BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF053G09

Length=671
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006349497.1|  PREDICTED: ATP-dependent zinc metalloproteas...    218   6e-62   Solanum tuberosum [potatoes]
ref|XP_006349498.1|  PREDICTED: ATP-dependent zinc metalloproteas...    213   2e-60   Solanum tuberosum [potatoes]
ref|XP_009611240.1|  PREDICTED: ATP-dependent zinc metalloproteas...    213   2e-60   Nicotiana tomentosiformis
ref|XP_010312354.1|  PREDICTED: ATP-dependent zinc metalloproteas...    204   2e-57   Solanum lycopersicum
ref|XP_006341014.1|  PREDICTED: ATP-dependent zinc metalloproteas...    201   3e-56   Solanum tuberosum [potatoes]
ref|XP_009781386.1|  PREDICTED: ATP-dependent zinc metalloproteas...    200   7e-56   Nicotiana sylvestris
ref|XP_004249560.1|  PREDICTED: ATP-dependent zinc metalloproteas...    200   8e-56   Solanum lycopersicum
ref|XP_009598017.1|  PREDICTED: ATP-dependent zinc metalloproteas...    191   2e-52   Nicotiana tomentosiformis
ref|XP_004246405.1|  PREDICTED: ATP-dependent zinc metalloproteas...    189   6e-52   Solanum lycopersicum
ref|XP_009772661.1|  PREDICTED: ATP-dependent zinc metalloproteas...    189   6e-52   Nicotiana sylvestris
ref|XP_011094876.1|  PREDICTED: ATP-dependent zinc metalloproteas...    171   3e-45   Sesamum indicum [beniseed]
ref|XP_011094875.1|  PREDICTED: ATP-dependent zinc metalloproteas...    170   4e-45   Sesamum indicum [beniseed]
ref|XP_002283273.1|  PREDICTED: ATP-dependent zinc metalloproteas...    162   6e-42   Vitis vinifera
ref|XP_002323508.2|  hypothetical protein POPTR_0016s10620g             157   2e-40   
gb|EYU41737.1|  hypothetical protein MIMGU_mgv1a001461mg                153   6e-39   Erythranthe guttata [common monkey flower]
ref|XP_006429118.1|  hypothetical protein CICLE_v10011087mg             151   3e-38   Citrus clementina [clementine]
ref|XP_006480880.1|  PREDICTED: ATP-dependent zinc metalloproteas...    151   3e-38   
emb|CDP06599.1|  unnamed protein product                                151   4e-38   Coffea canephora [robusta coffee]
ref|XP_011007150.1|  PREDICTED: ATP-dependent zinc metalloproteas...    150   6e-38   Populus euphratica
ref|XP_009345397.1|  PREDICTED: ATP-dependent zinc metalloproteas...    150   9e-38   Pyrus x bretschneideri [bai li]
ref|XP_009338598.1|  PREDICTED: ATP-dependent zinc metalloproteas...    149   2e-37   Pyrus x bretschneideri [bai li]
ref|XP_008240759.1|  PREDICTED: ATP-dependent zinc metalloproteas...    146   2e-36   Prunus mume [ume]
ref|XP_008369915.1|  PREDICTED: ATP-dependent zinc metalloproteas...    146   2e-36   
ref|XP_009416148.1|  PREDICTED: ATP-dependent zinc metalloproteas...    140   3e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008777193.1|  PREDICTED: ATP-dependent zinc metalloproteas...    137   2e-33   Phoenix dactylifera
ref|XP_007026989.1|  Cell division protease ftsH isoform 1              136   6e-33   
ref|XP_007026990.1|  Cell division protease ftsH isoform 2              135   6e-33   
ref|XP_010043509.1|  PREDICTED: ATP-dependent zinc metalloproteas...    136   7e-33   Eucalyptus grandis [rose gum]
ref|XP_010256889.1|  PREDICTED: ATP-dependent zinc metalloproteas...    134   3e-32   Nelumbo nucifera [Indian lotus]
ref|XP_004143122.1|  PREDICTED: ATP-dependent zinc metalloproteas...    133   6e-32   Cucumis sativus [cucumbers]
ref|XP_011089809.1|  PREDICTED: ATP-dependent zinc metalloproteas...    132   1e-31   Sesamum indicum [beniseed]
ref|XP_010920548.1|  PREDICTED: ATP-dependent zinc metalloproteas...    132   1e-31   Elaeis guineensis
ref|XP_010685724.1|  PREDICTED: ATP-dependent zinc metalloproteas...    132   2e-31   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010931243.1|  PREDICTED: ATP-dependent zinc metalloproteas...    132   2e-31   Elaeis guineensis
ref|XP_008464106.1|  PREDICTED: ATP-dependent zinc metalloproteas...    131   5e-31   Cucumis melo [Oriental melon]
gb|KCW85528.1|  hypothetical protein EUGRSUZ_B02325                     130   9e-31   Eucalyptus grandis [rose gum]
ref|XP_010043511.1|  PREDICTED: ATP-dependent zinc metalloproteas...    130   9e-31   Eucalyptus grandis [rose gum]
ref|XP_010931244.1|  PREDICTED: ATP-dependent zinc metalloproteas...    129   2e-30   Elaeis guineensis
ref|XP_010475512.1|  PREDICTED: ATP-dependent zinc metalloproteas...    128   4e-30   Camelina sativa [gold-of-pleasure]
ref|XP_010475511.1|  PREDICTED: ATP-dependent zinc metalloproteas...    128   4e-30   Camelina sativa [gold-of-pleasure]
gb|KJB55847.1|  hypothetical protein B456_009G097900                    128   5e-30   Gossypium raimondii
gb|KJB55846.1|  hypothetical protein B456_009G097900                    128   5e-30   Gossypium raimondii
gb|KCW85527.1|  hypothetical protein EUGRSUZ_B02324                     127   6e-30   Eucalyptus grandis [rose gum]
gb|KFK43073.1|  hypothetical protein AALP_AA1G075200                    127   7e-30   Arabis alpina [alpine rockcress]
ref|XP_010043510.1|  PREDICTED: ATP-dependent zinc metalloproteas...    127   7e-30   Eucalyptus grandis [rose gum]
ref|XP_007208082.1|  hypothetical protein PRUPE_ppa001525mg             127   8e-30   
ref|XP_010521865.1|  PREDICTED: ATP-dependent zinc metalloproteas...    127   8e-30   Tarenaya hassleriana [spider flower]
ref|XP_007016370.1|  FTSH protease 10                                   126   2e-29   
gb|KHG20351.1|  ATP-dependent zinc metalloprotease FTSH 10, mitoc...    125   3e-29   Gossypium arboreum [tree cotton]
ref|XP_010487550.1|  PREDICTED: ATP-dependent zinc metalloproteas...    124   4e-29   
ref|XP_010262544.1|  PREDICTED: ATP-dependent zinc metalloproteas...    125   4e-29   Nelumbo nucifera [Indian lotus]
ref|XP_008784613.1|  PREDICTED: ATP-dependent zinc metalloproteas...    125   5e-29   Phoenix dactylifera
ref|XP_010487557.1|  PREDICTED: ATP-dependent zinc metalloproteas...    125   6e-29   
ref|XP_010487541.1|  PREDICTED: ATP-dependent zinc metalloproteas...    125   6e-29   Camelina sativa [gold-of-pleasure]
ref|XP_002889652.1|  FTSH10                                             124   8e-29   Arabidopsis lyrata subsp. lyrata
gb|KJB16965.1|  hypothetical protein B456_002G257200                    123   3e-28   Gossypium raimondii
gb|KJB16964.1|  hypothetical protein B456_002G257200                    123   3e-28   Gossypium raimondii
ref|XP_006484360.1|  PREDICTED: ATP-dependent zinc metalloproteas...    119   4e-28   Citrus sinensis [apfelsine]
gb|KFK32242.1|  hypothetical protein AALP_AA6G216200                    122   5e-28   Arabis alpina [alpine rockcress]
emb|CDP09082.1|  unnamed protein product                                122   5e-28   Coffea canephora [robusta coffee]
gb|KHN32140.1|  ATP-dependent zinc metalloprotease FTSH 10, mitoc...    122   6e-28   Glycine soja [wild soybean]
ref|XP_003539662.1|  PREDICTED: ATP-dependent zinc metalloproteas...    122   6e-28   Glycine max [soybeans]
ref|XP_008222305.1|  PREDICTED: ATP-dependent zinc metalloproteas...    122   7e-28   Prunus mume [ume]
gb|KHG12964.1|  ATP-dependent zinc metalloprotease FTSH 10, mitoc...    122   8e-28   Gossypium arboreum [tree cotton]
ref|XP_007207144.1|  hypothetical protein PRUPE_ppa001491mg             122   8e-28   Prunus persica
ref|XP_006306790.1|  hypothetical protein CARUB_v10008328mg             121   8e-28   Capsella rubella
ref|XP_007133225.1|  hypothetical protein PHAVU_011G162000g             121   1e-27   Phaseolus vulgaris [French bean]
ref|XP_004302718.2|  PREDICTED: ATP-dependent zinc metalloproteas...    120   3e-27   Fragaria vesca subsp. vesca
ref|XP_006424865.1|  hypothetical protein CICLE_v10027837mg             120   3e-27   Citrus clementina [clementine]
gb|KDO72822.1|  hypothetical protein CISIN_1g047690mg                   120   3e-27   Citrus sinensis [apfelsine]
ref|XP_010106514.1|  ATP-dependent zinc metalloprotease FTSH 10         119   6e-27   Morus notabilis
ref|NP_172231.2|  FTSH protease 10                                      119   8e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008799731.1|  PREDICTED: ATP-dependent zinc metalloproteas...    118   1e-26   Phoenix dactylifera
gb|KHN21936.1|  ATP-dependent zinc metalloprotease FTSH 10, mitoc...    117   2e-26   Glycine soja [wild soybean]
ref|XP_003537985.1|  PREDICTED: ATP-dependent zinc metalloproteas...    117   3e-26   Glycine max [soybeans]
ref|XP_010937593.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...    117   3e-26   
ref|XP_010542637.1|  PREDICTED: ATP-dependent zinc metalloproteas...    117   3e-26   Tarenaya hassleriana [spider flower]
ref|XP_006488359.1|  PREDICTED: ATP-dependent zinc metalloproteas...    117   4e-26   Citrus sinensis [apfelsine]
gb|KDP42240.1|  hypothetical protein JCGZ_02970                         116   6e-26   Jatropha curcas
ref|XP_002530989.1|  Mitochondrial respiratory chain complexes as...    116   6e-26   
ref|XP_006409951.1|  hypothetical protein EUTSA_v10016261mg             116   7e-26   Eutrema salsugineum [saltwater cress]
ref|XP_003606687.1|  Cell division protease ftsH-like protein           116   8e-26   Medicago truncatula
gb|AAK77908.1|AF397903_1  AAA-metalloprotease FtsH                      115   9e-26   Pisum sativum [garden pea]
ref|XP_004164623.1|  PREDICTED: ATP-dependent zinc metalloproteas...    114   2e-25   
ref|XP_004142062.1|  PREDICTED: ATP-dependent zinc metalloproteas...    114   3e-25   Cucumis sativus [cucumbers]
ref|XP_008356937.1|  PREDICTED: ATP-dependent zinc metalloproteas...    114   3e-25   Malus domestica [apple tree]
emb|CDY09913.1|  BnaC08g45380D                                          112   9e-25   Brassica napus [oilseed rape]
ref|XP_009364366.1|  PREDICTED: ATP-dependent zinc metalloproteas...    112   1e-24   Pyrus x bretschneideri [bai li]
ref|XP_009387530.1|  PREDICTED: ATP-dependent zinc metalloproteas...    112   2e-24   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAC33234.1|  putative AAA-type ATPase                                111   4e-24   Arabidopsis thaliana [mouse-ear cress]
ref|NP_850129.1|  FTSH protease 3                                       111   4e-24   Arabidopsis thaliana [mouse-ear cress]
gb|AAL36270.1|  putative AAA-type ATPase                                111   4e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008448063.1|  PREDICTED: ATP-dependent zinc metalloproteas...    111   4e-24   Cucumis melo [Oriental melon]
gb|AAF79577.1|AC022464_35  F22G5.10                                     109   1e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003539663.1|  PREDICTED: ATP-dependent zinc metalloproteas...    109   2e-23   Glycine max [soybeans]
ref|XP_008448079.1|  PREDICTED: ATP-dependent zinc metalloproteas...    109   2e-23   Cucumis melo [Oriental melon]
ref|XP_008384940.1|  PREDICTED: ATP-dependent zinc metalloproteas...    108   2e-23   
ref|XP_007132051.1|  hypothetical protein PHAVU_011G062800g             108   3e-23   Phaseolus vulgaris [French bean]
ref|XP_004507174.1|  PREDICTED: ATP-dependent zinc metalloproteas...    108   5e-23   Cicer arietinum [garbanzo]
ref|XP_009375915.1|  PREDICTED: ATP-dependent zinc metalloproteas...    107   6e-23   Pyrus x bretschneideri [bai li]
ref|XP_009118433.1|  PREDICTED: ATP-dependent zinc metalloproteas...    107   9e-23   Brassica rapa
ref|XP_002881027.1|  hypothetical protein ARALYDRAFT_344684             107   1e-22   
ref|XP_009384843.1|  PREDICTED: ATP-dependent zinc metalloproteas...    106   1e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004294648.1|  PREDICTED: ATP-dependent zinc metalloproteas...    106   2e-22   Fragaria vesca subsp. vesca
ref|XP_006845226.1|  hypothetical protein AMTR_s00005p00256120          106   2e-22   Amborella trichopoda
ref|XP_006592193.1|  PREDICTED: ATP-dependent zinc metalloproteas...    102   5e-22   Glycine max [soybeans]
gb|KDP35648.1|  hypothetical protein JCGZ_09086                         103   1e-21   Jatropha curcas
ref|XP_009140963.1|  PREDICTED: ATP-dependent zinc metalloproteas...    103   2e-21   Brassica rapa
ref|XP_009384842.1|  PREDICTED: ATP-dependent zinc metalloproteas...    102   4e-21   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU38460.1|  hypothetical protein MIMGU_mgv1a001496mg                101   1e-20   Erythranthe guttata [common monkey flower]
ref|XP_010414442.1|  PREDICTED: ATP-dependent zinc metalloproteas...    100   1e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010469994.1|  PREDICTED: ATP-dependent zinc metalloproteas...    100   1e-20   Camelina sativa [gold-of-pleasure]
ref|XP_006417796.1|  hypothetical protein EUTSA_v10006814mg             100   2e-20   Eutrema salsugineum [saltwater cress]
ref|XP_006592191.1|  PREDICTED: ATP-dependent zinc metalloproteas...    100   2e-20   Glycine max [soybeans]
ref|XP_010510537.1|  PREDICTED: ATP-dependent zinc metalloproteas...  93.6    4e-18   Camelina sativa [gold-of-pleasure]
ref|XP_009125053.1|  PREDICTED: ATP-dependent zinc metalloproteas...  92.8    7e-18   Brassica rapa
gb|EPS71434.1|  hypothetical protein M569_03325                       92.0    1e-17   Genlisea aurea
gb|KHN32138.1|  ATP-dependent zinc metalloprotease FTSH 10, mitoc...  91.7    2e-17   Glycine soja [wild soybean]
ref|XP_002313426.1|  FtsH protease family protein                     90.5    5e-17   
emb|CDX77230.1|  BnaC04g40250D                                        90.5    5e-17   
emb|CDY31753.1|  BnaA04g16890D                                        85.1    3e-15   Brassica napus [oilseed rape]
ref|XP_002439915.1|  hypothetical protein SORBIDRAFT_09g022490        83.2    1e-14   Sorghum bicolor [broomcorn]
ref|XP_008366731.1|  PREDICTED: uncharacterized protein LOC103430373  79.0    2e-14   
ref|XP_011032280.1|  PREDICTED: ATP-dependent zinc metalloproteas...  81.6    3e-14   Populus euphratica
gb|AFW82207.1|  hypothetical protein ZEAMMB73_958383                  80.1    1e-13   
ref|XP_003567261.1|  PREDICTED: ATP-dependent zinc metalloproteas...  79.0    2e-13   
ref|XP_010043512.1|  PREDICTED: ATP-dependent zinc metalloproteas...  79.0    3e-13   
emb|CDY39531.1|  BnaC04g15300D                                        79.0    3e-13   Brassica napus [oilseed rape]
ref|XP_008359096.1|  PREDICTED: ATP-dependent zinc metalloproteas...  78.6    3e-13   
ref|XP_011007151.1|  PREDICTED: ATP-dependent zinc metalloproteas...  77.8    5e-13   Populus euphratica
emb|CDY47876.1|  BnaA07g14210D                                        77.4    8e-13   Brassica napus [oilseed rape]
ref|XP_003568313.1|  PREDICTED: ATP-dependent zinc metalloproteas...  75.5    4e-12   Brachypodium distachyon [annual false brome]
ref|XP_004961860.1|  PREDICTED: ATP-dependent zinc metalloproteas...  73.6    1e-11   Setaria italica
ref|XP_006592192.1|  PREDICTED: ATP-dependent zinc metalloproteas...  71.6    6e-11   
ref|XP_004970544.1|  PREDICTED: ATP-dependent zinc metalloproteas...  71.2    8e-11   Setaria italica
dbj|BAJ89991.1|  predicted protein                                    68.9    1e-10   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010042847.1|  PREDICTED: ATP-dependent zinc metalloproteas...  65.5    3e-10   Eucalyptus grandis [rose gum]
ref|XP_008350440.1|  PREDICTED: uncharacterized protein LOC103413780  66.2    7e-10   
ref|XP_008358519.1|  PREDICTED: ATP-dependent zinc metalloproteas...  67.8    1e-09   
ref|XP_009600786.1|  PREDICTED: ATP-dependent zinc metalloproteas...  67.8    1e-09   Nicotiana tomentosiformis
dbj|BAJ98147.1|  predicted protein                                    66.6    3e-09   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001055745.1|  Os05g0458400                                     65.5    5e-09   
gb|EEE63976.1|  hypothetical protein OsJ_18802                        65.5    6e-09   Oryza sativa Japonica Group [Japonica rice]
gb|EEC79350.1|  hypothetical protein OsI_20217                        65.5    6e-09   Oryza sativa Indica Group [Indian rice]
gb|KFK40664.1|  hypothetical protein AALP_AA2G026000                  62.4    8e-09   Arabis alpina [alpine rockcress]
ref|XP_010521866.1|  PREDICTED: ATP-dependent zinc metalloproteas...  63.5    2e-08   Tarenaya hassleriana [spider flower]
ref|XP_006655377.1|  PREDICTED: ATP-dependent zinc metalloproteas...  63.2    4e-08   
ref|XP_006644995.1|  PREDICTED: ATP-dependent zinc metalloproteas...  60.5    2e-07   Oryza brachyantha
ref|XP_002458748.1|  hypothetical protein SORBIDRAFT_03g039540        60.5    2e-07   Sorghum bicolor [broomcorn]
gb|KJB36698.1|  hypothetical protein B456_006G171800                  58.9    8e-07   Gossypium raimondii
ref|XP_002967857.1|  hypothetical protein SELMODRAFT_169256           58.9    8e-07   
ref|XP_006293791.1|  hypothetical protein CARUB_v10022773mg           58.5    1e-06   
ref|XP_010688798.1|  PREDICTED: succinate dehydrogenase cytochrom...  57.0    2e-06   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001044774.1|  Os01g0842600                                     57.8    2e-06   
gb|EAY76461.1|  hypothetical protein OsI_04395                        57.8    2e-06   Oryza sativa Indica Group [Indian rice]
gb|KEH23850.1|  ATP-dependent zinc metalloprotease FTSH protein       55.1    2e-05   Medicago truncatula
ref|XP_009804923.1|  PREDICTED: ATP-dependent zinc metalloproteas...  55.1    2e-05   Nicotiana sylvestris
ref|XP_006349499.1|  PREDICTED: ATP-dependent zinc metalloproteas...  53.5    5e-05   Solanum tuberosum [potatoes]
ref|XP_006349501.1|  PREDICTED: ATP-dependent zinc metalloproteas...  53.5    6e-05   Solanum tuberosum [potatoes]
ref|XP_006349500.1|  PREDICTED: ATP-dependent zinc metalloproteas...  53.5    6e-05   Solanum tuberosum [potatoes]
gb|EMT07840.1|  Cell division protease ftsH-like protein, mitocho...  53.1    6e-05   
gb|EMT04659.1|  Cell division protease ftsH-like protein, mitocho...  51.6    2e-04   
gb|EMS50561.1|  ATP-dependent zinc metalloprotease FTSH 8, mitoch...  51.6    2e-04   Triticum urartu
ref|XP_001782950.1|  predicted protein                                50.8    5e-04   
ref|XP_003590119.1|  Cell division protease ftsH-like protein         50.1    6e-04   
ref|XP_002981661.1|  hypothetical protein SELMODRAFT_115113           50.1    7e-04   



>ref|XP_006349497.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X1 [Solanum tuberosum]
Length=816

 Score =   218 bits (554),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 125/194 (64%), Positives = 153/194 (79%), Gaps = 11/194 (6%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYLTS  284
            M+LSR+ RS S     ++N+ LISGG+GVR  +LDE+A+ + CI RV GG+GFVRSYLTS
Sbjct  1    MILSRVNRSRS-----SINKALISGGHGVRYAILDEVASSNACITRVNGGLGFVRSYLTS  55

Query  285  VGAGKGIIN-----RAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNN  449
            +GAGK  +N     RAYLS++D + TNPRLRR FCSQ  KK NYENYYPKNKKE+PK NN
Sbjct  56   IGAGKHGVNKAALQRAYLSEIDKLCTNPRLRRFFCSQGSKKSNYENYYPKNKKEVPKGNN  115

Query  450  QKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFKN  629
            QK+ESG+E+S+  Q   PQ+NF+KQYQN++T LLFIGF+LSS + SPR Q EISFQEFKN
Sbjct  116  QKAESGKEESTGEQGN-PQENFMKQYQNILTPLLFIGFILSSTLFSPREQKEISFQEFKN  174

Query  630  KLLEPGLVDHIXVS  671
             LLEPGLVD I V+
Sbjct  175  NLLEPGLVDRIVVT  188



>ref|XP_006349498.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X2 [Solanum tuberosum]
Length=815

 Score =   213 bits (542),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 115/194 (59%), Positives = 144/194 (74%), Gaps = 12/194 (6%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYLTS  284
            M+LSR+ RS S     ++N+ LISGG+GVR  +LDE+A+ + CI RV GG+GFVRSYLTS
Sbjct  1    MILSRVNRSRS-----SINKALISGGHGVRYAILDEVASSNACITRVNGGLGFVRSYLTS  55

Query  285  VGAGKGIIN-----RAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNN  449
            +GAGK  +N     RAYLS++D + TNPRLRR FCSQ  KK     Y    K+ +PK NN
Sbjct  56   IGAGKHGVNKAALQRAYLSEIDKLCTNPRLRRFFCSQGSKKNYENYYPKNKKE-VPKGNN  114

Query  450  QKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFKN  629
            QK+ESG+E+S+  Q   PQ+NF+KQYQN++T LLFIGF+LSS + SPR Q EISFQEFKN
Sbjct  115  QKAESGKEESTGEQGN-PQENFMKQYQNILTPLLFIGFILSSTLFSPREQKEISFQEFKN  173

Query  630  KLLEPGLVDHIXVS  671
             LLEPGLVD I V+
Sbjct  174  NLLEPGLVDRIVVT  187



>ref|XP_009611240.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Nicotiana tomentosiformis]
Length=811

 Score =   213 bits (542),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 129/189 (68%), Positives = 158/189 (84%), Gaps = 8/189 (4%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYLTS  284
            M+LSRI RS+SKSS   +N+ L+SG   VR  +LDE+A+++ CI RV GG+GFVRSYLTS
Sbjct  1    MILSRINRSLSKSS---INKKLVSG---VRRVILDEVASRNACITRVNGGLGFVRSYLTS  54

Query  285  VGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKSES  464
            +GAGK  +N+AYLS++DS+F NPRLRR FCSQ  K KNYENYYPKNKKE+PK NNQK+ES
Sbjct  55   IGAGKQGVNKAYLSELDSLFANPRLRRFFCSQGSKNKNYENYYPKNKKEVPKGNNQKAES  114

Query  465  GREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFKNKLLEP  644
            G+E+ S+G+QG+PQD FLKQYQN++T LLFIGF+LSS +L PR Q EISFQEFKNKLLE 
Sbjct  115  GKEE-STGEQGNPQD-FLKQYQNILTPLLFIGFILSSTLLGPREQKEISFQEFKNKLLEA  172

Query  645  GLVDHIXVS  671
            GLVD I V+
Sbjct  173  GLVDRIVVA  181



>ref|XP_010312354.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X1 [Solanum lycopersicum]
Length=813

 Score =   204 bits (520),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 122/194 (63%), Positives = 147/194 (76%), Gaps = 14/194 (7%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYLTS  284
            M+LSRI R  S     T+N+ LISG   VR  +LDE+A+ + CI R  GG+GFVRSYLTS
Sbjct  1    MILSRINRCRS-----TINKALISG---VRYAILDEVASSNACITRANGGLGFVRSYLTS  52

Query  285  VGAGK-----GIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNN  449
            +GAGK       + RAYLS++D +  NPRLRR FCSQ  KK NYENYYPKNKKE+PK NN
Sbjct  53   IGAGKHGVSKAALQRAYLSEIDKLCANPRLRRFFCSQGSKKSNYENYYPKNKKEVPKGNN  112

Query  450  QKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFKN  629
            QK+ESG+E+S+  Q   PQ+NF+KQYQN++T LLFIGF+LSS + SPR Q EISFQEFKN
Sbjct  113  QKAESGKEESTGEQGN-PQENFMKQYQNILTPLLFIGFILSSTLFSPREQKEISFQEFKN  171

Query  630  KLLEPGLVDHIXVS  671
            KLLEPGLVD I V+
Sbjct  172  KLLEPGLVDRIVVT  185



>ref|XP_006341014.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
[Solanum tuberosum]
Length=817

 Score =   201 bits (512),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 119/190 (63%), Positives = 157/190 (83%), Gaps = 5/190 (3%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYLTS  284
            MMLSRI+RS+SK+S S++++G+   GYGVR+ VLDE+A    CI RV+GGIGFVR+YLT 
Sbjct  1    MMLSRISRSISKASRSSIHKGV---GYGVRSAVLDEVATGGACITRVDGGIGFVRTYLTL  57

Query  285  VGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKT-NNQKSE  461
            +G G+  +++AYLS++DS+  +PRLRR FCS+ PK++NYENYYPKNK EIPK  NNQK+E
Sbjct  58   IGGGRKGLSKAYLSELDSVLASPRLRRFFCSEGPKRRNYENYYPKNKIEIPKANNNQKAE  117

Query  462  SGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFKNKLLE  641
            SG+E+  SG+QG+PQ+NF+K   N++  LLFIGF+LSS+++SPR Q EISFQEFKNKLLE
Sbjct  118  SGKEE-GSGEQGNPQENFIKLNYNILAPLLFIGFILSSILMSPREQQEISFQEFKNKLLE  176

Query  642  PGLVDHIXVS  671
             GLVD I V+
Sbjct  177  AGLVDRIVVT  186



>ref|XP_009781386.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Nicotiana sylvestris]
Length=808

 Score =   200 bits (509),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 125/189 (66%), Positives = 154/189 (81%), Gaps = 10/189 (5%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYLTS  284
            M+LSRI RS++KSS   +N+ L+SG   VR  +LDE+A++  CI RV GG+GFVRSYLTS
Sbjct  1    MILSRINRSLAKSS---INKRLVSG---VRGVILDEVASRDACITRVNGGLGFVRSYLTS  54

Query  285  VGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKSES  464
            +GAGK  +N+AYLS++DS+F  PRLRR FCSQ  K KNYENYYPKNKKE+PK NNQK  +
Sbjct  55   IGAGKQGVNKAYLSELDSLFAKPRLRRFFCSQGSKNKNYENYYPKNKKEVPKGNNQK--A  112

Query  465  GREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFKNKLLEP  644
            G+E+ S+G+QG+PQD FLKQYQN++T LLFIGF+LSS +L PR Q EISFQEFKNKLLE 
Sbjct  113  GKEE-STGEQGNPQD-FLKQYQNILTPLLFIGFILSSTLLGPREQKEISFQEFKNKLLEA  170

Query  645  GLVDHIXVS  671
            GLVD I V+
Sbjct  171  GLVDRIVVA  179



>ref|XP_004249560.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X2 [Solanum lycopersicum]
Length=812

 Score =   200 bits (509),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 112/194 (58%), Positives = 138/194 (71%), Gaps = 15/194 (8%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYLTS  284
            M+LSRI R  S     T+N+ LISG   VR  +LDE+A+ + CI R  GG+GFVRSYLTS
Sbjct  1    MILSRINRCRS-----TINKALISG---VRYAILDEVASSNACITRANGGLGFVRSYLTS  52

Query  285  VGAGK-----GIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNN  449
            +GAGK       + RAYLS++D +  NPRLRR FCSQ  KK     Y    K+ +PK NN
Sbjct  53   IGAGKHGVSKAALQRAYLSEIDKLCANPRLRRFFCSQGSKKNYENYYPKNKKE-VPKGNN  111

Query  450  QKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFKN  629
            QK+ESG+E+S+  Q   PQ+NF+KQYQN++T LLFIGF+LSS + SPR Q EISFQEFKN
Sbjct  112  QKAESGKEESTGEQGN-PQENFMKQYQNILTPLLFIGFILSSTLFSPREQKEISFQEFKN  170

Query  630  KLLEPGLVDHIXVS  671
            KLLEPGLVD I V+
Sbjct  171  KLLEPGLVDRIVVT  184



>ref|XP_009598017.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Nicotiana tomentosiformis]
Length=821

 Score =   191 bits (485),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 120/190 (63%), Positives = 157/190 (83%), Gaps = 2/190 (1%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPSTVNRGLISGGYGV-RTKVLDELAAQSTCIARVEGGIGFVRSYLT  281
            MMLSRI RS+SKSS S +++GL+ GG    R+ VLDE+A +  CI RV+GG+ FVR+YLT
Sbjct  1    MMLSRIGRSLSKSSRSNIHKGLVYGGGYGVRSAVLDEVATRGACITRVDGGLRFVRTYLT  60

Query  282  SVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKSE  461
            S+G+GK  +++A LS++DS+F N RLRR FCS+ PK++NYENYYPK++KE+PK NNQK+E
Sbjct  61   SIGSGKQGLSKANLSELDSVFANHRLRRFFCSEGPKRRNYENYYPKDRKEVPKGNNQKAE  120

Query  462  SGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFKNKLLE  641
            SG+E+  +G+QG+PQ+NF+K   NL+T LLFIGF+LSS++LSPR Q EISFQEFKNKLLE
Sbjct  121  SGKEE-GAGEQGNPQENFVKLNYNLLTPLLFIGFILSSILLSPREQQEISFQEFKNKLLE  179

Query  642  PGLVDHIXVS  671
             GLVD I VS
Sbjct  180  AGLVDRIVVS  189



>ref|XP_004246405.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
[Solanum lycopersicum]
Length=813

 Score =   189 bits (480),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 115/190 (61%), Positives = 148/190 (78%), Gaps = 9/190 (5%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYLTS  284
            MMLSRI+RS+SK+S S++++G+   GYGVR+ VLDE+A    CI RV+GG+GFVR+YLT 
Sbjct  1    MMLSRISRSISKASRSSIHKGV---GYGVRSTVLDEVATGGACITRVDGGLGFVRTYLTL  57

Query  285  VGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNN-QKSE  461
            +G G+    R    ++DS+  +PRLRR FCS+ PK++NYENYYPKNKKEIPK NN QK+E
Sbjct  58   IGGGR----RGLSKELDSVLASPRLRRFFCSEGPKRRNYENYYPKNKKEIPKANNNQKAE  113

Query  462  SGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFKNKLLE  641
            SG+E+ S  Q   PQ+NF+K   NL+  LLFIGF+LSS+++SPR Q EISFQEFKNKLLE
Sbjct  114  SGKEEGSGEQGN-PQENFIKLNYNLLAPLLFIGFILSSILMSPREQQEISFQEFKNKLLE  172

Query  642  PGLVDHIXVS  671
             GLVD I V+
Sbjct  173  AGLVDRIVVT  182



>ref|XP_009772661.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Nicotiana sylvestris]
Length=820

 Score =   189 bits (480),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 118/190 (62%), Positives = 156/190 (82%), Gaps = 2/190 (1%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPSTVNRGLISGGYGV-RTKVLDELAAQSTCIARVEGGIGFVRSYLT  281
            MMLSRI RS+SKSS S +++GL+ GG    R+  LDE+A +  CI RV+G + FVR+YLT
Sbjct  1    MMLSRIGRSLSKSSHSNIHKGLVYGGGYGVRSAALDEVAVRGACITRVDGELWFVRTYLT  60

Query  282  SVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKSE  461
            S+G+GK  +++AYLS++DS+F N RLRR FCS+ PK++NYENYYPK++KE+PK NNQK+E
Sbjct  61   SIGSGKQGLSKAYLSELDSVFANHRLRRFFCSEGPKRRNYENYYPKDRKEVPKGNNQKAE  120

Query  462  SGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFKNKLLE  641
            SG+E+  +G+QG+PQ+NF+K   NL+T LLFIGF+LSS++LSPR Q EISFQEFKN+LLE
Sbjct  121  SGKEE-GAGEQGNPQENFVKLNYNLLTPLLFIGFILSSILLSPREQQEISFQEFKNRLLE  179

Query  642  PGLVDHIXVS  671
             GLVD I VS
Sbjct  180  AGLVDRIVVS  189



>ref|XP_011094876.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X2 [Sesamum indicum]
Length=815

 Score =   171 bits (432),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 102/188 (54%), Positives = 130/188 (69%), Gaps = 2/188 (1%)
 Frame = +3

Query  108  MLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYLTSV  287
            M SRI  SV +SS +++N+G  SG YGVR+  L E ++     +   G +GF+RSYLT +
Sbjct  1    MFSRIGSSVCRSSRASLNKGAASGSYGVRSATLTEFSSGKAFTSCENGELGFLRSYLTCI  60

Query  288  GAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKSESG  467
            GAGK       L +++S+FTNPRLRRLFC+QAPKK  YENYYPKNK   PK +NQKSE+ 
Sbjct  61   GAGKQAAKSHVLKELNSVFTNPRLRRLFCNQAPKKGRYENYYPKNKTRTPKGSNQKSEAK  120

Query  468  REDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFKNKLLEPG  647
             +  S  Q  +P  +  KQ QN +T LL IGFVL+SM + P  Q +ISFQEFKN+LLEPG
Sbjct  121  EDSGSGEQWNNP--DMAKQLQNFVTPLLLIGFVLTSMFMRPHDQKQISFQEFKNRLLEPG  178

Query  648  LVDHIXVS  671
            LVDHI +S
Sbjct  179  LVDHIVIS  186



>ref|XP_011094875.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X1 [Sesamum indicum]
Length=817

 Score =   170 bits (431),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 100/188 (53%), Positives = 128/188 (68%), Gaps = 0/188 (0%)
 Frame = +3

Query  108  MLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYLTSV  287
            M SRI  SV +SS +++N+G  SG YGVR+  L E ++     +   G +GF+RSYLT +
Sbjct  1    MFSRIGSSVCRSSRASLNKGAASGSYGVRSATLTEFSSGKAFTSCENGELGFLRSYLTCI  60

Query  288  GAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKSESG  467
            GAGK       L +++S+FTNPRLRRLFC+QAPKK  YENYYPKNK   PK +NQKSE+ 
Sbjct  61   GAGKQAAKSHVLKELNSVFTNPRLRRLFCNQAPKKGRYENYYPKNKTRTPKGSNQKSEAK  120

Query  468  REDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFKNKLLEPG  647
              + S   +     +  KQ QN +T LL IGFVL+SM + P  Q +ISFQEFKN+LLEPG
Sbjct  121  DAEDSGSGEQWNNPDMAKQLQNFVTPLLLIGFVLTSMFMRPHDQKQISFQEFKNRLLEPG  180

Query  648  LVDHIXVS  671
            LVDHI +S
Sbjct  181  LVDHIVIS  188



>ref|XP_002283273.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial 
[Vitis vinifera]
 emb|CBI16104.3| unnamed protein product [Vitis vinifera]
Length=820

 Score =   162 bits (409),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 105/193 (54%), Positives = 142/193 (74%), Gaps = 6/193 (3%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDELAAQ----STCIARVEGGIGFVRS  272
            M+LSR+ RS+S+SS +   R ++SGG   R+  L+E  ++    ST + +++GG+GF+R 
Sbjct  1    MILSRLGRSLSRSS-TAKPRNVLSGGNVGRSAFLNEALSRAPHYSTDLGQLDGGLGFLRG  59

Query  273  YLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQ  452
            YLTS+GA +G + ++YLSD++ +  NPR+RR   S+APKKKNYEN+YPKNKKE PK   Q
Sbjct  60   YLTSIGASRGFVGKSYLSDLNFVLANPRIRRFLSSEAPKKKNYENFYPKNKKETPKGEEQ  119

Query  453  KSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFKNK  632
            KSES +EDS++   G+ Q+ F+KQ QN++T LL IG  LSS    PR Q +ISFQEFKNK
Sbjct  120  KSES-KEDSNTDDHGNFQETFMKQLQNVLTPLLVIGLFLSSFSFGPREQKQISFQEFKNK  178

Query  633  LLEPGLVDHIXVS  671
            LLEPGLVDHI VS
Sbjct  179  LLEPGLVDHIVVS  191



>ref|XP_002323508.2| hypothetical protein POPTR_0016s10620g [Populus trichocarpa]
 gb|EEF05269.2| hypothetical protein POPTR_0016s10620g [Populus trichocarpa]
Length=814

 Score =   157 bits (398),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 108/196 (55%), Positives = 139/196 (71%), Gaps = 12/196 (6%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPSTVNRGLISGG---YGVRTKVLDELAAQSTCIARVEG----GIGF  263
            M+LSRI RS+S+S+ ST+ R +I+ G   +  RT ++DEL ++    A +E     G+G 
Sbjct  1    MILSRIGRSLSRSARSTLQRNVITTGNYLFNARTVLVDELTSR---FAALESNGIRGLGI  57

Query  264  VRSYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKT  443
            VR YL+  GAGK I++   LS+++SI  NPR+RR FCS+APKK+ YENYYPK+KKEIPK 
Sbjct  58   VRGYLSYSGAGKQIVSSTQLSNLNSILANPRVRRFFCSEAPKKRKYENYYPKDKKEIPKA  117

Query  444  NNQKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEF  623
            N  KSES +EDS     G  Q N LK +QN+IT LLF+ FV SSM  + + Q +ISFQEF
Sbjct  118  NESKSES-KEDSGGAGGGDSQ-NTLKLFQNIITPLLFLAFVYSSMFFNTQEQKQISFQEF  175

Query  624  KNKLLEPGLVDHIXVS  671
            KNKLLEPGLVDHI VS
Sbjct  176  KNKLLEPGLVDHIVVS  191



>gb|EYU41737.1| hypothetical protein MIMGU_mgv1a001461mg [Erythranthe guttata]
Length=815

 Score =   153 bits (387),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 102/189 (54%), Positives = 132/189 (70%), Gaps = 4/189 (2%)
 Frame = +3

Query  108  MLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYLTSV  287
            MLSRI R +++SS +++N+G   G YGVR+ +L E    +       GG+G +RSYLTS+
Sbjct  1    MLSRIGRCLNQSSRASLNKGGFPGSYGVRSAILTEFYTGNALTKSENGGLGLLRSYLTSI  60

Query  288  GAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKSESG  467
            GA K +     L +  S+  +PRLRRLFCSQAPKKK+YE YY KNK EIPK NNQKSE G
Sbjct  61   GACKQVTKSHVLEEFHSVMASPRLRRLFCSQAPKKKSYEKYYVKNKSEIPKGNNQKSE-G  119

Query  468  REDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSP-RTQNEISFQEFKNKLLEP  644
            +E+S SG Q +  +  + Q+ N +T LL +GFVL SM ++P   Q +ISFQEFKNKLLEP
Sbjct  120  KEESGSGGQWNKTETTI-QF-NFLTPLLLLGFVLMSMYMTPGGDQKQISFQEFKNKLLEP  177

Query  645  GLVDHIXVS  671
            GLVDHI +S
Sbjct  178  GLVDHIVIS  186



>ref|XP_006429118.1| hypothetical protein CICLE_v10011087mg [Citrus clementina]
 gb|ESR42358.1| hypothetical protein CICLE_v10011087mg [Citrus clementina]
Length=818

 Score =   151 bits (382),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 100/192 (52%), Positives = 131/192 (68%), Gaps = 9/192 (5%)
 Frame = +3

Query  105  MMLSRIARSVSKSS-PSTVNRGLISGGYGVRTKVLDELAAQST-CIARVEGGIGFVRSYL  278
            M+ SRI RS+ +S+  ST  + +++G Y  R  +L E    +T CI+RV+GG+GFVRS+L
Sbjct  1    MIFSRIGRSLCRSARSSTFQKNVVAGDYNARADLLIEPIFPTTPCISRVDGGVGFVRSFL  60

Query  279  TSVGAGKGIIN-RAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQK  455
            TS GAGK +++     S+ +SI  NPR R+    Q+PKK  YENYYPKNKKEIPK N QK
Sbjct  61   TSAGAGKQLVSLNKCSSNFNSIVANPRARKFCSGQSPKKSKYENYYPKNKKEIPKANEQK  120

Query  456  SESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFKNKL  635
            SES  +  +         NF +Q+ N ++ LL  GFVLSS++LSP+ Q EISFQEFKNKL
Sbjct  121  SESKGDSGAG------DQNFTRQFSNFLSHLLLFGFVLSSVLLSPKQQKEISFQEFKNKL  174

Query  636  LEPGLVDHIXVS  671
            LEPGLVD I V+
Sbjct  175  LEPGLVDRIVVT  186



>ref|XP_006480880.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X1 [Citrus sinensis]
 ref|XP_006480881.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X2 [Citrus sinensis]
Length=818

 Score =   151 bits (382),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 100/192 (52%), Positives = 131/192 (68%), Gaps = 9/192 (5%)
 Frame = +3

Query  105  MMLSRIARSVSKSS-PSTVNRGLISGGYGVRTKVLDELAAQST-CIARVEGGIGFVRSYL  278
            M+ SRI RS+ +S+  ST  + +++G Y  R  +L E    +T CI+RV+GG+GFVRS+L
Sbjct  1    MIFSRIGRSLCRSARSSTFQKNVVAGDYNARADLLIEPIFPTTPCISRVDGGVGFVRSFL  60

Query  279  TSVGAGKGIIN-RAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQK  455
            TS GAGK +++     S+ +SI  NPR R+    Q+PKK  YENYYPKNKKEIPK N QK
Sbjct  61   TSAGAGKQLVSLNKCSSNFNSIVANPRARKFCSGQSPKKSKYENYYPKNKKEIPKANEQK  120

Query  456  SESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFKNKL  635
            SES  +  +         NF +Q+ N ++ LL  GFVLSS++LSP+ Q EISFQEFKNKL
Sbjct  121  SESKGDSGAG------DQNFTRQFSNFLSHLLLFGFVLSSVLLSPKQQKEISFQEFKNKL  174

Query  636  LEPGLVDHIXVS  671
            LEPGLVD I V+
Sbjct  175  LEPGLVDRIVVT  186



>emb|CDP06599.1| unnamed protein product [Coffea canephora]
Length=823

 Score =   151 bits (381),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 111/196 (57%), Positives = 143/196 (73%), Gaps = 8/196 (4%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDELAAQ--STCIARVEGG-IGFVRSY  275
            M+ SRI RS+  SS S  +  LISG +GVR      + +   + CI RV+   +G VRSY
Sbjct  1    MIFSRIGRSLLSSSRSAYSNKLISG-FGVRGMRSPSVTSTDLNACIPRVDAPTLGPVRSY  59

Query  276  LTSVGAGKG----IINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKT  443
            LTS+ AG G    I    +LS+ +S+F NPRLRRLFCS+APK++NYENYYPK+KKEIPK 
Sbjct  60   LTSIRAGAGGGTKIAGTTFLSEFNSVFANPRLRRLFCSEAPKQRNYENYYPKDKKEIPKG  119

Query  444  NNQKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEF  623
            +N++S   +++SS+G Q + QD+  KQ+QNLI  LLFIG+VLSS++LSPR QN+ISFQEF
Sbjct  120  DNKRSSEAKDESSAGDQANGQDSSSKQFQNLIMPLLFIGYVLSSILLSPREQNQISFQEF  179

Query  624  KNKLLEPGLVDHIXVS  671
            K KLLEPGLVD I VS
Sbjct  180  KTKLLEPGLVDRIVVS  195



>ref|XP_011007150.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X1 [Populus euphratica]
Length=815

 Score =   150 bits (380),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 106/196 (54%), Positives = 136/196 (69%), Gaps = 12/196 (6%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPSTVNRGLISGG---YGVRTKVLDELAAQSTCIARVEG----GIGF  263
            M+LSRI RS+S+S+ ST+ R +I+        RT ++DEL ++    A +E     G+G 
Sbjct  1    MILSRIGRSLSRSARSTLQRNVITKSNYLLNARTVLVDELTSR---FAALESNGLRGLGI  57

Query  264  VRSYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKT  443
            VR Y+   GAGK I++   LS+++SI  NPR+RR FCS+APKK+ YENYYPK+KKEIPK 
Sbjct  58   VRGYVWYSGAGKQIVSSTQLSNLNSILANPRVRRFFCSEAPKKRKYENYYPKDKKEIPKA  117

Query  444  NNQKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEF  623
            N  KSES +EDS     G  Q N LKQ+QN+IT LLF+ FV SSM  + + Q +ISFQEF
Sbjct  118  NESKSES-KEDSGGAGGGDSQ-NTLKQFQNIITPLLFLAFVYSSMFFNTQEQKQISFQEF  175

Query  624  KNKLLEPGLVDHIXVS  671
            KNKLLEPGLVD I VS
Sbjct  176  KNKLLEPGLVDRIVVS  191



>ref|XP_009345397.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Pyrus x bretschneideri]
Length=815

 Score =   150 bits (378),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 105/192 (55%), Positives = 138/192 (72%), Gaps = 4/192 (2%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVL-DELAAQSTCI--ARVEGGIGFVRSY  275
            M+ S I RS+++S+ S   R +ISG Y  R+ +L D     ST +  A V+ G+G +R Y
Sbjct  1    MIFSSIGRSITRSARSKFKRNVISGTYNRRSTLLHDSFPQLSTLLGNACVDCGVGILRRY  60

Query  276  LTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQK  455
            +   GAGK +I++AY+S+V S+F  PR+RRLF SQ P+KKNYENYYPKNKKEIPK   QK
Sbjct  61   IADNGAGKQLISKAYMSNVKSVFGIPRIRRLFSSQGPEKKNYENYYPKNKKEIPKGGEQK  120

Query  456  SESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFKNKL  635
            +ES +E SS+G QG+ Q  F KQ Q+LI  L+FI F+++S+ L+P    EISFQEFKNKL
Sbjct  121  TES-KEGSSAGGQGNAQGQFSKQIQDLIAPLMFICFIVTSLFLNPHQAKEISFQEFKNKL  179

Query  636  LEPGLVDHIXVS  671
            LEPGLVDHI V+
Sbjct  180  LEPGLVDHIEVA  191



>ref|XP_009338598.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Pyrus x bretschneideri]
 ref|XP_009338599.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Pyrus x bretschneideri]
Length=815

 Score =   149 bits (376),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 105/192 (55%), Positives = 136/192 (71%), Gaps = 4/192 (2%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVL-DELAAQSTCI--ARVEGGIGFVRSY  275
            M+ S I RS++ S+ S   R +ISG Y  R  +L D     ST +  A V+ G+G +R Y
Sbjct  1    MIFSSIGRSITHSARSKFKRNVISGTYNRRNTLLPDSFPQLSTLLGNACVDCGVGILRGY  60

Query  276  LTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQK  455
            +   GAGK +I++AY+S+V S+F  PR+RRLF SQ P+KKNYENYYPKNKKEIPK   QK
Sbjct  61   IADNGAGKQLISKAYMSNVKSVFGIPRIRRLFSSQGPEKKNYENYYPKNKKEIPKGGEQK  120

Query  456  SESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFKNKL  635
            +ES +E SS+G QG+ Q  F KQ Q+LI  L+FI F+++S+ L+P    EISFQEFKNKL
Sbjct  121  TES-KEGSSAGGQGNAQGQFSKQIQDLIAPLMFICFIVTSLFLNPHQAKEISFQEFKNKL  179

Query  636  LEPGLVDHIXVS  671
            LEPGLVDHI V+
Sbjct  180  LEPGLVDHIEVA  191



>ref|XP_008240759.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Prunus mume]
Length=816

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 100/190 (53%), Positives = 135/190 (71%), Gaps = 3/190 (2%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDE-LAAQSTCIARVEGGIGFVRSYLT  281
            M+ S I RS+S S+ S   R +ISG Y  RT  L E +   + CI+ V+G +G +R YLT
Sbjct  1    MVFSSIGRSLSHSARSKFKRNVISGTYNGRTTFLHETVPLGNACISGVDGELGLLRGYLT  60

Query  282  SVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKSE  461
              GAGK +++  YLS+  S  TNPR+RR F SQ  +KKNYENYYPKNKKEIPK + QKS 
Sbjct  61   YNGAGKQLVSNTYLSNFKSFLTNPRIRRFFSSQGHEKKNYENYYPKNKKEIPKGDGQKSG  120

Query  462  SGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFKNKLLE  641
            S +  S++G QG+P++ F+  +Q +I  ++F+GFV +S++L+P+   EISFQEFKNKLLE
Sbjct  121  S-KGGSNAGDQGNPRELFIPWHQ-IIGPIMFLGFVFTSLLLNPQQAKEISFQEFKNKLLE  178

Query  642  PGLVDHIXVS  671
            PGLVDHI V+
Sbjct  179  PGLVDHIEVA  188



>ref|XP_008369915.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Malus domestica]
Length=815

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 102/192 (53%), Positives = 135/192 (70%), Gaps = 4/192 (2%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVL-DELAAQSTCIAR--VEGGIGFVRSY  275
            M+ S I R ++ S+ S   R +ISG Y  R  +L D     ST +    V+GG+G ++ Y
Sbjct  1    MIFSSIGRWITHSARSKFKRNVISGTYNRRNTLLHDSFPQLSTLLGNECVDGGVGILKGY  60

Query  276  LTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQK  455
            +   GAGK +I++AY+S+V S+F  PR+RRLF SQ P+KKNYENYYPKNKKEIPK   QK
Sbjct  61   IAYNGAGKRLISKAYMSNVKSVFGIPRIRRLFSSQGPEKKNYENYYPKNKKEIPKGGEQK  120

Query  456  SESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFKNKL  635
            +ES +E SS+G QG+ Q  F KQ Q+L+  L+FI F+++S+ L+P    EISFQEFKNKL
Sbjct  121  TES-KEGSSAGGQGNAQGQFSKQIQDLLAPLMFICFIVTSLFLNPHQAKEISFQEFKNKL  179

Query  636  LEPGLVDHIXVS  671
            LEPGLVDHI V+
Sbjct  180  LEPGLVDHIEVA  191



>ref|XP_009416148.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
[Musa acuminata subsp. malaccensis]
Length=809

 Score =   140 bits (352),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 98/190 (52%), Positives = 126/190 (66%), Gaps = 2/190 (1%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDELAAQSTCIAR-VEGGIGFVRSYLT  281
            M  S + RS+ +S+ S   +G +SGGYG R  +  E+  Q  CI R +  G+G +R Y T
Sbjct  1    MNFSGLGRSLLRSARSRSPKGALSGGYGARPVISSEVLLQKPCIGRDITAGVGLLRGYFT  60

Query  282  SVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKSE  461
            SVGA K I   ++LS    +  NP  RR F S +PKKKNYENYYP++KKEIPK ++ KS+
Sbjct  61   SVGANKAIGVGSHLSHWRFLLANPNFRRFFSSGSPKKKNYENYYPRDKKEIPKDSSNKSD  120

Query  462  SGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFKNKLLE  641
            S + DSS+   G+ Q+NF+KQ QN I  L+FIG +LSS       Q EISFQEF+NKLLE
Sbjct  121  S-KGDSSTEDHGNFQENFMKQLQNYIAPLIFIGLLLSSFSAGTSDQKEISFQEFRNKLLE  179

Query  642  PGLVDHIXVS  671
            PGLVDHI VS
Sbjct  180  PGLVDHIVVS  189



>ref|XP_008777193.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X1 [Phoenix dactylifera]
Length=822

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 93/189 (49%), Positives = 121/189 (64%), Gaps = 0/189 (0%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYLTS  284
            M  S + RS+ +S+ S   R  + GG+G R+ VL+E   QS C     GG+ F+R YLTS
Sbjct  1    MSFSSLGRSLVRSARSRSQRAALLGGFGARSGVLNETLLQSPCFRGGNGGLEFLRGYLTS  60

Query  285  VGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKSES  464
            +GA K +     L D   +  NP  +R F S++P+KKNYENYYPKNKKEIPK +      
Sbjct  61   IGASKAVGAGNRLCDWRFLLANPSFKRFFSSESPRKKNYENYYPKNKKEIPKGDGNNKSD  120

Query  465  GREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFKNKLLEP  644
             +EDSS+   G+ Q+NF+KQ Q+ +  L+FIG +LSS       Q EISFQEF+NKLLEP
Sbjct  121  SKEDSSADDHGNFQENFMKQLQSFLAPLIFIGLLLSSFSTGSFDQKEISFQEFRNKLLEP  180

Query  645  GLVDHIXVS  671
            GLVDHI VS
Sbjct  181  GLVDHIVVS  189



>ref|XP_007026989.1| Cell division protease ftsH isoform 1 [Theobroma cacao]
 gb|EOY07491.1| Cell division protease ftsH isoform 1 [Theobroma cacao]
Length=817

 Score =   136 bits (343),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 99/194 (51%), Positives = 125/194 (64%), Gaps = 13/194 (7%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPST-----VNRGLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVR  269
            M+ SRI R+VS+SS S      ++R L+S    V T V       + CI+RV  G+G VR
Sbjct  1    MIFSRIGRTVSRSSRSAFRTNVISRNLLSNESHVSTPV------GNACISRVNQGLGIVR  54

Query  270  SYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNN  449
             Y    G GK +++ A LS++DSI  NPR+RR F S+  KK  YENYYPKNKKEIPK N 
Sbjct  55   GYFAPAGTGKHLVSNARLSNLDSILANPRIRRFFSSEGSKKSRYENYYPKNKKEIPKANE  114

Query  450  QKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFKN  629
            QKS+S +EDS +G  G+ Q N  K  QN+IT LL  G + +S+   P  Q +ISFQEFKN
Sbjct  115  QKSQS-KEDSGAGDPGNSQ-NIAKLMQNVITPLLLFGILYTSIFSGPHEQKQISFQEFKN  172

Query  630  KLLEPGLVDHIXVS  671
            KLLEPGLV+ I VS
Sbjct  173  KLLEPGLVEKIVVS  186



>ref|XP_007026990.1| Cell division protease ftsH isoform 2 [Theobroma cacao]
 gb|EOY07492.1| Cell division protease ftsH isoform 2 [Theobroma cacao]
Length=637

 Score =   135 bits (339),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 99/194 (51%), Positives = 125/194 (64%), Gaps = 13/194 (7%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPST-----VNRGLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVR  269
            M+ SRI R+VS+SS S      ++R L+S    V T V       + CI+RV  G+G VR
Sbjct  1    MIFSRIGRTVSRSSRSAFRTNVISRNLLSNESHVSTPV------GNACISRVNQGLGIVR  54

Query  270  SYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNN  449
             Y    G GK +++ A LS++DSI  NPR+RR F S+  KK  YENYYPKNKKEIPK N 
Sbjct  55   GYFAPAGTGKHLVSNARLSNLDSILANPRIRRFFSSEGSKKSRYENYYPKNKKEIPKANE  114

Query  450  QKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFKN  629
            QKS+S +EDS +G  G+ Q N  K  QN+IT LL  G + +S+   P  Q +ISFQEFKN
Sbjct  115  QKSQS-KEDSGAGDPGNSQ-NIAKLMQNVITPLLLFGILYTSIFSGPHEQKQISFQEFKN  172

Query  630  KLLEPGLVDHIXVS  671
            KLLEPGLV+ I VS
Sbjct  173  KLLEPGLVEKIVVS  186



>ref|XP_010043509.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Eucalyptus grandis]
 gb|KCW85526.1| hypothetical protein EUGRSUZ_B02323 [Eucalyptus grandis]
Length=816

 Score =   136 bits (342),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 83/147 (56%), Positives = 104/147 (71%), Gaps = 4/147 (3%)
 Frame = +3

Query  231  CIARVEGGIGFVRSYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyeny  410
             +  ++G +GFVR YL S GA KG   ++YLSD++ +  NPR+ R F S+APKKKNYENY
Sbjct  43   ALGGLDGKLGFVREYLASAGAIKGFSAKSYLSDLNRVLANPRVHRFFSSEAPKKKNYENY  102

Query  411  ypknkkeIPKTNNQKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSP  590
             PK +KE+PK N QKSES  + ++       Q+ F+KQ+QNLIT L+ IG  LSS    P
Sbjct  103  CPKGRKEVPKGNEQKSESKGDSNTDDN----QETFMKQFQNLITPLIVIGLFLSSFSFGP  158

Query  591  RTQNEISFQEFKNKLLEPGLVDHIXVS  671
            R Q +ISFQEFKNKLLEPGLVDHI VS
Sbjct  159  REQQQISFQEFKNKLLEPGLVDHIVVS  185



>ref|XP_010256889.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Nelumbo nucifera]
Length=820

 Score =   134 bits (338),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 97/193 (50%), Positives = 130/193 (67%), Gaps = 8/193 (4%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDELAAQSTCIARVEGG----IGFVRS  272
            M+ S++ RS+S+S+ S   R  + G YG R+  L+E   +S       GG    +G +R 
Sbjct  1    MIFSKLGRSLSRSAAS---RNGLLGAYGRRSAFLNESLLRSPHGDAFPGGEHSRLGSLRC  57

Query  273  YLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQ  452
            YL S+G  K   ++ Y  D +++  +PRL R F ++APKKKNYEN+YPKNKKEIPK NNQ
Sbjct  58   YLISIGTNKEFASKRYSLDFNALLASPRLHRFFSNEAPKKKNYENFYPKNKKEIPKGNNQ  117

Query  453  KSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFKNK  632
            K+ES +E+S++  QG+ Q+NF+KQ QN +T L+FI  VLSS       Q +ISFQEFKNK
Sbjct  118  KTES-KEESNTENQGNFQENFMKQLQNYLTPLMFIALVLSSFSFGSHDQKQISFQEFKNK  176

Query  633  LLEPGLVDHIXVS  671
            LLEPGLVDHI VS
Sbjct  177  LLEPGLVDHIVVS  189



>ref|XP_004143122.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Cucumis sativus]
 ref|XP_004163225.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent zinc metalloprotease 
FTSH 10, mitochondrial-like [Cucumis sativus]
 gb|KGN47136.1| hypothetical protein Csa_6G190270 [Cucumis sativus]
Length=818

 Score =   133 bits (335),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 95/193 (49%), Positives = 128/193 (66%), Gaps = 8/193 (4%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDE--LAAQ--STCIARVEGGIGFVRS  272
            M+ SR+ RS+ +SS +   + L  GG     K ++E   AA    +C+   +G +GF+R 
Sbjct  1    MIFSRLTRSLPRSSRT---QNLFYGGGRSAIKTINEPIFAAPRVDSCVGERDGMLGFLRG  57

Query  273  YLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQ  452
            Y    G+   +I +  LSD + +  NP+LRR F S+APKKKNY+N+YPK KKEIPK N Q
Sbjct  58   YFAFSGSRTKLIPKEILSDFNFLIANPKLRRFFSSEAPKKKNYQNFYPKEKKEIPKGNEQ  117

Query  453  KSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFKNK  632
            KSES + DS++  QGS Q+ F+KQ+QN++T L+ IG + SS    PR Q +ISFQEFKNK
Sbjct  118  KSES-KGDSNTEDQGSFQEAFIKQFQNIVTPLIVIGLLFSSFSFGPREQQQISFQEFKNK  176

Query  633  LLEPGLVDHIXVS  671
             LEPGLVDHI VS
Sbjct  177  YLEPGLVDHIVVS  189



>ref|XP_011089809.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Sesamum indicum]
Length=826

 Score =   132 bits (333),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 95/196 (48%), Positives = 128/196 (65%), Gaps = 11/196 (6%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDE-------LAAQSTCIARVEGGIGF  263
            M+ SRI  S+++SS    N   I+G    R+   ++       + + S  + + EG +GF
Sbjct  1    MIFSRIRTSLTRSSRFRNN---INGASKGRSFAWNKENIGSPNVNSTSGSVNQFEGNLGF  57

Query  264  VRSYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKT  443
            +R YLTSVG GKG + R YLSD      NPR+RR + S+APKKKNYEN+YPK+KKE P  
Sbjct  58   LRGYLTSVGGGKGSVPRGYLSDFSYFAANPRIRRFYSSEAPKKKNYENFYPKDKKENPNK  117

Query  444  NNQKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEF  623
            N+QKS S +E+ ++   G+  + F+K  QN++T LL IG  LS+   SPR + +ISFQEF
Sbjct  118  NDQKSGS-KEEGNTDDHGNFHETFIKNLQNIVTPLLVIGLFLSAFSSSPREEKQISFQEF  176

Query  624  KNKLLEPGLVDHIXVS  671
            KNKLLEPGLVDHI VS
Sbjct  177  KNKLLEPGLVDHIVVS  192



>ref|XP_010920548.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
[Elaeis guineensis]
Length=819

 Score =   132 bits (332),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 93/189 (49%), Positives = 122/189 (65%), Gaps = 0/189 (0%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYLTS  284
            M+ SR+ +S+S+SS S    G   GG  VR+    E   QS       GG+GF+RSYLTS
Sbjct  1    MIFSRLGQSLSRSSRSLYEAGAFLGGSVVRSGCSKEAVLQSPSFRGGSGGLGFLRSYLTS  60

Query  285  VGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKSES  464
            +GA K I  + Y +D   +  NP  RRLF S++P KKNYENY+PK++KEIPK N      
Sbjct  61   IGANKAIGAKKYQADWRFLLANPSFRRLFSSESPDKKNYENYHPKDRKEIPKGNENNKSD  120

Query  465  GREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFKNKLLEP  644
             +E+S++  Q + Q+NF+KQ Q+ +  +LF+G +LSS       Q EISFQEFKNKLLEP
Sbjct  121  SKENSNTEDQANFQENFMKQLQSYLAPILFMGLLLSSFSFGSFDQKEISFQEFKNKLLEP  180

Query  645  GLVDHIXVS  671
            GLVDHI VS
Sbjct  181  GLVDHIVVS  189



>ref|XP_010685724.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Beta vulgaris subsp. vulgaris]
Length=819

 Score =   132 bits (332),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 95/175 (54%), Positives = 121/175 (69%), Gaps = 9/175 (5%)
 Frame = +3

Query  162  RGLISGGYGVRTKVLDELAAQSTCIA----RVEGGIGFVRSYLTSVGAGKGIINRAYLSD  329
            R LI+G Y  R  +LDE   +++ +     + +  +GF+RSYL S+GA     N+ YLSD
Sbjct  17   RNLINGCYKGRPVLLDESLLRASYVNSSANQFDSNLGFLRSYLGSIGAQ----NKDYLSD  72

Query  330  VDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKSESGRE-DsssgqqgsPQ  506
            V     NP   R F S+APKKKNYEN+YPK KKEIPKT+ QKSES  E +S++  QG+ Q
Sbjct  73   VKYALANPGFCRFFSSEAPKKKNYENFYPKEKKEIPKTDEQKSESKEESNSNTEDQGNFQ  132

Query  507  DNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFKNKLLEPGLVDHIXVS  671
            + F+KQ+Q+L+T LL IG  LS+   SPR Q +ISFQEFKNKLLEPGLVDHI VS
Sbjct  133  ETFMKQFQSLLTPLLMIGLFLSTFSFSPREQQQISFQEFKNKLLEPGLVDHIVVS  187



>ref|XP_010931243.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X1 [Elaeis guineensis]
Length=821

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 90/189 (48%), Positives = 121/189 (64%), Gaps = 0/189 (0%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYLTS  284
            M  S + RS+ +S+ S   R  + GG+G R++VL+E   QS C     GG+ F+R YLTS
Sbjct  1    MNFSSLGRSLVRSARSRSQRVALLGGFGARSRVLNETLLQSPCFRGDNGGLEFLRGYLTS  60

Query  285  VGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKSES  464
            +GA K +     L D   +  NP  +R F S++P+KKNYENYYPKNKKE PK +      
Sbjct  61   IGASKAVGAGNRLYDWRFLLANPSFKRFFSSESPRKKNYENYYPKNKKENPKGDGNNKSD  120

Query  465  GREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFKNKLLEP  644
             +E+S++   G+ Q+NF+KQ Q+ +  L+FIG +LSS       Q EISFQEF+NKLLEP
Sbjct  121  SKENSNADDHGNFQENFMKQLQSFLAPLIFIGLLLSSFSTGSFDQKEISFQEFRNKLLEP  180

Query  645  GLVDHIXVS  671
            GLVDHI VS
Sbjct  181  GLVDHIVVS  189



>ref|XP_008464106.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial 
[Cucumis melo]
Length=818

 Score =   131 bits (329),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 107/149 (72%), Gaps = 1/149 (1%)
 Frame = +3

Query  225  STCIARVEGGIGFVRSYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknye  404
             +C+A  EG +GF R Y   VG+    I +  LSD++ +  NP+LRR F S+APKKKNY+
Sbjct  42   DSCVAEREGLLGFFRGYFAFVGSRTKFIPKETLSDLNFLIANPKLRRFFSSEAPKKKNYQ  101

Query  405  nyypknkkeIPKTNNQKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVL  584
            N+YPK KKEIPK N QKSES + DS++  QGS Q+ F+KQ+QNL+T L+ IG + SS   
Sbjct  102  NFYPKEKKEIPKGNEQKSES-KGDSNTEDQGSFQEAFIKQFQNLVTPLIVIGLLFSSFSF  160

Query  585  SPRTQNEISFQEFKNKLLEPGLVDHIXVS  671
             PR Q +ISFQEFKNK LEPGLVDHI VS
Sbjct  161  GPREQQQISFQEFKNKYLEPGLVDHIVVS  189



>gb|KCW85528.1| hypothetical protein EUGRSUZ_B02325 [Eucalyptus grandis]
Length=816

 Score =   130 bits (327),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 99/137 (72%), Gaps = 4/137 (3%)
 Frame = +3

Query  261  FVRSYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPK  440
            FVR YL S GA KG   ++YLSD++ +  NPR+ R F S+APKKKNYENYYPK +KE+PK
Sbjct  53   FVREYLASAGAIKGFSAKSYLSDLNRVLANPRVHRFFSSEAPKKKNYENYYPKGRKEVPK  112

Query  441  TNNQKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQE  620
             N QKSES  + ++       Q+ F+KQ+QNLIT L+ IG  LSS    PR Q +ISFQE
Sbjct  113  GNEQKSESKGDSNTDDN----QETFMKQFQNLITPLVVIGLFLSSFSFGPREQQQISFQE  168

Query  621  FKNKLLEPGLVDHIXVS  671
            FKNKLLEPGLVDHI +S
Sbjct  169  FKNKLLEPGLVDHIVIS  185



>ref|XP_010043511.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X1 [Eucalyptus grandis]
Length=847

 Score =   130 bits (327),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 99/137 (72%), Gaps = 4/137 (3%)
 Frame = +3

Query  261  FVRSYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPK  440
            FVR YL S GA KG   ++YLSD++ +  NPR+ R F S+APKKKNYENYYPK +KE+PK
Sbjct  84   FVREYLASAGAIKGFSAKSYLSDLNRVLANPRVHRFFSSEAPKKKNYENYYPKGRKEVPK  143

Query  441  TNNQKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQE  620
             N QKSES  + ++       Q+ F+KQ+QNLIT L+ IG  LSS    PR Q +ISFQE
Sbjct  144  GNEQKSESKGDSNTDDN----QETFMKQFQNLITPLVVIGLFLSSFSFGPREQQQISFQE  199

Query  621  FKNKLLEPGLVDHIXVS  671
            FKNKLLEPGLVDHI +S
Sbjct  200  FKNKLLEPGLVDHIVIS  216



>ref|XP_010931244.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X2 [Elaeis guineensis]
Length=816

 Score =   129 bits (324),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 88/189 (47%), Positives = 117/189 (62%), Gaps = 5/189 (3%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYLTS  284
            M  S + RS+ +S+ S   R  + GG+G R++VL+E   QS C     GG+ F+R YLTS
Sbjct  1    MNFSSLGRSLVRSARSRSQRVALLGGFGARSRVLNETLLQSPCFRGDNGGLEFLRGYLTS  60

Query  285  VGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKSES  464
            +GA K +     L D   +  NP  +R F S++P+KKNYENYYPKNKKE PK +      
Sbjct  61   IGASKAVGAGNRLYDWRFLLANPSFKRFFSSESPRKKNYENYYPKNKKENPKGDGNNKSD  120

Query  465  GREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFKNKLLEP  644
             ++D  +      Q+NF+KQ Q+ +  L+FIG +LSS       Q EISFQEF+NKLLEP
Sbjct  121  SKDDHGNF-----QENFMKQLQSFLAPLIFIGLLLSSFSTGSFDQKEISFQEFRNKLLEP  175

Query  645  GLVDHIXVS  671
            GLVDHI VS
Sbjct  176  GLVDHIVVS  184



>ref|XP_010475512.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial 
isoform X2 [Camelina sativa]
Length=813

 Score =   128 bits (322),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 97/194 (50%), Positives = 129/194 (66%), Gaps = 14/194 (7%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDE--LAAQSTCIA---RVEGGIGFVR  269
            M+ S++  S+++SS S   +G + GG GVR+ +L E  L A S   A   +V GG+GF+R
Sbjct  1    MIFSKLGSSIARSSRS---KGFVYGG-GVRSAILSEGRLRAPSNLEAAANQVNGGLGFLR  56

Query  270  SYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNN  449
             +  S+ A KG+ +R+   D+  +F NP LRR F SQ PKKKNYENYYPK+ K+ PK N 
Sbjct  57   RHFASLAARKGV-DRS--GDLSRVFANPSLRRFFSSQTPKKKNYENYYPKDTKQAPK-NE  112

Query  450  QKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFKN  629
            QKSES RE S   +  +  D F K++QN++  L+ I F+LS+  L  R Q +ISFQEFKN
Sbjct  113  QKSES-REGSKKAKNENVGDMFTKEFQNMLIPLMAIAFILSTFSLGSRDQQQISFQEFKN  171

Query  630  KLLEPGLVDHIXVS  671
            KLLEPGLVDHI VS
Sbjct  172  KLLEPGLVDHIDVS  185



>ref|XP_010475511.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial 
isoform X1 [Camelina sativa]
Length=815

 Score =   128 bits (322),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 97/195 (50%), Positives = 129/195 (66%), Gaps = 14/195 (7%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDE--LAAQSTCIA---RVEGGIGFVR  269
            M+ S++  S+++SS S   +G + GG GVR+ +L E  L A S   A   +V GG+GF+R
Sbjct  1    MIFSKLGSSIARSSRS---KGFVYGG-GVRSAILSEGRLRAPSNLEAAANQVNGGLGFLR  56

Query  270  SYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNN  449
             +  S+ A KG+ +R+   D+  +F NP LRR F SQ PKKKNYENYYPK+ K+ PK N 
Sbjct  57   RHFASLAARKGV-DRS--GDLSRVFANPSLRRFFSSQTPKKKNYENYYPKDTKQAPK-NE  112

Query  450  QKSES-GREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFK  626
            QKSES G E S   +  +  D F K++QN++  L+ I F+LS+  L  R Q +ISFQEFK
Sbjct  113  QKSESRGEEGSKKAKNENVGDMFTKEFQNMLIPLMAIAFILSTFSLGSRDQQQISFQEFK  172

Query  627  NKLLEPGLVDHIXVS  671
            NKLLEPGLVDHI VS
Sbjct  173  NKLLEPGLVDHIDVS  187



>gb|KJB55847.1| hypothetical protein B456_009G097900 [Gossypium raimondii]
Length=785

 Score =   128 bits (321),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 86/151 (57%), Positives = 110/151 (73%), Gaps = 6/151 (4%)
 Frame = +3

Query  225  STCIARVEGGIGFVRSYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknye  404
            S  + R+ G  G++R YL S+GAGK   ++AYLSD++ +  NPR+RR F S+APKKKNYE
Sbjct  39   SGSVDRIIGQSGYLRGYLASIGAGKEFTSKAYLSDLNFVLANPRIRRFFSSEAPKKKNYE  98

Query  405  nyypknkkeIPKTNNQKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVL  584
            N+YPK KKEIPK N+QK +S +EDS +  Q + Q+ FLK +QNL+T LL +   LS   +
Sbjct  99   NFYPKEKKEIPKQNDQKPDS-KEDSKTDDQWNFQETFLKLFQNLVTPLLVLALFLS---M  154

Query  585  SPRT--QNEISFQEFKNKLLEPGLVDHIXVS  671
            SP T  Q +ISFQEFKNK LEPGLVDHI VS
Sbjct  155  SPWTVEQQQISFQEFKNKFLEPGLVDHIVVS  185



>gb|KJB55846.1| hypothetical protein B456_009G097900 [Gossypium raimondii]
Length=816

 Score =   128 bits (321),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 86/151 (57%), Positives = 110/151 (73%), Gaps = 6/151 (4%)
 Frame = +3

Query  225  STCIARVEGGIGFVRSYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknye  404
            S  + R+ G  G++R YL S+GAGK   ++AYLSD++ +  NPR+RR F S+APKKKNYE
Sbjct  40   SGSVDRIIGQSGYLRGYLASIGAGKEFTSKAYLSDLNFVLANPRIRRFFSSEAPKKKNYE  99

Query  405  nyypknkkeIPKTNNQKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVL  584
            N+YPK KKEIPK N+QK +S +EDS +  Q + Q+ FLK +QNL+T LL +   LS   +
Sbjct  100  NFYPKEKKEIPKQNDQKPDS-KEDSKTDDQWNFQETFLKLFQNLVTPLLVLALFLS---M  155

Query  585  SPRT--QNEISFQEFKNKLLEPGLVDHIXVS  671
            SP T  Q +ISFQEFKNK LEPGLVDHI VS
Sbjct  156  SPWTVEQQQISFQEFKNKFLEPGLVDHIVVS  186



>gb|KCW85527.1| hypothetical protein EUGRSUZ_B02324 [Eucalyptus grandis]
Length=799

 Score =   127 bits (320),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 102/147 (69%), Gaps = 4/147 (3%)
 Frame = +3

Query  231  CIARVEGGIGFVRSYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyeny  410
             +  ++G +GFVR YL S GA K    ++YLS ++ +  NPR+ R F S+ PKKKNYEN+
Sbjct  29   ALGGLDGKLGFVREYLASAGAIKAFSAKSYLSHLNRVLANPRVHRFFSSEVPKKKNYENF  88

Query  411  ypknkkeIPKTNNQKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSP  590
            YPK +KE+PK + QKSES  + ++       Q+ F+KQ+QNLIT L+ IG  LSS    P
Sbjct  89   YPKGRKEVPKGDKQKSESKGDSNTDDN----QETFMKQFQNLITPLVVIGLFLSSFSFGP  144

Query  591  RTQNEISFQEFKNKLLEPGLVDHIXVS  671
            R Q +ISFQEFKNKLLEPGLVDHI VS
Sbjct  145  REQQQISFQEFKNKLLEPGLVDHIVVS  171



>gb|KFK43073.1| hypothetical protein AALP_AA1G075200 [Arabis alpina]
Length=814

 Score =   127 bits (320),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 94/190 (49%), Positives = 128/190 (67%), Gaps = 11/190 (6%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDELAAQST-CIARVEGGIGFVRSYLT  281
            M+ S++  S+++SS S   +GL+ GG GVR+ +L E   Q+T  +   +GG+GF+R +  
Sbjct  1    MIFSKLGSSLARSSRS---KGLLYGG-GVRSAILSEGRFQTTPSLEAADGGLGFLRRHFA  56

Query  282  SVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKSE  461
            S+ + KG+ +     D+  +F NPRLRRLFCS+ PKKKNYENYYPK+ K+ PK N QKSE
Sbjct  57   SLVSRKGLDS----GDLSRVFVNPRLRRLFCSETPKKKNYENYYPKDAKQTPK-NEQKSE  111

Query  462  SGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFKNKLLE  641
            SG E S   +  +  D F K++ N++  ++ I  +LSS  L  R Q EISFQEFKNKLLE
Sbjct  112  SG-EGSKKSENENVGDMFTKEFHNILIPVVAIVLILSSFGLGSREQQEISFQEFKNKLLE  170

Query  642  PGLVDHIXVS  671
            PGLVDHI VS
Sbjct  171  PGLVDHIDVS  180



>ref|XP_010043510.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Eucalyptus grandis]
Length=813

 Score =   127 bits (320),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 102/147 (69%), Gaps = 4/147 (3%)
 Frame = +3

Query  231  CIARVEGGIGFVRSYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyeny  410
             +  ++G +GFVR YL S GA K    ++YLS ++ +  NPR+ R F S+ PKKKNYEN+
Sbjct  43   ALGGLDGKLGFVREYLASAGAIKAFSAKSYLSHLNRVLANPRVHRFFSSEVPKKKNYENF  102

Query  411  ypknkkeIPKTNNQKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSP  590
            YPK +KE+PK + QKSES  + ++       Q+ F+KQ+QNLIT L+ IG  LSS    P
Sbjct  103  YPKGRKEVPKGDKQKSESKGDSNTDDN----QETFMKQFQNLITPLVVIGLFLSSFSFGP  158

Query  591  RTQNEISFQEFKNKLLEPGLVDHIXVS  671
            R Q +ISFQEFKNKLLEPGLVDHI VS
Sbjct  159  REQQQISFQEFKNKLLEPGLVDHIVVS  185



>ref|XP_007208082.1| hypothetical protein PRUPE_ppa001525mg [Prunus persica]
 gb|EMJ09281.1| hypothetical protein PRUPE_ppa001525mg [Prunus persica]
Length=808

 Score =   127 bits (320),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 94/189 (50%), Positives = 130/189 (69%), Gaps = 9/189 (5%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYLTS  284
            M+ S I RS+S S+ S   R +IS     +T  L+  +   +C   V+G +G +R YLT 
Sbjct  1    MVFSSIGRSLSHSARSKFKRVIIS----QKTLFLNLFSKFISC---VDGELGLLRGYLTY  53

Query  285  VGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKSES  464
             GAGK +++  YLS+  S   NPR+RR F S+  +KKNYENYYPKNKKEIPK + QKS S
Sbjct  54   NGAGKQLVSNTYLSNFKSFLANPRIRRFFSSRGHEKKNYENYYPKNKKEIPKGDGQKSGS  113

Query  465  GREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFKNKLLEP  644
             +E S++G QG+P++ F+  +Q +I  ++F GFV +S++L+P+   EISFQEFKNKLLEP
Sbjct  114  -KEGSNAGDQGNPREFFIPWHQ-IIGPIMFFGFVFTSVLLNPQQAKEISFQEFKNKLLEP  171

Query  645  GLVDHIXVS  671
            GLVDHI V+
Sbjct  172  GLVDHIEVA  180



>ref|XP_010521865.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial 
isoform X1 [Tarenaya hassleriana]
Length=809

 Score =   127 bits (319),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 91/194 (47%), Positives = 126/194 (65%), Gaps = 15/194 (8%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDELAAQ-----STCIARVEGGIGFVR  269
            M+ S++ARS ++SSPS   RG +  G GVR+ +L+E+  Q        + +V+GG+ F+R
Sbjct  1    MIFSKLARSAARSSPS---RGSLYSG-GVRSAILNEVKLQQLPGLEVAVNQVDGGLVFLR  56

Query  270  SYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNN  449
                S+ + KG+I     SD+  +  NPR+RRLF S+APKKKNYENYY K  K+ PK N 
Sbjct  57   QQFASLASRKGLIT----SDLSGVLANPRIRRLFSSEAPKKKNYENYYAKEAKQTPK-NE  111

Query  450  QKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFKN  629
            QKSES +EDS   +  +  D F+K++QN++  LL IG +LSS       + +ISFQEF+N
Sbjct  112  QKSES-KEDSKKTEHENFGDMFMKKFQNMLIPLLAIGLILSSFSFDSVERQKISFQEFRN  170

Query  630  KLLEPGLVDHIXVS  671
            KLLEPGLVD I V 
Sbjct  171  KLLEPGLVDRIEVE  184



>ref|XP_007016370.1| FTSH protease 10 [Theobroma cacao]
 gb|EOY33989.1| FTSH protease 10 [Theobroma cacao]
Length=813

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 108/139 (78%), Gaps = 1/139 (1%)
 Frame = +3

Query  255  IGFVRSYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeI  434
            +GF+R YLTS+GA K   ++AYLSD++ +  NPR+ R F S+APKKKNYEN++PK KKEI
Sbjct  47   LGFLRGYLTSIGAPKEFNSKAYLSDLNFVLANPRISRFFSSEAPKKKNYENFHPKEKKEI  106

Query  435  PKTNNQKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISF  614
            PK N+QKS+S +E+S++  QG+ Q+ FLK +QNLI+ LL I  +LS   LS   Q +ISF
Sbjct  107  PKQNDQKSDS-KENSNTDDQGNFQEMFLKLFQNLISPLLVIALLLSYSPLSASEQQQISF  165

Query  615  QEFKNKLLEPGLVDHIXVS  671
            QEFKNKLLEPGLVDHI VS
Sbjct  166  QEFKNKLLEPGLVDHIVVS  184



>gb|KHG20351.1| ATP-dependent zinc metalloprotease FTSH 10, mitochondrial -like 
protein [Gossypium arboreum]
Length=816

 Score =   125 bits (315),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 97/193 (50%), Positives = 127/193 (66%), Gaps = 11/193 (6%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPSTVNRGLI--SGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYL  278
            M+ S++ RS  +SS S   R L+   GG  +       L   S  + R+ G  G++R YL
Sbjct  1    MIFSKLGRSAPRSSHS---RKLLYRGGGGAITGGTSPSLPLLSGSVDRIIGQSGYLRGYL  57

Query  279  TSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKS  458
              +GAGK   ++AYLSD++ +  NPR+RR F S+APKKKNYEN+YPK KKEIPK N+QK 
Sbjct  58   ALIGAGKEFTSKAYLSDLNFVLANPRIRRFFSSEAPKKKNYENFYPKEKKEIPKQNDQKP  117

Query  459  ESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRT--QNEISFQEFKNK  632
            +S +EDS +  Q + Q+ FLK +QNL+T LL +   LS   +SP T  Q +ISFQEFKNK
Sbjct  118  DS-KEDSKTDDQWNFQETFLKLFQNLVTPLLVLALFLS---MSPWTVEQQQISFQEFKNK  173

Query  633  LLEPGLVDHIXVS  671
             LEPGLVDHI VS
Sbjct  174  FLEPGLVDHIVVS  186



>ref|XP_010487550.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X2 [Camelina sativa]
Length=670

 Score =   124 bits (312),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 95/195 (49%), Positives = 127/195 (65%), Gaps = 14/195 (7%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDE--LAAQSTCIA---RVEGGIGFVR  269
            M+ S++  S+++SS S   +GL+ GG GVR+ +L E  L A     A   +V GG+GF+R
Sbjct  1    MIFSKLGSSIARSSRS---KGLVYGG-GVRSAILSEGRLRAPPNLEAAANQVSGGLGFLR  56

Query  270  SYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNN  449
             +  S+ A KG+       D+  +F NPRLRR F SQ PKKKN+ENYYPK++K+ PK N 
Sbjct  57   RHFASLAARKGLDAGG---DLSRVFANPRLRRFFSSQTPKKKNFENYYPKDRKQAPK-NE  112

Query  450  QKSES-GREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFK  626
            QKSES G E S   +  +  D F  ++QN++  L+ I F+LS+  L  R Q +ISFQEFK
Sbjct  113  QKSESRGEEGSKKTENENVGDMFTIEFQNMLIPLMAIAFILSTFSLGSRDQQQISFQEFK  172

Query  627  NKLLEPGLVDHIXVS  671
            NKLLEPGLVDHI VS
Sbjct  173  NKLLEPGLVDHIYVS  187



>ref|XP_010262544.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Nelumbo nucifera]
Length=821

 Score =   125 bits (314),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 94/195 (48%), Positives = 128/195 (66%), Gaps = 10/195 (5%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDELAAQS-----TCIARVEGGIGFVR  269
            M+ S++ RS+S+S+ S   R    G YG R  +L++   +S     +C+      +G +R
Sbjct  1    MIFSKLRRSLSRSAGS---RNGYLGAYGRRFALLNDSLLRSPPHRDSCLGGEHSRLGSLR  57

Query  270  SYLTSVGAGKGIINRAYLS-DVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTN  446
             YL S GA K   ++   S D + +  NPR  R F ++ PKKKNYEN+YPK+KKEIPK N
Sbjct  58   GYLASFGANKEFGSKRSSSLDFNFLLANPRFHRFFSNEVPKKKNYENFYPKDKKEIPKGN  117

Query  447  NQKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFK  626
            NQK+ES +E+S++  QG+ Q+NF+KQ QN +T L+FI  +LSS    P  Q +ISFQEFK
Sbjct  118  NQKTES-KEESNTEDQGNFQENFMKQLQNYLTPLIFIALLLSSFSFGPHDQKQISFQEFK  176

Query  627  NKLLEPGLVDHIXVS  671
            NKLLEPGLVDHI VS
Sbjct  177  NKLLEPGLVDHIVVS  191



>ref|XP_008784613.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
[Phoenix dactylifera]
Length=817

 Score =   125 bits (314),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 85/169 (50%), Positives = 109/169 (64%), Gaps = 0/169 (0%)
 Frame = +3

Query  165  GLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYLTSVGAGKGIINRAYLSDVDSIF  344
            G   GGY VR+    E   QS       GG+GF+RSYLTSVGA K I  + Y +D   + 
Sbjct  21   GAFLGGYVVRSGCSKEALLQSPGFRGDNGGLGFMRSYLTSVGANKAIGAKNYQADWRFLL  80

Query  345  TNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKSESGREDsssgqqgsPQDNFLKQ  524
             +P  RR F S++P KKNYENY PK++KEIPK N       +++S++  QG+ Q+NF+KQ
Sbjct  81   ASPSFRRFFSSESPNKKNYENYQPKDRKEIPKGNETNKSDSKDNSNTEDQGNFQENFIKQ  140

Query  525  YQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFKNKLLEPGLVDHIXVS  671
             Q+ +  +LF+G +LSS       Q EISFQEFKNKLLEPGLVDHI VS
Sbjct  141  LQSYLVPILFMGLLLSSFSFGSFDQKEISFQEFKNKLLEPGLVDHIVVS  189



>ref|XP_010487557.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X3 [Camelina sativa]
Length=815

 Score =   125 bits (313),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 95/195 (49%), Positives = 127/195 (65%), Gaps = 14/195 (7%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDE--LAAQSTCIA---RVEGGIGFVR  269
            M+ S++  S+++SS S   +GL+ GG GVR+ +L E  L A     A   +V GG+GF+R
Sbjct  1    MIFSKLGSSIARSSRS---KGLVYGG-GVRSAILSEGRLRAPPNLEAAANQVSGGLGFLR  56

Query  270  SYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNN  449
             +  S+ A KG+       D+  +F NPRLRR F SQ PKKKN+ENYYPK++K+ PK N 
Sbjct  57   RHFASLAARKGLDAGG---DLSRVFANPRLRRFFSSQTPKKKNFENYYPKDRKQAPK-NE  112

Query  450  QKSES-GREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFK  626
            QKSES G E S   +  +  D F  ++QN++  L+ I F+LS+  L  R Q +ISFQEFK
Sbjct  113  QKSESRGEEGSKKTENENVGDMFTIEFQNMLIPLMAIAFILSTFSLGSRDQQQISFQEFK  172

Query  627  NKLLEPGLVDHIXVS  671
            NKLLEPGLVDHI VS
Sbjct  173  NKLLEPGLVDHIYVS  187



>ref|XP_010487541.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X1 [Camelina sativa]
Length=815

 Score =   125 bits (313),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 95/195 (49%), Positives = 127/195 (65%), Gaps = 14/195 (7%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDE--LAAQSTCIA---RVEGGIGFVR  269
            M+ S++  S+++SS S   +GL+ GG GVR+ +L E  L A     A   +V GG+GF+R
Sbjct  1    MIFSKLGSSIARSSRS---KGLVYGG-GVRSAILSEGRLRAPPNLEAAANQVSGGLGFLR  56

Query  270  SYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNN  449
             +  S+ A KG+       D+  +F NPRLRR F SQ PKKKN+ENYYPK++K+ PK N 
Sbjct  57   RHFASLAARKGLDAGG---DLSRVFANPRLRRFFSSQTPKKKNFENYYPKDRKQAPK-NE  112

Query  450  QKSES-GREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFK  626
            QKSES G E S   +  +  D F  ++QN++  L+ I F+LS+  L  R Q +ISFQEFK
Sbjct  113  QKSESRGEEGSKKTENENVGDMFTIEFQNMLIPLMAIAFILSTFSLGSRDQQQISFQEFK  172

Query  627  NKLLEPGLVDHIXVS  671
            NKLLEPGLVDHI VS
Sbjct  173  NKLLEPGLVDHIYVS  187



>ref|XP_002889652.1| FTSH10 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65911.1| FTSH10 [Arabidopsis lyrata subsp. lyrata]
Length=813

 Score =   124 bits (312),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 92/194 (47%), Positives = 129/194 (66%), Gaps = 15/194 (8%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDE---LAAQS--TCIARVEGGIGFVR  269
            M+ S++  S+++SS S   +GL+ GG GVR+ +L++    A Q+    + +V+GG+GF+R
Sbjct  1    MIFSKLGSSLARSSRS---KGLVYGG-GVRSAILNQGRLRAPQNLEAAVNQVDGGLGFLR  56

Query  270  SYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNN  449
             +  S+ A KG+       D+  +F NPRLRR F SQ+PKK+NYENYYPK+ K+ PK N 
Sbjct  57   RHFASLAARKGLDT----GDLSRVFANPRLRRFFSSQSPKKRNYENYYPKDSKKAPK-NE  111

Query  450  QKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFKN  629
            QKS+SG E S   +  +  D F K+ QN++  L+ I  +LS+  L  R Q +ISFQEFKN
Sbjct  112  QKSQSG-EGSKKNENENVGDMFTKESQNMLIPLMAIALILSTFSLGSREQQQISFQEFKN  170

Query  630  KLLEPGLVDHIXVS  671
            KLLEPGLVDHI VS
Sbjct  171  KLLEPGLVDHIDVS  184



>gb|KJB16965.1| hypothetical protein B456_002G257200 [Gossypium raimondii]
Length=782

 Score =   123 bits (308),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 106/149 (71%), Gaps = 3/149 (2%)
 Frame = +3

Query  225  STCIARVEGGIGFVRSYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknye  404
            +TCI+RV  G+G VR Y    G GK +     LS++DSI  NPR+RR FCS+ PKK+NYE
Sbjct  40   NTCISRVNKGLGLVRGYFAPAGVGKQLSTNTRLSNLDSILANPRIRRFFCSEGPKKRNYE  99

Query  405  nyypknkkeIPKTNNQKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVL  584
            NY+PKNKK+IPK N QKS S +EDS +G+ G+ Q N  +  QN++T+LL +G   SS+  
Sbjct  100  NYFPKNKKDIPKANEQKSGS-KEDSGAGEPGNSQ-NIQRLVQNIVTTLLLVGITYSSLS-  156

Query  585  SPRTQNEISFQEFKNKLLEPGLVDHIXVS  671
             P  Q EISFQEFKNKLLEPG+VD I VS
Sbjct  157  GPHEQQEISFQEFKNKLLEPGMVDKIVVS  185



>gb|KJB16964.1| hypothetical protein B456_002G257200 [Gossypium raimondii]
Length=817

 Score =   123 bits (308),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 106/149 (71%), Gaps = 3/149 (2%)
 Frame = +3

Query  225  STCIARVEGGIGFVRSYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknye  404
            +TCI+RV  G+G VR Y    G GK +     LS++DSI  NPR+RR FCS+ PKK+NYE
Sbjct  40   NTCISRVNKGLGLVRGYFAPAGVGKQLSTNTRLSNLDSILANPRIRRFFCSEGPKKRNYE  99

Query  405  nyypknkkeIPKTNNQKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVL  584
            NY+PKNKK+IPK N QKS S +EDS +G+ G+ Q N  +  QN++T+LL +G   SS+  
Sbjct  100  NYFPKNKKDIPKANEQKSGS-KEDSGAGEPGNSQ-NIQRLVQNIVTTLLLVGITYSSLS-  156

Query  585  SPRTQNEISFQEFKNKLLEPGLVDHIXVS  671
             P  Q EISFQEFKNKLLEPG+VD I VS
Sbjct  157  GPHEQQEISFQEFKNKLLEPGMVDKIVVS  185



>ref|XP_006484360.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Citrus sinensis]
Length=352

 Score =   119 bits (298),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 83/173 (48%), Positives = 107/173 (62%), Gaps = 15/173 (9%)
 Frame = +3

Query  156  VNRGLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYLTSVGAGKGIINRAYLSDVD  335
            V   ++ GG     +V D L         V+G +G +R YL ++GA     N + L D++
Sbjct  26   VRSAIVGGGIPRLPRVTDGL---------VDGRLGVLRGYLAAIGAK----NESNLWDLN  72

Query  336  SIFTNPRLRRLFCSQApkkknyenyyp-knkkeIPKTNNQKSESGREDsssgqqgsPQDN  512
             +  NP + R F S++PK K     +  K KKEIPK + QKSES +EDS++   G+ QD 
Sbjct  73   HVLANPGIYRFFSSESPKNKKNFENFYPKEKKEIPKEDEQKSES-KEDSNTDDHGNFQDT  131

Query  513  FLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFKNKLLEPGLVDHIXVS  671
            F+KQ+QNLIT LL I   LSS  LSPR Q +ISFQEFKNKLLEPGLVDHI VS
Sbjct  132  FMKQFQNLITPLLVIALFLSSFSLSPREQQQISFQEFKNKLLEPGLVDHIVVS  184



>gb|KFK32242.1| hypothetical protein AALP_AA6G216200 [Arabis alpina]
Length=802

 Score =   122 bits (306),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 88/189 (47%), Positives = 125/189 (66%), Gaps = 15/189 (8%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYLTS  284
            M+ S++ RS+S+S      RGL+ GG GVR+  L  LA  +  ++ VE G+GF+R +  S
Sbjct  1    MIFSKLGRSISRS------RGLLYGG-GVRSARL--LAPPALEVSEVESGLGFLRRHFAS  51

Query  285  VGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKSES  464
            + A KG++N    +D+  +F NPR+RR F  +APKKKNYENY+PK+ K+ PK++ QKS+S
Sbjct  52   LSARKGLVN----NDLTGVFANPRIRRFFSDEAPKKKNYENYFPKDAKQTPKSD-QKSDS  106

Query  465  GREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFKNKLLEP  644
             +E S   +  +  D F+ ++QNL+  LL +G   S+       Q +ISFQEFKNKLLEP
Sbjct  107  -KEGSEKNENENLGDMFMNRFQNLLIPLLALGVFFSTFSFGSGDQQQISFQEFKNKLLEP  165

Query  645  GLVDHIXVS  671
            GLVDHI VS
Sbjct  166  GLVDHIDVS  174



>emb|CDP09082.1| unnamed protein product [Coffea canephora]
Length=821

 Score =   122 bits (306),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 81/142 (57%), Positives = 99/142 (70%), Gaps = 2/142 (1%)
 Frame = +3

Query  249  GGIGFVRSYLTSVGAGKGIINRA-YLSDVDSIFTNPRLRRLFCSQApkkknyenyypknk  425
            G +G +R YL SVG   G   +A Y  D + +  NPRLRR F S+APKKK YEN+YPK+K
Sbjct  51   GKLGLLREYLASVGGKSGQFPKASYFLDFNYVIANPRLRRFFSSEAPKKKKYENFYPKDK  110

Query  426  keIPKTNNQKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNE  605
            KE PK N QKSES +E  ++    + QD  +K  QNLIT LL +  +LSS+ +SPR Q +
Sbjct  111  KETPKENGQKSES-KEGGNADGNNNFQDTIMKLAQNLITPLLVVAIILSSLSISPREQKQ  169

Query  606  ISFQEFKNKLLEPGLVDHIXVS  671
            ISFQEFKNKLLEPGLVDHI VS
Sbjct  170  ISFQEFKNKLLEPGLVDHIVVS  191



>gb|KHN32140.1| ATP-dependent zinc metalloprotease FTSH 10, mitochondrial [Glycine 
soja]
Length=810

 Score =   122 bits (305),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 108/155 (70%), Gaps = 4/155 (3%)
 Frame = +3

Query  213  LAAQSTCIARVEGGIGFVRSYLTSVGA-GKGIINRAYLSDVDSIFTNPRLRRLFCSQApk  389
            L   + C    EG +GFVR Y++S  A   G+++   L D  S+  NPR+RRLFCS+APK
Sbjct  32   LPRTNACSEGAEGVLGFVRGYVSSARARSNGLVSN--LPDFKSVAANPRIRRLFCSKAPK  89

Query  390  kknyenyypknkkeIPKTNNQKSES-GREDsssgqqgsPQDNFLKQYQNLITSLLFIGFV  566
            KKNYEN+YPK KKE+PK N++K ES    ++++   G+ Q+ F+KQ QNL+T LL +G  
Sbjct  90   KKNYENFYPKEKKEVPKGNDKKYESKDNSNANTEDSGNFQEAFMKQVQNLVTPLLLMGLF  149

Query  567  LSSMVLSPRTQNEISFQEFKNKLLEPGLVDHIXVS  671
            L+S    PR Q +ISFQEFKNKLLEPGLVDHI VS
Sbjct  150  LTSFSFGPREQKQISFQEFKNKLLEPGLVDHIVVS  184



>ref|XP_003539662.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Glycine max]
Length=810

 Score =   122 bits (305),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 108/155 (70%), Gaps = 4/155 (3%)
 Frame = +3

Query  213  LAAQSTCIARVEGGIGFVRSYLTSVGA-GKGIINRAYLSDVDSIFTNPRLRRLFCSQApk  389
            L   + C    EG +GFVR Y++S  A   G+++   L D  S+  NPR+RRLFCS+APK
Sbjct  32   LPRTNACSEGAEGVLGFVRGYVSSARARSNGLVSN--LPDFKSVAANPRIRRLFCSKAPK  89

Query  390  kknyenyypknkkeIPKTNNQKSES-GREDsssgqqgsPQDNFLKQYQNLITSLLFIGFV  566
            KKNYEN+YPK KKE+PK N++K ES    ++++   G+ Q+ F+KQ QNL+T LL +G  
Sbjct  90   KKNYENFYPKEKKEVPKGNDKKYESKDNSNANTEDSGNFQEAFMKQVQNLVTPLLLMGLF  149

Query  567  LSSMVLSPRTQNEISFQEFKNKLLEPGLVDHIXVS  671
            L+S    PR Q +ISFQEFKNKLLEPGLVDHI VS
Sbjct  150  LTSFSFGPREQKQISFQEFKNKLLEPGLVDHIVVS  184



>ref|XP_008222305.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial 
[Prunus mume]
Length=814

 Score =   122 bits (305),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 87/148 (59%), Positives = 106/148 (72%), Gaps = 5/148 (3%)
 Frame = +3

Query  228  TCIARVEGGIGFVRSYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyen  407
            + + RV+G +GF+RSY  S  A     ++A +SD   I  NP+LRR F S+APKKKNYEN
Sbjct  43   SYLGRVDGDLGFLRSYFASSIAA----HKACVSDFSYILGNPKLRRHFSSEAPKKKNYEN  98

Query  408  yypknkkeIPKTNNQKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLS  587
            +YPK KKEIPK + QKSES ++DS +  QGS Q+ FL+Q+QNLIT LL IG  LSS    
Sbjct  99   FYPKEKKEIPKGDEQKSES-KDDSKADDQGSFQETFLRQFQNLITPLLVIGLFLSSFSFG  157

Query  588  PRTQNEISFQEFKNKLLEPGLVDHIXVS  671
               Q +ISFQEFKNKLLEPGLVDHI VS
Sbjct  158  SPDQQQISFQEFKNKLLEPGLVDHIVVS  185



>gb|KHG12964.1| ATP-dependent zinc metalloprotease FTSH 10, mitochondrial -like 
protein [Gossypium arboreum]
Length=817

 Score =   122 bits (305),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 83/149 (56%), Positives = 106/149 (71%), Gaps = 3/149 (2%)
 Frame = +3

Query  225  STCIARVEGGIGFVRSYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknye  404
            +TCI+R+  G+G V+ Y    G GK +     LS++DSI  NPR+RR FCS+ PKK+NYE
Sbjct  40   NTCISRINKGLGLVKGYFAPAGVGKQLSTNTPLSNLDSILANPRIRRFFCSEGPKKRNYE  99

Query  405  nyypknkkeIPKTNNQKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVL  584
            NY+PKNKK+IPK N QKS S +EDS +G+ G+ Q N  +  QN++T+LL IG   SS+  
Sbjct  100  NYFPKNKKDIPKANEQKSGS-KEDSGAGEPGNSQ-NIQRLVQNIVTTLLLIGITYSSLS-  156

Query  585  SPRTQNEISFQEFKNKLLEPGLVDHIXVS  671
             P  Q EISFQEFKNKLLEPG+VD I VS
Sbjct  157  GPHEQQEISFQEFKNKLLEPGMVDKIVVS  185



>ref|XP_007207144.1| hypothetical protein PRUPE_ppa001491mg [Prunus persica]
 gb|EMJ08343.1| hypothetical protein PRUPE_ppa001491mg [Prunus persica]
Length=814

 Score =   122 bits (305),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 87/148 (59%), Positives = 106/148 (72%), Gaps = 5/148 (3%)
 Frame = +3

Query  228  TCIARVEGGIGFVRSYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyen  407
            + + RV+G +GF+RSY  S  A     ++A +SD   I  NP+LRR F S+APKKKNYEN
Sbjct  43   SYLGRVDGDLGFLRSYFASSIAA----HKACVSDFSYILGNPKLRRHFSSEAPKKKNYEN  98

Query  408  yypknkkeIPKTNNQKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLS  587
            +YPK KKEIPK + QKSES ++DS +  QGS Q+ FL+Q+QNLIT LL IG  LSS    
Sbjct  99   FYPKEKKEIPKGDEQKSES-KDDSKADDQGSFQETFLRQFQNLITPLLVIGLFLSSFSFG  157

Query  588  PRTQNEISFQEFKNKLLEPGLVDHIXVS  671
               Q +ISFQEFKNKLLEPGLVDHI VS
Sbjct  158  SPDQQQISFQEFKNKLLEPGLVDHILVS  185



>ref|XP_006306790.1| hypothetical protein CARUB_v10008328mg [Capsella rubella]
 gb|EOA39688.1| hypothetical protein CARUB_v10008328mg [Capsella rubella]
Length=811

 Score =   121 bits (304),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 94/194 (48%), Positives = 125/194 (64%), Gaps = 16/194 (8%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDE--LAAQSTCIA---RVEGGIGFVR  269
            M+ S++  S+++SS S   +GL+ GG GVR+ +L E  L A     A   +V GG+GF+R
Sbjct  1    MIFSKLGSSIARSSRS---KGLVYGG-GVRSAILSEGRLRAPPNLEAAANQVNGGLGFLR  56

Query  270  SYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNN  449
             +  S+ A K         D+  +F NPRLRR F SQ+PKKKNYENYYPK+ K+ PK N 
Sbjct  57   RHFASLAARK-----LDTGDLSRVFANPRLRRFFSSQSPKKKNYENYYPKDSKQAPK-NE  110

Query  450  QKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFKN  629
            QKSES +E S   +  +  D F K++QN++  L+ I  +LS+  L  R Q +ISFQEFKN
Sbjct  111  QKSES-KEGSKKNENENVGDMFTKEFQNMLIPLMAIALILSTFSLGSREQQQISFQEFKN  169

Query  630  KLLEPGLVDHIXVS  671
            KLLEPGLVDHI VS
Sbjct  170  KLLEPGLVDHIDVS  183



>ref|XP_007133225.1| hypothetical protein PHAVU_011G162000g [Phaseolus vulgaris]
 gb|ESW05219.1| hypothetical protein PHAVU_011G162000g [Phaseolus vulgaris]
Length=811

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 94/190 (49%), Positives = 122/190 (64%), Gaps = 9/190 (5%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYLTS  284
            M  S+IARS+S+SS     R L+ G    R   L  +   + C    E  +GFVRSY++S
Sbjct  1    MNFSKIARSLSRSS-----RNLLHGN--GRLGTLTGIPRTNGCSDGAESVLGFVRSYVSS  53

Query  285  VGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKSES  464
              A    I  + L D  S+  NP+LRR F S+APKKKNYE +YPK KKE+PK N++K +S
Sbjct  54   ARASNHSI-FSNLLDFKSVAANPKLRRFFSSEAPKKKNYEKFYPKEKKEVPKENDKKFDS  112

Query  465  -GREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFKNKLLE  641
                ++++   GS Q+ F+KQ QN+IT LL +G  L++   SPR Q EISFQEFKNKLLE
Sbjct  113  KDNSNANTDDHGSFQEAFMKQVQNIITPLLVMGLFLTTFSSSPREQQEISFQEFKNKLLE  172

Query  642  PGLVDHIXVS  671
            PGLVDHI VS
Sbjct  173  PGLVDHIVVS  182



>ref|XP_004302718.2| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Fragaria vesca subsp. vesca]
Length=812

 Score =   120 bits (300),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 94/195 (48%), Positives = 123/195 (63%), Gaps = 16/195 (8%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPSTVNRGLI----SGGYGVRTKVLDELAAQSTCIARVEGGIGFVRS  272
            M+ S   R +S+S+ S   + LI    +G    R +    LA      A +  G+G +RS
Sbjct  1    MIFSTGGRLLSRSARSAFQKNLILVNNNGNAAFRHQPPTPLAGN----AGITDGLGLLRS  56

Query  273  YLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQ  452
            YLT  GAGK +++  YLS++ S   NPR+RRLF S+ P KKNYENYYPK+KK IPK   +
Sbjct  57   YLTYHGAGKQLVSNTYLSNLKSAIANPRMRRLFSSERPGKKNYENYYPKDKKGIPKGGQK  116

Query  453  KSESGREDsssgqqgsPQDNFLK--QYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFK  626
               SG +D +  Q    QD+FLK  Q Q+LI  LLF+GFVL S++  P+ Q +ISFQEFK
Sbjct  117  ---SGSKDGAGDQGSK-QDHFLKQIQIQDLIAPLLFVGFVLISLL--PQQQKQISFQEFK  170

Query  627  NKLLEPGLVDHIXVS  671
            N LLEPGLVDHI V+
Sbjct  171  NTLLEPGLVDHIEVA  185



>ref|XP_006424865.1| hypothetical protein CICLE_v10027837mg [Citrus clementina]
 ref|XP_006488358.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X1 [Citrus sinensis]
 gb|ESR38105.1| hypothetical protein CICLE_v10027837mg [Citrus clementina]
Length=811

 Score =   120 bits (300),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 85/173 (49%), Positives = 108/173 (62%), Gaps = 15/173 (9%)
 Frame = +3

Query  156  VNRGLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYLTSVGAGKGIINRAYLSDVD  335
            V   ++ GG     +V D L         V+G +G +R YL ++GA     N + L D++
Sbjct  26   VRSAIVGGGIPRLPRVTDGL---------VDGRLGVLRGYLAAIGAK----NESNLWDLN  72

Query  336  SIFTNPRLRRLFCSQApkkknyeny-ypknkkeIPKTNNQKSESGREDsssgqqgsPQDN  512
             +  NP + R F S++PK K      YPK KKEIPK + QKSES +EDS++   G+ QD 
Sbjct  73   HVLANPGIYRFFSSESPKNKKNFENFYPKEKKEIPKEDEQKSES-KEDSNTDDHGNFQDT  131

Query  513  FLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFKNKLLEPGLVDHIXVS  671
            F+KQ+QNLIT LL I   LSS  LSPR Q +ISFQEFKNKLLEPGLVDHI VS
Sbjct  132  FMKQFQNLITPLLVIALFLSSFSLSPREQQQISFQEFKNKLLEPGLVDHIVVS  184



>gb|KDO72822.1| hypothetical protein CISIN_1g047690mg [Citrus sinensis]
Length=811

 Score =   120 bits (300),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 85/173 (49%), Positives = 108/173 (62%), Gaps = 15/173 (9%)
 Frame = +3

Query  156  VNRGLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYLTSVGAGKGIINRAYLSDVD  335
            V   ++ GG     +V D L         V+G +G +R YL ++GA     N + L D++
Sbjct  26   VRSAIVGGGIPRLPRVTDGL---------VDGRLGVLRGYLAAIGAK----NESNLWDLN  72

Query  336  SIFTNPRLRRLFCSQApkkknyeny-ypknkkeIPKTNNQKSESGREDsssgqqgsPQDN  512
             +  NP + R F S++PK K      YPK KKEIPK + QKSES +EDS++   G+ QD 
Sbjct  73   HVLANPGIYRFFSSESPKNKKNFENFYPKEKKEIPKEDEQKSES-KEDSNTDDHGNFQDT  131

Query  513  FLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFKNKLLEPGLVDHIXVS  671
            F+KQ+QNLIT LL I   LSS  LSPR Q +ISFQEFKNKLLEPGLVDHI VS
Sbjct  132  FMKQFQNLITPLLVIALFLSSFSLSPREQQQISFQEFKNKLLEPGLVDHIVVS  184



>ref|XP_010106514.1| ATP-dependent zinc metalloprotease FTSH 10 [Morus notabilis]
 gb|EXC10690.1| ATP-dependent zinc metalloprotease FTSH 10 [Morus notabilis]
Length=817

 Score =   119 bits (298),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 104/153 (68%), Gaps = 6/153 (4%)
 Frame = +3

Query  216  AAQSTCIARVEGGIGFVRSYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkk  395
             A S    R  G +GF+R Y+ S+GA K     +  S    I  NP+ RRLF S+APKKK
Sbjct  40   GADSYLGGRGHGALGFLRGYVASIGASK-----SSASHFHYILANPQFRRLFSSEAPKKK  94

Query  396  nyenyypknkkeIPKTNNQKSESG-REDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLS  572
            NYEN+YPK KKEIPK + QKSES  ++DS++  +GS Q+ F+KQ+QNL+T LL IG   S
Sbjct  95   NYENFYPKEKKEIPKGDEQKSESNSKDDSNTDDRGSFQEAFMKQFQNLLTPLLVIGLFFS  154

Query  573  SMVLSPRTQNEISFQEFKNKLLEPGLVDHIXVS  671
            S    PR Q +ISFQEFKNKLLEPGLVD I VS
Sbjct  155  SFSFGPREQQQISFQEFKNKLLEPGLVDRIVVS  187



>ref|NP_172231.2| FTSH protease 10 [Arabidopsis thaliana]
 sp|Q8VZI8.1|FTSHA_ARATH RecName: Full=ATP-dependent zinc metalloprotease FTSH 10, mitochondrial; 
Short=AtFTSH10; Flags: Precursor [Arabidopsis thaliana]
 gb|AAL36045.1| At1g07510/F22G5_9 [Arabidopsis thaliana]
 gb|AAM70517.1| At1g07510/F22G5_9 [Arabidopsis thaliana]
 gb|AEE28137.1| FTSH protease 10 [Arabidopsis thaliana]
Length=813

 Score =   119 bits (297),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 91/194 (47%), Positives = 123/194 (63%), Gaps = 15/194 (8%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDE---LAAQS--TCIARVEGGIGFVR  269
            M+ S++  S+++SS S   +G + GG GVR+ V ++    A Q+    + +V+GG+GF+R
Sbjct  1    MIFSKLGSSLARSSRS---KGFVYGG-GVRSAVFNQGRLRAPQNLEAAVNQVDGGLGFLR  56

Query  270  SYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNN  449
             +  S  A KG+       D+   F NPRLRR F SQ PKKKNYENYYPK+ K+ PK N 
Sbjct  57   RHFASFAARKGL----EAGDLSRAFANPRLRRFFSSQTPKKKNYENYYPKDSKKAPK-NE  111

Query  450  QKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFKN  629
            QKSES R+ S   +  +  D F  +YQN++  L+ I  +LS+  L  R Q +ISFQEFKN
Sbjct  112  QKSES-RDGSKKNENENAGDAFSNEYQNMLIPLMAIALILSTFSLGSREQQQISFQEFKN  170

Query  630  KLLEPGLVDHIXVS  671
            KLLE GLVDHI VS
Sbjct  171  KLLEAGLVDHIDVS  184



>ref|XP_008799731.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
[Phoenix dactylifera]
Length=820

 Score =   118 bits (296),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 96/190 (51%), Positives = 119/190 (63%), Gaps = 2/190 (1%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYLTS  284
            M+L+R+ RS+++SS S    G   GGYG R+    E   QS       GG+GF+RSYLTS
Sbjct  1    MILTRLGRSLARSSRSRFETGAFLGGYGARSVFSKEALLQSPVFRGDSGGLGFLRSYLTS  60

Query  285  VGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTN-NQKSE  461
            +GA K      Y  D   +  NP  RR F +++P KKNYENYYPK+KKE P  N N KSE
Sbjct  61   IGANKAFGANNYQQDWRFLLANPSFRRFFSTESPNKKNYENYYPKSKKETPNGNENNKSE  120

Query  462  SGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFKNKLLE  641
            S    ++  Q   P+ NF+KQ Q+ +T LLFIG +LSS       Q EISFQ+FKNKLLE
Sbjct  121  SKENSNTEDQGYFPE-NFMKQLQSYLTPLLFIGLLLSSFSFGSSDQKEISFQQFKNKLLE  179

Query  642  PGLVDHIXVS  671
            PGLVDHI VS
Sbjct  180  PGLVDHIVVS  189



>gb|KHN21936.1| ATP-dependent zinc metalloprotease FTSH 10, mitochondrial [Glycine 
soja]
Length=810

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 94/193 (49%), Positives = 121/193 (63%), Gaps = 12/193 (6%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKV-LDELAAQSTCIARVEGGIGFVRSYLT  281
            M+ SRIARSVS+S  +   R  + G   + T V +    A S    RV   +GF R Y++
Sbjct  1    MIFSRIARSVSRSPRA---RNFLHGDGRLGTHVGVPRTNAYSEGAERV---LGFARGYVS  54

Query  282  SVGA-GKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKS  458
            S  A   G ++   L D  S+  NPR+RRLFCS+APKKKNY+N+YPK KKE+PK N++K 
Sbjct  55   SARALSNGFVSN--LPDFKSVAANPRIRRLFCSEAPKKKNYKNFYPKEKKEVPKGNDKKH  112

Query  459  ESGREDsssgqqgsP-QDNFLKQYQNLITSLLF-IGFVLSSMVLSPRTQNEISFQEFKNK  632
            ES     ++ +     ++ F+KQ QNLIT LL  +G  L+S     R Q EISFQEFKNK
Sbjct  113  ESKDNSHANTENSGNFKEAFMKQVQNLITPLLLGMGLFLTSFSFGHREQEEISFQEFKNK  172

Query  633  LLEPGLVDHIXVS  671
            LLEPGLVDHI VS
Sbjct  173  LLEPGLVDHIVVS  185



>ref|XP_003537985.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Glycine max]
Length=810

 Score =   117 bits (293),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 94/193 (49%), Positives = 121/193 (63%), Gaps = 12/193 (6%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKV-LDELAAQSTCIARVEGGIGFVRSYLT  281
            M+ SRIARSVS+S  +   R  + G   + T V +    A S    RV   +GF R Y++
Sbjct  1    MIFSRIARSVSRSPRA---RNFLHGDGRLGTHVGVPRTNAYSEGAERV---LGFARGYVS  54

Query  282  SVGA-GKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKS  458
            S  A   G ++   L D  S+  NPR+RRLFCS+APKKKNY+N+YPK KKE+PK N++K 
Sbjct  55   SARALSNGFVSN--LPDFKSVAANPRIRRLFCSEAPKKKNYKNFYPKEKKEVPKGNDKKH  112

Query  459  ESGREDsssgqqgsP-QDNFLKQYQNLITSLLF-IGFVLSSMVLSPRTQNEISFQEFKNK  632
            ES     ++ +     ++ F+KQ QNLIT LL  +G  L+S     R Q EISFQEFKNK
Sbjct  113  ESKDNSHANTENSGNFKEAFMKQVQNLITPLLLGMGLFLTSFSFGHREQEEISFQEFKNK  172

Query  633  LLEPGLVDHIXVS  671
            LLEPGLVDHI VS
Sbjct  173  LLEPGLVDHIVVS  185



>ref|XP_010937593.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent zinc metalloprotease 
FTSH 8, mitochondrial-like [Elaeis guineensis]
Length=820

 Score =   117 bits (293),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 89/169 (53%), Positives = 110/169 (65%), Gaps = 0/169 (0%)
 Frame = +3

Query  165  GLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYLTSVGAGKGIINRAYLSDVDSIF  344
            G IS G+GVR+    E   QS       GG+GF+RSYLTS+GA K +    Y  D   + 
Sbjct  21   GAISCGHGVRSGCSKESLLQSPVFRGDSGGLGFLRSYLTSIGANKALGANNYQRDWRFLL  80

Query  345  TNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKSESGREDsssgqqgsPQDNFLKQ  524
             NP LRR F +++P KKNYENYYPK+KKE PK N       +E+S++  QG  Q+NF+KQ
Sbjct  81   ANPSLRRFFSTESPNKKNYENYYPKHKKETPKGNENNKSDSKENSNTEDQGYFQENFMKQ  140

Query  525  YQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFKNKLLEPGLVDHIXVS  671
              + +T +LFIG +LSS  L    Q EISFQEFKNKLLEPGLVDHI VS
Sbjct  141  LLSYLTPILFIGLLLSSFSLGSSDQKEISFQEFKNKLLEPGLVDHIVVS  189



>ref|XP_010542637.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Tarenaya hassleriana]
 ref|XP_010542639.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Tarenaya hassleriana]
Length=817

 Score =   117 bits (293),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 85/174 (49%), Positives = 112/174 (64%), Gaps = 12/174 (7%)
 Frame = +3

Query  165  GLISGGYGVRTKVLDE-----LAAQSTCIARVEGGIGFVRSYLTSVGAGKGIINRAYLSD  329
            G + GG GVR+ +L E     L      + RV+GG+GF+R    S+ A KG+I      D
Sbjct  20   GSLYGG-GVRSAILSEGKLQPLPGLEAAVNRVDGGLGFLRQQFASLAARKGLIG----GD  74

Query  330  VDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKSESGREDsssgqqgsPQD  509
            +  +  NPR+RR F S+APKKKNYENYYPK  K   K N +KSESG EDS   +  +  D
Sbjct  75   LSGVLANPRIRRFFSSEAPKKKNYENYYPKETKRTSK-NEKKSESG-EDSKKSENENFGD  132

Query  510  NFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFKNKLLEPGLVDHIXVS  671
             F K++QN++  LL IG +LSS  L+ + Q +I+FQEF+NKLLEPGLVDHI V+
Sbjct  133  MFTKEFQNMLLPLLAIGLILSSFSLTSQEQPQITFQEFRNKLLEPGLVDHIEVT  186



>ref|XP_006488359.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X2 [Citrus sinensis]
Length=810

 Score =   117 bits (292),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 84/173 (49%), Positives = 107/173 (62%), Gaps = 16/173 (9%)
 Frame = +3

Query  156  VNRGLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYLTSVGAGKGIINRAYLSDVD  335
            V   ++ GG     +V D L         V+G +G +R YL ++GA     N + L D++
Sbjct  26   VRSAIVGGGIPRLPRVTDGL---------VDGRLGVLRGYLAAIGAK----NESNLWDLN  72

Query  336  SIFTNPRLRRLFCSQApkkknyeny-ypknkkeIPKTNNQKSESGREDsssgqqgsPQDN  512
             +  NP + R F S++PK K      YPK KKEIPK + QKSES  +DS++   G+ QD 
Sbjct  73   HVLANPGIYRFFSSESPKNKKNFENFYPKEKKEIPKEDEQKSES--KDSNTDDHGNFQDT  130

Query  513  FLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFKNKLLEPGLVDHIXVS  671
            F+KQ+QNLIT LL I   LSS  LSPR Q +ISFQEFKNKLLEPGLVDHI VS
Sbjct  131  FMKQFQNLITPLLVIALFLSSFSLSPREQQQISFQEFKNKLLEPGLVDHIVVS  183



>gb|KDP42240.1| hypothetical protein JCGZ_02970 [Jatropha curcas]
Length=803

 Score =   116 bits (290),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 119/190 (63%), Gaps = 14/190 (7%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPS-TVNRGLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYLT  281
            M+ S+++R VS+SS S  V RG  SGG    +++    A       R++GG+GFVR YL 
Sbjct  1    MIFSKLSRQVSRSSASINVLRG--SGGRSAISRLTGGGAGGVGFSERIDGGLGFVRGYLA  58

Query  282  SVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKSE  461
            S+GA      ++YLSD + +  NPR+ RLF S+APKKKNYEN+ PK KKE PK N QKSE
Sbjct  59   SIGANS---KKSYLSDWNYLLANPRIGRLFSSKAPKKKNYENFSPKEKKEAPKGNGQKSE  115

Query  462  SGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFKNKLLE  641
            S  ++ S          F++Q  NL+T+L+ IG +L         + +ISFQEFKNK LE
Sbjct  116  SKDDEWSF------DKKFIRQ-SNLLTALVVIGALLP-FAFGSHEEQQISFQEFKNKFLE  167

Query  642  PGLVDHIXVS  671
            PGLVDHI VS
Sbjct  168  PGLVDHIVVS  177



>ref|XP_002530989.1| Mitochondrial respiratory chain complexes assembly protein AFG3, 
putative [Ricinus communis]
 gb|EEF31401.1| Mitochondrial respiratory chain complexes assembly protein AFG3, 
putative [Ricinus communis]
Length=833

 Score =   116 bits (290),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 95/209 (45%), Positives = 125/209 (60%), Gaps = 26/209 (12%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPSTVNRGLI-SGGYG----VRTKVLDELAAQSTCIARVEGGIGFVR  269
            M+LSRIARS    S ST  R +I S G G     +  +L     ++ C +RV GG+G VR
Sbjct  1    MILSRIARS----SRSTFQRNVIASKGSGRILPTKESILPPTILENACNSRVHGGLGIVR  56

Query  270  SYLTSVG--------------AGKGII-NRAYLSDVDSIFTNPRLRRLFCSQApkkknye  404
             Y +S G              AGK ++ ++   S+ +SI  NPR+R  F +QAPKK++YE
Sbjct  57   DYYSSCGGVIRGYLTCSGGGGAGKQLLLSKTNFSNSNSILANPRVRLFFSTQAPKKRSYE  116

Query  405  nyypknkkeIPKTNNQKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVL  584
            NY+PK KKEIPK N   S + R   +    G+PQ NF+K +QN I  LLFI F+ SS++ 
Sbjct  117  NYHPKGKKEIPKENEGNS-ANRGGGAGAGGGNPQ-NFMKPFQNFIAPLLFIAFLSSSVLF  174

Query  585  SPRTQNEISFQEFKNKLLEPGLVDHIXVS  671
              +  N+ISFQEFK KLLEPGLVD I VS
Sbjct  175  GAQEPNQISFQEFKTKLLEPGLVDRIVVS  203



>ref|XP_006409951.1| hypothetical protein EUTSA_v10016261mg [Eutrema salsugineum]
 gb|ESQ51404.1| hypothetical protein EUTSA_v10016261mg [Eutrema salsugineum]
Length=813

 Score =   116 bits (290),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 90/191 (47%), Positives = 127/191 (66%), Gaps = 12/191 (6%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPSTVNRGLISGGYGVR-TKVLDELAAQSTCIARVEGG-IGFVRSYL  278
            M+ S++ RSV +SS S   RGL+ GG GVR  ++L   A ++  + +V+GG +GF+R + 
Sbjct  3    MIFSKLGRSVIQSSRS---RGLLYGG-GVRWARLLASPAIEAASVNQVDGGGLGFLRRHF  58

Query  279  TSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKS  458
             S+  GKG++N    +D+  +F NPR+RR F  +APKKKNYENY+PK+ K+ PK++ QKS
Sbjct  59   ASLTGGKGLVN----NDLTGVFANPRIRRFFSDEAPKKKNYENYFPKDTKQEPKSD-QKS  113

Query  459  ESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFKNKLL  638
            ES +E S   +  +  D F+ ++QNL+  LL +    SS       Q +ISFQEFKNKLL
Sbjct  114  ES-KEGSDKNESENLGDMFMNRFQNLLIPLLALAVFFSSFSFGSGDQQQISFQEFKNKLL  172

Query  639  EPGLVDHIXVS  671
            EPGLVDHI VS
Sbjct  173  EPGLVDHIDVS  183



>ref|XP_003606687.1| Cell division protease ftsH-like protein [Medicago truncatula]
 gb|AES88884.1| ATP-dependent zinc metalloprotease FTSH protein [Medicago truncatula]
Length=807

 Score =   116 bits (290),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 91/191 (48%), Positives = 120/191 (63%), Gaps = 9/191 (5%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYLTS  284
            M+ SRI RS+S+SS     + L+ G    R   L  ++  +  +  VE G+GFVR Y++S
Sbjct  1    MIFSRIGRSLSRSSRV---KNLLHGE--TRLGTLYGVSRTNVFVDDVEKGLGFVRGYVSS  55

Query  285  -VGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKSE  461
             +    G  +  Y  D  SI  N  L R+F S++PKKKNYE +YPK KKE+PK   +KSE
Sbjct  56   AIARNNGFGSNLY--DFKSIAANRMLHRMFSSESPKKKNYEKFYPKEKKEVPKGEEKKSE  113

Query  462  SGREDsssgqqgsP-QDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFKNKLL  638
            S  E  S+ + G    + F+KQ+QN +T LL +G  LSS+ L PR Q +ISFQEFKNKLL
Sbjct  114  SKDESKSNTEDGGSFHEAFIKQFQNYLTPLLVVGLFLSSLSLGPRDQQQISFQEFKNKLL  173

Query  639  EPGLVDHIXVS  671
            EPGLVDHI VS
Sbjct  174  EPGLVDHIVVS  184



>gb|AAK77908.1|AF397903_1 AAA-metalloprotease FtsH [Pisum sativum]
Length=810

 Score =   115 bits (289),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 92/192 (48%), Positives = 121/192 (63%), Gaps = 11/192 (6%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYLTS  284
            M+ SRI R++S+SS     + L+ G    R   L  +         VEGG+GF R Y++S
Sbjct  1    MIFSRIGRALSRSSRV---KNLLHGD--SRLGALSGVPRIDVYSEGVEGGLGFFRGYVSS  55

Query  285  -VGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKSE  461
             V    G ++   LS   S+  NPR  RLF S+APKKKNYEN+YPK +KE+PK  ++K+E
Sbjct  56   SVARNNGFVSN--LSGFKSVAGNPRFLRLFSSEAPKKKNYENFYPKGQKEVPKGGDKKNE  113

Query  462  SGREDsssgqqgsP--QDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFKNKL  635
            S +EDS S  +     Q+ F+KQ+Q+ +T LL +G  LSS    PR Q +ISFQEFKNKL
Sbjct  114  S-KEDSKSNTEDQGGFQEAFMKQFQSFLTPLLVMGLFLSSFSFGPREQQQISFQEFKNKL  172

Query  636  LEPGLVDHIXVS  671
            LEPGLVDHI VS
Sbjct  173  LEPGLVDHIVVS  184



>ref|XP_004164623.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Cucumis sativus]
Length=824

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 89/206 (43%), Positives = 127/206 (62%), Gaps = 31/206 (15%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPSTV---------NRGLISGGYGVRTKVLDELAAQSTCIARVEGGI  257
            M+ SRI  ++S+S+ S +         NR ++S    VR   L+     + C++RV G +
Sbjct  1    MIFSRIGAALSRSARSKLQSNGHFGFCNRRILS----VRETCLEANPFSNPCVSRVHGCL  56

Query  258  GFVRSYLTS--VGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkke  431
            G  ++Y +S  VGAGK +++R YL +V+    NPR+RRLF S +P KKNYENYYPK++KE
Sbjct  57   GLAKAYSSSTGVGAGKQLVSRKYLDNVNYFLANPRVRRLFSSGSPNKKNYENYYPKDQKE  116

Query  432  IPKTNNQK-----SESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLS-PR  593
            IPK  +QK     S SG  DS        Q+ F KQ+Q+L+  +LF G +L+S V     
Sbjct  117  IPKAKDQKTNSKDSNSGHTDS--------QEKFTKQFQDLM--ILFFGCILASFVFDGSN  166

Query  594  TQNEISFQEFKNKLLEPGLVDHIXVS  671
             Q +ISFQEF+N+LLEPGLVD I ++
Sbjct  167  EQKQISFQEFRNELLEPGLVDRIEIA  192



>ref|XP_004142062.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Cucumis sativus]
 gb|KGN54261.1| hypothetical protein Csa_4G296150 [Cucumis sativus]
Length=824

 Score =   114 bits (286),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 89/206 (43%), Positives = 127/206 (62%), Gaps = 31/206 (15%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPSTV---------NRGLISGGYGVRTKVLDELAAQSTCIARVEGGI  257
            M+ SRI  ++S+S+ S +         NR ++S    VR   L+     + C++RV G +
Sbjct  1    MIFSRIGAALSRSARSKLQSNGHFGFCNRRILS----VRETCLEANPFSNPCVSRVHGCL  56

Query  258  GFVRSYLTS--VGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkke  431
            G  ++Y +S  VGAGK +++R YL +V+    NPR+RRLF S +P KKNYENYYPK++KE
Sbjct  57   GLAKAYSSSTGVGAGKQLVSRKYLDNVNYFLANPRVRRLFSSGSPNKKNYENYYPKDQKE  116

Query  432  IPKTNNQK-----SESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLS-PR  593
            IPK  +QK     S SG  DS        Q+ F KQ+Q+L+  +LF G +L+S V     
Sbjct  117  IPKAKDQKTNSKDSNSGHTDS--------QEKFTKQFQDLM--ILFFGCILASFVFDGSN  166

Query  594  TQNEISFQEFKNKLLEPGLVDHIXVS  671
             Q +ISFQEF+N+LLEPGLVD I ++
Sbjct  167  EQKQISFQEFRNELLEPGLVDRIEIA  192



>ref|XP_008356937.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Malus domestica]
Length=812

 Score =   114 bits (285),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 105/149 (70%), Gaps = 7/149 (5%)
 Frame = +3

Query  228  TCIARVEGGIGFVRSYLT-SVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknye  404
            + +  V+G +GF+RSY   S+GA     ++A +SD   I  NP+L R F S+ PKKKNYE
Sbjct  43   SYLGPVDGELGFLRSYFAASIGA-----HKACVSDFSCILANPKLSRHFSSETPKKKNYE  97

Query  405  nyypknkkeIPKTNNQKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVL  584
            N+YPK KKEIPK + QKSES +++S +  QGS Q+ FL+Q+QNLIT LL IG  LSS   
Sbjct  98   NFYPKEKKEIPKGDEQKSES-KDESKADDQGSFQETFLRQFQNLITPLLVIGLFLSSFSF  156

Query  585  SPRTQNEISFQEFKNKLLEPGLVDHIXVS  671
                Q +ISFQEFKNKLLEPGLVDHI VS
Sbjct  157  GTPDQQQISFQEFKNKLLEPGLVDHIVVS  185



>emb|CDY09913.1| BnaC08g45380D [Brassica napus]
Length=767

 Score =   112 bits (281),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 78/192 (41%), Positives = 106/192 (55%), Gaps = 17/192 (9%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDE---LAAQSTCIARVEGGIGFVRSY  275
            M+ S++ARS         ++GL+ GG    + +L E   + AQS    +V+GG+GF+R  
Sbjct  1    MVFSKLARSAR-------SKGLVYGG----SAILSEGRRVGAQSGGANQVDGGLGFLRRR  49

Query  276  LTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQK  455
              S+ A KG ++    +D+  +F NPRLRR F SQAPKKK         K       N+ 
Sbjct  50   FASLAARKGGVD---ANDLTRVFANPRLRRFFSSQAPKKKKKNYENYYPKDAKKGPKNEH  106

Query  456  SESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFKNKL  635
                RE S   +  +  D   K++QNL+  L+ I  +LSS  L  R Q +ISFQEFKNKL
Sbjct  107  KSESREGSKKSENENAGDFNTKEFQNLLVPLMAIALILSSFSLGSREQQQISFQEFKNKL  166

Query  636  LEPGLVDHIXVS  671
            LE GLVDHI VS
Sbjct  167  LEAGLVDHIDVS  178



>ref|XP_009364366.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Pyrus x bretschneideri]
Length=812

 Score =   112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 82/143 (57%), Positives = 101/143 (71%), Gaps = 5/143 (3%)
 Frame = +3

Query  243  VEGGIGFVRSYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypkn  422
            V+G +GF+RSY  +  A     ++A +SD   I  NP+L R F S+ PKKKNYEN+YPK 
Sbjct  48   VDGELGFLRSYFAASIAA----HKACVSDFSCILANPKLSRHFSSETPKKKNYENFYPKE  103

Query  423  kkeIPKTNNQKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQN  602
            KKEIPK + QKSES +++S +  QGS Q+ FL+Q+QNLIT LL IG  LSS       Q 
Sbjct  104  KKEIPKGDEQKSES-KDESKTDDQGSFQETFLRQFQNLITPLLVIGLFLSSFSFGSPDQQ  162

Query  603  EISFQEFKNKLLEPGLVDHIXVS  671
            +ISFQEFKNKLLEPGLVDHI VS
Sbjct  163  QISFQEFKNKLLEPGLVDHIVVS  185



>ref|XP_009387530.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
[Musa acuminata subsp. malaccensis]
Length=818

 Score =   112 bits (279),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 87/189 (46%), Positives = 113/189 (60%), Gaps = 0/189 (0%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYLTS  284
            M+ S+IAR +S+SS      G +  G+GV++    E   Q        GG+  +R YLTS
Sbjct  1    MIFSKIARPISRSSRRRSGHGWLPSGFGVKSGCSREALLQDPICHGDNGGLRSLRGYLTS  60

Query  285  VGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKSES  464
            VGA + +  R +L+D      NP  RR F S++P KKNYENYYPK+KKEIPK N      
Sbjct  61   VGAHRTLGERNHLADWRFFLANPSFRRFFSSESPNKKNYENYYPKDKKEIPKANENNESD  120

Query  465  GREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFKNKLLEP  644
             +EDS++   GS ++N +K  Q  +  LLF+G + SS       Q EISF EFKNKLLEP
Sbjct  121  SKEDSNADDSGSLKENLMKALQGYVAPLLFMGLLFSSSSFGSSDQKEISFLEFKNKLLEP  180

Query  645  GLVDHIXVS  671
            GLVDHI VS
Sbjct  181  GLVDHIVVS  189



>gb|AAC33234.1| putative AAA-type ATPase [Arabidopsis thaliana]
Length=807

 Score =   111 bits (277),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 84/191 (44%), Positives = 123/191 (64%), Gaps = 16/191 (8%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPSTVNRGLISGGYGVRT--KVLDELAAQSTCIARVEGGIGFVRSYL  278
            +  S++ RS+S+S      +G + GG GVR+  ++L     ++  +  VEGG+GF+R + 
Sbjct  2    IFFSKLNRSISRS------KGFLYGG-GVRSAARLLTSPGLEAASVNEVEGGLGFIRRHF  54

Query  279  TSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKS  458
             S+ + KG++N    +D+  +F NPRLRR F  +APKKKNYENY+PK+K+E PK++ QKS
Sbjct  55   ASLASRKGLVN----NDLIGVFANPRLRRFFSDEAPKKKNYENYFPKDKQE-PKSD-QKS  108

Query  459  ESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFKNKLL  638
            E  +E S   +  +  D F+ ++QNL+  LL +    S+       Q +ISFQEFKNKLL
Sbjct  109  EH-KEGSEKNENENVGDMFMNRFQNLLIPLLALAVFFSTFSFGSGEQQQISFQEFKNKLL  167

Query  639  EPGLVDHIXVS  671
            EPGLVDHI VS
Sbjct  168  EPGLVDHIDVS  178



>ref|NP_850129.1| FTSH protease 3 [Arabidopsis thaliana]
 sp|Q84WU8.1|FTSH3_ARATH RecName: Full=ATP-dependent zinc metalloprotease FTSH 3, mitochondrial; 
Short=AtFTSH3; Flags: Precursor [Arabidopsis thaliana]
 gb|AAO22572.1| putative AAA-type ATPase [Arabidopsis thaliana]
 gb|AEC08208.1| FTSH protease 3 [Arabidopsis thaliana]
Length=809

 Score =   111 bits (277),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 84/191 (44%), Positives = 123/191 (64%), Gaps = 16/191 (8%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPSTVNRGLISGGYGVRT--KVLDELAAQSTCIARVEGGIGFVRSYL  278
            +  S++ RS+S+S      +G + GG GVR+  ++L     ++  +  VEGG+GF+R + 
Sbjct  4    IFFSKLNRSISRS------KGFLYGG-GVRSAARLLTSPGLEAASVNEVEGGLGFIRRHF  56

Query  279  TSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKS  458
             S+ + KG++N    +D+  +F NPRLRR F  +APKKKNYENY+PK+K+E PK++ QKS
Sbjct  57   ASLASRKGLVN----NDLIGVFANPRLRRFFSDEAPKKKNYENYFPKDKQE-PKSD-QKS  110

Query  459  ESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFKNKLL  638
            E  +E S   +  +  D F+ ++QNL+  LL +    S+       Q +ISFQEFKNKLL
Sbjct  111  EH-KEGSEKNENENVGDMFMNRFQNLLIPLLALAVFFSTFSFGSGEQQQISFQEFKNKLL  169

Query  639  EPGLVDHIXVS  671
            EPGLVDHI VS
Sbjct  170  EPGLVDHIDVS  180



>gb|AAL36270.1| putative AAA-type ATPase [Arabidopsis thaliana]
Length=809

 Score =   111 bits (277),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 84/191 (44%), Positives = 123/191 (64%), Gaps = 16/191 (8%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPSTVNRGLISGGYGVRT--KVLDELAAQSTCIARVEGGIGFVRSYL  278
            +  S++ RS+S+S      +G + GG GVR+  ++L     ++  +  VEGG+GF+R + 
Sbjct  4    IFFSKLNRSISRS------KGFLYGG-GVRSAARLLTSPGLEAASVNEVEGGLGFIRRHF  56

Query  279  TSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKS  458
             S+ + KG++N    +D+  +F NPRLRR F  +APKKKNYENY+PK+K+E PK++ QKS
Sbjct  57   ASLASRKGLVN----NDLIGVFANPRLRRFFSDEAPKKKNYENYFPKDKQE-PKSD-QKS  110

Query  459  ESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFKNKLL  638
            E  +E S   +  +  D F+ ++QNL+  LL +    S+       Q +ISFQEFKNKLL
Sbjct  111  EH-KEGSEKNENENVGDMFMNRFQNLLIPLLALAVFFSTFSFGSGDQQQISFQEFKNKLL  169

Query  639  EPGLVDHIXVS  671
            EPGLVDHI VS
Sbjct  170  EPGLVDHIDVS  180



>ref|XP_008448063.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X1 [Cucumis melo]
 ref|XP_008448071.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X1 [Cucumis melo]
Length=825

 Score =   111 bits (277),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 87/200 (44%), Positives = 129/200 (65%), Gaps = 18/200 (9%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPSTVNRGLISGGYG--------VRTKVLDELAAQSTCIARVEGGIG  260
            M+ SRI  S+S+S+ S +     +G +G        VR   L+     + CI+RV G +G
Sbjct  1    MIFSRIGASLSRSARSKLQS---NGHFGFCNGRILSVRESCLEANPLSNPCISRVHGCLG  57

Query  261  FVRSYLTSVG--AGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeI  434
              ++Y +S G  AGK +++R YL +V+    NPR+RRLF S +PKKKNYENYYPK++KEI
Sbjct  58   LAKAYSSSTGVAAGKQLVSRKYLENVNYFLANPRVRRLFSSGSPKKKNYENYYPKDQKEI  117

Query  435  PKTNNQKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLS-PRTQNEIS  611
            PK  +QK+ S +EDS++G     Q+ F KQ+Q+L+  +LF G +++S +      Q +IS
Sbjct  118  PKAKDQKTNS-KEDSNTGHTDI-QEKFTKQFQDLM--ILFFGCIVASFLFDGSNEQKQIS  173

Query  612  FQEFKNKLLEPGLVDHIXVS  671
            FQEF+ +LLEPGLVD I ++
Sbjct  174  FQEFRKELLEPGLVDRIEIA  193



>gb|AAF79577.1|AC022464_35 F22G5.10 [Arabidopsis thaliana]
Length=843

 Score =   109 bits (273),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 90/201 (45%), Positives = 122/201 (61%), Gaps = 21/201 (10%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDE---LAAQS--TCIARVEGGIGFVR  269
            M+ S++  S+++SS S   +G + GG GVR+ V ++    A Q+    + +V+GG+GF+R
Sbjct  1    MIFSKLGSSLARSSRS---KGFVYGG-GVRSAVFNQGRLRAPQNLEAAVNQVDGGLGFLR  56

Query  270  SYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNN  449
             +  S  A KG+       D+   F NPRLRR F SQ PKKKNYENYYPK+ K+ PK N 
Sbjct  57   RHFASFAARKGL----EAGDLSRAFANPRLRRFFSSQTPKKKNYENYYPKDSKKAPK-NE  111

Query  450  QKSES-GREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEIS-----  611
            QKSES G + S   +  +  D F  +YQN++  L+ I  +LS+  L  R Q + S     
Sbjct  112  QKSESRGDDGSKKNENENAGDAFSNEYQNMLIPLMAIALILSTFSLGSREQQQASMSNYT  171

Query  612  -FQEFKNKLLEPGLVDHIXVS  671
             FQEFKNKLLE GLVDHI VS
Sbjct  172  LFQEFKNKLLEAGLVDHIDVS  192



>ref|XP_003539663.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X1 [Glycine max]
Length=806

 Score =   109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 76/151 (50%), Positives = 102/151 (68%), Gaps = 4/151 (3%)
 Frame = +3

Query  225  STCIARVEGGIGFVRSYLTSVGA-GKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkkny  401
            + C    EG +G VR Y++S  A   G ++   L D  S+  NP +RRLFCS+APKK+NY
Sbjct  36   NACSEGAEGVLGSVRGYVSSARARSNGFVSN--LPDFKSVAANPTIRRLFCSKAPKKENY  93

Query  402  enyypknkkeIPKTNNQKSES-GREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSM  578
             N+YPK KKE+PK N++K ES    ++++   G+ Q+ F+KQ + L+T LL +G  L+S 
Sbjct  94   GNFYPKEKKEVPKGNDKKYESKDNSNANTEDSGNFQEAFMKQVKYLVTPLLLMGLFLTSF  153

Query  579  VLSPRTQNEISFQEFKNKLLEPGLVDHIXVS  671
               P  QN+ISFQEFKNKLLEPGLVDHI VS
Sbjct  154  SFGPPEQNQISFQEFKNKLLEPGLVDHIVVS  184



>ref|XP_008448079.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X2 [Cucumis melo]
Length=824

 Score =   109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 83/200 (42%), Positives = 124/200 (62%), Gaps = 19/200 (10%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPSTVNRGLISGGYG--------VRTKVLDELAAQSTCIARVEGGIG  260
            M+ SRI  S+S+S+ S +     +G +G        VR   L+     + CI+RV G +G
Sbjct  1    MIFSRIGASLSRSARSKLQS---NGHFGFCNGRILSVRESCLEANPLSNPCISRVHGCLG  57

Query  261  FVRSYLTSVG--AGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeI  434
              ++Y +S G  AGK +++R YL +V+    NPR+RRLF S +PKKKNYENYYPK++KEI
Sbjct  58   LAKAYSSSTGVAAGKQLVSRKYLENVNYFLANPRVRRLFSSGSPKKKNYENYYPKDQKEI  117

Query  435  PKTNNQKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLS-PRTQNEIS  611
            PK  +QK+ S   ++        Q+ F KQ+Q+L+  +LF G +++S +      Q +IS
Sbjct  118  PKAKDQKTNSKDSNTGHTDI---QEKFTKQFQDLM--ILFFGCIVASFLFDGSNEQKQIS  172

Query  612  FQEFKNKLLEPGLVDHIXVS  671
            FQEF+ +LLEPGLVD I ++
Sbjct  173  FQEFRKELLEPGLVDRIEIA  192



>ref|XP_008384940.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Malus domestica]
 ref|XP_008366266.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Malus domestica]
Length=812

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 81/148 (55%), Positives = 103/148 (70%), Gaps = 5/148 (3%)
 Frame = +3

Query  228  TCIARVEGGIGFVRSYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyen  407
            + +  V+G +GF+RSY  +  A     ++A +SD   I  +P+L R F S+ PKKKNYEN
Sbjct  43   SYLGPVDGELGFLRSYFAASIAA----HKACVSDFSGILASPKLCRHFSSENPKKKNYEN  98

Query  408  yypknkkeIPKTNNQKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLS  587
            +YPK KKEIPK + QKSES +++S +  QGS Q+ FL+Q+QNLIT LL IG  LSS    
Sbjct  99   FYPKEKKEIPKGDEQKSES-KDESKTNDQGSFQETFLRQFQNLITPLLVIGLFLSSFSFG  157

Query  588  PRTQNEISFQEFKNKLLEPGLVDHIXVS  671
               Q +ISFQEFKNKLLEPGLVDHI VS
Sbjct  158  SPDQQQISFQEFKNKLLEPGLVDHIVVS  185



>ref|XP_007132051.1| hypothetical protein PHAVU_011G062800g [Phaseolus vulgaris]
 gb|ESW04045.1| hypothetical protein PHAVU_011G062800g [Phaseolus vulgaris]
Length=809

 Score =   108 bits (270),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 79/150 (53%), Positives = 101/150 (67%), Gaps = 2/150 (1%)
 Frame = +3

Query  225  STCIARVEGGIGFVRSYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknye  404
            + C    E  +GF RSY++S  A    I  + L D  S   NPR+RRLF S+APKKKNYE
Sbjct  34   NACSDGAESVLGFFRSYVSSARASSYRI-FSNLPDFKSAAANPRVRRLFSSEAPKKKNYE  92

Query  405  nyypknkkeIPKTNNQKSES-GREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMV  581
             +YPK KKE PK N++K +S    ++++   G+ Q+ F+KQ QN+IT LL +G  L++  
Sbjct  93   KFYPKEKKETPKENDKKYDSKDNSNANTDGNGNFQEAFMKQVQNIITPLLVLGLFLTTFS  152

Query  582  LSPRTQNEISFQEFKNKLLEPGLVDHIXVS  671
             SPR Q EISFQEFKNKLLEPGLVDHI VS
Sbjct  153  NSPREQQEISFQEFKNKLLEPGLVDHIVVS  182



>ref|XP_004507174.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X1 [Cicer arietinum]
Length=800

 Score =   108 bits (269),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 77/147 (52%), Positives = 99/147 (67%), Gaps = 9/147 (6%)
 Frame = +3

Query  243  VEGGIGFVRSYLTSVGAGKGIINRAYLSD---VDSIFTNPRLRRLFCSQApkkknyenyy  413
            VEGG+GF R YL+S  A    +N  ++S+     S+  NPR  RLF S++PKKKNYE +Y
Sbjct  42   VEGGLGFFRGYLSSATA----LNNGFVSNSPYFKSVVANPRFLRLFSSESPKKKNYEKFY  97

Query  414  pknkkeIPKTNNQKSESGREDsssgqqgsP-QDNFLKQYQNLITSLLFIGFVLSSMVLSP  590
            PK KKE+PK N++K+ES  E  S+       Q+ F+KQ+QN +T LL +G  LSS     
Sbjct  98   PKEKKEVPK-NDKKNESEDESKSNTDDQGGFQEAFMKQFQNFLTPLLVMGLFLSSFSFGS  156

Query  591  RTQNEISFQEFKNKLLEPGLVDHIXVS  671
            R Q +ISFQEFKNKLLEPGLVDHI V+
Sbjct  157  REQQQISFQEFKNKLLEPGLVDHIVVT  183



>ref|XP_009375915.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Pyrus x bretschneideri]
Length=812

 Score =   107 bits (268),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 102/148 (69%), Gaps = 5/148 (3%)
 Frame = +3

Query  228  TCIARVEGGIGFVRSYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyen  407
            + +  V+G +GF+RSY  +  A     ++A +SD   I  +P+L R F S+ PKKKNYEN
Sbjct  43   SYLGPVDGELGFLRSYFAASIAA----HKACVSDFSGILASPKLCRHFSSETPKKKNYEN  98

Query  408  yypknkkeIPKTNNQKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLS  587
            +YPK KKEIPK + QKSES +++S +  QGS Q+ FL+Q+QNL T LL IG  LSS    
Sbjct  99   FYPKEKKEIPKGDEQKSES-KDESKTNDQGSFQETFLRQFQNLFTPLLVIGLFLSSFSFG  157

Query  588  PRTQNEISFQEFKNKLLEPGLVDHIXVS  671
               Q +ISFQEFKNKLLEPGLVDHI VS
Sbjct  158  SPDQQQISFQEFKNKLLEPGLVDHIVVS  185



>ref|XP_009118433.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial 
[Brassica rapa]
 emb|CDY06264.1| BnaA09g49390D [Brassica napus]
Length=800

 Score =   107 bits (267),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 78/192 (41%), Positives = 105/192 (55%), Gaps = 16/192 (8%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDE---LAAQSTCIARVEGGIGFVRSY  275
            MM S++ARS         ++GL+   YG R+ +L E   + A S    +V+GG+GF+R  
Sbjct  1    MMFSKLARSAR-------SKGLVL--YG-RSGILSEGRKVGAPSGGANQVDGGLGFLRRR  50

Query  276  LTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQK  455
              S+ A KG ++    +D+  +F NP LRR F SQAPKKK         K       N+ 
Sbjct  51   FASLAARKGGVD---ANDLSRVFANPGLRRFFSSQAPKKKKKNYENYYPKDAKKGPKNEH  107

Query  456  SESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFKNKL  635
                RE S   +  +  D   K++QNL+  L+ I  +LSS  L  R Q +ISFQEFKNKL
Sbjct  108  KSESREGSKKSENENAGDFNTKEFQNLLVPLMAIALILSSFSLGSREQQQISFQEFKNKL  167

Query  636  LEPGLVDHIXVS  671
            LE GLVDHI VS
Sbjct  168  LEAGLVDHIDVS  179



>ref|XP_002881027.1| hypothetical protein ARALYDRAFT_344684 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57286.1| hypothetical protein ARALYDRAFT_344684 [Arabidopsis lyrata subsp. 
lyrata]
Length=818

 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 85/201 (42%), Positives = 124/201 (62%), Gaps = 25/201 (12%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDEL------AAQSTCIARVEGGIGFV  266
            +  S+++RS+S+S      RG + GG GVR+ VL+E         ++  + +VEGG+GF+
Sbjct  2    IFFSKLSRSISRS------RGFLYGG-GVRSAVLNEARLLTSPGLEAASVNQVEGGLGFI  54

Query  267  RSYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTN  446
            R +  S+ + KG++N     D+  +F NP++RR F  +APKKKNYENY+PK+ K+ PK++
Sbjct  55   RRHFASLASRKGLVN----YDLIGVFANPKIRRFFSDEAPKKKNYENYFPKDTKQEPKSD  110

Query  447  NQKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNE------I  608
             QKSE  +E S   +  +  D F+ ++QNL+  LL +    SS       Q +      I
Sbjct  111  -QKSEH-KEGSEKNENENVGDMFMNRFQNLLIPLLALAVFFSSFSFGSGDQQQANVVLLI  168

Query  609  SFQEFKNKLLEPGLVDHIXVS  671
            SFQEFKNKLLEPGLVDHI VS
Sbjct  169  SFQEFKNKLLEPGLVDHIDVS  189



>ref|XP_009384843.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=821

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 90/192 (47%), Positives = 112/192 (58%), Gaps = 7/192 (4%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPSTVNR-GLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYLT  281
            M  + + RS+ +S+ S   R  L +G  G R  +  E      CI      +   R YLT
Sbjct  1    MSFANLGRSLLRSARSRSPRVALSNGNNGARPVLSGEALLHKPCIGYE--NVAGTRGYLT  58

Query  282  SVGAGK--GIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQK  455
            S+GA K  G+ NR  L D   +  NP  RR F S  P KKNYENY+PK+KKEIPK N   
Sbjct  59   SLGANKAVGVGNR--LLDWRFLLANPNFRRFFSSGNPNKKNYENYFPKDKKEIPKGNANN  116

Query  456  SESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFKNKL  635
                + DSS+   G+ Q+NF+KQ+Q+LIT L+FIG + SS       Q EISFQEFKNKL
Sbjct  117  KSDPKGDSSTEDHGNFQENFMKQWQSLITPLIFIGLLFSSFSRGSFDQKEISFQEFKNKL  176

Query  636  LEPGLVDHIXVS  671
            LE GLVDHI VS
Sbjct  177  LEAGLVDHIVVS  188



>ref|XP_004294648.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial 
[Fragaria vesca subsp. vesca]
Length=810

 Score =   106 bits (265),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 83/149 (56%), Positives = 109/149 (73%), Gaps = 8/149 (5%)
 Frame = +3

Query  228  TCIARVEGGIGFVRSYLTS-VGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknye  404
            + + RV+G +GF+RSY+ S +GA     ++ ++SDV  I  NP+  RLF S+APKKKN+E
Sbjct  41   SYLGRVDGDLGFMRSYIASAIGA-----HKTHVSDVSYILGNPKFLRLFSSEAPKKKNFE  95

Query  405  nyypknkkeIPKTNNQKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVL  584
            N+YPK KKEIPK ++QKSES ++ SS+  QGS Q+ F+KQ+QNL+  L+ IG   SS   
Sbjct  96   NFYPKEKKEIPKGDDQKSES-KDGSSTDDQGSFQEAFIKQFQNLV-PLVLIGLFFSSFSF  153

Query  585  SPRTQNEISFQEFKNKLLEPGLVDHIXVS  671
            S   Q +ISFQEFKNKLLEPGLVDHI VS
Sbjct  154  SSSDQKQISFQEFKNKLLEPGLVDHIVVS  182



>ref|XP_006845226.1| hypothetical protein AMTR_s00005p00256120 [Amborella trichopoda]
 gb|ERN06901.1| hypothetical protein AMTR_s00005p00256120 [Amborella trichopoda]
Length=825

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 94/205 (46%), Positives = 127/205 (62%), Gaps = 27/205 (13%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDELAAQSTCIARVEG-----GIGFVR  269
            M+  +I+R +S++    VN   + G YG R      L A++  I          G+G++ 
Sbjct  1    MIFLKISRFISRTR--AVNGSQLIG-YGAR------LGAKTESIIGSSKPNDGLGLGYMS  51

Query  270  SYLTSVGA-------GKGIINRAY---LSDVDSIFTNPRLRRLFCSQApkkknyenyypk  419
             YL+ + A       GK  I+  +   LS +  +  NP  RRLFCS+APKKKNYEN+YPK
Sbjct  52   RYLSYLAASGDFPTHGKAAIDFMHGRCLSQL--LLLNPGSRRLFCSEAPKKKNYENFYPK  109

Query  420  nkkeIPK-TNNQKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRT  596
             KKEIPK +N+Q+    ++DS++  QGS Q++F+KQ Q+ +T LL I FVLSS    PR 
Sbjct  110  EKKEIPKGSNDQRKSDSKDDSNADDQGSFQESFMKQLQSYLTPLLLIAFVLSSFSFGPRD  169

Query  597  QNEISFQEFKNKLLEPGLVDHIXVS  671
            Q +ISFQEFKNKLLEPGLVDHI VS
Sbjct  170  QKQISFQEFKNKLLEPGLVDHIVVS  194



>ref|XP_006592193.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 3, mitochondrial-like 
isoform X1 [Glycine max]
Length=319

 Score =   102 bits (253),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 83/150 (55%), Gaps = 26/150 (17%)
 Frame = +3

Query  225  STCIARVEGGIGFVRSYLTSVGA-GKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkkny  401
            + C    +G +GFVR Y++S  A   G ++   L D  S+  NP +RRLFCS+A      
Sbjct  98   NACSEGAQGVLGFVRGYVSSARALSNGFVSN--LPDFKSVAANPTIRRLFCSKA------  149

Query  402  enyypknkkeIPKTNNQKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMV  581
                       PK  N  S +  EDS +      Q+ F+KQ + L+T LL +G  L+S  
Sbjct  150  -----------PKKEN-NSNANTEDSGNF-----QEAFMKQVKYLVTPLLLMGLFLTSFS  192

Query  582  LSPRTQNEISFQEFKNKLLEPGLVDHIXVS  671
              P  QN+ISFQEFKNKLLEPGLVDHI VS
Sbjct  193  FGPPEQNQISFQEFKNKLLEPGLVDHIVVS  222



>gb|KDP35648.1| hypothetical protein JCGZ_09086 [Jatropha curcas]
Length=828

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 76/167 (46%), Positives = 107/167 (64%), Gaps = 3/167 (2%)
 Frame = +3

Query  180  GYGVRTKVLDELAAQSTCIARVEGGIGFVRS--YLTSVGAGKGIINRAYLSDVDSIFTNP  353
            G  V+  +L     ++ CI+RV+GG+G      YLT VG G+ ++++  LS+ +S+  +P
Sbjct  31   GVTVKESILPSALLENACISRVDGGLGLGIIRGYLTFVGGGRQLLSKTNLSNSNSLLASP  90

Query  354  RLRRLFCSQApkkknyenyypknkkeIPKTN-NQKSESGREDsssgqqgsPQDNFLKQYQ  530
            R+R  F ++APK + YENYYPK+KKEIPK N ++  E    DS          NF+KQ+Q
Sbjct  91   RVRLFFSTEAPKNRKYENYYPKDKKEIPKGNESENKEGSGGDSGGSSGAGNSQNFMKQFQ  150

Query  531  NLITSLLFIGFVLSSMVLSPRTQNEISFQEFKNKLLEPGLVDHIXVS  671
            N +  +LF  F+ SS+   P+ Q +ISFQEFK KLLEPGLVDHI VS
Sbjct  151  NFLAPILFTIFLYSSVFFGPQEQKQISFQEFKTKLLEPGLVDHIVVS  197



>ref|XP_009140963.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 3, mitochondrial-like 
[Brassica rapa]
Length=803

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 117/190 (62%), Gaps = 14/190 (7%)
 Frame = +3

Query  105  MMLSRIARS-VSKSSPSTVNRGLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYLT  281
            M+ S++ RS VS+S      R  + GG GVR+  L  LA  +     VEGG+GF+R +  
Sbjct  4    MIFSKLGRSSVSRS------RCFLYGG-GVRSARL--LAPPAIEANEVEGGLGFLRRHFN  54

Query  282  SVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKSE  461
            S+ A KG++N    SD+   F NP LRR F  +APKKKNYENY+PK  KE PK+++ KS+
Sbjct  55   SLSARKGLVNN---SDLIGAFANPILRRFFSDEAPKKKNYENYFPKATKEKPKSDH-KSD  110

Query  462  SGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFKNKLLE  641
            S    S   +Q S  D F+ ++QNL+  LL +    SS       Q +ISFQEFKNKLLE
Sbjct  111  SKEGSSDKNEQESVGDMFMNRFQNLLIPLLALAVFFSSFSFGSGDQQQISFQEFKNKLLE  170

Query  642  PGLVDHIXVS  671
            PGLVDHI VS
Sbjct  171  PGLVDHIDVS  180



>ref|XP_009384842.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=833

 Score =   102 bits (254),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 89/193 (46%), Positives = 106/193 (55%), Gaps = 15/193 (8%)
 Frame = +3

Query  126  RSVSKSSPSTVNR---------GLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYL  278
            RS    SP    R          L +G  G R  +  E      CI      +   R YL
Sbjct  12   RSARSRSPRVTARRSLLPLLPVALSNGNNGARPVLSGEALLHKPCIGYE--NVAGTRGYL  69

Query  279  TSVGAGK--GIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQ  452
            TS+GA K  G+ NR  L D   +  NP  RR F S  P KKNYENY+PK+KKEIPK N  
Sbjct  70   TSLGANKAVGVGNR--LLDWRFLLANPNFRRFFSSGNPNKKNYENYFPKDKKEIPKGNAN  127

Query  453  KSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFKNK  632
                 + DSS+   G+ Q+NF+KQ+Q+LIT L+FIG + SS       Q EISFQEFKNK
Sbjct  128  NKSDPKGDSSTEDHGNFQENFMKQWQSLITPLIFIGLLFSSFSRGSFDQKEISFQEFKNK  187

Query  633  LLEPGLVDHIXVS  671
            LLE GLVDHI VS
Sbjct  188  LLEAGLVDHIVVS  200



>gb|EYU38460.1| hypothetical protein MIMGU_mgv1a001496mg [Erythranthe guttata]
Length=808

 Score =   101 bits (251),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 73/148 (49%), Positives = 99/148 (67%), Gaps = 5/148 (3%)
 Frame = +3

Query  231  CIARVEGGIGFVRSYLTSVGAGKG-IINRAYLSDVDSIFTNPRLRRLFCSQApkkknyen  407
             I + +G I F+R Y+ +VGA KG  + R   SD  +    PR+ R F S+APKKKNYEN
Sbjct  47   SINQFDGKIQFLRGYIATVGASKGSPLPRNSFSDFTAY---PRISRFFSSEAPKKKNYEN  103

Query  408  yypknkkeIPKTNNQKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLS  587
            + PK  K +P+ N QK+ S +E+ ++  QG  +D F K  QN++TSLL IG  +S++  +
Sbjct  104  FSPKENKGVPEQNEQKTGS-KEEGNTDGQGYFRDLFSKNLQNIVTSLLVIGLFISALSST  162

Query  588  PRTQNEISFQEFKNKLLEPGLVDHIXVS  671
            PR   +ISFQEFKNKLLEPGLVDHI V+
Sbjct  163  PREGEQISFQEFKNKLLEPGLVDHIVVT  190



>ref|XP_010414442.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 3, mitochondrial 
[Camelina sativa]
Length=812

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 89/196 (45%), Positives = 127/196 (65%), Gaps = 20/196 (10%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDE---LAA---QSTCIARVEGG-IGF  263
            +  S++ RS+S+S      RG ++GG GVR+ VL+E   LA     +  + +VEGG +GF
Sbjct  2    IFFSKLGRSISRS------RGFLNGG-GVRSAVLNEARLLAPSGLDAASVNQVEGGGLGF  54

Query  264  VRSYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKT  443
            +R +  S+ + KG++N    +D+  +F NPRLRR F  +APKKKNYENY+PK+ K+ PK+
Sbjct  55   LRRHFASLASRKGLVN----NDLIGVFANPRLRRFFSDEAPKKKNYENYFPKDAKQEPKS  110

Query  444  NNQKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEF  623
            + QKS+  +E S   +  +  D F+ ++QNL+  LL +G   SS       Q +ISFQEF
Sbjct  111  D-QKSDH-KEGSEKNESENVGDMFMNRFQNLLIPLLALGLFFSSFSFGSGDQQQISFQEF  168

Query  624  KNKLLEPGLVDHIXVS  671
            KNKLLEPGLVDHI VS
Sbjct  169  KNKLLEPGLVDHIDVS  184



>ref|XP_010469994.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 3, mitochondrial-like 
isoform X1 [Camelina sativa]
 ref|XP_010469995.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 3, mitochondrial-like 
isoform X2 [Camelina sativa]
Length=812

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 89/196 (45%), Positives = 127/196 (65%), Gaps = 20/196 (10%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDE---LAA---QSTCIARVEGG-IGF  263
            +  S++ RS+S+S      RG ++GG GVR+ VL+E   LA     +  + +VEGG +GF
Sbjct  2    IFFSKLGRSISRS------RGFLNGG-GVRSAVLNEARLLAPSGLDAASVNQVEGGGLGF  54

Query  264  VRSYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKT  443
            +R +  S+ + KG++N    +D+  +F NPRLRR F  +APKKKNYENY+PK+ K+ PK+
Sbjct  55   LRRHFASLASRKGLVN----NDLIGVFANPRLRRFFSDEAPKKKNYENYFPKDAKQEPKS  110

Query  444  NNQKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEF  623
            + QKS+  +E S   +  +  D F+ ++QNL+  LL +G   SS       Q +ISFQEF
Sbjct  111  D-QKSDH-KEGSEKNESENVGDMFMNRFQNLLIPLLALGLFFSSFSFGSGDQQQISFQEF  168

Query  624  KNKLLEPGLVDHIXVS  671
            KNKLLEPGLVDHI VS
Sbjct  169  KNKLLEPGLVDHIDVS  184



>ref|XP_006417796.1| hypothetical protein EUTSA_v10006814mg [Eutrema salsugineum]
 gb|ESQ36149.1| hypothetical protein EUTSA_v10006814mg [Eutrema salsugineum]
Length=815

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 78/195 (40%), Positives = 107/195 (55%), Gaps = 15/195 (8%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLD-----ELAAQSTCIARVEGGIGFVR  269
            M+ S++  SV++S  S   +GL+ G  GVR+ +L+        A      + +GG+GF+R
Sbjct  1    MIFSKLGSSVARSYRS---KGLVYG-VGVRSAILNGGRLHAPPALEAAANQADGGLGFLR  56

Query  270  SYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNN  449
                S+ A KG+      +D+   F NPRLRR F S  PKKK     Y     +    N 
Sbjct  57   RRFASLAARKGLDT----NDLSRAFANPRLRRFFSSGNPKKKKNYENYYPKDAKKAPKNE  112

Query  450  QKSESGREDsssgqqgsPQDNFLKQYQ-NLITSLLFIGFVLSSMVLSPRTQNEISFQEFK  626
            Q+SES RE S   +  +  D   K++Q N++  L+ I  +LSS  L  R Q +ISFQEFK
Sbjct  113  QRSES-REGSKKIENENVGDINTKEFQINMLVPLMAIALILSSFSLGSREQQQISFQEFK  171

Query  627  NKLLEPGLVDHIXVS  671
            NKLLE GLVDHI VS
Sbjct  172  NKLLEAGLVDHIDVS  186



>ref|XP_006592191.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X2 [Glycine max]
Length=782

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 82/150 (55%), Gaps = 26/150 (17%)
 Frame = +3

Query  225  STCIARVEGGIGFVRSYLTSVGA-GKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkkny  401
            + C    EG +G VR Y++S  A   G ++   L D  S+  NP +RRLFCS+A      
Sbjct  36   NACSEGAEGVLGSVRGYVSSARARSNGFVSN--LPDFKSVAANPTIRRLFCSKA------  87

Query  402  enyypknkkeIPKTNNQKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMV  581
                       PK  N  S +  EDS +      Q+ F+KQ + L+T LL +G  L+S  
Sbjct  88   -----------PKKENN-SNANTEDSGNF-----QEAFMKQVKYLVTPLLLMGLFLTSFS  130

Query  582  LSPRTQNEISFQEFKNKLLEPGLVDHIXVS  671
              P  QN+ISFQEFKNKLLEPGLVDHI VS
Sbjct  131  FGPPEQNQISFQEFKNKLLEPGLVDHIVVS  160



>ref|XP_010510537.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 3, mitochondrial-like 
[Camelina sativa]
Length=809

 Score = 93.6 bits (231),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 123/191 (64%), Gaps = 15/191 (8%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPSTVNRGLISGGYGVRT-KVLDELAAQSTCIARVEG-GIGFVRSYL  278
            +  S++ RS+S+S      RG ++G  GVR+ ++L     ++  + +VEG G+GF+R + 
Sbjct  4    IFFSKLGRSISRS------RGFLNGS-GVRSARLLAPSGLEAASVNQVEGEGLGFLRRHF  56

Query  279  TSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKS  458
             S+ + KG++N    +D+  +  NPRLRR F  +APKKKNYENY+PK+ K+ PK++ QKS
Sbjct  57   ASLASRKGLVN----NDLIGVLANPRLRRFFSDEAPKKKNYENYFPKDPKQEPKSD-QKS  111

Query  459  ESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFKNKLL  638
            +  +E S   +  +  D F+ ++QNL+  LL +G   SS       Q +ISFQEFKNKLL
Sbjct  112  DH-KEGSEKNESENVGDMFMNRFQNLLIPLLALGLFFSSFSFGSGDQQQISFQEFKNKLL  170

Query  639  EPGLVDHIXVS  671
            EPGLVDHI VS
Sbjct  171  EPGLVDHIDVS  181



>ref|XP_009125053.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 3, mitochondrial 
[Brassica rapa]
Length=814

 Score = 92.8 bits (229),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 81/191 (42%), Positives = 113/191 (59%), Gaps = 13/191 (7%)
 Frame = +3

Query  102  TMMLSRIARSVSKSSPSTVNRGLISGGYGVRT-KVLDELAAQSTCIARVEGGIGFVRSYL  278
            TM  S++ RS       +V+R     G GVR+ +++   A ++       GG+GF+  + 
Sbjct  2    TMFFSKLGRS-------SVSRSRFLHGGGVRSARLIGPPAVEAAASVNQGGGLGFLSRHF  54

Query  279  TSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKS  458
             S+   KG+++   +     +F NPRLRR F  +APKKKNYENY+PK  K+ PK++ QKS
Sbjct  55   ASLTGRKGLVDNDLIG---GVFANPRLRRFFSDEAPKKKNYENYFPKTPKQEPKSD-QKS  110

Query  459  ESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFKNKLL  638
            ES +E S   +  +  D F  ++QNL+  LL +   LSS       Q +ISFQEFKNKLL
Sbjct  111  ES-KEGSDKNENENLGDMFANRFQNLLIPLLALAIFLSSFSFGSGDQQQISFQEFKNKLL  169

Query  639  EPGLVDHIXVS  671
            EPGLVDHI VS
Sbjct  170  EPGLVDHIDVS  180



>gb|EPS71434.1| hypothetical protein M569_03325, partial [Genlisea aurea]
Length=778

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 66/140 (47%), Positives = 92/140 (66%), Gaps = 9/140 (6%)
 Frame = +3

Query  264  VRSYLTSVGAGKGIINRAYLSDVDSIFTNPRLR-RLFCSQApkkknyenyypknkkeIPK  440
            +RSY +++GA KG ++R+Y SD      N RL  R FC++APKKKNYE++YPK KKE PK
Sbjct  37   LRSYFSTLGAYKGSVSRSYASDFRHFGRNFRLNNRSFCAEAPKKKNYESFYPKPKKETPK  96

Query  441  TNNQ---KSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEIS  611
               +   K E  +ED ++      Q+ F++ +QN+IT L+ +G  +S+       + +IS
Sbjct  97   QEQKSGFKEEGSKEDQANF-----QETFIRNFQNVITPLIVLGLFISAFTPKANDEKQIS  151

Query  612  FQEFKNKLLEPGLVDHIXVS  671
            FQEFKNKLLEPGLVD I VS
Sbjct  152  FQEFKNKLLEPGLVDRIVVS  171



>gb|KHN32138.1| ATP-dependent zinc metalloprotease FTSH 10, mitochondrial [Glycine 
soja]
Length=771

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 58/150 (39%), Positives = 79/150 (53%), Gaps = 33/150 (22%)
 Frame = +3

Query  225  STCIARVEGGIGFVRSYLTSVGA-GKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkkny  401
            + C    +G +GFVR Y++S  A   G ++   L D  S+  NP +RRLFCS+A      
Sbjct  36   NACSEGAQGVLGFVRGYVSSARALSNGFVSN--LPDFKSVAANPTIRRLFCSKA------  87

Query  402  enyypknkkeIPKTNNQKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMV  581
                       PK   ++ +SG            Q+ F+KQ + L+T LL +G  L+S  
Sbjct  88   -----------PK---KEKDSGNF----------QEAFMKQVKYLVTPLLLMGLFLTSFK  123

Query  582  LSPRTQNEISFQEFKNKLLEPGLVDHIXVS  671
              P  Q +ISF+EFK KLLEPGLVDHI VS
Sbjct  124  FGPPKQKQISFREFKKKLLEPGLVDHIVVS  153



>ref|XP_002313426.1| FtsH protease family protein [Populus trichocarpa]
 gb|EEE87381.1| FtsH protease family protein [Populus trichocarpa]
Length=786

 Score = 90.5 bits (223),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 71/143 (50%), Positives = 95/143 (66%), Gaps = 7/143 (5%)
 Frame = +3

Query  252  GIGFVRSYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkke  431
            G+G +R YLTS+G+ +G  N  +LSD++SI  NPR+RR F ++APKKKNYEN+YPK KKE
Sbjct  20   GLGLLRGYLTSIGS-RGTHN-PFLSDLNSILANPRIRRFFSTEAPKKKNYENFYPKGKKE  77

Query  432  IPKTNNQKSESGREDsssgqqgsPQDN---FLKQYQNLITSLLFIGFVLSSMVLSPRTQN  602
            +PK   QKSES +E+SS+        N   F+K +  L+  L  +  +          + 
Sbjct  78   VPKGEKQKSES-KENSSNADHDESDFNKGTFMKAFY-LLAPLFVVQLLFYPFSFGDGDKQ  135

Query  603  EISFQEFKNKLLEPGLVDHIXVS  671
            +ISFQEFKN+LLEPGLVDHI VS
Sbjct  136  QISFQEFKNRLLEPGLVDHIVVS  158



>emb|CDX77230.1| BnaC04g40250D [Brassica napus]
Length=789

 Score = 90.5 bits (223),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 87/190 (46%), Positives = 111/190 (58%), Gaps = 29/190 (15%)
 Frame = +3

Query  105  MMLSRIARS-VSKSSPSTVNRGLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYLT  281
            M+ S++ RS VS+S      RG + GG GVR+  L  LA+ +     VEGG+GF+R +  
Sbjct  4    MIFSKLGRSSVSRS------RGFLYGG-GVRSARL--LASPAFEANEVEGGLGFLRRHFN  54

Query  282  SVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKSE  461
            S+ A KG++N    SD+   F NP LRR F  +APKKKNYE Y+PK  KE PK N+ KS+
Sbjct  55   SLSARKGLVNN---SDLVGAFANPILRRFFSDEAPKKKNYETYFPKATKEKPK-NDHKSD  110

Query  462  SGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFKNKLLE  641
            S    S   +Q S  D F+ ++QNL+  L                   ISFQEFKNKLLE
Sbjct  111  SKEGSSDKNEQESVGDMFMNRFQNLLIPL---------------LALAISFQEFKNKLLE  155

Query  642  PGLVDHIXVS  671
            PGLVDHI VS
Sbjct  156  PGLVDHIDVS  165



>emb|CDY31753.1| BnaA04g16890D [Brassica napus]
Length=788

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 86/190 (45%), Positives = 111/190 (58%), Gaps = 29/190 (15%)
 Frame = +3

Query  105  MMLSRIARS-VSKSSPSTVNRGLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYLT  281
            M+ S++ RS VS+S      R  + GG GVR+  L  LA  +     VEGG+GF+R +  
Sbjct  4    MIFSKLGRSSVSRS------RCFLYGG-GVRSARL--LAPPAIEANEVEGGLGFLRRHFN  54

Query  282  SVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKSE  461
            S+ A KG++N    SD+   F NP LRR F  +APKKKNYENY+PK  KE PK+++ KS+
Sbjct  55   SLSARKGLVNN---SDLIGAFANPILRRFFSDEAPKKKNYENYFPKATKEKPKSDH-KSD  110

Query  462  SGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFKNKLLE  641
            S    S   +Q S  D F+ ++QNL+  L                   ISFQEFKNKLLE
Sbjct  111  SKEGSSDKNEQESVGDMFMNRFQNLLIPL---------------LALAISFQEFKNKLLE  155

Query  642  PGLVDHIXVS  671
            PGLVDHI VS
Sbjct  156  PGLVDHIDVS  165



>ref|XP_002439915.1| hypothetical protein SORBIDRAFT_09g022490 [Sorghum bicolor]
 gb|EES18345.1| hypothetical protein SORBIDRAFT_09g022490 [Sorghum bicolor]
Length=815

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 70/190 (37%), Positives = 96/190 (51%), Gaps = 6/190 (3%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYLTS  284
            M L+ +AR++ +S+ S+  R     G G+R               R  G  GFVRSYLT+
Sbjct  1    MTLASLARALGRSARSSRPRQGFQLG-GLRQSPA--PPLPPPVHGRESGATGFVRSYLTA  57

Query  285  VG-AGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKSE  461
               A  G        D   I  +P+ RRLF  ++ K         K +   PK +     
Sbjct  58   ASSAALGKPAAGKTVDWRYILASPQFRRLFSDESKKNYENYYPKGKKEA--PKGDGSNKS  115

Query  462  SGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFKNKLLE  641
              +++S++ +  + QDN +K  QN +  LL +G +LSSM  S   Q EISFQEFKNKLLE
Sbjct  116  ESKQESNTDEGWNFQDNAMKHLQNFLAPLLILGLMLSSMSSSTADQKEISFQEFKNKLLE  175

Query  642  PGLVDHIXVS  671
            PGLVD I VS
Sbjct  176  PGLVDRIVVS  185



>ref|XP_008366731.1| PREDICTED: uncharacterized protein LOC103430373 [Malus domestica]
Length=220

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 54/177 (31%), Positives = 88/177 (50%), Gaps = 16/177 (9%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVL-DELAAQSTCI--ARVEGGIGFVRSY  275
            M+ S I RS++ S+ S +NR +ISG Y  R  +  D      T +  A V+G +G +R Y
Sbjct  1    MVFSSIRRSITHSARSKLNRNVISGSYNWRNTLRHDSFPPSXTPLGNACVDGCVGILRGY  60

Query  276  LTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQK  455
            +   GAGK  +++AY+S++ S+   PR+RRLF SQ              +K + +     
Sbjct  61   IAYNGAGKQXLSKAYMSNLKSVLGIPRIRRLFSSQG-------PGKKTLRKLLSEKQEGN  113

Query  456  SESGREDsssgqqgsPQ------DNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEI  608
            SE GR +    +    +          + Y   I  L+FIGF+++S+ L+P    E+
Sbjct  114  SERGRTEIXVQRGIKCRWSGEYSGTVFEAYSRFIAPLMFIGFIVTSLFLNPHQTKEV  170



>ref|XP_011032280.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Populus euphratica]
 ref|XP_011042728.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Populus euphratica]
Length=813

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 98/159 (62%), Gaps = 14/159 (9%)
 Frame = +3

Query  225  STCIARVEGGI-------GFVRSYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQA  383
            S  I  +EGG        G +R YLTS+G+ +G  N  +LSD++SI  NPR+RR F ++A
Sbjct  31   SAVINNIEGGFIDGRGGLGLLRGYLTSIGS-RGTHN-PFLSDLNSILANPRIRRFFSTEA  88

Query  384  pkkknyenyypknkkeIPKTNNQKSESGREDsssgqqgsPQDN---FLKQYQNLITSLLF  554
            PKKKNYEN+YPK KKE+PK   QKSES +E+SS+        N   F+K +  L+  L  
Sbjct  89   PKKKNYENFYPKGKKEVPKGEKQKSES-KENSSNADHDESDFNKRTFMKAFY-LLAPLFV  146

Query  555  IGFVLSSMVLSPRTQNEISFQEFKNKLLEPGLVDHIXVS  671
               +          + +ISFQEFKN+LLEPGLVDHI VS
Sbjct  147  AQLLFYPFSFGDGDKQQISFQEFKNRLLEPGLVDHIVVS  185



>gb|AFW82207.1| hypothetical protein ZEAMMB73_958383 [Zea mays]
Length=815

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 70/191 (37%), Positives = 98/191 (51%), Gaps = 8/191 (4%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDELAAQSTCIARVEGGI-GFVRSYLT  281
            M L+ +AR++ +S+ S+  R     G G+R             +   EGG  GFVRSYLT
Sbjct  1    MTLASLARALGRSARSSRPRQGFQLG-GLRQPPA---PPLPPPVHGGEGGAAGFVRSYLT  56

Query  282  SVG-AGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKS  458
            +   A  G  +     D   +  +P  RRLF   + K         K +  +PK +    
Sbjct  57   AASSAALGKPSAGKTVDWRYVLASPHFRRLFSDGSKKNYENYYPKGKKE--VPKGDGTNK  114

Query  459  ESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFKNKLL  638
               +++S++ +  + QDN +K  QN +  LL +G +LSSM  S   Q EISFQEFKNKLL
Sbjct  115  SESKQESNTDEGWNFQDNAMKHMQNFLAPLLILGLMLSSMSSSSADQKEISFQEFKNKLL  174

Query  639  EPGLVDHIXVS  671
            EPGLVD I VS
Sbjct  175  EPGLVDRIVVS  185



>ref|XP_003567261.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 3, mitochondrial-like 
[Brachypodium distachyon]
Length=635

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 69/195 (35%), Positives = 99/195 (51%), Gaps = 21/195 (11%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYLTS  284
            M LS + R++S+S      +G + GG+G   +           +    GG+GFVR YLTS
Sbjct  1    MSLSSLPRALSRS-----RQGSLLGGHG-GFRAPLPSPPPPPLLDSASGGLGFVRRYLTS  54

Query  285  VGAGKGIINRA--YLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTN-NQK  455
                +     A   + D  S+  N + RRLFC Q+ K  +      K +   PK + + K
Sbjct  55   ALVHRSAAANAPGKVGDWRSLLANSQSRRLFCDQSKKNYDKSCPNGKEE---PKGDGSDK  111

Query  456  SESGREDsssgqqgsPQDNFLKQYQNL---ITSLLFIGFVLSSMVLSPRTQNEISFQEFK  626
            SES ++          Q NF ++   L   +  +  +  +LS++ LS   Q+EISFQEFK
Sbjct  112  SESKQK-----FNSGSQWNFQEKLDKLFRFLAPVFLLELILSTLPLS-TAQHEISFQEFK  165

Query  627  NKLLEPGLVDHIXVS  671
            NKLLEPGLVDHI VS
Sbjct  166  NKLLEPGLVDHIVVS  180



>ref|XP_010043512.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X2 [Eucalyptus grandis]
 ref|XP_010043513.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X2 [Eucalyptus grandis]
Length=683

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +3

Query  516  LKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFKNKLLEPGLVDHIXVS  671
            +KQ+QNLIT L+ IG  LSS    PR Q +ISFQEFKNKLLEPGLVDHI +S
Sbjct  1    MKQFQNLITPLVVIGLFLSSFSFGPREQQQISFQEFKNKLLEPGLVDHIVIS  52



>emb|CDY39531.1| BnaC04g15300D [Brassica napus]
Length=822

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 84/207 (41%), Positives = 115/207 (56%), Gaps = 36/207 (17%)
 Frame = +3

Query  102  TMMLSRIARS-VSKSSPSTVNRGLISGGYGVRT-KVLDELAAQSTCIARVEGGIGFVRSY  275
            TM  S++ RS VS+S      RG + GG GVR+ +++   A Q        GG+GF+  +
Sbjct  2    TMFFSKLGRSSVSRS------RGFLYGG-GVRSLRLIGPPANQG-------GGLGFLSRH  47

Query  276  LTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQK  455
              S+   KG+++    +D+  +F NPRL R F  +APKKKNYENY+PK  K+    ++QK
Sbjct  48   FASLTGRKGLLD----NDLIGVFANPRLGRFFSDEAPKKKNYENYFPKAPKQEEPKSDQK  103

Query  456  SESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNE----------  605
            SES +E S   +  +  D F  ++QNL+  LL +   LSS       Q +          
Sbjct  104  SES-KEGSDKNENENLGDMFANRFQNLLIPLLALAIFLSSFSFGSGDQQQAKHLYSKLCN  162

Query  606  -----ISFQEFKNKLLEPGLVDHIXVS  671
                 ISFQEFKNKLLEPGLVDHI VS
Sbjct  163  ILESCISFQEFKNKLLEPGLVDHIDVS  189



>ref|XP_008359096.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Malus domestica]
Length=777

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = +3

Query  504  QDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFKNKLLEPGLVDHIXVS  671
            Q+ FL+Q+QNLIT LL IG  LSS       Q +ISFQEFKNKLLEPGLVDHI VS
Sbjct  95   QETFLRQFQNLITPLLVIGLFLSSFSFGSPDQQQISFQEFKNKLLEPGLVDHIVVS  150



>ref|XP_011007151.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X2 [Populus euphratica]
Length=709

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = +3

Query  510  NFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFKNKLLEPGLVDHIXVS  671
            N LKQ+QN+IT LLF+ FV SSM  + + Q +ISFQEFKNKLLEPGLVD I VS
Sbjct  32   NTLKQFQNIITPLLFLAFVYSSMFFNTQEQKQISFQEFKNKLLEPGLVDRIVVS  85



>emb|CDY47876.1| BnaA07g14210D [Brassica napus]
Length=830

 Score = 77.4 bits (189),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 79/206 (38%), Positives = 111/206 (54%), Gaps = 28/206 (14%)
 Frame = +3

Query  102  TMMLSRIARSVSKSSPSTVNRGLISGGYGVRT-KVLDELAAQSTCIARVEGGIGFVRSYL  278
            TM  S++ RS       +V+R     G GVR+ +++   A ++       GG+GF+  + 
Sbjct  2    TMFFSKLGRS-------SVSRSRFLHGGGVRSARLIGPPAVEAAASVNQGGGLGFLSRHF  54

Query  279  TSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKS  458
             S+   KG++    +     +F NPRL R F  +APKKKNYENY+PK  K+ PK+++ KS
Sbjct  55   ASLTGRKGLVENDLIG---GVFANPRLGRFFSDEAPKKKNYENYFPKAPKQEPKSDH-KS  110

Query  459  ESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNE-----------  605
            ES +E S   +  +  D F  ++QNL+  LL +   LSS       Q +           
Sbjct  111  ES-KEGSDKNENENLGDMFANRFQNLLIPLLALAIFLSSFSFGSGDQQQAKHLYSKLCNI  169

Query  606  ----ISFQEFKNKLLEPGLVDHIXVS  671
                ISFQEFKNKLLEPGLVDHI VS
Sbjct  170  LESCISFQEFKNKLLEPGLVDHIDVS  195



>ref|XP_003568313.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial 
[Brachypodium distachyon]
Length=814

 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 76/195 (39%), Positives = 106/195 (54%), Gaps = 19/195 (10%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPSTVNR-GLISGGY-GVRTKVLDELAAQSTCIARVEGG----IGFV  266
            M L+ +AR V +S+ S+  R G   GG  G+R       A  +  +  V GG    +G +
Sbjct  1    MSLASLARVVGRSARSSRPRQGFSLGGLSGLR-------APTAPPLPPVHGGDVGALGLL  53

Query  267  RSYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTN  446
            R Y+T+   G+  + +A  SD   +  +P+ RRLFCS + K         K     PK +
Sbjct  54   RGYMTA-SLGRPAVGKA--SDWRYLLASPQFRRLFCSGSKKNYENYYPNGKKGA--PKGD  108

Query  447  NQKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFK  626
                +S ++DS++  Q + QD F KQ QN +  LL +G +LSS+  S   Q EISFQEFK
Sbjct  109  GSNKDS-KQDSNTDDQWNFQDAFGKQLQNFLAPLLLLGLMLSSLSSSSSDQKEISFQEFK  167

Query  627  NKLLEPGLVDHIXVS  671
            NKLLEPGLVD I VS
Sbjct  168  NKLLEPGLVDRIVVS  182



>ref|XP_004961860.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
[Setaria italica]
Length=816

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 44/111 (40%), Positives = 62/111 (56%), Gaps = 2/111 (2%)
 Frame = +3

Query  339  IFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKSESGREDsssgqqgsPQDNFL  518
            +  +P+ RRLF  ++ K         K +  +PK +       +++S+     + Q+  +
Sbjct  77   LLASPQFRRLFSDESKKNYENYYPKGKKE--VPKGDGSNKSESKQESTDEGGWNFQETAM  134

Query  519  KQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFKNKLLEPGLVDHIXVS  671
            KQ QN +  LL +G +LSSM      Q EISFQEFKNKLLEPGLVD I VS
Sbjct  135  KQLQNFLAPLLILGLMLSSMSSGTADQKEISFQEFKNKLLEPGLVDRIVVS  185



>ref|XP_006592192.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X3 [Glycine max]
Length=674

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +3

Query  516  LKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFKNKLLEPGLVDHIXVS  671
            +KQ + L+T LL +G  L+S    P  QN+ISFQEFKNKLLEPGLVDHI VS
Sbjct  1    MKQVKYLVTPLLLMGLFLTSFSFGPPEQNQISFQEFKNKLLEPGLVDHIVVS  52



>ref|XP_004970544.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 3, mitochondrial-like 
[Setaria italica]
Length=810

 Score = 71.2 bits (173),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 68/196 (35%), Positives = 108/196 (55%), Gaps = 16/196 (8%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPSTV---NRGLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSY  275
            M LS ++R++++S+ ST       L+ G  G+R       +     +    GG+GFVRSY
Sbjct  1    MSLSSLSRALARSARSTRPPRQGSLLEGYAGLRAAPTPRPSMPGGDV----GGLGFVRSY  56

Query  276  LTSVGAGKGI--INRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNN  449
            LTS    +      +  L D   +  + + RRLF   + K     +   K ++  PK + 
Sbjct  57   LTSALGSRAAAPTGQGKLGDWRFLLASSQFRRLFSDGSNKNYEKYHPKEKQEE--PKGDG  114

Query  450  QKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPR--TQNEISFQEF  623
                + ++DS+S  Q + +++ +K++Q L+  LLF+G VL+++   PR  +  +ISFQEF
Sbjct  115  SDKSNPKKDSNSKFQWNFKEDVMKKFQELLAPLLFLGLVLATL---PRGNSAQQISFQEF  171

Query  624  KNKLLEPGLVDHIXVS  671
            KNKLLEPGLVDHI VS
Sbjct  172  KNKLLEPGLVDHIVVS  187



>dbj|BAJ89991.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=279

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 62/190 (33%), Positives = 96/190 (51%), Gaps = 15/190 (8%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYLTS  284
            M LS ++R++++SS S   +G + GG+GV +     L + S        G+  VR YLTS
Sbjct  1    MSLSALSRALARSSRS--RQGYLLGGHGVFSA---PLPSHSPPPGGDSAGLRLVRRYLTS  55

Query  285  V--GAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKS  458
                               S+  N + RR+F  Q+ K    E         +PK +    
Sbjct  56   ALGSRAAAANGAGKARGWRSLLANSQSRRMFSDQSKKNFPKEKE-------VPKGDGSNK  108

Query  459  ESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFKNKLL  638
               +++SSSG Q   Q+ F+K +++ +  +  +G ++ + V    ++ EISFQEFKNKLL
Sbjct  109  SESKKESSSGGQPKAQEKFVKLFEDTLGPVFLLGLLVLATVPG-SSEKEISFQEFKNKLL  167

Query  639  EPGLVDHIXV  668
            EPGLVDHI V
Sbjct  168  EPGLVDHIVV  177



>ref|XP_010042847.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Eucalyptus grandis]
Length=130

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 66/97 (68%), Gaps = 4/97 (4%)
 Frame = +3

Query  186  GVRTKVLDELAAQST----CIARVEGGIGFVRSYLTSVGAGKGIINRAYLSDVDSIFTNP  353
            GVR+  L+  ++ +      +  ++G +GFVR YL S GA KG   ++YLSD++ +  NP
Sbjct  24   GVRSGPLNGASSGTPRLDGALGGLDGKLGFVREYLASAGAIKGFSAKSYLSDLNRVLANP  83

Query  354  RLRRLFCSQApkkknyenyypknkkeIPKTNNQKSES  464
            R+ R F S+APKKKNYENY PK +KE+PK N QKSES
Sbjct  84   RVHRFFSSEAPKKKNYENYCPKGRKEVPKGNEQKSES  120



>ref|XP_008350440.1| PREDICTED: uncharacterized protein LOC103413780 [Malus domestica]
Length=253

 Score = 66.2 bits (160),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 58/96 (60%), Gaps = 3/96 (3%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVL-DELAAQSTCI--ARVEGGIGFVRSY  275
            M+ S I RS++ S+ S +NR +ISG Y  R  +  D      T +  A V+G +G +R Y
Sbjct  1    MVFSSIRRSITHSARSKLNRNVISGSYNWRNTLRHDSFPPSXTPLGNACVDGCVGILRGY  60

Query  276  LTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQA  383
            +   GAGK  +++AY+S++ S+   PR+RRLF SQ 
Sbjct  61   IAYNGAGKQXLSKAYMSNLKSVLGIPRIRRLFSSQG  96



>ref|XP_008358519.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Malus domestica]
Length=800

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 75/199 (38%), Positives = 112/199 (56%), Gaps = 23/199 (12%)
 Frame = +3

Query  105  MMLSRIARSVSKSS--PSTVN-RGLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSY  275
            M+ +RI RSVS+SS   + +N RG  +G  G     +  +    + +  V+G + F+RSY
Sbjct  1    MIFTRIGRSVSRSSRFGNLLNGRGRSAGLIG--NGGISGVPRCGSYLGPVDGELRFLRSY  58

Query  276  LTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQK  455
              +  A     ++A +SD   I  NP+L   F S+ PKKKN EN++PK KKEIPK + QK
Sbjct  59   FAASIAA----HKARVSDFSCILANPKLCLHFSSETPKKKNSENFHPKEKKEIPKGDEQK  114

Query  456  SESGREDsssgqqgsPQDNFLKQYQNLITSL--------LFIGFVLSSMVLSPRTQNEIS  611
            ++   E  +       Q  FL+   NLI  L        + + +V+  + +S + + +IS
Sbjct  115  TKPKDESKTDN-----QKFFLRHAPNLIILLSAIMILLSILLIYVVKQIEISVQ-EMQIS  168

Query  612  FQEFKNKLLEPGLVDHIXV  668
            FQEFKN+LLEPGLVD+I V
Sbjct  169  FQEFKNQLLEPGLVDNIVV  187



>ref|XP_009600786.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
[Nicotiana tomentosiformis]
 ref|XP_009600787.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
[Nicotiana tomentosiformis]
Length=716

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 43/53 (81%), Gaps = 2/53 (4%)
 Frame = +3

Query  516  LKQYQNLITSLLFIGFVLSS-MVLSPRTQNEISFQEFKNKLLEPGLVDHIXVS  671
            +K+YQ LI SLLF+GF LSS ++LS   Q EISFQEFKNKLLEPGLVD I V+
Sbjct  1    MKRYQ-LILSLLFVGFALSSILLLSYFEQEEISFQEFKNKLLEPGLVDRIVVA  52



>dbj|BAJ98147.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91973.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK03446.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93081.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=811

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 60/141 (43%), Positives = 73/141 (52%), Gaps = 6/141 (4%)
 Frame = +3

Query  249  GGIGFVRSYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkk  428
            G +G VR YLT   A  G       SD   +  +P+ RRLFCS + K         K + 
Sbjct  45   GPLGLVRGYLT---ASLGSPATVKTSDWRYLLASPQFRRLFCSGSKKNYENYYPKGKKEA  101

Query  429  eIPKTNNQKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEI  608
              PK +    +S  E  + GQ    QD   KQ QN +  LL +G + SS+  S   Q EI
Sbjct  102  --PKGDGSNKDSKHESGTDGQWNF-QDGTFKQLQNFLGPLLLLGLMFSSLSSSSSDQKEI  158

Query  609  SFQEFKNKLLEPGLVDHIXVS  671
            SFQEFKNKLLEPGLVD I VS
Sbjct  159  SFQEFKNKLLEPGLVDRIVVS  179



>ref|NP_001055745.1| Os05g0458400 [Oryza sativa Japonica Group]
 sp|Q0DHL4.1|FTSH8_ORYSJ RecName: Full=ATP-dependent zinc metalloprotease FTSH 8, mitochondrial; 
Short=OsFTSH8; Flags: Precursor [Oryza sativa Japonica 
Group]
 dbj|BAF17659.1| Os05g0458400 [Oryza sativa Japonica Group]
Length=822

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 58/137 (42%), Positives = 74/137 (54%), Gaps = 4/137 (3%)
 Frame = +3

Query  261  FVRSYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPK  440
            FVR YLT+       +     +D  SI  NP+ RRLF   + K         K +   PK
Sbjct  59   FVRGYLTAALGRPAAVKAG--TDWRSILANPQFRRLFSDGSKKNYENYYPKGKKEA--PK  114

Query  441  TNNQKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQE  620
             +       ++DSS+  Q + Q+   KQ QN +  LLF+G +LSS+  S   Q EISFQE
Sbjct  115  GDGSNKSDSKQDSSTDDQWNFQETASKQLQNFLAPLLFLGLMLSSLSSSSSDQKEISFQE  174

Query  621  FKNKLLEPGLVDHIXVS  671
            FKNKLLEPGLVD I VS
Sbjct  175  FKNKLLEPGLVDRIVVS  191



>gb|EEE63976.1| hypothetical protein OsJ_18802 [Oryza sativa Japonica Group]
Length=792

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 58/137 (42%), Positives = 74/137 (54%), Gaps = 4/137 (3%)
 Frame = +3

Query  261  FVRSYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPK  440
            FVR YLT+       +     +D  SI  NP+ RRLF   + K         K +   PK
Sbjct  29   FVRGYLTAALGRPAAVKAG--TDWRSILANPQFRRLFSDGSKKNYENYYPKGKKEA--PK  84

Query  441  TNNQKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQE  620
             +       ++DSS+  Q + Q+   KQ QN +  LLF+G +LSS+  S   Q EISFQE
Sbjct  85   GDGSNKSDSKQDSSTDDQWNFQETASKQLQNFLAPLLFLGLMLSSLSSSSSDQKEISFQE  144

Query  621  FKNKLLEPGLVDHIXVS  671
            FKNKLLEPGLVD I VS
Sbjct  145  FKNKLLEPGLVDRIVVS  161



>gb|EEC79350.1| hypothetical protein OsI_20217 [Oryza sativa Indica Group]
Length=829

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 58/137 (42%), Positives = 74/137 (54%), Gaps = 4/137 (3%)
 Frame = +3

Query  261  FVRSYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPK  440
            FVR YLT+       +     +D  SI  NP+ RRLF   + K         K +   PK
Sbjct  66   FVRGYLTAALGRPAAVKAG--TDWRSILANPQFRRLFSDGSKKNYENYYPKGKKEA--PK  121

Query  441  TNNQKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQE  620
             +       ++DSS+  Q + Q+   KQ QN +  LLF+G +LSS+  S   Q EISFQE
Sbjct  122  GDGSNKSDSKQDSSTDDQWNFQETASKQLQNFLAPLLFLGLMLSSLSSSSSDQKEISFQE  181

Query  621  FKNKLLEPGLVDHIXVS  671
            FKNKLLEPGLVD I VS
Sbjct  182  FKNKLLEPGLVDRIVVS  198



>gb|KFK40664.1| hypothetical protein AALP_AA2G026000 [Arabis alpina]
Length=187

 Score = 62.4 bits (150),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 57/93 (61%), Gaps = 13/93 (14%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYLTS  284
            M+ S++ RS+S+S      RGL+ GG GVR+  L  LA  +  ++ VE G+GF+R +  S
Sbjct  1    MIFSKLGRSISRS------RGLLYGG-GVRSARL--LAPPAFEVSEVESGLGFLRRHFAS  51

Query  285  VGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQA  383
            + A KG++N    +D+  +F NPR+ R F  +A
Sbjct  52   LSARKGLVN----NDLTGVFANPRILRFFSDEA  80



>ref|XP_010521866.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial 
isoform X2 [Tarenaya hassleriana]
Length=679

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +3

Query  513  FLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFKNKLLEPGLVDHIXVS  671
            F+K++QN++  LL IG +LSS       + +ISFQEF+NKLLEPGLVD I V 
Sbjct  2    FMKKFQNMLIPLLAIGLILSSFSFDSVERQKISFQEFRNKLLEPGLVDRIEVE  54



>ref|XP_006655377.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
[Oryza brachyantha]
Length=798

 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 56/137 (41%), Positives = 75/137 (55%), Gaps = 5/137 (4%)
 Frame = +3

Query  261  FVRSYLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPK  440
            FVR YLT+   G   + +A      S+  NP+ RRLF   + K         K +   PK
Sbjct  36   FVRGYLTAA-LGSPAVGKA--GGWRSLLANPQFRRLFSDGSKKNYENYYPKGKKEA--PK  90

Query  441  TNNQKSESGREDsssgqqgsPQDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQE  620
             +       +++SSS  Q + Q+  +KQ QN +  +LF+  +LSS+  S   Q EISFQE
Sbjct  91   GDGSNKSDSKQESSSDDQWNFQETAIKQLQNFLAPVLFLALMLSSLSSSSSEQKEISFQE  150

Query  621  FKNKLLEPGLVDHIXVS  671
            FKNKLLEPGLVD I VS
Sbjct  151  FKNKLLEPGLVDRIVVS  167



>ref|XP_006644995.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 3, mitochondrial-like 
[Oryza brachyantha]
Length=807

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 67/203 (33%), Positives = 96/203 (47%), Gaps = 36/203 (18%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPSTVNR--GLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYL  278
            M LS ++R++++S  S+  R   L+ G  G+R       A+         GG+GF+R+Y+
Sbjct  1    MSLSSLSRALARSERSSRQRQGSLLRGHGGLR-------ASLPLSPPPPPGGLGFLRNYV  53

Query  279  TS---------VGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkke  431
            TS          GAGKG        D   +  N + RR F  ++ K     +        
Sbjct  54   TSFVGNRTVVATGAGKG-------GDWRFLLANRQFRRQFSDESNKNYEKNSGKE-----  101

Query  432  IPKTNNQKSESGREDsssgqqgsPQDNF---LKQYQNLITSLLFIGFVLSSMVLSPRTQN  602
              K  ++  ES   DS        Q NF   +K+++++I  L   G  L S+  S   Q 
Sbjct  102  --KEKDEGGESDNSDSKKQSSSGDQWNFQEIIKRFKDMIAPLFLFGLFLLSVPASSSEQ-  158

Query  603  EISFQEFKNKLLEPGLVDHIXVS  671
            EI+FQEFKNKLLEPG VDHI VS
Sbjct  159  EINFQEFKNKLLEPGFVDHIVVS  181



>ref|XP_002458748.1| hypothetical protein SORBIDRAFT_03g039540 [Sorghum bicolor]
 gb|EES03868.1| hypothetical protein SORBIDRAFT_03g039540 [Sorghum bicolor]
Length=808

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 61/186 (33%), Positives = 84/186 (45%), Gaps = 41/186 (22%)
 Frame = +3

Query  168  LISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYLTSV---------GAGKGIINRAY  320
            L+ G  G+R       A +ST     E G+GF RSYLTS          GAGK       
Sbjct  26   LLEGYAGLRAAP----APRSTIPGGDERGLGFARSYLTSALGSRAAAPTGAGK-------  74

Query  321  LSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQKSESGREDsssgqqgs  500
            + D   +  + + RRLF   + K     +         PK   QK E    D S  ++ S
Sbjct  75   VGDWRFLLASSQFRRLFSDGSNKDYEKYH---------PKEKEQKPEGDGSDKSDSKKDS  125

Query  501  P-------QDNFLKQYQNLITSLLFIGFVLSSMVLSPR--TQNEISFQEFKNKLLEPGLV  653
                    Q++ +K++Q  +     I  +   +   P+  +  EISFQEFKNKLLEPGLV
Sbjct  126  NSNNQWNFQEDVMKKFQEFLAP---ILLLGLMLATLPKGSSVQEISFQEFKNKLLEPGLV  182

Query  654  DHIXVS  671
            DHI V+
Sbjct  183  DHIVVA  188



>gb|KJB36698.1| hypothetical protein B456_006G171800 [Gossypium raimondii]
Length=617

 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 52/95 (55%), Gaps = 9/95 (9%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPSTVNRGLISGGYGVRTKVLDEL----AAQSTCIARVEGGIGFVRS  272
            M++SRI RS+S SS       +IS     R  +L+E        + CI+ V  G+G +R 
Sbjct  1    MIVSRIGRSLSCSSSFNFKNNVIS-----RNLLLNETHIPRPVGNACISHVSQGLGLLRG  55

Query  273  YLTSVGAGKGIINRAYLSDVDSIFTNPRLRRLFCS  377
            Y     AGK ++  A LS +DSI  NPR+RRLF S
Sbjct  56   YFALAEAGKKLVLNARLSILDSILGNPRIRRLFSS  90



>ref|XP_002967857.1| hypothetical protein SELMODRAFT_169256 [Selaginella moellendorffii]
 gb|EFJ31204.1| hypothetical protein SELMODRAFT_169256 [Selaginella moellendorffii]
Length=828

 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 70/106 (66%), Gaps = 2/106 (2%)
 Frame = +3

Query  357  LRRLFCSQApkkknyenyypknkkeIPKTN-NQKSESGREDsssgqqgsPQDNFLKQYQN  533
            L+R FCS+APK K YENY+PKNKK++PK    Q++E   ED  +      ++    Q Q+
Sbjct  91   LKRQFCSEAPKNKGYENYHPKNKKDLPKGRAEQRAEQKHEDPKNEGDKGFKEVSKAQLQS  150

Query  534  LITSLLFIGFVLSSM-VLSPRTQNEISFQEFKNKLLEPGLVDHIXV  668
             I++ + +  +LSS+ V    T+ +ISFQEFKNKLLE GLVDHI V
Sbjct  151  YISTAIGLAILLSSLSVRFNGTRQQISFQEFKNKLLETGLVDHIEV  196



>ref|XP_006293791.1| hypothetical protein CARUB_v10022773mg [Capsella rubella]
 gb|EOA26689.1| hypothetical protein CARUB_v10022773mg [Capsella rubella]
Length=679

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +3

Query  513  FLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFKNKLLEPGLVDHIXVS  671
            F+ ++QNL+  LL +G   SS    P  Q +ISFQEFKNKLLEPGLVDHI VS
Sbjct  2    FMNRFQNLLIPLLALGLFFSSFSFGPGDQQQISFQEFKNKLLEPGLVDHIDVS  54



>ref|XP_010688798.1| PREDICTED: succinate dehydrogenase cytochrome b560 subunit-like 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010688799.1| PREDICTED: succinate dehydrogenase cytochrome b560 subunit-like 
[Beta vulgaris subsp. vulgaris]
Length=247

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 54/92 (59%), Gaps = 4/92 (4%)
 Frame = +3

Query  108  MLSRIARSVSKSSPSTV-NRGLISGGYGVRTKVLDELAAQSTCIARVEGGIGFVRSYLTS  284
            M+SRI R++S+S+ S++ N  +   GYG+RT  +   +A  T  +R E G+GFV SY +S
Sbjct  3    MISRIGRNISRSARSSLLNATIGCDGYGIRTAAIANQSAGFT--SRSEQGLGFVNSYFSS  60

Query  285  VGAGKGIINRAYLSDVDSIFTNPRLRRLFCSQ  380
            +GAGK   N ++ S     F NP   R F + 
Sbjct  61   IGAGKQ-ANPSFSSVFRPNFANPSFARFFSTD  91



>ref|NP_001044774.1| Os01g0842600 [Oryza sativa Japonica Group]
 sp|Q8S2A7.1|FTSH3_ORYSJ RecName: Full=ATP-dependent zinc metalloprotease FTSH 3, mitochondrial; 
Short=OsFTSH3; Flags: Precursor [Oryza sativa Japonica 
Group]
 dbj|BAB86453.1| putative AAA-metalloprotease FtsH [Oryza sativa Japonica Group]
 dbj|BAF06688.1| Os01g0842600 [Oryza sativa Japonica Group]
 gb|EAZ14117.1| hypothetical protein OsJ_04041 [Oryza sativa Japonica Group]
 dbj|BAG94510.1| unnamed protein product [Oryza sativa Japonica Group]
Length=802

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 58/153 (38%), Positives = 76/153 (50%), Gaps = 28/153 (18%)
 Frame = +3

Query  249  GGIGFVRSYLTSV---------GAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkkny  401
            G +GF+RSY+TSV         GAGKG        D   +  + + RRLF  ++ K    
Sbjct  41   GELGFLRSYVTSVIGNRAAVASGAGKG-------GDWRFLLASRQFRRLFSDKSKKNHGK  93

Query  402  enyypknkkeIPKTNNQKSESGREDsssgqqgsPQDNF---LKQYQNLITSLLFIGFVLS  572
             +          +   +  ES + DS        Q NF   +KQ++++I  L   G +L 
Sbjct  94   HSEE--------ENKGKGDESDKSDSKKQSSSGDQWNFEESIKQFKDMIAPLFLFGLLLL  145

Query  573  SMVLSPRTQNEISFQEFKNKLLEPGLVDHIXVS  671
            S   S   Q EISFQEFKNKLLEPGLVDHI VS
Sbjct  146  SASASSSEQ-EISFQEFKNKLLEPGLVDHIVVS  177



>gb|EAY76461.1| hypothetical protein OsI_04395 [Oryza sativa Indica Group]
Length=802

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 58/153 (38%), Positives = 76/153 (50%), Gaps = 28/153 (18%)
 Frame = +3

Query  249  GGIGFVRSYLTSV---------GAGKGIINRAYLSDVDSIFTNPRLRRLFCSQApkkkny  401
            G +GF+RSY+TSV         GAGKG        D   +  + + RRLF  ++ K    
Sbjct  41   GELGFLRSYVTSVIGNRAAVASGAGKG-------GDWRFLLASRQFRRLFSDKSKKNHGK  93

Query  402  enyypknkkeIPKTNNQKSESGREDsssgqqgsPQDNF---LKQYQNLITSLLFIGFVLS  572
             +          +   +  ES + DS        Q NF   +KQ++++I  L   G +L 
Sbjct  94   HSEE--------ENKGKGDESDKSDSKKQSSSGDQWNFEESIKQFKDMIAPLFLFGLLLL  145

Query  573  SMVLSPRTQNEISFQEFKNKLLEPGLVDHIXVS  671
            S   S   Q EISFQEFKNKLLEPGLVDHI VS
Sbjct  146  SASASSSEQ-EISFQEFKNKLLEPGLVDHIVVS  177



>gb|KEH23850.1| ATP-dependent zinc metalloprotease FTSH protein [Medicago truncatula]
Length=701

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 38/64 (59%), Gaps = 8/64 (13%)
 Frame = +3

Query  504  QDNFLKQYQNLITSL-------LFIGFVLSSMVLSP-RTQNEISFQEFKNKLLEPGLVDH  659
            Q+  +KQ+Q   T L       L +G  LS +     + Q +ISFQEF NKLLEPGLVDH
Sbjct  26   QEALMKQFQEFRTPLSVAMAMILIMGITLSILYFDAGKQQQQISFQEFVNKLLEPGLVDH  85

Query  660  IXVS  671
            I VS
Sbjct  86   IVVS  89



>ref|XP_009804923.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
[Nicotiana sylvestris]
 ref|XP_009804924.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
[Nicotiana sylvestris]
Length=716

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 41/53 (77%), Gaps = 2/53 (4%)
 Frame = +3

Query  516  LKQYQNLITSLLFIGFVLSSMVLSPRTQ-NEISFQEFKNKLLEPGLVDHIXVS  671
            +K+YQ LI  LLF+GF LSS++L    +  EISFQEFKNKLLEPGLVD I V+
Sbjct  1    MKKYQ-LILFLLFVGFALSSILLLIYLEPEEISFQEFKNKLLEPGLVDRIVVA  52



>ref|XP_006349499.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X1 [Solanum tuberosum]
Length=716

 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 39/53 (74%), Gaps = 2/53 (4%)
 Frame = +3

Query  516  LKQYQNLITSLLFIGFVLSS-MVLSPRTQNEISFQEFKNKLLEPGLVDHIXVS  671
            +KQ+  ++  +LFIG VLSS ++L+     EISFQEFKNKLLEPG VD I V+
Sbjct  1    MKQHHYILL-ILFIGSVLSSILLLNHLDSEEISFQEFKNKLLEPGHVDRIVVA  52



>ref|XP_006349501.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X3 [Solanum tuberosum]
Length=688

 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 39/53 (74%), Gaps = 2/53 (4%)
 Frame = +3

Query  516  LKQYQNLITSLLFIGFVLSS-MVLSPRTQNEISFQEFKNKLLEPGLVDHIXVS  671
            +KQ+  ++  +LFIG VLSS ++L+     EISFQEFKNKLLEPG VD I V+
Sbjct  1    MKQHHYILL-ILFIGSVLSSILLLNHLDSEEISFQEFKNKLLEPGHVDRIVVA  52



>ref|XP_006349500.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X2 [Solanum tuberosum]
Length=700

 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 39/53 (74%), Gaps = 2/53 (4%)
 Frame = +3

Query  516  LKQYQNLITSLLFIGFVLSS-MVLSPRTQNEISFQEFKNKLLEPGLVDHIXVS  671
            +KQ+  ++  +LFIG VLSS ++L+     EISFQEFKNKLLEPG VD I V+
Sbjct  1    MKQHHYILL-ILFIGSVLSSILLLNHLDSEEISFQEFKNKLLEPGHVDRIVVA  52



>gb|EMT07840.1| Cell division protease ftsH-like protein, mitochondrial [Aegilops 
tauschii]
Length=953

 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 71/211 (34%), Positives = 102/211 (48%), Gaps = 33/211 (16%)
 Frame = +3

Query  105  MMLSRIARSVSKSSPSTVNRGLISGGYGV-RTKVLDELAAQSTCIARVEG-GIGFVRSYL  278
            M LS ++R++++SS S   +G + GG+GV R  +       S  +   EG G+  VR YL
Sbjct  1    MSLSALSRALARSSRS--RQGYLLGGHGVLRAPLPSPSPPPSPLLPGGEGAGLRLVRRYL  58

Query  279  TS-VGAGKGIINRA-YLSDVDSIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTN-N  449
            TS +G+     N A  + D  S+  N + RRL   Q+ K    E         +P+ + +
Sbjct  59   TSALGSRASSANAAGKVRDGRSLLANSQSRRLLSDQSKKNFPKEKE-------VPQGDGS  111

Query  450  QKSESGREDsssgqqgsPQDNFLKQYQNLI------------------TSLLFIGFVLSS  575
             KSES +E +S GQ    Q+  LK +Q+ I                    LL +   +S 
Sbjct  112  NKSESKKESNSGGQPNV-QEKLLKLFQDSIGPVFLLGLLLATLSGSSEKELLMLLKRVSK  170

Query  576  MVLSPRTQNEISFQEFKNKLLEPGLVDHIXV  668
            +  +      ISFQEFKNKLLEPGLVD I V
Sbjct  171  IYSTVPPAVLISFQEFKNKLLEPGLVDRIVV  201



>gb|EMT04659.1| Cell division protease ftsH-like protein, mitochondrial [Aegilops 
tauschii]
Length=703

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 34/56 (61%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +3

Query  504  QDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFKNKLLEPGLVDHIXVS  671
            QD   KQ QN +  LL +G + SS+  S   Q EISFQEFKNKLLEPGLVD I VS
Sbjct  15   QDGTFKQLQNFLGPLLLLGLMFSSLSSSSSDQKEISFQEFKNKLLEPGLVDRIVVS  70



>gb|EMS50561.1| ATP-dependent zinc metalloprotease FTSH 8, mitochondrial [Triticum 
urartu]
Length=748

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +3

Query  504  QDNFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFKNKLLEPGLVDHIXVS  671
            QD   KQ QN +  LL +G + SS+  S   Q EISFQEFKNKLLEPGLVD I VS
Sbjct  60   QDGTFKQLQNFLGPLLLLGLMFSSLSSSSSDQKEISFQEFKNKLLEPGLVDRIVVS  115



>ref|XP_001782950.1| predicted protein [Physcomitrella patens]
 gb|EDQ52248.1| predicted protein [Physcomitrella patens]
Length=872

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 62/174 (36%), Positives = 85/174 (49%), Gaps = 24/174 (14%)
 Frame = +3

Query  165  GLISGG---YGVRTKVLDELAAQSTCIARVEGGIGFVRSYLTSVGAGKGIINRAYLSDVD  335
            GL+  G   Y V    LD       CI  +            +   G G   RA L ++ 
Sbjct  63   GLLKSGIADYVVTKTALDRFGTSRRCIHEI------------ARRNGSGTAGRAVLQNLG  110

Query  336  SIFTNPRLRRLFCSQApkkknyenyypknkkeIPKTNNQ-KSE-SGREDsssgqqgsPQD  509
            S       +R  CS+ PKKK +ENYYPKN+KEIP+  N+ KSE  G ++S         +
Sbjct  111  S-------KRSLCSEIPKKKGFENYYPKNRKEIPEGRNEPKSEQKGEQESKQEGDKMSTE  163

Query  510  NFLKQYQNLITSLLFIGFVLSSMVLSPRTQNEISFQEFKNKLLEPGLVDHIXVS  671
                Q Q+LI +      +L+S+ +      +ISFQEFKNKLLE GLVD I ++
Sbjct  164  TSKSQIQSLIATGAATVAILTSLSMGRSDAQQISFQEFKNKLLESGLVDRIEIT  217



>ref|XP_003590119.1| Cell division protease ftsH-like protein [Medicago truncatula]
 gb|AES60370.1| ATP-dependent zinc metalloprotease FTSH protein [Medicago truncatula]
Length=510

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 35/53 (66%), Gaps = 3/53 (6%)
 Frame = +3

Query  516  LKQYQNLITSLLFIGFVLSSMVLSPRTQN-EISFQEFKNKLLEPGLVDHIXVS  671
            LK+   L+T  L  G +LS     P  +N EISFQEFK K+LEPGLVDHI VS
Sbjct  29   LKKLGTLMT--LIGGLILSFFYFRPFGKNQEISFQEFKIKVLEPGLVDHIVVS  79



>ref|XP_002981661.1| hypothetical protein SELMODRAFT_115113, partial [Selaginella 
moellendorffii]
 gb|EFJ17143.1| hypothetical protein SELMODRAFT_115113, partial [Selaginella 
moellendorffii]
Length=737

 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 66/108 (61%), Gaps = 9/108 (8%)
 Frame = +3

Query  363  RLFCSQApkkknyenyypknkkeIPKTNNQKSESGREDsssgqqgsPQDNFLK-----QY  527
            R FCS+APK K YENY+PKNKK++PK    ++E   E        +  D   K     Q 
Sbjct  1    RQFCSEAPKNKGYENYHPKNKKDLPKG---RAEQRAEQKHGADPKNEGDKGFKEVSKAQL  57

Query  528  QNLITSLLFIGFVLSSM-VLSPRTQNEISFQEFKNKLLEPGLVDHIXV  668
            Q+ I++ + +  +LSS+ V    T+ +ISFQEFKNKLLE GLVDHI V
Sbjct  58   QSYISTAIGLAILLSSLSVRFNGTRQQISFQEFKNKLLETGLVDHIEV  105



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1064095936780