILQRMGVGLFITIIESLVGAIV  428



>ref|XP_007210270.1| hypothetical protein PRUPE_ppa003155mg [Prunus persica]
 gb|EMJ11469.1| hypothetical protein PRUPE_ppa003155mg [Prunus persica]
Length=597

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 105/158 (66%), Gaps = 1/158 (1%)
 Frame = +2

Query  56   LPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIP  235
            +P GS  +K+  T  +  L+KAA++  E+ +  DG     W+LCS+QE E+VKC++RV+P
Sbjct  283  VPTGSINSKISHTDQFRILDKAAIITNEDKINLDGSTATPWKLCSLQEVEQVKCLLRVVP  342

Query  236  IWPAGIACSLAIIQQGTFTINQALQMNRHLGRR-FQIPAGSLFVVSLLTIAVLLPFYDRV  412
            IW + I   +A++QQ T+T+ QALQ +R LG   F+IPA S  V +++ + + +P YDR+
Sbjct  343  IWISTIIYYVAMVQQQTYTVFQALQSDRRLGNTGFKIPAASYIVFNMVALTIWIPIYDRL  402

Query  413  LVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            +VP  R+ T   GGITILQ+MG G+  +I+ M VS  V
Sbjct  403  IVPALRRMTGKEGGITILQKMGFGMVLAIITMVVSAVV  440



>ref|XP_009623435.1| PREDICTED: protein NRT1/ PTR FAMILY 2.11-like [Nicotiana tomentosiformis]
Length=585

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/152 (45%), Positives = 100/152 (66%), Gaps = 2/152 (1%)
 Frame = +2

Query  77   TKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIPIWPAGIA  256
            T+LP T  + F NKA+++  E+ +  DG   N+WRLCSIQ+ EEVKC+VRV PIW AG+ 
Sbjct  275  TELPYTDQFRFWNKASIITPEDKIKEDGSAANQWRLCSIQQVEEVKCVVRVFPIWIAGLI  334

Query  257  CSLAIIQQGTFTINQALQMNRHLG--RRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWAR  430
              + + Q  T+ + QALQ +R L     F+IPA S  V  +L++ + +P YDR++VP+ +
Sbjct  335  YYIVLAQMQTYVVFQALQSDRRLKTTSTFKIPAASYAVFQMLSMTIWIPIYDRLIVPFLQ  394

Query  431  KRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            + T+   GIT+LQ+MGIGL  ++  M VS  V
Sbjct  395  RITKKEAGITVLQKMGIGLVIAVFTMLVSALV  426



>ref|XP_008239651.1| PREDICTED: protein NRT1/ PTR FAMILY 2.11-like [Prunus mume]
Length=595

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 106/158 (67%), Gaps = 1/158 (1%)
 Frame = +2

Query  56   LPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIP  235
            +PP S  +KLP T  +  L+KAA++  ++++  DG   N WRLCS Q+ EE+KC++RV+P
Sbjct  274  MPPNSINSKLPYTNQFRCLDKAAILTPQDEILPDGSAANPWRLCSRQQVEELKCLLRVLP  333

Query  236  IWPAGIACSLAIIQQGTFTINQALQMNRHLGR-RFQIPAGSLFVVSLLTIAVLLPFYDRV  412
            IW A + C +AI+Q  T+ + QA+Q +R LG   F IP  S  V  +L++ + +P YD++
Sbjct  334  IWAAALVCHVAIVQLQTYVVFQAIQSDRRLGNTNFDIPPASYSVFLMLSMTIWIPIYDQL  393

Query  413  LVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            +VP+ ++ T   GGIT+LQR+GIG   +++ M VS FV
Sbjct  394  VVPFLQRLTGKEGGITLLQRIGIGTFLTVICMIVSAFV  431



>tpg|DAA50699.1| TPA: hypothetical protein ZEAMMB73_457708 [Zea mays]
Length=479

 Score =   144 bits (363),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 107/160 (67%), Gaps = 4/160 (3%)
 Frame = +2

Query  59   PPGSAA--TKLPLTKDYGFLNKAAVVVIEEDL-TGDGKCRNRWRLCSIQETEEVKCIVRV  229
            PP ++A  TKL  T  +  L+KAA+V   +++ +G G   + WRLCS+Q+ EEVKC++R+
Sbjct  181  PPHTSAIVTKLAHTDQFRCLDKAAIVASPDEVRSGGGAPADPWRLCSVQQVEEVKCLIRI  240

Query  230  IPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRR-FQIPAGSLFVVSLLTIAVLLPFYD  406
            +P+W  GI   +A++QQ T+ +  ALQ +RHLGR  FQIPA S  V ++L   + +PFYD
Sbjct  241  VPVWSTGIIYYVAVVQQSTYVVLSALQSDRHLGRAGFQIPAASFTVFAMLAQTLWIPFYD  300

Query  407  RVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            R+L+P  RK T    G T+LQR GIG+A S +AM +S  V
Sbjct  301  RLLLPKLRKITGKEEGFTLLQRQGIGIALSTVAMVISAIV  340



>gb|KEH31902.1| peptide/nitrate transporter [Medicago truncatula]
Length=597

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 103/158 (65%), Gaps = 1/158 (1%)
 Frame = +2

Query  56   LPPGSAATKLPLTKDYGFLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIP  235
            +PP S  +KLP T  +  L+KAA++  ++ +  DG   + W LCSIQ+ EE+KC+VRV+P
Sbjct  291  VPPMSINSKLPYTYQFRVLDKAAMITSQDKINPDGSAADPWSLCSIQQVEELKCLVRVLP  350

Query  236  IWPAGIACSLAIIQQGTFTINQALQMNRHLGRR-FQIPAGSLFVVSLLTIAVLLPFYDRV  412
            IW + I   L I+QQ T  + QALQ NR +G   F+IP  S  V  +L++ + LP YDR+
Sbjct  351  IWFSAILYHLVIVQQHTLLVFQALQSNRRMGNTDFKIPGASYTVFLMLSMTLWLPIYDRI  410

Query  413  LVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            +VP  R+ T    GIT+LQR+G+G+   IL++ VS FV
Sbjct  411  VVPCLRRFTEKEAGITVLQRIGVGIFLGILSILVSAFV  448



>ref|NP_001130581.1| uncharacterized protein LOC100191680 [Zea mays]
 gb|ACF78856.1| unknown [Zea mays]
Length=513

 Score =   144 bits (363),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 107/160 (67%), Gaps = 4/160 (3%)
 Frame = +2

Query  59   PPGSAA--TKLPLTKDYGFLNKAAVVVIEEDL-TGDGKCRNRWRLCSIQETEEVKCIVRV  229
            PP ++A  TKL  T  +  L+KAA+V   +++ +G G   + WRLCS+Q+ EEVKC++R+
Sbjct  215  PPHTSAIVTKLAHTDQFRCLDKAAIVASPDEVRSGGGAPADPWRLCSVQQVEEVKCLIRI  274

Query  230  IPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRR-FQIPAGSLFVVSLLTIAVLLPFYD  406
            +P+W  GI   +A++QQ T+ +  ALQ +RHLGR  FQIPA S  V ++L   + +PFYD
Sbjct  275  VPVWSTGIIYYVAVVQQSTYVVLSALQSDRHLGRAGFQIPAASFTVFAMLAQTLWIPFYD  334

Query  407  RVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            R+L+P  RK T    G T+LQR GIG+A S +AM +S  V
Sbjct  335  RLLLPKLRKITGKEEGFTLLQRQGIGIALSTVAMVISAIV  374



>gb|ABK95497.1| unknown [Populus trichocarpa]
Length=176

 Score =   137 bits (345),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 70/140 (50%), Positives = 92/140 (66%), Gaps = 1/140 (1%)
 Frame = +2

Query  107  FLNKAAVVVIEEDLTGDGKCRNRWRLCSIQETEEVKCIVRVIPIWPAGIACSLAIIQQGT  286
            FL+KAA+VV EED    G+  N WRL ++   EE+K I+R+ PIW AGI    A  QQ T
Sbjct  3    FLDKAAIVV-EEDNFKQGQAPNLWRLNTVHRVEELKSIIRMGPIWAAGILLITAYAQQNT  61

Query  287  FTINQALQMNRHLGRRFQIPAGSLFVVSLLTIAVLLPFYDRVLVPWARKRTRVIGGITIL  466
            F++ QA  M+RHL + FQIPAGS+ V ++ ++   + FYDR+LVP A K T +  GI+ L
Sbjct  62   FSLQQAKSMDRHLTKSFQIPAGSMSVFTMTSMLTTIAFYDRILVPVASKFTGLERGISFL  121

Query  467  QRMGIGLAFSILAMAVSGFV  526
             RMGIG   SI A  V+GFV
Sbjct  122  HRMGIGFVISIFATLVAGFV  141



>ref|XP_008670500.1| PREDICTED: uncharacterized protein LOC100191680 isoform X1 [Zea 
mays]
 gb|ACN34612.1| unknown [Zea mays]
 gb|ACR36295.1| unknown [Zea mays]
 tpg|DAA50698.1| TPA: hypothetical protein ZEAMMB73_457708 [Zea mays]
Length=589

 Score =   144 bits (363),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 107/160 (67%), Gaps = 4/160 (3%)
 Frame = +2

Query  59   PPGSAA--TKLPLTKDYGFLNKAAVVVIEEDL-TGDGKCRNRWRLCSIQETEEVKCIVRV  229
            PP ++A  TKL  T  +  L+KAA+V   +++ +G G   + WRLCS+Q+ EEVKC++R+
Sbjct  291  PPHTSAIVTKLAHTDQFRCLDKAAIVASPDEVRSGGGAPADPWRLCSVQQVEEVKCLIRI  350

Query  230  IPIWPAGIACSLAIIQQGTFTINQALQMNRHLGRR-FQIPAGSLFVVSLLTIAVLLPFYD  406
            +P+W  GI   +A++QQ T+ +  ALQ +RHLGR  FQIPA S  V ++L   + +PFYD
Sbjct  351  VPVWSTGIIYYVAVVQQSTYVVLSALQSDRHLGRAGFQIPAASFTVFAMLAQTLWIPFYD  410

Query  407  RVLVPWARKRTRVIGGITILQRMGIGLAFSILAMAVSGFV  526
            R+L+P  RK T    G T+LQR GIG+A S +AM +S  V
Sbjct  411  RLLLPKLRKITGKEEGFTLLQRQGIGIALSTVAMVISAIV  450



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 561572122600