BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF052N21

Length=636
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009618666.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    147   5e-37   Nicotiana tomentosiformis
ref|XP_009618667.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    147   5e-37   
ref|XP_009783532.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    145   3e-36   Nicotiana sylvestris
ref|XP_009783537.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    145   3e-36   Nicotiana sylvestris
ref|XP_006364269.1|  PREDICTED: serine/arginine repetitive matrix...    144   6e-36   Solanum tuberosum [potatoes]
ref|XP_011084184.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    143   2e-35   
ref|XP_004245196.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    142   3e-35   Solanum lycopersicum
gb|EYU29231.1|  hypothetical protein MIMGU_mgv1a002140mg                141   5e-35   Erythranthe guttata [common monkey flower]
emb|CBI21007.3|  unnamed protein product                                136   5e-34   Vitis vinifera
gb|EYU29230.1|  hypothetical protein MIMGU_mgv1a002072mg                138   7e-34   Erythranthe guttata [common monkey flower]
ref|XP_010648638.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    138   1e-33   Vitis vinifera
ref|XP_002285000.2|  PREDICTED: peptidyl-prolyl cis-trans isomera...    138   1e-33   Vitis vinifera
ref|XP_010670670.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    137   1e-33   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010670673.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    137   2e-33   Beta vulgaris subsp. vulgaris [field beet]
emb|CDP04788.1|  unnamed protein product                                137   2e-33   Coffea canephora [robusta coffee]
emb|CAN80313.1|  hypothetical protein VITISV_020758                     136   4e-33   Vitis vinifera
ref|XP_011026475.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    136   5e-33   Populus euphratica
ref|XP_011026473.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    136   5e-33   Populus euphratica
ref|XP_011019778.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    136   6e-33   Populus euphratica
ref|XP_011019781.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    135   6e-33   Populus euphratica
ref|XP_011019777.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    135   6e-33   Populus euphratica
ref|XP_011019776.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    135   6e-33   Populus euphratica
ref|XP_011019775.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    135   6e-33   Populus euphratica
ref|XP_002324283.2|  hypothetical protein POPTR_0018s01460g             135   7e-33   
ref|XP_004164532.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    130   1e-32   
ref|XP_004138866.1|  PREDICTED: uncharacterized protein LOC101210345    135   1e-32   
gb|KGN62922.1|  hypothetical protein Csa_2G380020                       135   1e-32   Cucumis sativus [cucumbers]
ref|XP_008445168.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    134   2e-32   Cucumis melo [Oriental melon]
ref|XP_007013817.1|  Peptidyl-prolyl cis-trans isomerase CYP19-2 ...    135   2e-32   
ref|XP_007013820.1|  Peptidyl-prolyl cis-trans isomerase CYP19-2 ...    135   2e-32   
gb|KHG19968.1|  Peptidyl-prolyl cis-trans isomerase cyp5                134   2e-32   Gossypium arboreum [tree cotton]
ref|XP_006450486.1|  hypothetical protein CICLE_v10007495mg             134   2e-32   Citrus clementina [clementine]
ref|XP_006450487.1|  hypothetical protein CICLE_v10007495mg             134   2e-32   Citrus clementina [clementine]
ref|XP_006483322.1|  PREDICTED: serine/arginine repetitive matrix...    134   3e-32   Citrus sinensis [apfelsine]
ref|XP_006483320.1|  PREDICTED: serine/arginine repetitive matrix...    134   3e-32   Citrus sinensis [apfelsine]
gb|EPS68763.1|  hypothetical protein M569_06004                         133   4e-32   Genlisea aurea
gb|KDP33623.1|  hypothetical protein JCGZ_07194                         133   4e-32   Jatropha curcas
gb|KJB07784.1|  hypothetical protein B456_001G045000                    132   6e-32   Gossypium raimondii
ref|XP_011081940.1|  PREDICTED: LOW QUALITY PROTEIN: peptidyl-pro...    132   8e-32   
gb|KJB07776.1|  hypothetical protein B456_001G045000                    132   1e-31   Gossypium raimondii
gb|KJB07775.1|  hypothetical protein B456_001G045000                    132   1e-31   Gossypium raimondii
ref|XP_008394052.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    132   1e-31   
ref|XP_008394051.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    132   1e-31   
ref|XP_003523694.1|  PREDICTED: serine/arginine repetitive matrix...    131   3e-31   
gb|KHN08115.1|  Peptidyl-prolyl cis-trans isomerase D                   130   4e-31   Glycine soja [wild soybean]
ref|XP_003526420.1|  PREDICTED: serine/arginine repetitive matrix...    130   4e-31   
ref|XP_006581365.1|  PREDICTED: serine/arginine repetitive matrix...    130   4e-31   
gb|KHN07093.1|  Peptidyl-prolyl cis-trans isomerase D                   130   5e-31   Glycine soja [wild soybean]
ref|XP_007161232.1|  hypothetical protein PHAVU_001G053000g             130   7e-31   Phaseolus vulgaris [French bean]
ref|XP_007161231.1|  hypothetical protein PHAVU_001G052900g             130   1e-30   Phaseolus vulgaris [French bean]
ref|XP_007225294.1|  hypothetical protein PRUPE_ppa001326mg             129   1e-30   Prunus persica
ref|XP_002515550.1|  peptidyl-prolyl cis-trans isomerase, putative      129   1e-30   
gb|KCW80439.1|  hypothetical protein EUGRSUZ_C01785                     127   2e-30   Eucalyptus grandis [rose gum]
ref|XP_008219899.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    129   2e-30   Prunus mume [ume]
ref|XP_007161230.1|  hypothetical protein PHAVU_001G052800g             129   2e-30   Phaseolus vulgaris [French bean]
gb|KJB07770.1|  hypothetical protein B456_001G044900                    129   2e-30   Gossypium raimondii
ref|XP_009334769.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    129   2e-30   Pyrus x bretschneideri [bai li]
gb|AES58972.2|  peptidyl-prolyl cis-trans isomerase                     128   2e-30   Medicago truncatula
ref|XP_009334770.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    129   2e-30   Pyrus x bretschneideri [bai li]
ref|XP_009345297.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    129   3e-30   Pyrus x bretschneideri [bai li]
ref|XP_010048236.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    127   5e-30   Eucalyptus grandis [rose gum]
ref|XP_010048233.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    127   5e-30   Eucalyptus grandis [rose gum]
ref|XP_010048238.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    127   5e-30   Eucalyptus grandis [rose gum]
ref|XP_010048237.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    127   5e-30   Eucalyptus grandis [rose gum]
ref|XP_008378303.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    125   5e-30   
gb|KCW80440.1|  hypothetical protein EUGRSUZ_C01785                     126   8e-30   Eucalyptus grandis [rose gum]
ref|XP_006382072.1|  hypothetical protein POPTR_0006s26710g             126   1e-29   
ref|XP_004501305.1|  PREDICTED: serine/arginine repetitive matrix...    126   1e-29   Cicer arietinum [garbanzo]
gb|KJB07786.1|  hypothetical protein B456_001G045000                    126   2e-29   Gossypium raimondii
ref|XP_004498656.1|  PREDICTED: serine/arginine repetitive matrix...    125   2e-29   Cicer arietinum [garbanzo]
ref|XP_008378304.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    125   2e-29   
gb|KHG30308.1|  Peptidyl-prolyl cis-trans isomerase cyp5                119   3e-29   Gossypium arboreum [tree cotton]
emb|CDX68845.1|  BnaC01g06080D                                          125   4e-29   
emb|CDX75243.1|  BnaA01g04590D                                          124   5e-29   
ref|XP_009126010.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    124   7e-29   
ref|XP_004291478.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    123   1e-28   Fragaria vesca subsp. vesca
ref|XP_008347718.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    112   3e-28   
ref|XP_010037119.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    114   4e-28   Eucalyptus grandis [rose gum]
gb|AES73684.2|  peptidyl-prolyl cis-trans isomerase                     122   5e-28   Medicago truncatula
emb|CAN75764.1|  hypothetical protein VITISV_034442                     121   7e-28   Vitis vinifera
ref|XP_006838913.1|  hypothetical protein AMTR_s00002p00269760          121   9e-28   
emb|CAA22569.1|  putative protein                                       120   1e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010447392.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    120   2e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010447391.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    120   2e-27   Camelina sativa [gold-of-pleasure]
ref|NP_194968.2|  cyclophilin-like peptidyl-prolyl cis-trans isom...    120   2e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002867244.1|  hypothetical protein ARALYDRAFT_491484             120   2e-27   
ref|NP_001190888.1|  cyclophilin-like peptidyl-prolyl cis-trans i...    119   3e-27   Arabidopsis thaliana [mouse-ear cress]
gb|KHG26228.1|  Peptidyl-prolyl cis-trans isomerase D                   112   3e-27   Gossypium arboreum [tree cotton]
ref|XP_010437913.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    119   3e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010437912.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    119   3e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010249988.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    119   5e-27   Nelumbo nucifera [Indian lotus]
ref|XP_010432721.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    119   5e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010249986.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    119   6e-27   Nelumbo nucifera [Indian lotus]
ref|XP_010432719.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    119   6e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010432723.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    118   7e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010432722.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    118   9e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010110347.1|  Peptidyl-prolyl cis-trans isomerase 1              118   9e-27   
ref|XP_006412476.1|  hypothetical protein EUTSA_v10024440mg             118   1e-26   
ref|XP_010527624.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    116   1e-26   Tarenaya hassleriana [spider flower]
ref|XP_010527623.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    116   1e-26   Tarenaya hassleriana [spider flower]
ref|XP_010527622.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    116   1e-26   Tarenaya hassleriana [spider flower]
ref|XP_007050461.1|  Cyclophilin-like peptidyl-prolyl cis-trans i...    116   1e-26   
ref|XP_008792090.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    117   2e-26   Phoenix dactylifera
ref|XP_008785212.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    117   2e-26   Phoenix dactylifera
ref|XP_010527621.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    116   2e-26   Tarenaya hassleriana [spider flower]
ref|XP_010527619.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    116   2e-26   Tarenaya hassleriana [spider flower]
ref|XP_010527620.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    116   2e-26   Tarenaya hassleriana [spider flower]
ref|XP_010527617.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    116   2e-26   Tarenaya hassleriana [spider flower]
ref|XP_010546569.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    117   2e-26   Tarenaya hassleriana [spider flower]
gb|AAM13845.1|  unknown protein                                         117   3e-26   Arabidopsis thaliana [mouse-ear cress]
gb|KJB25950.1|  hypothetical protein B456_004G217800                    115   3e-26   Gossypium raimondii
gb|KJB25951.1|  hypothetical protein B456_004G217800                    115   3e-26   Gossypium raimondii
gb|KJB25952.1|  hypothetical protein B456_004G217800                    115   4e-26   Gossypium raimondii
ref|XP_010925250.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    116   4e-26   Elaeis guineensis
ref|XP_010914920.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    116   5e-26   Elaeis guineensis
ref|XP_007050460.1|  Cyclophilin-like peptidyl-prolyl cis-trans i...    115   7e-26   
ref|XP_004146961.1|  PREDICTED: uncharacterized protein LOC101219904    114   1e-25   Cucumis sativus [cucumbers]
ref|XP_008451290.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    114   2e-25   Cucumis melo [Oriental melon]
ref|XP_004162194.1|  PREDICTED: uncharacterized LOC101219904            114   2e-25   
gb|KJB25949.1|  hypothetical protein B456_004G217800                    114   2e-25   Gossypium raimondii
ref|XP_006283087.1|  hypothetical protein CARUB_v10004106mg             114   2e-25   
ref|XP_002520955.1|  cyclophilin, putative                              113   3e-25   Ricinus communis
gb|KJB25953.1|  hypothetical protein B456_004G217800                    113   3e-25   Gossypium raimondii
gb|KDO68605.1|  hypothetical protein CISIN_1g006162mg                   113   3e-25   Citrus sinensis [apfelsine]
ref|XP_010527616.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    113   4e-25   Tarenaya hassleriana [spider flower]
ref|XP_010527615.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    113   4e-25   Tarenaya hassleriana [spider flower]
ref|XP_010646137.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    113   4e-25   Vitis vinifera
ref|XP_002280876.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    113   4e-25   Vitis vinifera
ref|XP_009419289.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    113   5e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010028211.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    106   5e-25   Eucalyptus grandis [rose gum]
ref|XP_004498655.1|  PREDICTED: serine/arginine repetitive matrix...    112   7e-25   
ref|XP_009381127.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    112   1e-24   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDP21391.1|  hypothetical protein JCGZ_21862                         111   2e-24   Jatropha curcas
ref|XP_006443960.1|  hypothetical protein CICLE_v10019230mg             110   2e-24   Citrus clementina [clementine]
ref|XP_006443959.1|  hypothetical protein CICLE_v10019230mg             110   2e-24   
gb|KDO68608.1|  hypothetical protein CISIN_1g006162mg                   110   2e-24   Citrus sinensis [apfelsine]
gb|AJA29688.1|  peptidyl-prolyl cis-trans isomerase                     110   4e-24   Betula luminifera [liang ye hua]
ref|XP_008681079.1|  PREDICTED: uncharacterized protein LOC100192...    110   4e-24   
ref|XP_008681078.1|  PREDICTED: uncharacterized protein LOC100192...    110   4e-24   Zea mays [maize]
ref|NP_850740.1|  cyclophilin-like peptidyl-prolyl cis-trans isom...    107   4e-24   Arabidopsis thaliana [mouse-ear cress]
gb|EEE56526.1|  hypothetical protein OsJ_05815                          110   5e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002302085.2|  hypothetical protein POPTR_0002s04800g             110   5e-24   
gb|EEC72707.1|  hypothetical protein OsI_06299                          110   6e-24   Oryza sativa Indica Group [Indian rice]
ref|XP_010038050.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    109   6e-24   Eucalyptus grandis [rose gum]
gb|AAS75310.1|  multidomain cyclophilin type peptidyl-prolyl cis-...    108   7e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002306802.2|  hypothetical protein POPTR_0005s23730g             109   7e-24   Populus trichocarpa [western balsam poplar]
ref|XP_010038051.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    109   8e-24   Eucalyptus grandis [rose gum]
dbj|BAH57223.1|  AT3G63400                                              108   8e-24   Arabidopsis thaliana [mouse-ear cress]
ref|NP_191899.1|  cyclophilin-like peptidyl-prolyl cis-trans isom...    108   8e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009370747.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    108   1e-23   
ref|XP_010679140.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    108   1e-23   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010679138.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    108   1e-23   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010679137.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    108   1e-23   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010028213.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    102   2e-23   Eucalyptus grandis [rose gum]
ref|XP_010274266.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    108   2e-23   Nelumbo nucifera [Indian lotus]
ref|XP_010274264.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    108   2e-23   Nelumbo nucifera [Indian lotus]
ref|XP_008802287.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    108   2e-23   Phoenix dactylifera
ref|XP_010274268.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    108   2e-23   Nelumbo nucifera [Indian lotus]
ref|XP_008802286.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    108   2e-23   Phoenix dactylifera
ref|XP_010274267.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    108   2e-23   Nelumbo nucifera [Indian lotus]
ref|XP_008802285.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    108   2e-23   Phoenix dactylifera
ref|XP_008802283.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    108   2e-23   Phoenix dactylifera
ref|XP_006647052.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    108   2e-23   Oryza brachyantha
ref|XP_006647053.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    108   2e-23   Oryza brachyantha
emb|CDP03680.1|  unnamed protein product                                108   2e-23   Coffea canephora [robusta coffee]
ref|XP_004493727.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    107   3e-23   Cicer arietinum [garbanzo]
gb|KEH23833.1|  peptidyl-prolyl cis-trans isomerase                     107   3e-23   Medicago truncatula
ref|XP_008355416.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    107   4e-23   
ref|XP_010234011.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    107   4e-23   Brachypodium distachyon [annual false brome]
emb|CDX93909.1|  BnaC04g20680D                                          107   4e-23   
ref|XP_010028210.1|  PREDICTED: uncharacterized protein LOC104418...    101   5e-23   Eucalyptus grandis [rose gum]
ref|XP_002876720.1|  hypothetical protein ARALYDRAFT_324764             106   5e-23   
ref|XP_010234012.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    107   6e-23   Brachypodium distachyon [annual false brome]
ref|XP_010234010.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    107   6e-23   Brachypodium distachyon [annual false brome]
ref|XP_010234009.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    107   6e-23   Brachypodium distachyon [annual false brome]
ref|XP_006402278.1|  hypothetical protein EUTSA_v10006033mg             104   7e-23   
ref|XP_009798520.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    106   7e-23   Nicotiana sylvestris
ref|XP_011032623.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    106   8e-23   Populus euphratica
ref|XP_010268554.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    103   8e-23   Nelumbo nucifera [Indian lotus]
ref|XP_009399354.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    106   1e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009399355.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    105   1e-22   
dbj|BAJ98045.1|  predicted protein                                      103   1e-22   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007199724.1|  hypothetical protein PRUPE_ppa002435mg             105   1e-22   Prunus persica
ref|XP_008235346.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    105   1e-22   Prunus mume [ume]
ref|XP_008235345.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    105   1e-22   Prunus mume [ume]
ref|XP_006657500.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    105   2e-22   Oryza brachyantha
ref|XP_008235347.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    105   2e-22   
ref|XP_006657499.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    105   2e-22   
ref|XP_010935780.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    105   2e-22   Elaeis guineensis
ref|XP_006290850.1|  hypothetical protein CARUB_v10016960mg             105   2e-22   
ref|XP_007162476.1|  hypothetical protein PHAVU_001G155500g             105   2e-22   Phaseolus vulgaris [French bean]
ref|XP_010468852.1|  PREDICTED: LOW QUALITY PROTEIN: peptidyl-pro...    104   2e-22   Camelina sativa [gold-of-pleasure]
ref|XP_008366534.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    104   3e-22   
ref|XP_009601160.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    105   3e-22   Nicotiana tomentosiformis
ref|XP_008366532.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    104   3e-22   
ref|XP_009601158.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    105   3e-22   Nicotiana tomentosiformis
ref|XP_006604471.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    105   3e-22   Glycine max [soybeans]
ref|XP_006604469.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    104   3e-22   Glycine max [soybeans]
ref|XP_003603433.1|  Peptidyl-prolyl cis-trans isomerase                105   3e-22   
ref|XP_009388658.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    105   3e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006604473.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    104   3e-22   Glycine max [soybeans]
ref|XP_006604472.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    104   3e-22   Glycine max [soybeans]
emb|CDY53714.1|  BnaAnng12550D                                          103   4e-22   Brassica napus [oilseed rape]
ref|XP_009138664.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    103   4e-22   Brassica rapa
gb|AIZ68177.1|  peptidyl-prolyl cis-trans isomerase CYP40-like pr...    102   4e-22   Ornithogalum longebracteatum [sea-onion]
ref|XP_004247203.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    104   4e-22   Solanum lycopersicum
ref|XP_010028504.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    102   4e-22   Eucalyptus grandis [rose gum]
gb|EDM00869.1|  rCG62684, isoform CRA_b                               97.8    4e-22   Rattus norvegicus [brown rat]
gb|EPS61145.1|  hypothetical protein M569_13654                         103   5e-22   Genlisea aurea
ref|XP_011458604.1|  PREDICTED: LOW QUALITY PROTEIN: peptidyl-pro...    104   5e-22   Fragaria vesca subsp. vesca
ref|XP_010512756.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    103   6e-22   Camelina sativa [gold-of-pleasure]
ref|XP_008454916.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    100   6e-22   
gb|EWM22369.1|  Cyclophilin-like peptidyl-prolyl cis-trans isomer...    103   6e-22   Nannochloropsis gaditana
ref|XP_010999957.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    101   6e-22   Populus euphratica
ref|NP_001232291.1|  putative peptidylprolyl isomerase D              99.4    7e-22   
ref|XP_006349731.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    103   7e-22   Solanum tuberosum [potatoes]
ref|XP_008454915.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    101   9e-22   Cucumis melo [Oriental melon]
gb|KJB17878.1|  hypothetical protein B456_003G021400                    101   9e-22   Gossypium raimondii
emb|CDK25020.1|  unnamed protein product                                100   9e-22   Kuraishia capsulata CBS 1993
ref|XP_001651471.1|  AAEL005799-PA                                    99.0    1e-21   
gb|KHN10697.1|  Peptidyl-prolyl cis-trans isomerase                     103   1e-21   Glycine soja [wild soybean]
ref|XP_010530877.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    100   2e-21   Tarenaya hassleriana [spider flower]
ref|XP_002310739.2|  hypothetical protein POPTR_0007s11390g           99.8    2e-21   
ref|XP_010548031.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    100   2e-21   Tarenaya hassleriana [spider flower]
gb|EYU46533.1|  hypothetical protein MIMGU_mgv1a002319mg                102   2e-21   Erythranthe guttata [common monkey flower]
ref|XP_010028212.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  96.7    2e-21   Eucalyptus grandis [rose gum]
ref|XP_004136993.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    100   2e-21   Cucumis sativus [cucumbers]
ref|XP_004165805.1|  PREDICTED: LOW QUALITY PROTEIN: peptidyl-pro...    100   2e-21   
ref|XP_010584391.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    100   2e-21   Haliaeetus leucocephalus
ref|XP_005854554.1|  myosin light chain kinase                          102   2e-21   Nannochloropsis gaditana CCMP526
gb|ACH45652.1|  putative peptidylprolyl isomerase D                     100   2e-21   Taeniopygia guttata
gb|KHG16182.1|  Peptidyl-prolyl cis-trans isomerase CYP40 -like p...  99.8    2e-21   Gossypium arboreum [tree cotton]
ref|XP_010584392.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  99.8    2e-21   Haliaeetus leucocephalus
ref|XP_005148983.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  99.8    2e-21   Melopsittacus undulatus
ref|XP_009350556.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  99.8    3e-21   Pyrus x bretschneideri [bai li]
ref|XP_011026088.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    102   3e-21   Populus euphratica
ref|XP_005486377.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  99.8    3e-21   Zonotrichia albicollis
ref|XP_003524582.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  99.8    3e-21   
ref|XP_010104462.1|  Peptidyl-prolyl cis-trans isomerase              96.3    3e-21   
ref|XP_010104463.1|  Peptidyl-prolyl cis-trans isomerase              97.1    3e-21   Morus notabilis
ref|XP_001761081.1|  predicted protein                                99.8    3e-21   
ref|XP_003436324.1|  AGAP002952-PB                                    96.7    3e-21   Anopheles gambiae str. PEST
ref|XP_002521846.1|  peptidyl-prolyl cis-trans isomerase d, ppid,...  99.8    3e-21   Ricinus communis
gb|ACH45651.1|  putative peptidylprolyl isomerase D                   99.8    3e-21   Taeniopygia guttata
ref|XP_006579808.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  99.8    3e-21   Glycine max [soybeans]
gb|ACO07673.1|  40 kDa peptidyl-prolyl cis-trans isomerase            99.8    3e-21   Oncorhynchus mykiss
gb|ACH70718.1|  peptidylprolyl isomerase D (cyclophilin D)            99.8    3e-21   Salmo salar
ref|XP_005517649.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  99.4    3e-21   Pseudopodoces humilis [Tibetan ground-jay]
emb|CDQ63777.1|  unnamed protein product                              99.4    3e-21   Oncorhynchus mykiss
gb|ACO08154.1|  40 kDa peptidyl-prolyl cis-trans isomerase            99.4    4e-21   Oncorhynchus mykiss
gb|KHG25547.1|  Peptidyl-prolyl cis-trans isomerase CYP40 -like p...  99.4    4e-21   Gossypium arboreum [tree cotton]
ref|XP_006384447.1|  SQUINT family protein                            99.4    4e-21   
ref|XP_004509164.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  99.0    4e-21   Cicer arietinum [garbanzo]
ref|XP_011001198.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  99.0    5e-21   Populus euphratica
ref|NP_001048194.1|  Os02g0761100                                     99.4    5e-21   
ref|XP_011464347.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  98.6    5e-21   Fragaria vesca subsp. vesca
ref|XP_007047186.1|  Peptidyl-prolyl cis-trans isomerase / cyclop...  98.2    5e-21   
gb|EYU44370.1|  hypothetical protein MIMGU_mgv1a0089282mg             98.2    5e-21   Erythranthe guttata [common monkey flower]
ref|XP_011007670.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  98.6    5e-21   Populus euphratica
gb|KJB48523.1|  hypothetical protein B456_008G073900                  99.0    5e-21   Gossypium raimondii
ref|XP_011007671.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  97.8    5e-21   Populus euphratica
ref|XP_011079927.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    101   6e-21   Sesamum indicum [beniseed]
ref|XP_006409501.1|  hypothetical protein EUTSA_v10022753mg           98.6    6e-21   Eutrema salsugineum [saltwater cress]
ref|XP_006740015.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  95.1    6e-21   Leptonychotes weddellii
ref|XP_004288060.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  98.6    6e-21   Fragaria vesca subsp. vesca
ref|XP_007047182.1|  Peptidyl-prolyl cis-trans isomerase / cyclop...  98.6    7e-21   
ref|XP_010028209.1|  PREDICTED: uncharacterized protein LOC104418...  95.9    7e-21   Eucalyptus grandis [rose gum]
gb|EGW00520.1|  40 kDa peptidyl-prolyl cis-trans isomerase            97.1    7e-21   Cricetulus griseus [Chinese hamsters]
ref|XP_007047178.1|  Peptidyl-prolyl cis-trans isomerase / cyclop...  98.6    7e-21   
ref|XP_008236639.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  98.6    7e-21   Prunus mume [ume]
ref|XP_003550075.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  98.6    7e-21   Glycine max [soybeans]
ref|XP_010413155.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    100   7e-21   
ref|XP_009781931.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  98.6    7e-21   Nicotiana sylvestris
ref|XP_005076198.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  98.6    7e-21   Mesocricetus auratus [Syrian golden hamster]
ref|XP_007047183.1|  Peptidyl-prolyl cis-trans isomerase / cyclop...  98.2    8e-21   
ref|XP_003521263.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    100   8e-21   
ref|XP_010413154.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    100   8e-21   Camelina sativa [gold-of-pleasure]
gb|EMF14722.1|  peptidyl-prolyl cis-trans isomerase 1                 98.6    8e-21   Sphaerulina musiva SO2202
ref|XP_002313093.1|  SQUINT family protein                            98.6    8e-21   Populus trichocarpa [western balsam poplar]
ref|XP_003570584.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  98.6    8e-21   
ref|XP_011007669.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  98.2    8e-21   
ref|XP_006121931.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  98.2    9e-21   
ref|NP_001004279.1|  peptidyl-prolyl cis-trans isomerase D            98.2    9e-21   
ref|XP_007047185.1|  Peptidyl-prolyl cis-trans isomerase / cyclop...  97.8    9e-21   
ref|XP_003504914.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  97.4    1e-20   
ref|XP_003970715.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  95.5    1e-20   
ref|XP_006647943.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  98.2    1e-20   
ref|XP_007042358.1|  Peptidyl-prolyl cis-trans isomerase / cyclop...  98.2    1e-20   
ref|XP_003036654.1|  hypothetical protein SCHCODRAFT_80344            97.8    1e-20   
emb|CDX71247.1|  BnaC07g05260D                                        97.8    1e-20   
ref|XP_006000743.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  98.2    1e-20   
ref|XP_007005972.1|  hypothetical protein TREMEDRAFT_23729            94.4    1e-20   
ref|XP_010107982.1|  Peptidyl-prolyl cis-trans isomerase CYP40        97.8    1e-20   
ref|XP_007611328.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  97.8    1e-20   
ref|XP_007624483.1|  PREDICTED: LOW QUALITY PROTEIN: peptidyl-pro...  97.8    1e-20   
gb|ACI66097.1|  40 kDa peptidyl-prolyl cis-trans isomerase            97.8    1e-20   
emb|CDQ62287.1|  unnamed protein product                              97.8    1e-20   
ref|XP_007609920.1|  PREDICTED: LOW QUALITY PROTEIN: peptidyl-pro...  97.8    1e-20   
gb|ERE90429.1|  peptidyl-prolyl cis-trans isomerase D-like protein    97.8    1e-20   
gb|ACO07506.1|  40 kDa peptidyl-prolyl cis-trans isomerase            97.8    1e-20   
ref|XP_011099202.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  97.4    2e-20   
ref|XP_005299363.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  97.4    2e-20   
ref|XP_011099199.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  97.4    2e-20   
ref|XP_010517185.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  97.4    2e-20   
ref|XP_001780456.1|  predicted protein                                95.5    2e-20   
ref|XP_008679866.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    100   2e-20   
ref|XP_008679865.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    100   2e-20   
ref|XP_008679864.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    100   2e-20   
ref|XP_010467327.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  97.1    2e-20   
ref|XP_010489178.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  97.1    2e-20   
ref|XP_009759456.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  97.1    2e-20   
ref|XP_665956.1|  hypothetical protein                                94.4    2e-20   
ref|XP_009593827.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  97.1    2e-20   
ref|XP_006346442.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  97.1    2e-20   
ref|XP_001388285.1|  hypothetical protein                             94.4    2e-20   
ref|XP_001774773.1|  predicted protein                                97.1    2e-20   
gb|KEH30915.1|  peptidyl-prolyl cis-trans isomerase D                 96.7    2e-20   
ref|NP_565381.1|  peptidyl-prolyl cis-trans isomerase CYP40           97.1    2e-20   
ref|XP_003608033.1|  Peptidyl-prolyl cis-trans isomerase CYP40        97.1    2e-20   
ref|XP_010381484.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  97.1    3e-20   
gb|KEH30916.1|  peptidyl-prolyl cis-trans isomerase D                 96.7    3e-20   
gb|KHG00695.1|  Peptidyl-prolyl cis-trans isomerase CYP40             97.1    3e-20   
ref|XP_007071343.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  97.1    3e-20   
ref|XP_009589624.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  96.7    3e-20   
tpg|DAA59762.1|  TPA: hypothetical protein ZEAMMB73_415877            96.7    3e-20   
ref|XP_008679868.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  97.1    3e-20   
emb|CDS03415.1|  Putative Peptidyl-prolyl cis-trans isomerasecyp5     94.4    3e-20   
ref|XP_010898283.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  96.7    3e-20   
ref|XP_004230798.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  96.7    3e-20   
ref|XP_006297983.1|  hypothetical protein CARUB_v10014032mg           96.7    3e-20   
ref|XP_456922.1|  DEHA2A13640p                                        96.7    3e-20   
ref|XP_010939760.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  96.7    3e-20   
ref|XP_001633810.1|  predicted protein                                96.7    3e-20   
ref|XP_008796575.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  96.7    3e-20   
gb|KFK40038.1|  hypothetical protein AALP_AA3G321900                  96.7    3e-20   
ref|XP_002306460.1|  hypothetical protein POPTR_0005s14210g           96.7    3e-20   
ref|XP_009119395.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  96.7    3e-20   
ref|XP_004324857.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  96.3    3e-20   
gb|EMD94092.1|  hypothetical protein COCHEDRAFT_1201904               94.0    4e-20   
gb|EMP24944.1|  Peptidyl-prolyl cis-trans isomerase D                 96.7    4e-20   
ref|XP_003970636.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  96.7    4e-20   
ref|XP_010939761.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  96.7    4e-20   
ref|XP_007201325.1|  hypothetical protein PRUPE_ppa007583mg           96.3    4e-20   
ref|XP_004290309.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  96.3    4e-20   
ref|XP_010953800.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  96.7    4e-20   
ref|XP_008775239.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  96.7    4e-20   
ref|XP_007117529.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  96.3    4e-20   
ref|XP_006213657.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  96.3    4e-20   
gb|KIW28425.1|  hypothetical protein PV07_08092                       96.3    4e-20   
ref|XP_001862300.1|  peptidyl-prolyl cis-trans isomerase g            95.9    4e-20   
ref|XP_004266204.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  96.3    4e-20   
ref|XP_007446681.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  96.3    4e-20   
ref|XP_007184203.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  96.3    4e-20   
ref|XP_008775240.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  96.3    4e-20   
ref|XP_004926608.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  94.4    4e-20   
ref|XP_007117530.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  96.3    4e-20   
gb|KHG00696.1|  Peptidyl-prolyl cis-trans isomerase CYP40             96.7    5e-20   
ref|XP_004606206.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  96.3    5e-20   
ref|XP_004953999.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  96.3    5e-20   
ref|XP_426283.3|  PREDICTED: peptidyl-prolyl cis-trans isomerase ...  96.3    5e-20   
ref|XP_002459423.1|  hypothetical protein SORBIDRAFT_02g004430        98.2    5e-20   
ref|XP_007998311.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  95.9    5e-20   
ref|XP_004232050.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  95.9    6e-20   
ref|XP_011092738.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  95.9    6e-20   
ref|XP_006338217.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  95.9    6e-20   
ref|XP_011092737.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  95.9    6e-20   
ref|XP_004337098.1|  cyclophylin, putative                            93.6    6e-20   
ref|XP_010985159.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  95.9    6e-20   
gb|EMD36826.1|  hypothetical protein CERSUDRAFT_114733                95.9    6e-20   
ref|XP_006829301.1|  hypothetical protein AMTR_s00001p00273100        95.9    6e-20   
gb|EHH30637.1|  hypothetical protein EGK_20384                        95.9    6e-20   
ref|XP_006867984.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  95.9    6e-20   
ref|XP_005593787.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  95.9    7e-20   
ref|XP_001094929.2|  PREDICTED: peptidyl-prolyl cis-trans isomera...  95.9    7e-20   
ref|XP_002452869.1|  hypothetical protein SORBIDRAFT_04g033940        95.9    7e-20   
ref|XP_004505186.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  95.5    7e-20   
ref|XP_007692567.1|  hypothetical protein COCMIDRAFT_30232            93.2    7e-20   
ref|XP_311948.5|  AGAP002952-PA                                       98.6    7e-20   
ref|XP_005985804.1|  PREDICTED: LOW QUALITY PROTEIN: peptidylprol...  95.5    7e-20   
emb|CAA69622.1|  cyclophylin                                          93.2    7e-20   
ref|XP_003112830.1|  CRE-CYN-1 protein                                93.6    8e-20   
ref|XP_006892841.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  95.5    8e-20   
gb|KJB32424.1|  hypothetical protein B456_005G240200                  94.7    8e-20   
ref|XP_007229920.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  95.5    8e-20   
gb|KJB71084.1|  hypothetical protein B456_011G104900                  95.5    8e-20   
ref|XP_004394281.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  95.5    8e-20   
ref|XP_008324858.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  95.5    8e-20   
gb|KHG06583.1|  Peptidyl-prolyl cis-trans isomerase CYP40 -like p...  95.5    8e-20   
ref|XP_003436323.1|  AGAP002952-PC                                    98.2    9e-20   
ref|XP_007701371.1|  hypothetical protein COCSADRAFT_92320            92.8    9e-20   
gb|EHH54044.1|  hypothetical protein EGM_14781                        95.5    9e-20   
gb|EPY40565.1|  peptidyl-prolyl cis-trans isomerase A (cyclophili...  93.6    9e-20   
ref|XP_002054499.1|  GJ22774                                          98.2    9e-20   
ref|NP_001271664.1|  uncharacterized protein LOC101867179             95.5    9e-20   
ref|XP_008651151.1|  PREDICTED: uncharacterized protein LOC100274...  97.4    9e-20   
ref|XP_008584597.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  95.5    9e-20   
ref|XP_007530443.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  95.5    9e-20   
ref|XP_009414029.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  95.5    9e-20   
ref|XP_007998308.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  95.5    9e-20   
ref|XP_004017329.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  95.5    9e-20   
ref|XP_003899367.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  95.5    9e-20   
ref|XP_001941476.1|  peptidyl-prolyl cis-trans isomerase              92.8    9e-20   
ref|XP_003564091.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  95.5    9e-20   
ref|XP_002745353.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  95.5    9e-20   
ref|XP_003984955.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  95.5    9e-20   
ref|NP_001252763.1|  peptidylprolyl isomerase D                       95.5    9e-20   
ref|XP_004777378.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  95.5    9e-20   
gb|EEE66674.1|  hypothetical protein OsJ_23316                        97.4    9e-20   
gb|EEC81610.1|  hypothetical protein OsI_25113                        97.4    9e-20   
ref|XP_008683780.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  95.5    9e-20   
gb|KJB32423.1|  hypothetical protein B456_005G240200                  95.5    9e-20   
gb|EHH26276.1|  hypothetical protein EGK_16197                        95.5    1e-19   
ref|XP_002921709.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  95.5    1e-19   
ref|XP_001500384.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  95.5    1e-19   
gb|KFB52696.1|  AGAP002952-PC-like protein                            97.4    1e-19   
gb|EFB29938.1|  hypothetical protein PANDA_010618                     95.1    1e-19   
gb|KJB32427.1|  hypothetical protein B456_005G240200                  95.5    1e-19   
ref|XP_001955669.1|  GF18880                                          98.2    1e-19   
ref|XP_006423069.1|  hypothetical protein CICLE_v10028706mg           95.1    1e-19   
ref|NP_776578.1|  peptidyl-prolyl cis-trans isomerase D               95.1    1e-19   
ref|XP_003097196.1|  hypothetical protein CRE_18104                   92.8    1e-19   
ref|XP_005909484.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  95.1    1e-19   
ref|XP_005666719.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  95.1    1e-19   
ref|XP_007998309.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  95.1    1e-19   
gb|EMS56633.1|  Peptidyl-prolyl cis-trans isomerase                   93.6    1e-19   
ref|XP_009399694.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  95.5    1e-19   
ref|NP_001231315.1|  peptidyl-prolyl cis-trans isomerase D            95.1    1e-19   
gb|KDP38235.1|  hypothetical protein JCGZ_04878                       95.1    1e-19   
ref|XP_009399695.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  95.5    1e-19   
emb|CBN74399.1|  conserved unknown protein                            96.3    1e-19   
ref|XP_011427426.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  98.2    1e-19   
ref|XP_003139210.1|  cyclophilin Ovcyp-2                              92.4    1e-19   
emb|CDO97146.1|  unnamed protein product                              95.1    1e-19   
ref|XP_002632172.1|  Hypothetical protein CBG07031                    92.4    1e-19   
ref|XP_009399693.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  95.1    1e-19   
gb|KFA77235.1|  hypothetical protein S40288_01249                     95.1    1e-19   
gb|KEY72096.1|  hypothetical protein S7711_00112                      95.1    1e-19   
gb|KIW08816.1|  hypothetical protein PV09_00747                       95.1    1e-19   
ref|XP_003629580.1|  Peptidyl-prolyl cis-trans isomerase B            95.1    1e-19   
emb|CEP10276.1|  hypothetical protein                                 95.1    1e-19   
ref|XP_003221776.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  95.1    1e-19   
ref|XP_010691019.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  94.7    1e-19   
ref|NP_080628.1|  peptidyl-prolyl cis-trans isomerase D               94.7    1e-19   
gb|KHN31054.1|  Peptidyl-prolyl cis-trans isomerase CYP40             94.7    1e-19   
dbj|BAE29632.1|  unnamed protein product                              94.7    1e-19   
ref|XP_003529384.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  94.7    1e-19   
ref|XP_008584596.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  95.1    1e-19   
ref|XP_004777377.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  95.1    1e-19   
gb|KJB32426.1|  hypothetical protein B456_005G240200                  95.1    1e-19   
ref|XP_007436535.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  94.7    1e-19   
ref|XP_011226330.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  95.1    1e-19   
ref|XP_008683779.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  95.1    2e-19   
gb|KDO49142.1|  hypothetical protein CISIN_1g018089mg                 94.7    2e-19   
gb|AAU87301.1|  cyclophilin                                           92.4    2e-19   
ref|XP_009054986.1|  hypothetical protein LOTGIDRAFT_118738           95.1    2e-19   
gb|AIZ74330.1|  cyclophilin                                           92.4    2e-19   
gb|ACV88654.1|  cyclophilin                                           92.4    2e-19   
ref|XP_007155953.1|  hypothetical protein PHAVU_003G246400g           94.7    2e-19   
ref|XP_010680438.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  94.7    2e-19   
gb|KIW43118.1|  peptidyl-prolyl cis-trans isomerase D                 94.7    2e-19   
ref|XP_003650848.1|  hypothetical protein THITE_2094562               94.7    2e-19   
ref|XP_004289844.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  92.4    2e-19   
gb|ELU12765.1|  hypothetical protein CAPTEDRAFT_170435                94.7    2e-19   
gb|KDO49144.1|  hypothetical protein CISIN_1g018089mg                 94.4    2e-19   
ref|XP_004708796.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  94.7    2e-19   
ref|XP_005401022.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  94.7    2e-19   
ref|XP_532704.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase ...  94.7    2e-19   
ref|XP_004883006.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  94.7    2e-19   
ref|XP_003477039.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  94.7    2e-19   
ref|XP_006480138.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  94.4    2e-19   
ref|XP_002000002.1|  GI22772                                          97.4    2e-19   
ref|XP_010090292.1|  Peptidyl-prolyl cis-trans isomerase              92.0    2e-19   
emb|CDH48646.1|  cyclophilin                                          92.0    2e-19   
ref|NP_001087854.1|  peptidyl-prolyl cis-trans isomerase D            94.4    2e-19   
ref|XP_006656773.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  94.7    2e-19   
ref|XP_006981152.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  94.4    2e-19   
emb|CEP18822.1|  hypothetical protein                                 92.0    2e-19   
ref|XP_007714724.1|  hypothetical protein COCCADRAFT_102503           91.7    2e-19   
ref|XP_003418541.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  94.4    2e-19   
ref|XP_008852547.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  94.4    2e-19   
ref|XP_005593336.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  94.4    2e-19   
ref|XP_005344179.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  94.4    2e-19   
ref|XP_004382106.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  94.4    2e-19   
ref|XP_001903954.1|  hypothetical protein                             94.4    2e-19   
ref|NP_001057148.1|  Os06g0216800                                     94.4    3e-19   
emb|CDS13662.1|  hypothetical protein LRAMOSA05836                    94.0    3e-19   
ref|XP_003295671.1|  hypothetical protein PTT_02276                   91.7    3e-19   
emb|CEI93837.1|  Putative Peptidyl-prolyl cis-trans isomerase cyp11   94.0    3e-19   
ref|XP_008459216.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  94.0    3e-19   
ref|XP_007156535.1|  hypothetical protein PHAVU_003G294200g           94.0    3e-19   
gb|EPT03269.1|  peptidyl-prolyl cis-trans isomerase Cpr7              94.0    3e-19   
ref|XP_001994815.1|  GH17446                                          96.7    3e-19   
gb|KJB79272.1|  hypothetical protein B456_013G041000                  94.0    3e-19   
ref|XP_007845898.1|  peptidyl-prolyl cis-trans isomerase              94.0    3e-19   
ref|XP_008651150.1|  PREDICTED: uncharacterized protein LOC100274...  96.3    3e-19   
gb|KFQ46673.1|  Peptidyl-prolyl cis-trans isomerase D                 90.5    3e-19   
ref|XP_008651149.1|  PREDICTED: uncharacterized protein LOC100274...  96.3    3e-19   
gb|KFO07741.1|  Peptidyl-prolyl cis-trans isomerase D                 90.9    3e-19   
gb|KFP78820.1|  Peptidyl-prolyl cis-trans isomerase D                 90.5    3e-19   
ref|XP_007778549.1|  hypothetical protein W97_02459                   94.0    3e-19   



>ref|XP_009618666.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Nicotiana tomentosiformis]
Length=799

 Score =   147 bits (372),  Expect = 5e-37, Method: Composition-based stats.
 Identities = 70/82 (85%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +3

Query  129  MSKKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  308
            MSKKK LVFLDV I GDP ERMVFELFTD+APKTAENFRALCTGEKG S KTG  LHYKG
Sbjct  1    MSKKKQLVFLDVSIDGDPVERMVFELFTDIAPKTAENFRALCTGEKGVSSKTGKPLHYKG  60

Query  309  TFFHHIVKGSMAQAGDLLREDG  374
            TFFH IVKGS+AQAGDLLR+DG
Sbjct  61   TFFHRIVKGSVAQAGDLLRQDG  82



>ref|XP_009618667.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X2 [Nicotiana tomentosiformis]
Length=797

 Score =   147 bits (371),  Expect = 5e-37, Method: Composition-based stats.
 Identities = 70/82 (85%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +3

Query  129  MSKKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  308
            MSKKK LVFLDV I GDP ERMVFELFTD+APKTAENFRALCTGEKG S KTG  LHYKG
Sbjct  1    MSKKKQLVFLDVSIDGDPVERMVFELFTDIAPKTAENFRALCTGEKGVSSKTGKPLHYKG  60

Query  309  TFFHHIVKGSMAQAGDLLREDG  374
            TFFH IVKGS+AQAGDLLR+DG
Sbjct  61   TFFHRIVKGSVAQAGDLLRQDG  82



>ref|XP_009783532.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Nicotiana sylvestris]
Length=799

 Score =   145 bits (365),  Expect = 3e-36, Method: Composition-based stats.
 Identities = 69/82 (84%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +3

Query  129  MSKKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  308
            MSKKK LVFLDV I GDP E MVFELFTD+APKTAENFRALCTGEKG S KTG  LHYKG
Sbjct  1    MSKKKQLVFLDVSIDGDPVETMVFELFTDIAPKTAENFRALCTGEKGVSSKTGKPLHYKG  60

Query  309  TFFHHIVKGSMAQAGDLLREDG  374
            TFFH IVKGS+AQAGDLLR+DG
Sbjct  61   TFFHRIVKGSVAQAGDLLRQDG  82



>ref|XP_009783537.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X2 [Nicotiana sylvestris]
Length=797

 Score =   145 bits (365),  Expect = 3e-36, Method: Composition-based stats.
 Identities = 69/82 (84%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +3

Query  129  MSKKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  308
            MSKKK LVFLDV I GDP E MVFELFTD+APKTAENFRALCTGEKG S KTG  LHYKG
Sbjct  1    MSKKKQLVFLDVSIDGDPVETMVFELFTDIAPKTAENFRALCTGEKGVSSKTGKPLHYKG  60

Query  309  TFFHHIVKGSMAQAGDLLREDG  374
            TFFH IVKGS+AQAGDLLR+DG
Sbjct  61   TFFHRIVKGSVAQAGDLLRQDG  82



>ref|XP_006364269.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X1 [Solanum tuberosum]
Length=807

 Score =   144 bits (364),  Expect = 6e-36, Method: Composition-based stats.
 Identities = 68/82 (83%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +3

Query  129  MSKKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  308
            MSKKK  VFLDV I GDP ER+ FELFTDVAPKTAENFRALCTGEKG S KTG  LHYKG
Sbjct  1    MSKKKPQVFLDVSIDGDPVERLAFELFTDVAPKTAENFRALCTGEKGVSSKTGRPLHYKG  60

Query  309  TFFHHIVKGSMAQAGDLLREDG  374
            TFFHHI+KGS+AQAGDLLR+DG
Sbjct  61   TFFHHIIKGSVAQAGDLLRQDG  82



>ref|XP_011084184.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 [Sesamum 
indicum]
 ref|XP_011084254.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 [Sesamum 
indicum]
 ref|XP_011084337.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 [Sesamum 
indicum]
Length=784

 Score =   143 bits (360),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 67/83 (81%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = +3

Query  126  KMSKKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            K++KKKVLVFLDV I GDPFERM+FELFTDVAPKTAENFRALCTGEKG S KTG  LHYK
Sbjct  3    KINKKKVLVFLDVSIDGDPFERMIFELFTDVAPKTAENFRALCTGEKGVSLKTGKPLHYK  62

Query  306  GTFFHHIVKGSMAQAGDLLREDG  374
            GTFFH I+KG +AQ GD LR+DG
Sbjct  63   GTFFHRIIKGYVAQGGDFLRQDG  85



>ref|XP_004245196.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Solanum lycopersicum]
Length=807

 Score =   142 bits (358),  Expect = 3e-35, Method: Composition-based stats.
 Identities = 68/82 (83%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +3

Query  129  MSKKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  308
            MSKKK  VFLDV I GDP ERM FELFTDVAPKTAENFRALCTGEKG S KTG  LHYKG
Sbjct  1    MSKKKPQVFLDVSIDGDPVERMAFELFTDVAPKTAENFRALCTGEKGVSSKTGRPLHYKG  60

Query  309  TFFHHIVKGSMAQAGDLLREDG  374
            TFFH IVKGS+AQAGD+LR+DG
Sbjct  61   TFFHRIVKGSVAQAGDMLRQDG  82



>gb|EYU29231.1| hypothetical protein MIMGU_mgv1a002140mg [Erythranthe guttata]
Length=709

 Score =   141 bits (355),  Expect = 5e-35, Method: Composition-based stats.
 Identities = 64/83 (77%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = +3

Query  126  KMSKKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            K++K+K+LVFLDV + GDPFERM+FELFTDVAPKTAENFRALCTGEKG S KTG  LHYK
Sbjct  3    KVNKRKLLVFLDVSVDGDPFERMIFELFTDVAPKTAENFRALCTGEKGVSVKTGKPLHYK  62

Query  306  GTFFHHIVKGSMAQAGDLLREDG  374
            GTFFH I+KG +AQ GD LR+DG
Sbjct  63   GTFFHRIIKGYLAQGGDFLRQDG  85



>emb|CBI21007.3| unnamed protein product [Vitis vinifera]
Length=438

 Score =   136 bits (343),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +3

Query  135  KKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  314
            KK  LV+LDV I GDP ERMVFELF+DVAPKTAENFRALCTGEKG  PKTG  LHYKG+F
Sbjct  4    KKNPLVYLDVSIDGDPIERMVFELFSDVAPKTAENFRALCTGEKGIGPKTGKPLHYKGSF  63

Query  315  FHHIVKGSMAQAGDLLREDG  374
            FH I+KGSM Q GD LR DG
Sbjct  64   FHRIIKGSMVQGGDFLRRDG  83



>gb|EYU29230.1| hypothetical protein MIMGU_mgv1a002072mg [Erythranthe guttata]
Length=719

 Score =   138 bits (347),  Expect = 7e-34, Method: Composition-based stats.
 Identities = 64/83 (77%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +3

Query  126  KMSKKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            KMSK+K LVF DV + GDP ERMVFELFTDVAP+TAENFRALCTGEKG S KTG  LHYK
Sbjct  4    KMSKRKPLVFFDVSVDGDPLERMVFELFTDVAPRTAENFRALCTGEKGASLKTGRPLHYK  63

Query  306  GTFFHHIVKGSMAQAGDLLREDG  374
            GTFFH I+KG +AQ GD LR DG
Sbjct  64   GTFFHRIIKGYVAQGGDFLRRDG  86



>ref|XP_010648638.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X2 [Vitis vinifera]
Length=795

 Score =   138 bits (347),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 64/83 (77%), Positives = 69/83 (83%), Gaps = 1/83 (1%)
 Frame = +3

Query  129  MSKKK-VLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            M+KKK  LV+LDV I GDP ERMVFELF+DVAPKTAENFRALCTGEKG  PKTG  LHYK
Sbjct  1    MTKKKNPLVYLDVSIDGDPIERMVFELFSDVAPKTAENFRALCTGEKGIGPKTGKPLHYK  60

Query  306  GTFFHHIVKGSMAQAGDLLREDG  374
            G+FFH I+KGSM Q GD LR DG
Sbjct  61   GSFFHRIIKGSMVQGGDFLRRDG  83



>ref|XP_002285000.2| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Vitis vinifera]
 ref|XP_010648637.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Vitis vinifera]
Length=796

 Score =   138 bits (347),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 64/83 (77%), Positives = 69/83 (83%), Gaps = 1/83 (1%)
 Frame = +3

Query  129  MSKKK-VLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            M+KKK  LV+LDV I GDP ERMVFELF+DVAPKTAENFRALCTGEKG  PKTG  LHYK
Sbjct  1    MTKKKNPLVYLDVSIDGDPIERMVFELFSDVAPKTAENFRALCTGEKGIGPKTGKPLHYK  60

Query  306  GTFFHHIVKGSMAQAGDLLREDG  374
            G+FFH I+KGSM Q GD LR DG
Sbjct  61   GSFFHRIIKGSMVQGGDFLRRDG  83



>ref|XP_010670670.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010670671.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010670672.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=768

 Score =   137 bits (346),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 63/80 (79%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +3

Query  135  KKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  314
            K+  LVFLDV I GDP+ERMVFELF+DV PKTAENFRALCTGEKG  PK G  LHYKGTF
Sbjct  4    KRNPLVFLDVSIDGDPYERMVFELFSDVVPKTAENFRALCTGEKGVGPKLGKPLHYKGTF  63

Query  315  FHHIVKGSMAQAGDLLREDG  374
            FH IVKGSMAQ GDLLR++G
Sbjct  64   FHRIVKGSMAQGGDLLRQEG  83



>ref|XP_010670673.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=765

 Score =   137 bits (345),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 63/80 (79%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +3

Query  135  KKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  314
            K+  LVFLDV I GDP+ERMVFELF+DV PKTAENFRALCTGEKG  PK G  LHYKGTF
Sbjct  4    KRNPLVFLDVSIDGDPYERMVFELFSDVVPKTAENFRALCTGEKGVGPKLGKPLHYKGTF  63

Query  315  FHHIVKGSMAQAGDLLREDG  374
            FH IVKGSMAQ GDLLR++G
Sbjct  64   FHRIVKGSMAQGGDLLRQEG  83



>emb|CDP04788.1| unnamed protein product [Coffea canephora]
Length=784

 Score =   137 bits (345),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 64/82 (78%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +3

Query  129  MSKKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  308
            MSK+K LVFLDV I GDPFERM+FELFTDVAPKTAENFRALCTGE+G S +    LHYKG
Sbjct  1    MSKQKPLVFLDVSIDGDPFERMIFELFTDVAPKTAENFRALCTGEEGESSRAKRPLHYKG  60

Query  309  TFFHHIVKGSMAQAGDLLREDG  374
            TFFH I+KGS A+AGDLLR DG
Sbjct  61   TFFHRIIKGSWAKAGDLLRRDG  82



>emb|CAN80313.1| hypothetical protein VITISV_020758 [Vitis vinifera]
Length=728

 Score =   136 bits (342),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 64/83 (77%), Positives = 69/83 (83%), Gaps = 1/83 (1%)
 Frame = +3

Query  129  MSKKK-VLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            M+KKK  LV+LDV I GDP ERMVFELF+DVAPKTAENFRALCTGEKG  PKTG  LHYK
Sbjct  1    MTKKKNPLVYLDVSIDGDPIERMVFELFSDVAPKTAENFRALCTGEKGIGPKTGKPLHYK  60

Query  306  GTFFHHIVKGSMAQAGDLLREDG  374
            G+FFH I+KGSM Q GD LR DG
Sbjct  61   GSFFHRIIKGSMVQGGDFLRRDG  83



>ref|XP_011026475.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X2 [Populus euphratica]
Length=794

 Score =   136 bits (342),  Expect = 5e-33, Method: Composition-based stats.
 Identities = 60/80 (75%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +3

Query  135  KKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  314
            KK  LVF+D+CI GDP ERMVFELF+D+APKTAENFRALCTGE G  PK+G  LHYKG+F
Sbjct  8    KKNPLVFMDLCIDGDPKERMVFELFSDIAPKTAENFRALCTGETGIGPKSGRPLHYKGSF  67

Query  315  FHHIVKGSMAQAGDLLREDG  374
            FH IVKGSMAQ GD+L+ DG
Sbjct  68   FHRIVKGSMAQGGDILKRDG  87



>ref|XP_011026473.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X1 [Populus euphratica]
 ref|XP_011026474.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X1 [Populus euphratica]
Length=795

 Score =   136 bits (342),  Expect = 5e-33, Method: Composition-based stats.
 Identities = 60/80 (75%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +3

Query  135  KKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  314
            KK  LVF+D+CI GDP ERMVFELF+D+APKTAENFRALCTGE G  PK+G  LHYKG+F
Sbjct  8    KKNPLVFMDLCIDGDPKERMVFELFSDIAPKTAENFRALCTGETGIGPKSGRPLHYKGSF  67

Query  315  FHHIVKGSMAQAGDLLREDG  374
            FH IVKGSMAQ GD+L+ DG
Sbjct  68   FHRIVKGSMAQGGDILKRDG  87



>ref|XP_011019778.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X4 [Populus euphratica]
Length=805

 Score =   136 bits (342),  Expect = 6e-33, Method: Composition-based stats.
 Identities = 60/83 (72%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +3

Query  126  KMSKKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            KM+KK  LVF+DVCI GDP ERMVFELF D+APKT ENFRALCTGE+G  PK+   LHYK
Sbjct  4    KMAKKNPLVFMDVCIDGDPKERMVFELFLDIAPKTVENFRALCTGERGIGPKSQRPLHYK  63

Query  306  GTFFHHIVKGSMAQAGDLLREDG  374
            G+FFH I+KGSMAQ GD+L+ DG
Sbjct  64   GSFFHRIIKGSMAQGGDILKRDG  86



>ref|XP_011019781.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X6 [Populus euphratica]
Length=810

 Score =   135 bits (341),  Expect = 6e-33, Method: Composition-based stats.
 Identities = 60/83 (72%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +3

Query  126  KMSKKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            KM+KK  LVF+DVCI GDP ERMVFELF D+APKT ENFRALCTGE+G  PK+   LHYK
Sbjct  4    KMAKKNPLVFMDVCIDGDPKERMVFELFLDIAPKTVENFRALCTGERGIGPKSQRPLHYK  63

Query  306  GTFFHHIVKGSMAQAGDLLREDG  374
            G+FFH I+KGSMAQ GD+L+ DG
Sbjct  64   GSFFHRIIKGSMAQGGDILKRDG  86



>ref|XP_011019777.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X3 [Populus euphratica]
Length=811

 Score =   135 bits (341),  Expect = 6e-33, Method: Composition-based stats.
 Identities = 60/83 (72%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +3

Query  126  KMSKKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            KM+KK  LVF+DVCI GDP ERMVFELF D+APKT ENFRALCTGE+G  PK+   LHYK
Sbjct  4    KMAKKNPLVFMDVCIDGDPKERMVFELFLDIAPKTVENFRALCTGERGIGPKSQRPLHYK  63

Query  306  GTFFHHIVKGSMAQAGDLLREDG  374
            G+FFH I+KGSMAQ GD+L+ DG
Sbjct  64   GSFFHRIIKGSMAQGGDILKRDG  86



>ref|XP_011019776.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X2 [Populus euphratica]
Length=815

 Score =   135 bits (341),  Expect = 6e-33, Method: Composition-based stats.
 Identities = 60/83 (72%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +3

Query  126  KMSKKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            KM+KK  LVF+DVCI GDP ERMVFELF D+APKT ENFRALCTGE+G  PK+   LHYK
Sbjct  4    KMAKKNPLVFMDVCIDGDPKERMVFELFLDIAPKTVENFRALCTGERGIGPKSQRPLHYK  63

Query  306  GTFFHHIVKGSMAQAGDLLREDG  374
            G+FFH I+KGSMAQ GD+L+ DG
Sbjct  64   GSFFHRIIKGSMAQGGDILKRDG  86



>ref|XP_011019775.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X1 [Populus euphratica]
Length=816

 Score =   135 bits (341),  Expect = 6e-33, Method: Composition-based stats.
 Identities = 60/83 (72%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +3

Query  126  KMSKKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            KM+KK  LVF+DVCI GDP ERMVFELF D+APKT ENFRALCTGE+G  PK+   LHYK
Sbjct  4    KMAKKNPLVFMDVCIDGDPKERMVFELFLDIAPKTVENFRALCTGERGIGPKSQRPLHYK  63

Query  306  GTFFHHIVKGSMAQAGDLLREDG  374
            G+FFH I+KGSMAQ GD+L+ DG
Sbjct  64   GSFFHRIIKGSMAQGGDILKRDG  86



>ref|XP_002324283.2| hypothetical protein POPTR_0018s01460g [Populus trichocarpa]
 gb|EEF02848.2| hypothetical protein POPTR_0018s01460g [Populus trichocarpa]
Length=819

 Score =   135 bits (341),  Expect = 7e-33, Method: Composition-based stats.
 Identities = 61/80 (76%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +3

Query  135  KKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  314
            KK  LVF+DVCI GDP ERMVFELF+D+APKTAENFRALCTGEKG  PK+   LHYKG+F
Sbjct  8    KKNPLVFMDVCIDGDPKERMVFELFSDIAPKTAENFRALCTGEKGIGPKSERPLHYKGSF  67

Query  315  FHHIVKGSMAQAGDLLREDG  374
            FH IVKGSMAQ GD+L+ DG
Sbjct  68   FHRIVKGSMAQGGDILKRDG  87



>ref|XP_004164532.1| PREDICTED: peptidyl-prolyl cis-trans isomerase cyp5-like, partial 
[Cucumis sativus]
Length=296

 Score =   130 bits (327),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = +3

Query  135  KKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  314
            KK +LVFLDV I GDP ER+VFELF DVAPKTAENFRALCTGEKG  PKTG  LHYKG+F
Sbjct  4    KKNLLVFLDVSIDGDPRERLVFELFYDVAPKTAENFRALCTGEKGIGPKTGKPLHYKGSF  63

Query  315  FHHIVKGSMAQAGDLLREDGMV  380
            FH I+ GSMAQ GD ++ DG V
Sbjct  64   FHRIIGGSMAQGGDFVKRDGTV  85



>ref|XP_004138866.1| PREDICTED: uncharacterized protein LOC101210345 [Cucumis sativus]
Length=774

 Score =   135 bits (339),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 63/85 (74%), Positives = 70/85 (82%), Gaps = 1/85 (1%)
 Frame = +3

Query  129  MSKKK-VLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            M+KKK +LVFLDV I GDP ER+VFELF DVAPKTAENFRALCTGEKG  PKTG  LHYK
Sbjct  1    MTKKKNLLVFLDVSIDGDPRERLVFELFYDVAPKTAENFRALCTGEKGIGPKTGKPLHYK  60

Query  306  GTFFHHIVKGSMAQAGDLLREDGMV  380
            G+FFH I+ GSMAQ GD ++ DG V
Sbjct  61   GSFFHRIIGGSMAQGGDFVKRDGTV  85



>gb|KGN62922.1| hypothetical protein Csa_2G380020 [Cucumis sativus]
Length=784

 Score =   135 bits (339),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 63/85 (74%), Positives = 70/85 (82%), Gaps = 1/85 (1%)
 Frame = +3

Query  129  MSKKK-VLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            M+KKK +LVFLDV I GDP ER+VFELF DVAPKTAENFRALCTGEKG  PKTG  LHYK
Sbjct  1    MTKKKNLLVFLDVSIDGDPRERLVFELFYDVAPKTAENFRALCTGEKGIGPKTGKPLHYK  60

Query  306  GTFFHHIVKGSMAQAGDLLREDGMV  380
            G+FFH I+ GSMAQ GD ++ DG V
Sbjct  61   GSFFHRIIGGSMAQGGDFVKRDGTV  85



>ref|XP_008445168.1| PREDICTED: peptidyl-prolyl cis-trans isomerase 8 isoform X3 [Cucumis 
melo]
 ref|XP_008445170.1| PREDICTED: peptidyl-prolyl cis-trans isomerase 8 isoform X3 [Cucumis 
melo]
Length=779

 Score =   134 bits (338),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 64/85 (75%), Positives = 69/85 (81%), Gaps = 1/85 (1%)
 Frame = +3

Query  129  MSKKK-VLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            M+KKK  LVFLDV I GDP ERMVFELF DVAPKTAENFRALCTGEKG  PKTG  LHYK
Sbjct  1    MTKKKNPLVFLDVSIDGDPRERMVFELFYDVAPKTAENFRALCTGEKGIGPKTGKPLHYK  60

Query  306  GTFFHHIVKGSMAQAGDLLREDGMV  380
            G+FFH I+ GSMAQ GD ++ DG V
Sbjct  61   GSFFHRIIGGSMAQGGDFVKRDGTV  85



>ref|XP_007013817.1| Peptidyl-prolyl cis-trans isomerase CYP19-2 isoform 1 [Theobroma 
cacao]
 ref|XP_007013819.1| Peptidyl-prolyl cis-trans isomerase CYP19-2 isoform 1 [Theobroma 
cacao]
 gb|EOY31436.1| Peptidyl-prolyl cis-trans isomerase CYP19-2 isoform 1 [Theobroma 
cacao]
 gb|EOY31438.1| Peptidyl-prolyl cis-trans isomerase CYP19-2 isoform 1 [Theobroma 
cacao]
Length=843

 Score =   135 bits (339),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 58/80 (73%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +3

Query  135  KKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  314
            KK  LVF+DV + GDP ERM+FELF D+APKTAENFRALCTGEKG  PKTG  LHYKG+F
Sbjct  4    KKNPLVFMDVSVDGDPVERMIFELFPDIAPKTAENFRALCTGEKGIGPKTGKPLHYKGSF  63

Query  315  FHHIVKGSMAQAGDLLREDG  374
            FH ++KGSMAQ GD +R DG
Sbjct  64   FHRVIKGSMAQGGDFVRRDG  83



>ref|XP_007013820.1| Peptidyl-prolyl cis-trans isomerase CYP19-2 isoform 4 [Theobroma 
cacao]
 gb|EOY31439.1| Peptidyl-prolyl cis-trans isomerase CYP19-2 isoform 4 [Theobroma 
cacao]
Length=858

 Score =   135 bits (339),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 60/83 (72%), Positives = 69/83 (83%), Gaps = 1/83 (1%)
 Frame = +3

Query  129  MSKKK-VLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            M+KKK  LVF+DV + GDP ERM+FELF D+APKTAENFRALCTGEKG  PKTG  LHYK
Sbjct  16   MAKKKNPLVFMDVSVDGDPVERMIFELFPDIAPKTAENFRALCTGEKGIGPKTGKPLHYK  75

Query  306  GTFFHHIVKGSMAQAGDLLREDG  374
            G+FFH ++KGSMAQ GD +R DG
Sbjct  76   GSFFHRVIKGSMAQGGDFVRRDG  98



>gb|KHG19968.1| Peptidyl-prolyl cis-trans isomerase cyp5 [Gossypium arboreum]
Length=702

 Score =   134 bits (336),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 61/83 (73%), Positives = 69/83 (83%), Gaps = 1/83 (1%)
 Frame = +3

Query  129  MSKKK-VLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            M+KKK  LVF+DV I GDP ERMVFELF D+APKTAENFRALCTGEKG  PKTG  LHYK
Sbjct  1    MAKKKNPLVFMDVSIDGDPAERMVFELFPDIAPKTAENFRALCTGEKGIGPKTGKPLHYK  60

Query  306  GTFFHHIVKGSMAQAGDLLREDG  374
            G+FFH ++KGS+AQ GD +R DG
Sbjct  61   GSFFHRVMKGSLAQGGDFVRRDG  83



>ref|XP_006450486.1| hypothetical protein CICLE_v10007495mg [Citrus clementina]
 gb|ESR63726.1| hypothetical protein CICLE_v10007495mg [Citrus clementina]
Length=792

 Score =   134 bits (337),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 59/83 (71%), Positives = 71/83 (86%), Gaps = 1/83 (1%)
 Frame = +3

Query  129  MSKKK-VLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            M+KKK +LVF+DV I GDP ERMVFELF+D+APKTAENFRALCTGEKG  P+TG  LHYK
Sbjct  1    MAKKKSLLVFMDVSIDGDPVERMVFELFSDIAPKTAENFRALCTGEKGIGPRTGKPLHYK  60

Query  306  GTFFHHIVKGSMAQAGDLLREDG  374
            G+FFH ++KGSMA+ GD ++ DG
Sbjct  61   GSFFHRVIKGSMAEGGDFVKRDG  83



>ref|XP_006450487.1| hypothetical protein CICLE_v10007495mg [Citrus clementina]
 ref|XP_006450488.1| hypothetical protein CICLE_v10007495mg [Citrus clementina]
 gb|ESR63727.1| hypothetical protein CICLE_v10007495mg [Citrus clementina]
 gb|ESR63728.1| hypothetical protein CICLE_v10007495mg [Citrus clementina]
Length=801

 Score =   134 bits (337),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 59/83 (71%), Positives = 71/83 (86%), Gaps = 1/83 (1%)
 Frame = +3

Query  129  MSKKK-VLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            M+KKK +LVF+DV I GDP ERMVFELF+D+APKTAENFRALCTGEKG  P+TG  LHYK
Sbjct  1    MAKKKSLLVFMDVSIDGDPVERMVFELFSDIAPKTAENFRALCTGEKGIGPRTGKPLHYK  60

Query  306  GTFFHHIVKGSMAQAGDLLREDG  374
            G+FFH ++KGSMA+ GD ++ DG
Sbjct  61   GSFFHRVIKGSMAEGGDFVKRDG  83



>ref|XP_006483322.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X3 [Citrus sinensis]
Length=792

 Score =   134 bits (336),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 57/80 (71%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +3

Query  135  KKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  314
            KK +LVF+DV I GDP ERMVFELF+D+APKTAENFRALCTGEKG  P+TG  LHYKG+F
Sbjct  4    KKSLLVFMDVSIDGDPVERMVFELFSDIAPKTAENFRALCTGEKGIGPRTGKPLHYKGSF  63

Query  315  FHHIVKGSMAQAGDLLREDG  374
            FH ++KGSMA+ GD ++ DG
Sbjct  64   FHRVIKGSMAEGGDFVKRDG  83



>ref|XP_006483320.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X1 [Citrus sinensis]
 ref|XP_006483321.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X2 [Citrus sinensis]
 gb|KDO61676.1| hypothetical protein CISIN_1g003708mg [Citrus sinensis]
 gb|KDO61677.1| hypothetical protein CISIN_1g003708mg [Citrus sinensis]
 gb|KDO61678.1| hypothetical protein CISIN_1g003708mg [Citrus sinensis]
Length=801

 Score =   134 bits (336),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 57/80 (71%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +3

Query  135  KKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  314
            KK +LVF+DV I GDP ERMVFELF+D+APKTAENFRALCTGEKG  P+TG  LHYKG+F
Sbjct  4    KKSLLVFMDVSIDGDPVERMVFELFSDIAPKTAENFRALCTGEKGIGPRTGKPLHYKGSF  63

Query  315  FHHIVKGSMAQAGDLLREDG  374
            FH ++KGSMA+ GD ++ DG
Sbjct  64   FHRVIKGSMAEGGDFVKRDG  83



>gb|EPS68763.1| hypothetical protein M569_06004, partial [Genlisea aurea]
Length=756

 Score =   133 bits (335),  Expect = 4e-32, Method: Composition-based stats.
 Identities = 61/83 (73%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +3

Query  126  KMSKKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            K+ KK+V VF DV + GDP+ERM+FELF DVAPKTAENFRALCTGEKGTS  TG  LHYK
Sbjct  3    KIKKKRVSVFFDVSVDGDPYERMIFELFADVAPKTAENFRALCTGEKGTSVTTGKPLHYK  62

Query  306  GTFFHHIVKGSMAQAGDLLREDG  374
            GTFFH I+KG + Q GDLLR+DG
Sbjct  63   GTFFHRIIKGYVVQGGDLLRQDG  85



>gb|KDP33623.1| hypothetical protein JCGZ_07194 [Jatropha curcas]
Length=789

 Score =   133 bits (335),  Expect = 4e-32, Method: Composition-based stats.
 Identities = 60/80 (75%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +3

Query  135  KKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  314
            KK  LVF+DV I GDPFERMVFELF D+APKTAENFRALCTGEKG  PKTG  LHYKG+F
Sbjct  4    KKNPLVFIDVSIDGDPFERMVFELFYDIAPKTAENFRALCTGEKGIGPKTGRPLHYKGSF  63

Query  315  FHHIVKGSMAQAGDLLREDG  374
            FH I++GSMAQ GD ++ DG
Sbjct  64   FHCIIRGSMAQGGDFVKRDG  83



>gb|KJB07784.1| hypothetical protein B456_001G045000 [Gossypium raimondii]
Length=722

 Score =   132 bits (333),  Expect = 6e-32, Method: Composition-based stats.
 Identities = 59/80 (74%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +3

Query  135  KKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  314
            KK  LVF+DV I GDP ERMVFELF D+APKTAENFRALCTGEKG  PKTG  LHYKG+F
Sbjct  4    KKNPLVFMDVSIDGDPAERMVFELFPDIAPKTAENFRALCTGEKGIGPKTGKPLHYKGSF  63

Query  315  FHHIVKGSMAQAGDLLREDG  374
            FH ++KGS+AQ GD +R DG
Sbjct  64   FHRVMKGSLAQGGDFVRRDG  83



>ref|XP_011081940.1| PREDICTED: LOW QUALITY PROTEIN: peptidyl-prolyl cis-trans isomerase 
CYP95-like [Sesamum indicum]
Length=754

 Score =   132 bits (333),  Expect = 8e-32, Method: Composition-based stats.
 Identities = 63/83 (76%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = +3

Query  126  KMSKKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            K   KK LVFLDV I GDP ERM+FELFTDVAP+TAENFRALCTGEKG S KTG  LHYK
Sbjct  3    KTKGKKQLVFLDVSIDGDPVERMIFELFTDVAPRTAENFRALCTGEKGVSAKTGKPLHYK  62

Query  306  GTFFHHIVKGSMAQAGDLLREDG  374
            GTFFH I KG +AQ GD LR+DG
Sbjct  63   GTFFHRIEKGHLAQGGDFLRQDG  85



>gb|KJB07776.1| hypothetical protein B456_001G045000 [Gossypium raimondii]
 gb|KJB07777.1| hypothetical protein B456_001G045000 [Gossypium raimondii]
 gb|KJB07787.1| hypothetical protein B456_001G045000 [Gossypium raimondii]
 gb|KJB07788.1| hypothetical protein B456_001G045000 [Gossypium raimondii]
Length=801

 Score =   132 bits (333),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 59/80 (74%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +3

Query  135  KKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  314
            KK  LVF+DV I GDP ERMVFELF D+APKTAENFRALCTGEKG  PKTG  LHYKG+F
Sbjct  4    KKNPLVFMDVSIDGDPAERMVFELFPDIAPKTAENFRALCTGEKGIGPKTGKPLHYKGSF  63

Query  315  FHHIVKGSMAQAGDLLREDG  374
            FH ++KGS+AQ GD +R DG
Sbjct  64   FHRVMKGSLAQGGDFVRRDG  83



>gb|KJB07775.1| hypothetical protein B456_001G045000 [Gossypium raimondii]
 gb|KJB07778.1| hypothetical protein B456_001G045000 [Gossypium raimondii]
 gb|KJB07785.1| hypothetical protein B456_001G045000 [Gossypium raimondii]
Length=799

 Score =   132 bits (332),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 59/80 (74%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +3

Query  135  KKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  314
            KK  LVF+DV I GDP ERMVFELF D+APKTAENFRALCTGEKG  PKTG  LHYKG+F
Sbjct  4    KKNPLVFMDVSIDGDPAERMVFELFPDIAPKTAENFRALCTGEKGIGPKTGKPLHYKGSF  63

Query  315  FHHIVKGSMAQAGDLLREDG  374
            FH ++KGS+AQ GD +R DG
Sbjct  64   FHRVMKGSLAQGGDFVRRDG  83



>ref|XP_008394052.1| PREDICTED: peptidyl-prolyl cis-trans isomerase 8 isoform X2 [Malus 
domestica]
Length=835

 Score =   132 bits (332),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 58/83 (70%), Positives = 70/83 (84%), Gaps = 1/83 (1%)
 Frame = +3

Query  129  MSKKK-VLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            M+KKK  LVF+DV + GDP+ERMVFELF+DV PKTAENFRALCTGE+G SPK+G  LHYK
Sbjct  1    MTKKKNPLVFMDVSVDGDPYERMVFELFSDVVPKTAENFRALCTGEQGISPKSGKPLHYK  60

Query  306  GTFFHHIVKGSMAQAGDLLREDG  374
            G+FFH I+KG +AQ GD ++ DG
Sbjct  61   GSFFHRIIKGYIAQGGDFVKRDG  83



>ref|XP_008394051.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G isoform X1 [Malus 
domestica]
Length=856

 Score =   132 bits (332),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 58/83 (70%), Positives = 70/83 (84%), Gaps = 1/83 (1%)
 Frame = +3

Query  129  MSKKK-VLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            M+KKK  LVF+DV + GDP+ERMVFELF+DV PKTAENFRALCTGE+G SPK+G  LHYK
Sbjct  1    MTKKKNPLVFMDVSVDGDPYERMVFELFSDVVPKTAENFRALCTGEQGISPKSGKPLHYK  60

Query  306  GTFFHHIVKGSMAQAGDLLREDG  374
            G+FFH I+KG +AQ GD ++ DG
Sbjct  61   GSFFHRIIKGYIAQGGDFVKRDG  83



>ref|XP_003523694.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X1 [Glycine max]
 ref|XP_006578153.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X2 [Glycine max]
Length=843

 Score =   131 bits (329),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 60/83 (72%), Positives = 68/83 (82%), Gaps = 1/83 (1%)
 Frame = +3

Query  129  MSKKK-VLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            M+KKK  LVF+DV I GDP ERMVFELF DVAPKTAENFRALCTGEKG SP TG +LHYK
Sbjct  1    MTKKKNPLVFMDVSIDGDPVERMVFELFYDVAPKTAENFRALCTGEKGISPNTGKSLHYK  60

Query  306  GTFFHHIVKGSMAQAGDLLREDG  374
            G+FFH I+KGS+ Q GD +  +G
Sbjct  61   GSFFHQIIKGSIVQGGDFVNRNG  83



>gb|KHN08115.1| Peptidyl-prolyl cis-trans isomerase D [Glycine soja]
Length=805

 Score =   130 bits (328),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 60/83 (72%), Positives = 68/83 (82%), Gaps = 1/83 (1%)
 Frame = +3

Query  129  MSKKK-VLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            M+KKK  LVF+DV I GDP ERMVFELF DVAPKTAENFRALCTGEKG SP TG +LHYK
Sbjct  1    MTKKKNPLVFMDVSIDGDPVERMVFELFYDVAPKTAENFRALCTGEKGISPNTGKSLHYK  60

Query  306  GTFFHHIVKGSMAQAGDLLREDG  374
            G+FFH I+KGS+ Q GD +  +G
Sbjct  61   GSFFHQIIKGSIVQGGDFVNRNG  83



>ref|XP_003526420.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X1 [Glycine max]
 ref|XP_006581364.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X2 [Glycine max]
Length=850

 Score =   130 bits (328),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 60/83 (72%), Positives = 68/83 (82%), Gaps = 1/83 (1%)
 Frame = +3

Query  129  MSKKK-VLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            M+KKK  LVF+DV I GDP ERMVFELF DVAPKTAENFRALCTGEKG SP TG +LHYK
Sbjct  1    MTKKKNPLVFMDVSIDGDPVERMVFELFYDVAPKTAENFRALCTGEKGISPNTGKSLHYK  60

Query  306  GTFFHHIVKGSMAQAGDLLREDG  374
            G+FFH I+KGS+ Q GD +  +G
Sbjct  61   GSFFHQIIKGSIVQGGDFVNRNG  83



>ref|XP_006581365.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X3 [Glycine max]
Length=837

 Score =   130 bits (328),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 60/83 (72%), Positives = 68/83 (82%), Gaps = 1/83 (1%)
 Frame = +3

Query  129  MSKKK-VLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            M+KKK  LVF+DV I GDP ERMVFELF DVAPKTAENFRALCTGEKG SP TG +LHYK
Sbjct  1    MTKKKNPLVFMDVSIDGDPVERMVFELFYDVAPKTAENFRALCTGEKGISPNTGKSLHYK  60

Query  306  GTFFHHIVKGSMAQAGDLLREDG  374
            G+FFH I+KGS+ Q GD +  +G
Sbjct  61   GSFFHQIIKGSIVQGGDFVNRNG  83



>gb|KHN07093.1| Peptidyl-prolyl cis-trans isomerase D [Glycine soja]
Length=824

 Score =   130 bits (328),  Expect = 5e-31, Method: Composition-based stats.
 Identities = 60/83 (72%), Positives = 68/83 (82%), Gaps = 1/83 (1%)
 Frame = +3

Query  129  MSKKK-VLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            M+KKK  LVF+DV I GDP ERMVFELF DVAPKTAENFRALCTGEKG SP TG +LHYK
Sbjct  1    MTKKKNPLVFMDVSIDGDPVERMVFELFYDVAPKTAENFRALCTGEKGISPNTGKSLHYK  60

Query  306  GTFFHHIVKGSMAQAGDLLREDG  374
            G+FFH I+KGS+ Q GD +  +G
Sbjct  61   GSFFHQIIKGSIVQGGDFVNRNG  83



>ref|XP_007161232.1| hypothetical protein PHAVU_001G053000g [Phaseolus vulgaris]
 gb|ESW33226.1| hypothetical protein PHAVU_001G053000g [Phaseolus vulgaris]
Length=895

 Score =   130 bits (327),  Expect = 7e-31, Method: Composition-based stats.
 Identities = 59/83 (71%), Positives = 68/83 (82%), Gaps = 1/83 (1%)
 Frame = +3

Query  129  MSKKK-VLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            M+KKK  LVF+DV I GDP ERMVFELF DVAPKTAENFRALCTGE+G  P TG +LHYK
Sbjct  1    MAKKKNCLVFMDVSIDGDPVERMVFELFYDVAPKTAENFRALCTGERGVGPSTGKSLHYK  60

Query  306  GTFFHHIVKGSMAQAGDLLREDG  374
            G+FFH IVKGS+A+ GD +  +G
Sbjct  61   GSFFHRIVKGSIARGGDFVNRNG  83



>ref|XP_007161231.1| hypothetical protein PHAVU_001G052900g [Phaseolus vulgaris]
 gb|ESW33225.1| hypothetical protein PHAVU_001G052900g [Phaseolus vulgaris]
Length=915

 Score =   130 bits (326),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 59/83 (71%), Positives = 68/83 (82%), Gaps = 1/83 (1%)
 Frame = +3

Query  129  MSKKK-VLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            M+KKK  LVF+DV I GDP ERMVFELF DVAPKTAENFRALCTGE G SP TG +LHYK
Sbjct  1    MAKKKNSLVFMDVSIDGDPVERMVFELFYDVAPKTAENFRALCTGESGVSPNTGKSLHYK  60

Query  306  GTFFHHIVKGSMAQAGDLLREDG  374
            G+FFH +VKGS+A+ GD +  +G
Sbjct  61   GSFFHRVVKGSIARGGDFVNRNG  83



>ref|XP_007225294.1| hypothetical protein PRUPE_ppa001326mg [Prunus persica]
 gb|EMJ26493.1| hypothetical protein PRUPE_ppa001326mg [Prunus persica]
Length=854

 Score =   129 bits (325),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 59/83 (71%), Positives = 69/83 (83%), Gaps = 1/83 (1%)
 Frame = +3

Query  129  MSKKK-VLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            M+KKK  LVF+DV + GDP ERMVFELF+DVAPKTAENFRALCTGEKG  PK+G  LHYK
Sbjct  1    MTKKKNPLVFMDVSVDGDPVERMVFELFSDVAPKTAENFRALCTGEKGIGPKSGRPLHYK  60

Query  306  GTFFHHIVKGSMAQAGDLLREDG  374
            G+FFH I+KG +AQ GD ++ DG
Sbjct  61   GSFFHRIIKGYIAQGGDFIKRDG  83



>ref|XP_002515550.1| peptidyl-prolyl cis-trans isomerase, putative [Ricinus communis]
 gb|EEF46999.1| peptidyl-prolyl cis-trans isomerase, putative [Ricinus communis]
Length=729

 Score =   129 bits (323),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 59/84 (70%), Positives = 69/84 (82%), Gaps = 1/84 (1%)
 Frame = +3

Query  126  KMSKKK-VLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHY  302
            +M+K+K  +VF+DV I GDPFERMVFELF + APKT ENFRALCTGEKG  PKTG  LHY
Sbjct  4    EMAKRKNPMVFMDVSIDGDPFERMVFELFPEFAPKTVENFRALCTGEKGIGPKTGRPLHY  63

Query  303  KGTFFHHIVKGSMAQAGDLLREDG  374
            KG+FFH I+KGSMAQ GD ++ DG
Sbjct  64   KGSFFHCIIKGSMAQGGDFVKRDG  87



>gb|KCW80439.1| hypothetical protein EUGRSUZ_C01785 [Eucalyptus grandis]
Length=614

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = +3

Query  129  MSKKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  308
            M KK +LVF+DV I GDP ERMVFELF +VAPKTAENFRALCTGEKG   KTG  LH+KG
Sbjct  2    MKKKDLLVFMDVSIDGDPAERMVFELFPEVAPKTAENFRALCTGEKGIGQKTGRPLHFKG  61

Query  309  TFFHHIVKGSMAQAGDLLREDG  374
            +FFH I++GSMAQ GD  + DG
Sbjct  62   SFFHRIIRGSMAQGGDFHKRDG  83



>ref|XP_008219899.1| PREDICTED: peptidyl-prolyl cis-trans isomerase 8 isoform X1 [Prunus 
mume]
 ref|XP_008219900.1| PREDICTED: peptidyl-prolyl cis-trans isomerase 8 isoform X1 [Prunus 
mume]
Length=843

 Score =   129 bits (324),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 58/83 (70%), Positives = 69/83 (83%), Gaps = 1/83 (1%)
 Frame = +3

Query  129  MSKKK-VLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            M+KKK  LVF+DV + GDP ERMVFELF+DVAP+TAENFRALCTGEKG  PK+G  LHYK
Sbjct  1    MTKKKNPLVFMDVSVDGDPVERMVFELFSDVAPRTAENFRALCTGEKGIGPKSGRPLHYK  60

Query  306  GTFFHHIVKGSMAQAGDLLREDG  374
            G+FFH I+KG +AQ GD ++ DG
Sbjct  61   GSFFHRIIKGYIAQGGDFIKRDG  83



>ref|XP_007161230.1| hypothetical protein PHAVU_001G052800g [Phaseolus vulgaris]
 gb|ESW33224.1| hypothetical protein PHAVU_001G052800g [Phaseolus vulgaris]
Length=933

 Score =   129 bits (324),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 59/83 (71%), Positives = 68/83 (82%), Gaps = 1/83 (1%)
 Frame = +3

Query  129  MSKKK-VLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            M+KKK  LVF+DV I GDP ERMVFELF DVAPKTAENFRALCTGE+G  P TG +LHYK
Sbjct  1    MAKKKNSLVFMDVSIDGDPVERMVFELFYDVAPKTAENFRALCTGERGVGPNTGKSLHYK  60

Query  306  GTFFHHIVKGSMAQAGDLLREDG  374
            G+FFH IVKGS+A+ GD +  +G
Sbjct  61   GSFFHRIVKGSIARGGDFVNRNG  83



>gb|KJB07770.1| hypothetical protein B456_001G044900 [Gossypium raimondii]
 gb|KJB07771.1| hypothetical protein B456_001G044900 [Gossypium raimondii]
 gb|KJB07772.1| hypothetical protein B456_001G044900 [Gossypium raimondii]
 gb|KJB07773.1| hypothetical protein B456_001G044900 [Gossypium raimondii]
Length=787

 Score =   129 bits (323),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 58/83 (70%), Positives = 67/83 (81%), Gaps = 1/83 (1%)
 Frame = +3

Query  129  MSKKK-VLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            M+KKK  LVF+DV I GDP ERMVFELF D+APKT ENFRALCTGEKG  P+TG  LHYK
Sbjct  1    MAKKKNPLVFMDVSIDGDPVERMVFELFPDIAPKTVENFRALCTGEKGIGPRTGKPLHYK  60

Query  306  GTFFHHIVKGSMAQAGDLLREDG  374
            G+FFH + KGS+A+ GD +R DG
Sbjct  61   GSFFHRVSKGSLAKGGDFVRRDG  83



>ref|XP_009334769.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X1 [Pyrus x bretschneideri]
Length=854

 Score =   129 bits (323),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 56/83 (67%), Positives = 68/83 (82%), Gaps = 1/83 (1%)
 Frame = +3

Query  129  MSKKK-VLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            M+KKK   VF+DV + GDP+ERMVFELF+DV PKTAENF ALCTGE+G SPK+G  LHYK
Sbjct  1    MTKKKNPFVFMDVSVDGDPYERMVFELFSDVVPKTAENFHALCTGEQGISPKSGKPLHYK  60

Query  306  GTFFHHIVKGSMAQAGDLLREDG  374
            G+FFH I+KG +AQ GD ++ DG
Sbjct  61   GSFFHRIIKGYIAQGGDFVKRDG  83



>gb|AES58972.2| peptidyl-prolyl cis-trans isomerase [Medicago truncatula]
Length=772

 Score =   128 bits (322),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 56/83 (67%), Positives = 69/83 (83%), Gaps = 1/83 (1%)
 Frame = +3

Query  129  MSKKK-VLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            M+KKK  +VF+DV + GDP+E+MVFELF DVAPKTAENFRALCTGEKG SP TG +LHYK
Sbjct  1    MAKKKNSMVFMDVSVDGDPYEKMVFELFYDVAPKTAENFRALCTGEKGVSPNTGKSLHYK  60

Query  306  GTFFHHIVKGSMAQAGDLLREDG  374
            G+FFH I+KGS+ + GD +  +G
Sbjct  61   GSFFHQILKGSIVKGGDFINRNG  83



>ref|XP_009334770.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X2 [Pyrus x bretschneideri]
Length=846

 Score =   129 bits (323),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 56/83 (67%), Positives = 68/83 (82%), Gaps = 1/83 (1%)
 Frame = +3

Query  129  MSKKK-VLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            M+KKK   VF+DV + GDP+ERMVFELF+DV PKTAENF ALCTGE+G SPK+G  LHYK
Sbjct  1    MTKKKNPFVFMDVSVDGDPYERMVFELFSDVVPKTAENFHALCTGEQGISPKSGKPLHYK  60

Query  306  GTFFHHIVKGSMAQAGDLLREDG  374
            G+FFH I+KG +AQ GD ++ DG
Sbjct  61   GSFFHRIIKGYIAQGGDFVKRDG  83



>ref|XP_009345297.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like [Pyrus 
x bretschneideri]
Length=1043

 Score =   129 bits (323),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 56/83 (67%), Positives = 68/83 (82%), Gaps = 1/83 (1%)
 Frame = +3

Query  129  MSKKK-VLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            M+KKK   VF+DV + GDP+ERMVFELF+DV PKTAENF ALCTGE+G SPK+G  LHYK
Sbjct  1    MTKKKNPFVFMDVSVDGDPYERMVFELFSDVVPKTAENFHALCTGEQGISPKSGKPLHYK  60

Query  306  GTFFHHIVKGSMAQAGDLLREDG  374
            G+FFH I+KG +AQ GD ++ DG
Sbjct  61   GSFFHRIIKGYIAQGGDFVKRDG  83



>ref|XP_010048236.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X2 [Eucalyptus grandis]
Length=797

 Score =   127 bits (320),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 58/82 (71%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = +3

Query  129  MSKKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  308
            M KK +LVF+DV I GDP ERMVFELF +VAPKTAENFRALCTGEKG   KTG  LH+KG
Sbjct  2    MKKKDLLVFMDVSIDGDPAERMVFELFPEVAPKTAENFRALCTGEKGIGQKTGRPLHFKG  61

Query  309  TFFHHIVKGSMAQAGDLLREDG  374
            +FFH I++GSMAQ GD  + DG
Sbjct  62   SFFHRIIRGSMAQGGDFHKRDG  83



>ref|XP_010048233.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Eucalyptus grandis]
 ref|XP_010048234.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Eucalyptus grandis]
 ref|XP_010048235.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Eucalyptus grandis]
 gb|KCW80436.1| hypothetical protein EUGRSUZ_C01785 [Eucalyptus grandis]
Length=799

 Score =   127 bits (320),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 58/82 (71%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = +3

Query  129  MSKKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  308
            M KK +LVF+DV I GDP ERMVFELF +VAPKTAENFRALCTGEKG   KTG  LH+KG
Sbjct  2    MKKKDLLVFMDVSIDGDPAERMVFELFPEVAPKTAENFRALCTGEKGIGQKTGRPLHFKG  61

Query  309  TFFHHIVKGSMAQAGDLLREDG  374
            +FFH I++GSMAQ GD  + DG
Sbjct  62   SFFHRIIRGSMAQGGDFHKRDG  83



>ref|XP_010048238.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X4 [Eucalyptus grandis]
Length=794

 Score =   127 bits (320),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 58/82 (71%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = +3

Query  129  MSKKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  308
            M KK +LVF+DV I GDP ERMVFELF +VAPKTAENFRALCTGEKG   KTG  LH+KG
Sbjct  2    MKKKDLLVFMDVSIDGDPAERMVFELFPEVAPKTAENFRALCTGEKGIGQKTGRPLHFKG  61

Query  309  TFFHHIVKGSMAQAGDLLREDG  374
            +FFH I++GSMAQ GD  + DG
Sbjct  62   SFFHRIIRGSMAQGGDFHKRDG  83



>ref|XP_010048237.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X3 [Eucalyptus grandis]
 gb|KCW80434.1| hypothetical protein EUGRSUZ_C01785 [Eucalyptus grandis]
 gb|KCW80435.1| hypothetical protein EUGRSUZ_C01785 [Eucalyptus grandis]
Length=796

 Score =   127 bits (320),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 58/82 (71%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = +3

Query  129  MSKKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  308
            M KK +LVF+DV I GDP ERMVFELF +VAPKTAENFRALCTGEKG   KTG  LH+KG
Sbjct  2    MKKKDLLVFMDVSIDGDPAERMVFELFPEVAPKTAENFRALCTGEKGIGQKTGRPLHFKG  61

Query  309  TFFHHIVKGSMAQAGDLLREDG  374
            +FFH I++GSMAQ GD  + DG
Sbjct  62   SFFHRIIRGSMAQGGDFHKRDG  83



>ref|XP_008378303.1| PREDICTED: peptidyl-prolyl cis-trans isomerase cyp11-like isoform 
X1 [Malus domestica]
Length=517

 Score =   125 bits (314),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = +3

Query  135  KKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  314
            KK   VF+DV + GDP+ERMVFELF+DVAPKTAENFRALCTGE+G  PK+   LHYKG+F
Sbjct  4    KKNPFVFMDVSVDGDPYERMVFELFSDVAPKTAENFRALCTGEQGIGPKSRKPLHYKGSF  63

Query  315  FHHIVKGSMAQAGDLLREDGMV  380
            FH IVKG  AQ GD ++ DG  
Sbjct  64   FHRIVKGYNAQGGDFVKRDGTA  85



>gb|KCW80440.1| hypothetical protein EUGRSUZ_C01785 [Eucalyptus grandis]
 gb|KCW80441.1| hypothetical protein EUGRSUZ_C01785 [Eucalyptus grandis]
Length=695

 Score =   126 bits (317),  Expect = 8e-30, Method: Composition-based stats.
 Identities = 58/82 (71%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = +3

Query  129  MSKKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  308
            M KK +LVF+DV I GDP ERMVFELF +VAPKTAENFRALCTGEKG   KTG  LH+KG
Sbjct  2    MKKKDLLVFMDVSIDGDPAERMVFELFPEVAPKTAENFRALCTGEKGIGQKTGRPLHFKG  61

Query  309  TFFHHIVKGSMAQAGDLLREDG  374
            +FFH I++GSMAQ GD  + DG
Sbjct  62   SFFHRIIRGSMAQGGDFHKRDG  83



>ref|XP_006382072.1| hypothetical protein POPTR_0006s26710g [Populus trichocarpa]
 gb|ERP59869.1| hypothetical protein POPTR_0006s26710g [Populus trichocarpa]
Length=842

 Score =   126 bits (317),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 61/100 (61%), Positives = 69/100 (69%), Gaps = 17/100 (17%)
 Frame = +3

Query  126  KMSKKKVLVFLDVCIGGDPFERMVFE-----------------LFTDVAPKTAENFRALC  254
            KM+KK  LVF+DVCI GDP ERMVFE                 LF D+APKT ENFRALC
Sbjct  4    KMAKKNPLVFMDVCIDGDPKERMVFEVSSCFKFQPCRMDDEIPLFLDIAPKTVENFRALC  63

Query  255  TGEKGTSPKTGATLHYKGTFFHHIVKGSMAQAGDLLREDG  374
            TGEKG  PK+   LHYKG+FFH I+KGSMAQ GD+L+ DG
Sbjct  64   TGEKGIGPKSQRPLHYKGSFFHRIIKGSMAQGGDILKRDG  103



>ref|XP_004501305.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X1 [Cicer arietinum]
Length=838

 Score =   126 bits (317),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 58/83 (70%), Positives = 68/83 (82%), Gaps = 1/83 (1%)
 Frame = +3

Query  129  MSKKK-VLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            MSKKK  LVF+DV I GDP E+MVFELF DVAPKTAENFRALCTGEKG SP TG +LHYK
Sbjct  4    MSKKKNPLVFMDVSIDGDPVEKMVFELFYDVAPKTAENFRALCTGEKGISPNTGKSLHYK  63

Query  306  GTFFHHIVKGSMAQAGDLLREDG  374
            G+FFH ++KGS+ + GD +  +G
Sbjct  64   GSFFHQVIKGSIVKGGDFVNRNG  86



>gb|KJB07786.1| hypothetical protein B456_001G045000 [Gossypium raimondii]
Length=807

 Score =   126 bits (316),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 59/86 (69%), Positives = 66/86 (77%), Gaps = 6/86 (7%)
 Frame = +3

Query  135  KKKVLVFLDVCIGGDPFERMVFE------LFTDVAPKTAENFRALCTGEKGTSPKTGATL  296
            KK  LVF+DV I GDP ERMVFE      LF D+APKTAENFRALCTGEKG  PKTG  L
Sbjct  4    KKNPLVFMDVSIDGDPAERMVFEFSLILQLFPDIAPKTAENFRALCTGEKGIGPKTGKPL  63

Query  297  HYKGTFFHHIVKGSMAQAGDLLREDG  374
            HYKG+FFH ++KGS+AQ GD +R DG
Sbjct  64   HYKGSFFHRVMKGSLAQGGDFVRRDG  89



>ref|XP_004498656.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X2 [Cicer arietinum]
 ref|XP_004498657.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X3 [Cicer arietinum]
Length=773

 Score =   125 bits (315),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 59/83 (71%), Positives = 67/83 (81%), Gaps = 1/83 (1%)
 Frame = +3

Query  129  MSKKK-VLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            M+KKK  +VFLDV I GDP ERMVFELF DVAPKTAENFRALCTGEKG S  TG +LHYK
Sbjct  1    MAKKKNPMVFLDVSIDGDPAERMVFELFYDVAPKTAENFRALCTGEKGVSSNTGKSLHYK  60

Query  306  GTFFHHIVKGSMAQAGDLLREDG  374
            G+FFH IVKGS+ + GD +  +G
Sbjct  61   GSFFHQIVKGSIVRGGDFINRNG  83



>ref|XP_008378304.1| PREDICTED: peptidyl-prolyl cis-trans isomerase 8-like isoform 
X2 [Malus domestica]
Length=826

 Score =   125 bits (315),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 57/83 (69%), Positives = 67/83 (81%), Gaps = 1/83 (1%)
 Frame = +3

Query  129  MSKKK-VLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            M+KKK   VF+DV + GDP+ERMVFELF+DVAPKTAENFRALCTGE+G  PK+   LHYK
Sbjct  1    MTKKKNPFVFMDVSVDGDPYERMVFELFSDVAPKTAENFRALCTGEQGIGPKSRKPLHYK  60

Query  306  GTFFHHIVKGSMAQAGDLLREDG  374
            G+FFH IVKG  AQ GD ++ DG
Sbjct  61   GSFFHRIVKGYNAQGGDFVKRDG  83



>gb|KHG30308.1| Peptidyl-prolyl cis-trans isomerase cyp5 [Gossypium arboreum]
Length=196

 Score =   119 bits (297),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 63/80 (79%), Gaps = 3/80 (4%)
 Frame = +3

Query  135  KKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  314
            KK  LVF+DV I GDP ERM   LF D+APKTAENFRALCTGEKG  PKTG  LHYKG+F
Sbjct  4    KKNPLVFMDVSIDGDPAERM---LFPDIAPKTAENFRALCTGEKGIGPKTGKPLHYKGSF  60

Query  315  FHHIVKGSMAQAGDLLREDG  374
            FH ++KGS+AQ GD +R DG
Sbjct  61   FHRVMKGSLAQGGDFVRRDG  80



>emb|CDX68845.1| BnaC01g06080D [Brassica napus]
Length=765

 Score =   125 bits (313),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 56/80 (70%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = +3

Query  135  KKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  314
            KK   V++DVCI GDP E MVFELF DVAPKT+ENFRALCTGEKG  P++G  LHYKG+F
Sbjct  4    KKNPQVYMDVCIDGDPAETMVFELFPDVAPKTSENFRALCTGEKGIGPRSGKPLHYKGSF  63

Query  315  FHHIVKGSMAQAGDLLREDG  374
            FH I+KGS AQAGD +  DG
Sbjct  64   FHRILKGSSAQAGDFVNRDG  83



>emb|CDX75243.1| BnaA01g04590D [Brassica napus]
Length=765

 Score =   124 bits (312),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 56/80 (70%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = +3

Query  135  KKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  314
            KK   V++DVCI GDP E MVFELF DVAPKT+ENFRALCTGEKG  P++G  LHYKG+F
Sbjct  4    KKNPQVYMDVCIDGDPAETMVFELFPDVAPKTSENFRALCTGEKGIGPRSGKPLHYKGSF  63

Query  315  FHHIVKGSMAQAGDLLREDG  374
            FH I+KGS AQAGD +  DG
Sbjct  64   FHRILKGSSAQAGDFVSRDG  83



>ref|XP_009126010.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Brassica rapa]
 ref|XP_009126018.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Brassica rapa]
Length=760

 Score =   124 bits (311),  Expect = 7e-29, Method: Composition-based stats.
 Identities = 56/80 (70%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = +3

Query  135  KKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  314
            KK   V++DVCI GDP E MVFELF DVAPKT+ENFRALCTGEKG  P++G  LHYKG+F
Sbjct  4    KKNPQVYMDVCIDGDPAETMVFELFPDVAPKTSENFRALCTGEKGIGPRSGKPLHYKGSF  63

Query  315  FHHIVKGSMAQAGDLLREDG  374
            FH I+KGS AQAGD +  DG
Sbjct  64   FHRILKGSSAQAGDFVSRDG  83



>ref|XP_004291478.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Fragaria vesca subsp. vesca]
 ref|XP_011459211.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Fragaria vesca subsp. vesca]
Length=761

 Score =   123 bits (309),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 56/83 (67%), Positives = 67/83 (81%), Gaps = 1/83 (1%)
 Frame = +3

Query  129  MSKKK-VLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            M+KKK  LVF+D+CI GDP E+MVFELF D APKTA+NFRALCTGEKG  PK+G  LHYK
Sbjct  1    MAKKKNPLVFMDLCIDGDPAEKMVFELFYDRAPKTADNFRALCTGEKGIGPKSGRPLHYK  60

Query  306  GTFFHHIVKGSMAQAGDLLREDG  374
            G+FFH I+KG  A+ GD ++ DG
Sbjct  61   GSFFHRILKGYYAKGGDFVKRDG  83



>ref|XP_008347718.1| PREDICTED: peptidyl-prolyl cis-trans isomerase cyp5-like [Malus 
domestica]
Length=87

 Score =   112 bits (281),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 60/76 (79%), Gaps = 0/76 (0%)
 Frame = +3

Query  135  KKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  314
            KK   VF+DV + GDP+ERMVFELF+DVAPKTAENFRALCTGE+G  PK+   LHYKG+F
Sbjct  4    KKNPFVFMDVSVDGDPYERMVFELFSDVAPKTAENFRALCTGEQGIGPKSRKPLHYKGSF  63

Query  315  FHHIVKGSMAQAGDLL  362
            FH IVKG  AQ   L+
Sbjct  64   FHRIVKGYNAQDTGLM  79



>ref|XP_010037119.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like [Eucalyptus 
grandis]
Length=158

 Score =   114 bits (286),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = +3

Query  129  MSKKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  308
            M KK +LVF+DV I GDP ERM+FELF +VAPKTAENFRAL TGEKG   KTG  LH KG
Sbjct  2    MKKKDLLVFMDVSIDGDPAERMIFELFPEVAPKTAENFRALYTGEKGIGQKTGRPLHLKG  61

Query  309  TFFHHIVKGSMAQAGDLLREDG  374
            +FFH I++G MAQ GD  + DG
Sbjct  62   SFFHRIIRGFMAQGGDFHKRDG  83



>gb|AES73684.2| peptidyl-prolyl cis-trans isomerase [Medicago truncatula]
Length=895

 Score =   122 bits (306),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 56/83 (67%), Positives = 66/83 (80%), Gaps = 1/83 (1%)
 Frame = +3

Query  129  MSKKK-VLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            M+KKK  LVF+DV I GDP +RMVFELF DVAPKTAENFRALCTGE+G S  TG  LHYK
Sbjct  4    MTKKKNPLVFMDVSIDGDPVKRMVFELFHDVAPKTAENFRALCTGERGISSNTGKLLHYK  63

Query  306  GTFFHHIVKGSMAQAGDLLREDG  374
            G+FFH I+KGS+ + GD +  +G
Sbjct  64   GSFFHQIMKGSIVKGGDFVNRNG  86



>emb|CAN75764.1| hypothetical protein VITISV_034442 [Vitis vinifera]
Length=786

 Score =   121 bits (304),  Expect = 7e-28, Method: Composition-based stats.
 Identities = 58/88 (66%), Positives = 65/88 (74%), Gaps = 1/88 (1%)
 Frame = +3

Query  129  MSKKK-VLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            M+KKK  LVFLDV I GDP E++V ELF DV PKTAENFRALCTGEKG    TG  LHYK
Sbjct  1    MTKKKNPLVFLDVSIDGDPVEKIVIELFADVVPKTAENFRALCTGEKGVGTSTGKPLHYK  60

Query  306  GTFFHHIVKGSMAQAGDLLREDGMVIYF  389
            G+FFH I+KG MAQ GD  + +GM   F
Sbjct  61   GSFFHRIIKGFMAQGGDFSKGNGMCFLF  88



>ref|XP_006838913.1| hypothetical protein AMTR_s00002p00269760 [Amborella trichopoda]
 gb|ERN01482.1| hypothetical protein AMTR_s00002p00269760 [Amborella trichopoda]
Length=795

 Score =   121 bits (303),  Expect = 9e-28, Method: Composition-based stats.
 Identities = 57/80 (71%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +3

Query  135  KKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  314
            KK  LVFLDV IGGDP  +MVFELF+DV PKTAENFRALCTGEKG    TG  LHYKG+ 
Sbjct  4    KKNSLVFLDVSIGGDPAGKMVFELFSDVVPKTAENFRALCTGEKGIGQVTGKPLHYKGSI  63

Query  315  FHHIVKGSMAQAGDLLREDG  374
            FH I+KG MAQ GD  R+DG
Sbjct  64   FHRIIKGFMAQGGDFSRKDG  83



>emb|CAA22569.1| putative protein [Arabidopsis thaliana]
 emb|CAB79959.1| putative protein [Arabidopsis thaliana]
Length=857

 Score =   120 bits (302),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 56/83 (67%), Positives = 66/83 (80%), Gaps = 1/83 (1%)
 Frame = +3

Query  129  MSKKK-VLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            M+KKK   VF+DV I GDP E MVFELF +VAPKT+ENFRALCTGEKG  P++G  LHYK
Sbjct  1    MAKKKNPQVFMDVSIDGDPAETMVFELFPEVAPKTSENFRALCTGEKGIGPRSGKPLHYK  60

Query  306  GTFFHHIVKGSMAQAGDLLREDG  374
            G+FFH I+KGS AQAGD +  +G
Sbjct  61   GSFFHRIMKGSSAQAGDFVNRNG  83



>ref|XP_010447392.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X2 [Camelina sativa]
Length=822

 Score =   120 bits (300),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 55/80 (69%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +3

Query  135  KKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  314
            KK   VF+DV I GDP E MVFELF +VAPKT+ENFRALCTGEKG  P++G  LHYKG+F
Sbjct  4    KKNPQVFMDVSIDGDPAETMVFELFPEVAPKTSENFRALCTGEKGIGPRSGKPLHYKGSF  63

Query  315  FHHIVKGSMAQAGDLLREDG  374
            FH I+KGS AQAGD +  DG
Sbjct  64   FHRILKGSSAQAGDFVNRDG  83



>ref|XP_010447391.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X1 [Camelina sativa]
Length=824

 Score =   120 bits (300),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 55/80 (69%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +3

Query  135  KKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  314
            KK   VF+DV I GDP E MVFELF +VAPKT+ENFRALCTGEKG  P++G  LHYKG+F
Sbjct  4    KKNPQVFMDVSIDGDPAETMVFELFPEVAPKTSENFRALCTGEKGIGPRSGKPLHYKGSF  63

Query  315  FHHIVKGSMAQAGDLLREDG  374
            FH I+KGS AQAGD +  DG
Sbjct  64   FHRILKGSSAQAGDFVNRDG  83



>ref|NP_194968.2| cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein 
[Arabidopsis thaliana]
 ref|NP_001190889.1| cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein 
[Arabidopsis thaliana]
 sp|Q8RWY7.2|CYP95_ARATH RecName: Full=Peptidyl-prolyl cis-trans isomerase CYP95; Short=AtCYP95; 
Short=PPIase CYP95; AltName: Full=Cyclophilin-like 
protein CypRS92 [Arabidopsis thaliana]
 gb|AEE86054.1| peptidylprolyl isomerase [Arabidopsis thaliana]
 gb|AEE86057.1| peptidylprolyl isomerase [Arabidopsis thaliana]
Length=837

 Score =   120 bits (300),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 56/83 (67%), Positives = 66/83 (80%), Gaps = 1/83 (1%)
 Frame = +3

Query  129  MSKKK-VLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            M+KKK   VF+DV I GDP E MVFELF +VAPKT+ENFRALCTGEKG  P++G  LHYK
Sbjct  1    MAKKKNPQVFMDVSIDGDPAETMVFELFPEVAPKTSENFRALCTGEKGIGPRSGKPLHYK  60

Query  306  GTFFHHIVKGSMAQAGDLLREDG  374
            G+FFH I+KGS AQAGD +  +G
Sbjct  61   GSFFHRIMKGSSAQAGDFVNRNG  83



>ref|XP_002867244.1| hypothetical protein ARALYDRAFT_491484 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43503.1| hypothetical protein ARALYDRAFT_491484 [Arabidopsis lyrata subsp. 
lyrata]
Length=845

 Score =   120 bits (300),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 54/80 (68%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +3

Query  135  KKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  314
            KK   VF+DV I GDP E MVFELF +VAPKT+ENFRALCTGEKG  P++G  LHYKG+F
Sbjct  4    KKNPQVFMDVSIDGDPAETMVFELFPEVAPKTSENFRALCTGEKGIGPRSGKPLHYKGSF  63

Query  315  FHHIVKGSMAQAGDLLREDG  374
            FH I++GS AQAGD +  DG
Sbjct  64   FHRILQGSSAQAGDFVNRDG  83



>ref|NP_001190888.1| cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein 
[Arabidopsis thaliana]
 gb|AEE86056.1| peptidylprolyl isomerase [Arabidopsis thaliana]
Length=820

 Score =   119 bits (299),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 54/80 (68%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +3

Query  135  KKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  314
            KK   VF+DV I GDP E MVFELF +VAPKT+ENFRALCTGEKG  P++G  LHYKG+F
Sbjct  4    KKNPQVFMDVSIDGDPAETMVFELFPEVAPKTSENFRALCTGEKGIGPRSGKPLHYKGSF  63

Query  315  FHHIVKGSMAQAGDLLREDG  374
            FH I+KGS AQAGD +  +G
Sbjct  64   FHRIMKGSSAQAGDFVNRNG  83



>gb|KHG26228.1| Peptidyl-prolyl cis-trans isomerase D [Gossypium arboreum]
Length=177

 Score =   112 bits (281),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 64/87 (74%), Gaps = 1/87 (1%)
 Frame = +3

Query  129  MSKKK-VLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            MSKKK  +VF DV IGGD  ER++ ELF DV PKTAENFRALCTGEKG    TG  LHYK
Sbjct  1    MSKKKNPMVFFDVSIGGDLVERIIIELFADVVPKTAENFRALCTGEKGIGKSTGKPLHYK  60

Query  306  GTFFHHIVKGSMAQAGDLLREDGMVIY  386
            GTF H I+KG MAQ GD  + +GM+ +
Sbjct  61   GTFLHRIIKGFMAQGGDFSKGNGMLAH  87



>ref|XP_010437913.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X2 [Camelina sativa]
Length=805

 Score =   119 bits (299),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 55/80 (69%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +3

Query  135  KKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  314
            KK   VF+DV I GDP E MVFELF +VAPKT+ENFRALCTGEKG  P++G  LHYKG+F
Sbjct  4    KKNPQVFMDVSIDGDPAETMVFELFPEVAPKTSENFRALCTGEKGIGPRSGKPLHYKGSF  63

Query  315  FHHIVKGSMAQAGDLLREDG  374
            FH I+KGS AQAGD +  DG
Sbjct  64   FHRILKGSSAQAGDFVNRDG  83



>ref|XP_010437912.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X1 [Camelina sativa]
Length=806

 Score =   119 bits (299),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 55/80 (69%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +3

Query  135  KKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  314
            KK   VF+DV I GDP E MVFELF +VAPKT+ENFRALCTGEKG  P++G  LHYKG+F
Sbjct  4    KKNPQVFMDVSIDGDPAETMVFELFPEVAPKTSENFRALCTGEKGIGPRSGKPLHYKGSF  63

Query  315  FHHIVKGSMAQAGDLLREDG  374
            FH I+KGS AQAGD +  DG
Sbjct  64   FHRILKGSSAQAGDFVNRDG  83



>ref|XP_010249988.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X2 [Nelumbo nucifera]
Length=806

 Score =   119 bits (298),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 56/83 (67%), Positives = 64/83 (77%), Gaps = 1/83 (1%)
 Frame = +3

Query  129  MSKKK-VLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            M+K+K  LVFLDV I GDP E+M+FELF DV P+TAENFRALCTGEKG    TG  LHYK
Sbjct  1    MTKRKNPLVFLDVSIDGDPAEKMIFELFHDVVPRTAENFRALCTGEKGIGSTTGKHLHYK  60

Query  306  GTFFHHIVKGSMAQAGDLLREDG  374
            G+FFH I++G MAQ GD  R DG
Sbjct  61   GSFFHRIIRGFMAQGGDFSRGDG  83



>ref|XP_010432721.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X2 [Camelina sativa]
Length=829

 Score =   119 bits (297),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 54/80 (68%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +3

Query  135  KKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  314
            KK   VF+DV I GDP E MVFELF +VAP+T+ENFRALCTGEKG  P++G  LHYKG+F
Sbjct  4    KKNPQVFMDVSIDGDPAETMVFELFPEVAPQTSENFRALCTGEKGIGPRSGKPLHYKGSF  63

Query  315  FHHIVKGSMAQAGDLLREDG  374
            FH I+KGS AQAGD +  DG
Sbjct  64   FHRILKGSSAQAGDFVNRDG  83



>ref|XP_010249986.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Nelumbo nucifera]
 ref|XP_010249987.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Nelumbo nucifera]
Length=807

 Score =   119 bits (297),  Expect = 6e-27, Method: Composition-based stats.
 Identities = 56/83 (67%), Positives = 64/83 (77%), Gaps = 1/83 (1%)
 Frame = +3

Query  129  MSKKK-VLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            M+K+K  LVFLDV I GDP E+M+FELF DV P+TAENFRALCTGEKG    TG  LHYK
Sbjct  1    MTKRKNPLVFLDVSIDGDPAEKMIFELFHDVVPRTAENFRALCTGEKGIGSTTGKHLHYK  60

Query  306  GTFFHHIVKGSMAQAGDLLREDG  374
            G+FFH I++G MAQ GD  R DG
Sbjct  61   GSFFHRIIRGFMAQGGDFSRGDG  83



>ref|XP_010432719.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X1 [Camelina sativa]
Length=846

 Score =   119 bits (297),  Expect = 6e-27, Method: Composition-based stats.
 Identities = 54/80 (68%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +3

Query  135  KKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  314
            KK   VF+DV I GDP E MVFELF +VAP+T+ENFRALCTGEKG  P++G  LHYKG+F
Sbjct  4    KKNPQVFMDVSIDGDPAETMVFELFPEVAPQTSENFRALCTGEKGIGPRSGKPLHYKGSF  63

Query  315  FHHIVKGSMAQAGDLLREDG  374
            FH I+KGS AQAGD +  DG
Sbjct  64   FHRILKGSSAQAGDFVNRDG  83



>ref|XP_010432723.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X4 [Camelina sativa]
Length=808

 Score =   118 bits (296),  Expect = 7e-27, Method: Composition-based stats.
 Identities = 54/80 (68%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +3

Query  135  KKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  314
            KK   VF+DV I GDP E MVFELF +VAP+T+ENFRALCTGEKG  P++G  LHYKG+F
Sbjct  4    KKNPQVFMDVSIDGDPAETMVFELFPEVAPQTSENFRALCTGEKGIGPRSGKPLHYKGSF  63

Query  315  FHHIVKGSMAQAGDLLREDG  374
            FH I+KGS AQAGD +  DG
Sbjct  64   FHRILKGSSAQAGDFVNRDG  83



>ref|XP_010432722.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X3 [Camelina sativa]
Length=825

 Score =   118 bits (296),  Expect = 9e-27, Method: Composition-based stats.
 Identities = 54/80 (68%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +3

Query  135  KKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  314
            KK   VF+DV I GDP E MVFELF +VAP+T+ENFRALCTGEKG  P++G  LHYKG+F
Sbjct  4    KKNPQVFMDVSIDGDPAETMVFELFPEVAPQTSENFRALCTGEKGIGPRSGKPLHYKGSF  63

Query  315  FHHIVKGSMAQAGDLLREDG  374
            FH I+KGS AQAGD +  DG
Sbjct  64   FHRILKGSSAQAGDFVNRDG  83



>ref|XP_010110347.1| Peptidyl-prolyl cis-trans isomerase 1 [Morus notabilis]
 gb|EXC26034.1| Peptidyl-prolyl cis-trans isomerase 1 [Morus notabilis]
Length=860

 Score =   118 bits (296),  Expect = 9e-27, Method: Composition-based stats.
 Identities = 56/92 (61%), Positives = 68/92 (74%), Gaps = 10/92 (11%)
 Frame = +3

Query  129  MSKKK-VLVFLDVCIGGDPFERMVFEL---------FTDVAPKTAENFRALCTGEKGTSP  278
            M+K+K  +VF+DV I GDP E+MVFEL         F D+APKTAENFRALCTGEKG  P
Sbjct  1    MAKRKNSMVFMDVSIDGDPAEKMVFELIDYSFTQQLFFDIAPKTAENFRALCTGEKGIGP  60

Query  279  KTGATLHYKGTFFHHIVKGSMAQAGDLLREDG  374
            ++G  LHYKG+FFH I+KG MAQ GD ++ DG
Sbjct  61   QSGRPLHYKGSFFHRIIKGFMAQGGDFVKRDG  92



>ref|XP_006412476.1| hypothetical protein EUTSA_v10024440mg [Eutrema salsugineum]
 gb|ESQ53929.1| hypothetical protein EUTSA_v10024440mg [Eutrema salsugineum]
Length=810

 Score =   118 bits (295),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 54/80 (68%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +3

Query  135  KKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  314
            KK   V++DVCI GDP E MVFELF +VAPKT+ENFRALCTGEKG   ++G  LHYKG+F
Sbjct  4    KKNPQVYMDVCIDGDPAETMVFELFPEVAPKTSENFRALCTGEKGIGLRSGKPLHYKGSF  63

Query  315  FHHIVKGSMAQAGDLLREDG  374
            FH IVKG  AQAGD +  DG
Sbjct  64   FHRIVKGYSAQAGDFVNRDG  83



>ref|XP_010527624.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X9 [Tarenaya hassleriana]
Length=536

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 68/101 (67%), Gaps = 6/101 (6%)
 Frame = +3

Query  129  MSKKKVL-VFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            MSKKK   VFLDV IGGDP ER+V +LF DV PKTAENFRALCTGEKG    TG  LH+K
Sbjct  1    MSKKKNPNVFLDVSIGGDPVERIVIQLFADVVPKTAENFRALCTGEKGIGETTGKPLHFK  60

Query  306  GTFFHHIVKGSMAQAGDLLREDGM---VIY--FFMDYGFVL  413
            G+FFH I+KG MAQ GD    +G     IY   F D  F L
Sbjct  61   GSFFHRIIKGFMAQGGDFSNGNGTGGESIYGGKFSDENFKL  101



>ref|XP_010527623.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X8 [Tarenaya hassleriana]
Length=538

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 68/101 (67%), Gaps = 6/101 (6%)
 Frame = +3

Query  129  MSKKKVL-VFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            MSKKK   VFLDV IGGDP ER+V +LF DV PKTAENFRALCTGEKG    TG  LH+K
Sbjct  1    MSKKKNPNVFLDVSIGGDPVERIVIQLFADVVPKTAENFRALCTGEKGIGETTGKPLHFK  60

Query  306  GTFFHHIVKGSMAQAGDLLREDGM---VIY--FFMDYGFVL  413
            G+FFH I+KG MAQ GD    +G     IY   F D  F L
Sbjct  61   GSFFHRIIKGFMAQGGDFSNGNGTGGESIYGGKFSDENFKL  101



>ref|XP_010527622.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X7 [Tarenaya hassleriana]
Length=541

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 68/101 (67%), Gaps = 6/101 (6%)
 Frame = +3

Query  129  MSKKKVL-VFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            MSKKK   VFLDV IGGDP ER+V +LF DV PKTAENFRALCTGEKG    TG  LH+K
Sbjct  1    MSKKKNPNVFLDVSIGGDPVERIVIQLFADVVPKTAENFRALCTGEKGIGETTGKPLHFK  60

Query  306  GTFFHHIVKGSMAQAGDLLREDGM---VIY--FFMDYGFVL  413
            G+FFH I+KG MAQ GD    +G     IY   F D  F L
Sbjct  61   GSFFHRIIKGFMAQGGDFSNGNGTGGESIYGGKFSDENFKL  101



>ref|XP_007050461.1| Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein, 
putative isoform 2 [Theobroma cacao]
 gb|EOX94618.1| Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein, 
putative isoform 2 [Theobroma cacao]
Length=557

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 68/102 (67%), Gaps = 6/102 (6%)
 Frame = +3

Query  129  MSKKK-VLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            MSKKK  LVFLDV + GDP ER++ ELF DV PKTAENFRALCTGEKG    TG  LHYK
Sbjct  1    MSKKKNPLVFLDVSVDGDPVERIIIELFADVVPKTAENFRALCTGEKGVGKSTGKPLHYK  60

Query  306  GTFFHHIVKGSMAQAGDLLREDGM---VIY--FFMDYGFVLV  416
            G+F H I+KG MAQ GD  + +G     IY    +D  F L 
Sbjct  61   GSFLHRIIKGFMAQGGDFSKGNGTGGESIYGGKLVDENFKLA  102



>ref|XP_008792090.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008792091.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X1 [Phoenix dactylifera]
Length=845

 Score =   117 bits (294),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 53/79 (67%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = +3

Query  138  KKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFF  317
            K   VFLDV IGG P  RMVFELF D+ PKTAENFRALCTGEKG  P T   LHYKG+ F
Sbjct  5    KNPTVFLDVAIGGGPSRRMVFELFADIVPKTAENFRALCTGEKGIGPTTRKPLHYKGSIF  64

Query  318  HHIVKGSMAQAGDLLREDG  374
            H I+KG MAQ GD  + DG
Sbjct  65   HRIIKGFMAQGGDFSKRDG  83



>ref|XP_008785212.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X1 [Phoenix dactylifera]
Length=818

 Score =   117 bits (293),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 60/97 (62%), Positives = 65/97 (67%), Gaps = 5/97 (5%)
 Frame = +3

Query  138  KKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFF  317
            K   VFLDV IG  P ERMVFELF D+ PKTAENFRALCTGEKG  P TG  LHY+G+ F
Sbjct  5    KNPTVFLDVAIGRGPAERMVFELFADIVPKTAENFRALCTGEKGVGPSTGKPLHYRGSIF  64

Query  318  HHIVKGSMAQAGDLLREDGM---VIY--FFMDYGFVL  413
            H I+KG MAQ GD  + DG     IY   F D  FVL
Sbjct  65   HRIIKGFMAQGGDFAKRDGTGGESIYGGKFPDENFVL  101



>ref|XP_010527621.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X6 [Tarenaya hassleriana]
Length=629

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 68/101 (67%), Gaps = 6/101 (6%)
 Frame = +3

Query  129  MSKKKVL-VFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            MSKKK   VFLDV IGGDP ER+V +LF DV PKTAENFRALCTGEKG    TG  LH+K
Sbjct  1    MSKKKNPNVFLDVSIGGDPVERIVIQLFADVVPKTAENFRALCTGEKGIGETTGKPLHFK  60

Query  306  GTFFHHIVKGSMAQAGDLLREDGM---VIY--FFMDYGFVL  413
            G+FFH I+KG MAQ GD    +G     IY   F D  F L
Sbjct  61   GSFFHRIIKGFMAQGGDFSNGNGTGGESIYGGKFSDENFKL  101



>ref|XP_010527619.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X4 [Tarenaya hassleriana]
Length=631

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 68/101 (67%), Gaps = 6/101 (6%)
 Frame = +3

Query  129  MSKKKVL-VFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            MSKKK   VFLDV IGGDP ER+V +LF DV PKTAENFRALCTGEKG    TG  LH+K
Sbjct  1    MSKKKNPNVFLDVSIGGDPVERIVIQLFADVVPKTAENFRALCTGEKGIGETTGKPLHFK  60

Query  306  GTFFHHIVKGSMAQAGDLLREDGM---VIY--FFMDYGFVL  413
            G+FFH I+KG MAQ GD    +G     IY   F D  F L
Sbjct  61   GSFFHRIIKGFMAQGGDFSNGNGTGGESIYGGKFSDENFKL  101



>ref|XP_010527620.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X5 [Tarenaya hassleriana]
Length=631

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 68/101 (67%), Gaps = 6/101 (6%)
 Frame = +3

Query  129  MSKKKVL-VFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            MSKKK   VFLDV IGGDP ER+V +LF DV PKTAENFRALCTGEKG    TG  LH+K
Sbjct  1    MSKKKNPNVFLDVSIGGDPVERIVIQLFADVVPKTAENFRALCTGEKGIGETTGKPLHFK  60

Query  306  GTFFHHIVKGSMAQAGDLLREDGM---VIY--FFMDYGFVL  413
            G+FFH I+KG MAQ GD    +G     IY   F D  F L
Sbjct  61   GSFFHRIIKGFMAQGGDFSNGNGTGGESIYGGKFSDENFKL  101



>ref|XP_010527617.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X3 [Tarenaya hassleriana]
Length=633

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 68/101 (67%), Gaps = 6/101 (6%)
 Frame = +3

Query  129  MSKKKVL-VFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            MSKKK   VFLDV IGGDP ER+V +LF DV PKTAENFRALCTGEKG    TG  LH+K
Sbjct  1    MSKKKNPNVFLDVSIGGDPVERIVIQLFADVVPKTAENFRALCTGEKGIGETTGKPLHFK  60

Query  306  GTFFHHIVKGSMAQAGDLLREDGM---VIY--FFMDYGFVL  413
            G+FFH I+KG MAQ GD    +G     IY   F D  F L
Sbjct  61   GSFFHRIIKGFMAQGGDFSNGNGTGGESIYGGKFSDENFKL  101



>ref|XP_010546569.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010546570.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X2 [Tarenaya hassleriana]
Length=845

 Score =   117 bits (293),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 54/80 (68%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +3

Query  135  KKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  314
            KK   VF+DV I GDP E MVFELF +VAP TA+NFRALCTGEKG   ++G  LHYKG+F
Sbjct  4    KKNPQVFMDVSIDGDPAETMVFELFPEVAPNTADNFRALCTGEKGVGLRSGKPLHYKGSF  63

Query  315  FHHIVKGSMAQAGDLLREDG  374
            FH I+KGSMAQAGD +  DG
Sbjct  64   FHKIIKGSMAQAGDFVNRDG  83



>gb|AAM13845.1| unknown protein [Arabidopsis thaliana]
 gb|AAS75312.1| multidomain cyclophilin type peptidyl-prolyl cis-trans isomerase 
[Arabidopsis thaliana]
Length=837

 Score =   117 bits (292),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 55/83 (66%), Positives = 65/83 (78%), Gaps = 1/83 (1%)
 Frame = +3

Query  129  MSKKK-VLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            M+KKK   VF+DV I GDP E MVFELF +VAPKT+ENFRALCTGEKG  P++   LHYK
Sbjct  1    MAKKKNPQVFMDVSIDGDPAETMVFELFPEVAPKTSENFRALCTGEKGIGPRSRKPLHYK  60

Query  306  GTFFHHIVKGSMAQAGDLLREDG  374
            G+FFH I+KGS AQAGD +  +G
Sbjct  61   GSFFHRIMKGSSAQAGDFVNRNG  83



>gb|KJB25950.1| hypothetical protein B456_004G217800 [Gossypium raimondii]
Length=599

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 68/102 (67%), Gaps = 6/102 (6%)
 Frame = +3

Query  129  MSKKK-VLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            MSKKK  +VF DV IGGD  ER++ ELF DV PKTAENFRALCTGEKG    TG  LHYK
Sbjct  1    MSKKKNPMVFFDVSIGGDLVERIIIELFADVVPKTAENFRALCTGEKGIGKCTGKPLHYK  60

Query  306  GTFFHHIVKGSMAQAGDLLREDGM---VIY--FFMDYGFVLV  416
            GTFFH I+KG MAQ GD  + +G     IY   F D  F L 
Sbjct  61   GTFFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLT  102



>gb|KJB25951.1| hypothetical protein B456_004G217800 [Gossypium raimondii]
Length=602

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 68/102 (67%), Gaps = 6/102 (6%)
 Frame = +3

Query  129  MSKKK-VLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            MSKKK  +VF DV IGGD  ER++ ELF DV PKTAENFRALCTGEKG    TG  LHYK
Sbjct  1    MSKKKNPMVFFDVSIGGDLVERIIIELFADVVPKTAENFRALCTGEKGIGKCTGKPLHYK  60

Query  306  GTFFHHIVKGSMAQAGDLLREDGM---VIY--FFMDYGFVLV  416
            GTFFH I+KG MAQ GD  + +G     IY   F D  F L 
Sbjct  61   GTFFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLT  102



>gb|KJB25952.1| hypothetical protein B456_004G217800 [Gossypium raimondii]
Length=626

 Score =   115 bits (289),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 68/102 (67%), Gaps = 6/102 (6%)
 Frame = +3

Query  129  MSKKK-VLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            MSKKK  +VF DV IGGD  ER++ ELF DV PKTAENFRALCTGEKG    TG  LHYK
Sbjct  1    MSKKKNPMVFFDVSIGGDLVERIIIELFADVVPKTAENFRALCTGEKGIGKCTGKPLHYK  60

Query  306  GTFFHHIVKGSMAQAGDLLREDGM---VIY--FFMDYGFVLV  416
            GTFFH I+KG MAQ GD  + +G     IY   F D  F L 
Sbjct  61   GTFFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLT  102



>ref|XP_010925250.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like [Elaeis 
guineensis]
 ref|XP_010925251.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like [Elaeis 
guineensis]
 ref|XP_010925252.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like [Elaeis 
guineensis]
Length=842

 Score =   116 bits (291),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 53/79 (67%), Positives = 58/79 (73%), Gaps = 0/79 (0%)
 Frame = +3

Query  138  KKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFF  317
            K   VFLDV IGG P ERMVFELF D+ PKTAENFRALCTGEKG    TG  LHY+G+ F
Sbjct  5    KNPTVFLDVAIGGGPAERMVFELFADIVPKTAENFRALCTGEKGVGSTTGKPLHYRGSIF  64

Query  318  HHIVKGSMAQAGDLLREDG  374
            H I+KG MAQ GD  + DG
Sbjct  65   HRIIKGFMAQGGDFSKRDG  83



>ref|XP_010914920.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X1 [Elaeis guineensis]
Length=836

 Score =   116 bits (290),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 59/97 (61%), Positives = 65/97 (67%), Gaps = 5/97 (5%)
 Frame = +3

Query  138  KKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFF  317
            K+  VFLDV IGG P  RMVFELF D+ PKTAENFRALCTGEKG    TG  LHY+G+ F
Sbjct  5    KRPTVFLDVAIGGRPSGRMVFELFADIVPKTAENFRALCTGEKGIGHTTGKPLHYRGSIF  64

Query  318  HHIVKGSMAQAGDLLREDGM---VIY--FFMDYGFVL  413
            H I+KG MAQ GD  + DG     IY   F D  FVL
Sbjct  65   HRIIKGFMAQGGDFSKRDGTGGESIYGGKFPDENFVL  101



>ref|XP_007050460.1| Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein, 
putative isoform 1 [Theobroma cacao]
 gb|EOX94617.1| Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein, 
putative isoform 1 [Theobroma cacao]
Length=676

 Score =   115 bits (288),  Expect = 7e-26, Method: Composition-based stats.
 Identities = 55/83 (66%), Positives = 62/83 (75%), Gaps = 1/83 (1%)
 Frame = +3

Query  129  MSKKK-VLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            MSKKK  LVFLDV + GDP ER++ ELF DV PKTAENFRALCTGEKG    TG  LHYK
Sbjct  1    MSKKKNPLVFLDVSVDGDPVERIIIELFADVVPKTAENFRALCTGEKGVGKSTGKPLHYK  60

Query  306  GTFFHHIVKGSMAQAGDLLREDG  374
            G+F H I+KG MAQ GD  + +G
Sbjct  61   GSFLHRIIKGFMAQGGDFSKGNG  83



>ref|XP_004146961.1| PREDICTED: uncharacterized protein LOC101219904 [Cucumis sativus]
 gb|KGN44769.1| hypothetical protein Csa_7G378580 [Cucumis sativus]
Length=668

 Score =   114 bits (285),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 55/83 (66%), Positives = 63/83 (76%), Gaps = 1/83 (1%)
 Frame = +3

Query  129  MSKKK-VLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            MSKKK  LVFLDV IGG+P +R++ ELF +V PKTA+NFRALCTGEKG    T   LHYK
Sbjct  1    MSKKKNPLVFLDVSIGGEPVQRIIIELFANVVPKTADNFRALCTGEKGIGKTTEKPLHYK  60

Query  306  GTFFHHIVKGSMAQAGDLLREDG  374
            GTFFH I+KG MAQ GD  R +G
Sbjct  61   GTFFHRIIKGFMAQGGDFSRGNG  83



>ref|XP_008451290.1| PREDICTED: peptidyl-prolyl cis-trans isomerase 8 [Cucumis melo]
Length=669

 Score =   114 bits (285),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 55/83 (66%), Positives = 63/83 (76%), Gaps = 1/83 (1%)
 Frame = +3

Query  129  MSKKK-VLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            MSKKK  LVFLDV IGG+P +R++ ELF +V PKTA+NFRALCTGEKG    T   LHYK
Sbjct  1    MSKKKNPLVFLDVSIGGEPVQRIIIELFANVVPKTADNFRALCTGEKGIGKTTEKPLHYK  60

Query  306  GTFFHHIVKGSMAQAGDLLREDG  374
            GTFFH I+KG MAQ GD  R +G
Sbjct  61   GTFFHRIIKGFMAQGGDFSRGNG  83



>ref|XP_004162194.1| PREDICTED: uncharacterized LOC101219904 [Cucumis sativus]
Length=655

 Score =   114 bits (285),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 55/83 (66%), Positives = 63/83 (76%), Gaps = 1/83 (1%)
 Frame = +3

Query  129  MSKKK-VLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            MSKKK  LVFLDV IGG+P +R++ ELF +V PKTA+NFRALCTGEKG    T   LHYK
Sbjct  1    MSKKKNPLVFLDVSIGGEPVQRIIIELFANVVPKTADNFRALCTGEKGIGKTTEKPLHYK  60

Query  306  GTFFHHIVKGSMAQAGDLLREDG  374
            GTFFH I+KG MAQ GD  R +G
Sbjct  61   GTFFHRIIKGFMAQGGDFSRGNG  83



>gb|KJB25949.1| hypothetical protein B456_004G217800 [Gossypium raimondii]
Length=661

 Score =   114 bits (284),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 56/83 (67%), Positives = 62/83 (75%), Gaps = 1/83 (1%)
 Frame = +3

Query  129  MSKKK-VLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            MSKKK  +VF DV IGGD  ER++ ELF DV PKTAENFRALCTGEKG    TG  LHYK
Sbjct  1    MSKKKNPMVFFDVSIGGDLVERIIIELFADVVPKTAENFRALCTGEKGIGKCTGKPLHYK  60

Query  306  GTFFHHIVKGSMAQAGDLLREDG  374
            GTFFH I+KG MAQ GD  + +G
Sbjct  61   GTFFHRIIKGFMAQGGDFSKGNG  83



>ref|XP_006283087.1| hypothetical protein CARUB_v10004106mg [Capsella rubella]
 gb|EOA15985.1| hypothetical protein CARUB_v10004106mg [Capsella rubella]
Length=879

 Score =   114 bits (286),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 51/73 (70%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = +3

Query  156  LDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHIVKG  335
            +DV I GDP E MVFELF +VAPKT+ENFRALCTGEKG  P++G  LHYKG+FFH I+KG
Sbjct  1    MDVSIDGDPAETMVFELFPEVAPKTSENFRALCTGEKGIGPRSGKPLHYKGSFFHRILKG  60

Query  336  SMAQAGDLLREDG  374
            S AQAGD +  DG
Sbjct  61   SSAQAGDFVNRDG  73



>ref|XP_002520955.1| cyclophilin, putative [Ricinus communis]
 gb|EEF41372.1| cyclophilin, putative [Ricinus communis]
Length=688

 Score =   113 bits (283),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 56/83 (67%), Positives = 62/83 (75%), Gaps = 1/83 (1%)
 Frame = +3

Query  129  MSKKK-VLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            MSKKK  LV+ DV I GDP ER+V ELF DVAPKTAENFRALCTGE G    TG  LHYK
Sbjct  1    MSKKKNPLVYFDVSIDGDPVERIVIELFADVAPKTAENFRALCTGEMGIGKTTGKPLHYK  60

Query  306  GTFFHHIVKGSMAQAGDLLREDG  374
            G+FFH I+KG MAQ GD  + +G
Sbjct  61   GSFFHRIIKGFMAQGGDFSKGNG  83



>gb|KJB25953.1| hypothetical protein B456_004G217800 [Gossypium raimondii]
Length=634

 Score =   113 bits (283),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 56/83 (67%), Positives = 62/83 (75%), Gaps = 1/83 (1%)
 Frame = +3

Query  129  MSKKK-VLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            MSKKK  +VF DV IGGD  ER++ ELF DV PKTAENFRALCTGEKG    TG  LHYK
Sbjct  1    MSKKKNPMVFFDVSIGGDLVERIIIELFADVVPKTAENFRALCTGEKGIGKCTGKPLHYK  60

Query  306  GTFFHHIVKGSMAQAGDLLREDG  374
            GTFFH I+KG MAQ GD  + +G
Sbjct  61   GTFFHRIIKGFMAQGGDFSKGNG  83



>gb|KDO68605.1| hypothetical protein CISIN_1g006162mg [Citrus sinensis]
Length=622

 Score =   113 bits (282),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 64/98 (65%), Gaps = 5/98 (5%)
 Frame = +3

Query  135  KKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  314
            KK  LVFLDV I GDP E++V ELF DV PKTAENFRALCTGEKG    TG  LHYKGT 
Sbjct  4    KKNPLVFLDVSIDGDPVEKIVIELFADVVPKTAENFRALCTGEKGIGKSTGKPLHYKGTM  63

Query  315  FHHIVKGSMAQAGDLLREDGM---VIY--FFMDYGFVL  413
            FH I+KG M Q GD  + +G     IY   F D  F L
Sbjct  64   FHRIIKGFMIQGGDFSKGNGTGGESIYGGKFTDENFKL  101



>ref|XP_010527616.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X2 [Tarenaya hassleriana]
Length=634

 Score =   113 bits (282),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 56/83 (67%), Positives = 62/83 (75%), Gaps = 1/83 (1%)
 Frame = +3

Query  129  MSKKK-VLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            MSKKK   VFLDV IGGDP ER+V +LF DV PKTAENFRALCTGEKG    TG  LH+K
Sbjct  1    MSKKKNPNVFLDVSIGGDPVERIVIQLFADVVPKTAENFRALCTGEKGIGETTGKPLHFK  60

Query  306  GTFFHHIVKGSMAQAGDLLREDG  374
            G+FFH I+KG MAQ GD    +G
Sbjct  61   GSFFHRIIKGFMAQGGDFSNGNG  83



>ref|XP_010527615.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X1 [Tarenaya hassleriana]
Length=636

 Score =   113 bits (282),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 56/83 (67%), Positives = 62/83 (75%), Gaps = 1/83 (1%)
 Frame = +3

Query  129  MSKKK-VLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            MSKKK   VFLDV IGGDP ER+V +LF DV PKTAENFRALCTGEKG    TG  LH+K
Sbjct  1    MSKKKNPNVFLDVSIGGDPVERIVIQLFADVVPKTAENFRALCTGEKGIGETTGKPLHFK  60

Query  306  GTFFHHIVKGSMAQAGDLLREDG  374
            G+FFH I+KG MAQ GD    +G
Sbjct  61   GSFFHRIIKGFMAQGGDFSNGNG  83



>ref|XP_010646137.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X2 [Vitis vinifera]
 emb|CBI25055.3| unnamed protein product [Vitis vinifera]
Length=700

 Score =   113 bits (283),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 54/80 (68%), Positives = 60/80 (75%), Gaps = 0/80 (0%)
 Frame = +3

Query  135  KKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  314
            KK  LVFLDV I GDP E++V ELF DV PKTAENFRALCTGEKG    TG  LHYKG+F
Sbjct  4    KKNPLVFLDVSIDGDPVEKIVIELFADVVPKTAENFRALCTGEKGVGTSTGKPLHYKGSF  63

Query  315  FHHIVKGSMAQAGDLLREDG  374
            FH I+KG MAQ GD  + +G
Sbjct  64   FHRIIKGFMAQGGDFSKGNG  83



>ref|XP_002280876.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X1 [Vitis vinifera]
Length=702

 Score =   113 bits (283),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 54/80 (68%), Positives = 60/80 (75%), Gaps = 0/80 (0%)
 Frame = +3

Query  135  KKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  314
            KK  LVFLDV I GDP E++V ELF DV PKTAENFRALCTGEKG    TG  LHYKG+F
Sbjct  4    KKNPLVFLDVSIDGDPVEKIVIELFADVVPKTAENFRALCTGEKGVGTSTGKPLHYKGSF  63

Query  315  FHHIVKGSMAQAGDLLREDG  374
            FH I+KG MAQ GD  + +G
Sbjct  64   FHRIIKGFMAQGGDFSKGNG  83



>ref|XP_009419289.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009419290.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like [Musa 
acuminata subsp. malaccensis]
Length=819

 Score =   113 bits (283),  Expect = 5e-25, Method: Composition-based stats.
 Identities = 57/100 (57%), Positives = 66/100 (66%), Gaps = 5/100 (5%)
 Frame = +3

Query  129  MSKKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  308
            M+K+  +VFLDV I G+   R++FELF D+ PKTAENFRALCTGE G  P T   LHYKG
Sbjct  1    MAKRNPIVFLDVAIDGNAAGRLMFELFADIVPKTAENFRALCTGEMGFGPMTKKPLHYKG  60

Query  309  TFFHHIVKGSMAQAGDLLREDGM---VIY--FFMDYGFVL  413
            + FH I+KG MAQ GD  R DG     IY   F D  FVL
Sbjct  61   SIFHRIIKGFMAQGGDFSRRDGTGGESIYGGKFADENFVL  100



>ref|XP_010028211.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X3 [Eucalyptus grandis]
Length=155

 Score =   106 bits (265),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = +3

Query  129  MSKKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  308
            M+KK +LVF+DV I GDP ERMVFELF +VAPKTAENFRAL T EKG   KTG  LH KG
Sbjct  2    MTKKNLLVFMDVSIDGDPAERMVFELFPEVAPKTAENFRALYTEEKGIGQKTGRPLHLKG  61

Query  309  TFFHHIVKGSMAQA  350
            +FFH I++GSMAQ 
Sbjct  62   SFFHRIIRGSMAQV  75



>ref|XP_004498655.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X1 [Cicer arietinum]
Length=812

 Score =   112 bits (281),  Expect = 7e-25, Method: Composition-based stats.
 Identities = 60/111 (54%), Positives = 70/111 (63%), Gaps = 25/111 (23%)
 Frame = +3

Query  129  MSKKK-VLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCT----------------  257
            M+KKK  +VFLDV I GDP ERMVFELF DVAPKTAENFRALCT                
Sbjct  1    MAKKKNPMVFLDVSIDGDPAERMVFELFYDVAPKTAENFRALCTGNITFDLHGTFLFLLK  60

Query  258  ------GEKGTSPKTGATLHYKGTFFHHIVKGSMAQAGDLLREDGMVIYFF  392
                  GEKG S  TG +LHYKG+FFH IVKGS+ + GD +  +  V++ F
Sbjct  61   SVILHSGEKGVSSNTGKSLHYKGSFFHQIVKGSIVRGGDFINRN--VLFHF  109



>ref|XP_009381127.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like [Musa 
acuminata subsp. malaccensis]
Length=832

 Score =   112 bits (279),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 60/101 (59%), Positives = 65/101 (64%), Gaps = 6/101 (6%)
 Frame = +3

Query  129  MSKKK-VLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            M+KK   +VFLDV I G    RMVFELF D+ PKTAENFRALCTGE G  P T   LHYK
Sbjct  1    MAKKNNPIVFLDVAIDGKAAGRMVFELFADIVPKTAENFRALCTGEMGIGPTTKKPLHYK  60

Query  306  GTFFHHIVKGSMAQAGDLLREDGM---VIY--FFMDYGFVL  413
            G+ FH I+KG MAQ GD  R DG     IY   F D  FVL
Sbjct  61   GSVFHRIIKGFMAQGGDFSRRDGTGGESIYGGKFSDENFVL  101



>gb|KDP21391.1| hypothetical protein JCGZ_21862 [Jatropha curcas]
Length=716

 Score =   111 bits (278),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 59/101 (58%), Positives = 68/101 (67%), Gaps = 6/101 (6%)
 Frame = +3

Query  129  MSKKK-VLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            MSK+K  LVF DV I GDP ER+ FELF +  PKTAENFRALCTGEKG    TG  LHYK
Sbjct  1    MSKRKNPLVFFDVSIDGDPVERIAFELFANFVPKTAENFRALCTGEKGIGKTTGKPLHYK  60

Query  306  GTFFHHIVKGSMAQAGDLLREDGM---VIY--FFMDYGFVL  413
            G+FFH I++G MAQ GD  + +G     IY   F D  F+L
Sbjct  61   GSFFHRIIRGFMAQGGDFSKGNGTGGESIYGGKFADENFIL  101



>ref|XP_006443960.1| hypothetical protein CICLE_v10019230mg [Citrus clementina]
 ref|XP_006479627.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X1 [Citrus sinensis]
 ref|XP_006479628.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X2 [Citrus sinensis]
 gb|ESR57200.1| hypothetical protein CICLE_v10019230mg [Citrus clementina]
 gb|KDO68607.1| hypothetical protein CISIN_1g006162mg [Citrus sinensis]
Length=650

 Score =   110 bits (276),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 53/80 (66%), Positives = 58/80 (73%), Gaps = 0/80 (0%)
 Frame = +3

Query  135  KKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  314
            KK  LVFLDV I GDP E++V ELF DV PKTAENFRALCTGEKG    TG  LHYKGT 
Sbjct  4    KKNPLVFLDVSIDGDPVEKIVIELFADVVPKTAENFRALCTGEKGIGKSTGKPLHYKGTM  63

Query  315  FHHIVKGSMAQAGDLLREDG  374
            FH I+KG M Q GD  + +G
Sbjct  64   FHRIIKGFMIQGGDFSKGNG  83



>ref|XP_006443959.1| hypothetical protein CICLE_v10019230mg [Citrus clementina]
 ref|XP_006479629.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X3 [Citrus sinensis]
 gb|ESR57199.1| hypothetical protein CICLE_v10019230mg [Citrus clementina]
 gb|KDO68606.1| hypothetical protein CISIN_1g006162mg [Citrus sinensis]
Length=643

 Score =   110 bits (276),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 53/80 (66%), Positives = 58/80 (73%), Gaps = 0/80 (0%)
 Frame = +3

Query  135  KKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  314
            KK  LVFLDV I GDP E++V ELF DV PKTAENFRALCTGEKG    TG  LHYKGT 
Sbjct  4    KKNPLVFLDVSIDGDPVEKIVIELFADVVPKTAENFRALCTGEKGIGKSTGKPLHYKGTM  63

Query  315  FHHIVKGSMAQAGDLLREDG  374
            FH I+KG M Q GD  + +G
Sbjct  64   FHRIIKGFMIQGGDFSKGNG  83



>gb|KDO68608.1| hypothetical protein CISIN_1g006162mg [Citrus sinensis]
Length=658

 Score =   110 bits (276),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 53/80 (66%), Positives = 58/80 (73%), Gaps = 0/80 (0%)
 Frame = +3

Query  135  KKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  314
            KK  LVFLDV I GDP E++V ELF DV PKTAENFRALCTGEKG    TG  LHYKGT 
Sbjct  4    KKNPLVFLDVSIDGDPVEKIVIELFADVVPKTAENFRALCTGEKGIGKSTGKPLHYKGTM  63

Query  315  FHHIVKGSMAQAGDLLREDG  374
            FH I+KG M Q GD  + +G
Sbjct  64   FHRIIKGFMIQGGDFSKGNG  83



>gb|AJA29688.1| peptidyl-prolyl cis-trans isomerase [Betula luminifera]
Length=695

 Score =   110 bits (275),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 51/80 (64%), Positives = 57/80 (71%), Gaps = 0/80 (0%)
 Frame = +3

Query  135  KKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  314
            KK   VFLD+ I GDP ER+V ELF DV PKTAENFRALCTGEKG    TG  LHY+G++
Sbjct  4    KKNPFVFLDLSIDGDPVERIVIELFADVVPKTAENFRALCTGEKGIGKSTGKPLHYRGSY  63

Query  315  FHHIVKGSMAQAGDLLREDG  374
             H I+KG MAQ GD    DG
Sbjct  64   LHRIIKGFMAQGGDFSSGDG  83



>ref|XP_008681079.1| PREDICTED: uncharacterized protein LOC100192934 isoform X2 [Zea 
mays]
 gb|AFW70622.1| hypothetical protein ZEAMMB73_258859 [Zea mays]
Length=829

 Score =   110 bits (276),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 50/80 (63%), Positives = 59/80 (74%), Gaps = 0/80 (0%)
 Frame = +3

Query  135  KKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  314
            KK  +VFLDV +G +P ERM+FELF DVAP T ENFRALCTGE G   KT   L YKGT 
Sbjct  4    KKNPIVFLDVSVGDEPDERMIFELFADVAPLTTENFRALCTGELGIGQKTKKPLCYKGTL  63

Query  315  FHHIVKGSMAQAGDLLREDG  374
            FH ++KG MAQ GD+ +E+G
Sbjct  64   FHRVIKGFMAQGGDIAKENG  83



>ref|XP_008681078.1| PREDICTED: uncharacterized protein LOC100192934 isoform X1 [Zea 
mays]
 gb|AFW70621.1| hypothetical protein ZEAMMB73_258859 [Zea mays]
Length=832

 Score =   110 bits (276),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 50/80 (63%), Positives = 59/80 (74%), Gaps = 0/80 (0%)
 Frame = +3

Query  135  KKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  314
            KK  +VFLDV +G +P ERM+FELF DVAP T ENFRALCTGE G   KT   L YKGT 
Sbjct  4    KKNPIVFLDVSVGDEPDERMIFELFADVAPLTTENFRALCTGELGIGQKTKKPLCYKGTL  63

Query  315  FHHIVKGSMAQAGDLLREDG  374
            FH ++KG MAQ GD+ +E+G
Sbjct  64   FHRVIKGFMAQGGDIAKENG  83



>ref|NP_850740.1| cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein 
[Arabidopsis thaliana]
 gb|AEE80476.1| cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein 
[Arabidopsis thaliana]
Length=387

 Score =   107 bits (268),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 63/98 (64%), Gaps = 5/98 (5%)
 Frame = +3

Query  135  KKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  314
            KK   VFLDV IGGDP +R+V ELF DV PKTAENFRALCTGE G    TG  LH+KG+ 
Sbjct  4    KKNPNVFLDVSIGGDPVQRIVIELFADVVPKTAENFRALCTGEAGVGKSTGKPLHFKGSS  63

Query  315  FHHIVKGSMAQAGDLLREDGM---VIY--FFMDYGFVL  413
            FH ++KG MAQ GD    +G     IY   F D  F L
Sbjct  64   FHRVIKGFMAQGGDFSNGNGTGGESIYGGKFSDENFRL  101



>gb|EEE56526.1| hypothetical protein OsJ_05815 [Oryza sativa Japonica Group]
Length=670

 Score =   110 bits (274),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 58/101 (57%), Positives = 68/101 (67%), Gaps = 6/101 (6%)
 Frame = +3

Query  129  MSKKK-VLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            M+KKK  +VF+DV IG +P ERMVFELF DVAP+TAENFRALCTGE G    +   L+YK
Sbjct  1    MAKKKNPIVFMDVSIGDEPDERMVFELFADVAPRTAENFRALCTGEMGIGQTSKKPLYYK  60

Query  306  GTFFHHIVKGSMAQAGDLLREDGM---VIY--FFMDYGFVL  413
            G+ FH ++KG MAQ GD    DG     IY   F D  FVL
Sbjct  61   GSLFHRVIKGFMAQGGDFSNGDGSGGESIYGGTFEDENFVL  101



>ref|XP_002302085.2| hypothetical protein POPTR_0002s04800g [Populus trichocarpa]
 gb|EEE81358.2| hypothetical protein POPTR_0002s04800g [Populus trichocarpa]
Length=688

 Score =   110 bits (274),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 53/82 (65%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = +3

Query  129  MSKKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  308
            + KK  LVFLDV I GDP ER+  ELF DV PKTAENFRALCTGEKG    TG  LHYKG
Sbjct  2    IKKKNPLVFLDVSIDGDPAERIFIELFADVVPKTAENFRALCTGEKGIGKTTGKPLHYKG  61

Query  309  TFFHHIVKGSMAQAGDLLREDG  374
              FH I+KG MAQ GD  + +G
Sbjct  62   CSFHRIIKGFMAQGGDFSKRNG  83



>gb|EEC72707.1| hypothetical protein OsI_06299 [Oryza sativa Indica Group]
Length=787

 Score =   110 bits (274),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 58/101 (57%), Positives = 68/101 (67%), Gaps = 6/101 (6%)
 Frame = +3

Query  129  MSKKK-VLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            M+KKK  +VF+DV IG +P ERMVFELF DVAP+TAENFRALCTGE G    +   L+YK
Sbjct  1    MAKKKNPIVFMDVSIGDEPDERMVFELFADVAPRTAENFRALCTGEMGIGQTSKKPLYYK  60

Query  306  GTFFHHIVKGSMAQAGDLLREDGM---VIY--FFMDYGFVL  413
            G+ FH ++KG MAQ GD    DG     IY   F D  FVL
Sbjct  61   GSLFHRVIKGFMAQGGDFSNGDGSGGESIYGGTFEDENFVL  101



>ref|XP_010038050.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X1 [Eucalyptus grandis]
 gb|KCW49849.1| hypothetical protein EUGRSUZ_K03321 [Eucalyptus grandis]
Length=664

 Score =   109 bits (273),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 52/83 (63%), Positives = 61/83 (73%), Gaps = 1/83 (1%)
 Frame = +3

Query  129  MSKKK-VLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            M+K+K  LVFLDV I GDP ER+V ELF D  P+TAENFR+LCTGEKG    TG  LHYK
Sbjct  1    MTKRKNPLVFLDVSIDGDPVERIVIELFADTVPRTAENFRSLCTGEKGVGKTTGKPLHYK  60

Query  306  GTFFHHIVKGSMAQAGDLLREDG  374
            G++FH I+KG MAQ GD    +G
Sbjct  61   GSYFHRIIKGFMAQGGDFSNGNG  83



>gb|AAS75310.1| multidomain cyclophilin type peptidyl-prolyl cis-trans isomerase 
[Arabidopsis thaliana]
Length=566

 Score =   108 bits (271),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 63/98 (64%), Gaps = 5/98 (5%)
 Frame = +3

Query  135  KKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  314
            KK   VFLDV IGGDP +R+V ELF DV PKTAENFRALCTGE G    TG  LH+KG+ 
Sbjct  4    KKNPNVFLDVSIGGDPVQRIVIELFADVVPKTAENFRALCTGEAGVGKSTGKPLHFKGSS  63

Query  315  FHHIVKGSMAQAGDLLREDGM---VIY--FFMDYGFVL  413
            FH ++KG MAQ GD    +G     IY   F D  F L
Sbjct  64   FHRVIKGFMAQGGDFSNGNGTGGESIYGGKFSDENFRL  101



>ref|XP_002306802.2| hypothetical protein POPTR_0005s23730g [Populus trichocarpa]
 gb|EEE93798.2| hypothetical protein POPTR_0005s23730g [Populus trichocarpa]
Length=673

 Score =   109 bits (273),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 61/101 (60%), Positives = 68/101 (67%), Gaps = 6/101 (6%)
 Frame = +3

Query  129  MSKKK-VLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            MSKKK  LVFLDV I GDP ER+  ELF DV P+TAENFRALCTGEKGT   TG  LHYK
Sbjct  1    MSKKKNPLVFLDVSIDGDPAERIFIELFADVVPRTAENFRALCTGEKGTGKTTGKPLHYK  60

Query  306  GTFFHHIVKGSMAQAGDLLREDGM---VIY--FFMDYGFVL  413
            G+ FH I+K  MAQ GD  + +G     IY   F D  F+L
Sbjct  61   GSSFHRIIKEFMAQGGDFSKGNGTGGESIYGGKFADENFIL  101



>ref|XP_010038051.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X2 [Eucalyptus grandis]
Length=661

 Score =   109 bits (272),  Expect = 8e-24, Method: Composition-based stats.
 Identities = 50/80 (63%), Positives = 58/80 (73%), Gaps = 0/80 (0%)
 Frame = +3

Query  135  KKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  314
            +K  LVFLDV I GDP ER+V ELF D  P+TAENFR+LCTGEKG    TG  LHYKG++
Sbjct  4    RKNPLVFLDVSIDGDPVERIVIELFADTVPRTAENFRSLCTGEKGVGKTTGKPLHYKGSY  63

Query  315  FHHIVKGSMAQAGDLLREDG  374
            FH I+KG MAQ GD    +G
Sbjct  64   FHRIIKGFMAQGGDFSNGNG  83



>dbj|BAH57223.1| AT3G63400 [Arabidopsis thaliana]
Length=570

 Score =   108 bits (271),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 63/98 (64%), Gaps = 5/98 (5%)
 Frame = +3

Query  135  KKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  314
            KK   VFLDV IGGDP +R+V ELF DV PKTAENFRALCTGE G    TG  LH+KG+ 
Sbjct  4    KKNPNVFLDVSIGGDPVQRIVIELFADVVPKTAENFRALCTGEAGVGKSTGKPLHFKGSS  63

Query  315  FHHIVKGSMAQAGDLLREDGM---VIY--FFMDYGFVL  413
            FH ++KG MAQ GD    +G     IY   F D  F L
Sbjct  64   FHRVIKGFMAQGGDFSNGNGTGGESIYGGKFSDENFRL  101



>ref|NP_191899.1| cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein 
[Arabidopsis thaliana]
 ref|NP_001190169.1| cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein 
[Arabidopsis thaliana]
 sp|Q9LY75.1|CYP63_ARATH RecName: Full=Peptidyl-prolyl cis-trans isomerase CYP63; Short=AtCYP63; 
Short=PPIase CYP63; AltName: Full=Cyclophilin-63; 
AltName: Full=Cyclophilin-like protein CypRS64 [Arabidopsis 
thaliana]
 emb|CAB87793.1| cyclophylin-like protein [Arabidopsis thaliana]
 gb|AAN41315.1| putative cyclophylin protein [Arabidopsis thaliana]
 gb|AEE80475.1| cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein 
[Arabidopsis thaliana]
 gb|AEE80477.1| cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein 
[Arabidopsis thaliana]
Length=570

 Score =   108 bits (271),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 63/98 (64%), Gaps = 5/98 (5%)
 Frame = +3

Query  135  KKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  314
            KK   VFLDV IGGDP +R+V ELF DV PKTAENFRALCTGE G    TG  LH+KG+ 
Sbjct  4    KKNPNVFLDVSIGGDPVQRIVIELFADVVPKTAENFRALCTGEAGVGKSTGKPLHFKGSS  63

Query  315  FHHIVKGSMAQAGDLLREDGM---VIY--FFMDYGFVL  413
            FH ++KG MAQ GD    +G     IY   F D  F L
Sbjct  64   FHRVIKGFMAQGGDFSNGNGTGGESIYGGKFSDENFRL  101



>ref|XP_009370747.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 [Pyrus x 
bretschneideri]
Length=535

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 65/101 (64%), Gaps = 6/101 (6%)
 Frame = +3

Query  129  MSKKK-VLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            MSKKK   VFLDV I  DP E++V ELF DV PKTAENFRALCTGEKG    TG  LHYK
Sbjct  1    MSKKKNPRVFLDVSIDRDPVEQIVIELFADVVPKTAENFRALCTGEKGIGKSTGKPLHYK  60

Query  306  GTFFHHIVKGSMAQAGDLLREDGM---VIY--FFMDYGFVL  413
            G+ FH ++KG MAQ GD    +G     IY   F D  F L
Sbjct  61   GSTFHRVIKGFMAQGGDFSNGNGTGGESIYGGKFADENFNL  101



>ref|XP_010679140.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X3 [Beta vulgaris subsp. vulgaris]
Length=658

 Score =   108 bits (270),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 55/83 (66%), Positives = 60/83 (72%), Gaps = 1/83 (1%)
 Frame = +3

Query  129  MSKKK-VLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            MSKKK   VFLDV IGGDP +R+V ELF DV PKTAENFR LCTG KG    TG  LH+K
Sbjct  1    MSKKKNPHVFLDVSIGGDPVQRIVIELFADVVPKTAENFRVLCTGGKGVGATTGKPLHFK  60

Query  306  GTFFHHIVKGSMAQAGDLLREDG  374
            GT FH I+KG MAQ GD  + DG
Sbjct  61   GTNFHRIIKGFMAQGGDFSKGDG  83



>ref|XP_010679138.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=659

 Score =   108 bits (270),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 55/83 (66%), Positives = 60/83 (72%), Gaps = 1/83 (1%)
 Frame = +3

Query  129  MSKKK-VLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            MSKKK   VFLDV IGGDP +R+V ELF DV PKTAENFR LCTG KG    TG  LH+K
Sbjct  1    MSKKKNPHVFLDVSIGGDPVQRIVIELFADVVPKTAENFRVLCTGGKGVGATTGKPLHFK  60

Query  306  GTFFHHIVKGSMAQAGDLLREDG  374
            GT FH I+KG MAQ GD  + DG
Sbjct  61   GTNFHRIIKGFMAQGGDFSKGDG  83



>ref|XP_010679137.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=661

 Score =   108 bits (270),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 55/83 (66%), Positives = 60/83 (72%), Gaps = 1/83 (1%)
 Frame = +3

Query  129  MSKKK-VLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            MSKKK   VFLDV IGGDP +R+V ELF DV PKTAENFR LCTG KG    TG  LH+K
Sbjct  1    MSKKKNPHVFLDVSIGGDPVQRIVIELFADVVPKTAENFRVLCTGGKGVGATTGKPLHFK  60

Query  306  GTFFHHIVKGSMAQAGDLLREDG  374
            GT FH I+KG MAQ GD  + DG
Sbjct  61   GTNFHRIIKGFMAQGGDFSKGDG  83



>ref|XP_010028213.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X5 [Eucalyptus grandis]
Length=129

 Score =   102 bits (253),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 64/101 (63%), Gaps = 19/101 (19%)
 Frame = +3

Query  129  MSKKKVLVFLDVCIGGDPFERMVFE------------------LFTDVAPKTAENFRALC  254
            M+KK +LVF+DV I GDP ERMVFE                  LF +VAPKTAENFRAL 
Sbjct  2    MTKKNLLVFMDVSIDGDPAERMVFEILHNPYLLISFLVNPIQQLFPEVAPKTAENFRALY  61

Query  255  TGEKGTSPKTGATLHYKGTFFHHIVKGSMAQAGDLL-REDG  374
            T EKG   KTG  LH KG+FFH I++GSMAQ GD   R DG
Sbjct  62   TEEKGIGQKTGRPLHLKGSFFHRIIRGSMAQGGDFHKRHDG  102



>ref|XP_010274266.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63-like isoform 
X2 [Nelumbo nucifera]
Length=695

 Score =   108 bits (270),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 49/83 (59%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = +3

Query  129  MSKKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  308
            + K   LVFLD+ I G+P E++V ELF D+ PKTAENFRALCTGEKG    TG  LHYKG
Sbjct  2    VKKMNPLVFLDISIDGNPAEKVVIELFADIVPKTAENFRALCTGEKGIGASTGKPLHYKG  61

Query  309  TFFHHIVKGSMAQAGDLLREDGM  377
            + FH I+KG MAQ GD    +G+
Sbjct  62   SIFHRIIKGFMAQGGDFSHRNGV  84



>ref|XP_010274264.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63-like isoform 
X1 [Nelumbo nucifera]
 ref|XP_010274265.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63-like isoform 
X1 [Nelumbo nucifera]
Length=696

 Score =   108 bits (270),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 49/83 (59%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = +3

Query  129  MSKKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  308
            + K   LVFLD+ I G+P E++V ELF D+ PKTAENFRALCTGEKG    TG  LHYKG
Sbjct  2    VKKMNPLVFLDISIDGNPAEKVVIELFADIVPKTAENFRALCTGEKGIGASTGKPLHYKG  61

Query  309  TFFHHIVKGSMAQAGDLLREDGM  377
            + FH I+KG MAQ GD    +G+
Sbjct  62   SIFHRIIKGFMAQGGDFSHRNGV  84



>ref|XP_008802287.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X4 [Phoenix dactylifera]
Length=681

 Score =   108 bits (270),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 52/80 (65%), Positives = 59/80 (74%), Gaps = 0/80 (0%)
 Frame = +3

Query  135  KKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  314
            KK  LVFLD+ + GD  ERMV ELF+DV PKTAENFRALCTGEKG    TG +LHYKG+ 
Sbjct  4    KKNPLVFLDISVDGDRAERMVIELFSDVVPKTAENFRALCTGEKGIGASTGKSLHYKGSI  63

Query  315  FHHIVKGSMAQAGDLLREDG  374
            FH IVK   AQ GD+ + DG
Sbjct  64   FHRIVKRLGAQGGDIAKLDG  83



>ref|XP_010274268.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63-like isoform 
X4 [Nelumbo nucifera]
Length=691

 Score =   108 bits (270),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 49/83 (59%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = +3

Query  129  MSKKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  308
            + K   LVFLD+ I G+P E++V ELF D+ PKTAENFRALCTGEKG    TG  LHYKG
Sbjct  2    VKKMNPLVFLDISIDGNPAEKVVIELFADIVPKTAENFRALCTGEKGIGASTGKPLHYKG  61

Query  309  TFFHHIVKGSMAQAGDLLREDGM  377
            + FH I+KG MAQ GD    +G+
Sbjct  62   SIFHRIIKGFMAQGGDFSHRNGV  84



>ref|XP_008802286.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X3 [Phoenix dactylifera]
Length=682

 Score =   108 bits (270),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 52/80 (65%), Positives = 59/80 (74%), Gaps = 0/80 (0%)
 Frame = +3

Query  135  KKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  314
            KK  LVFLD+ + GD  ERMV ELF+DV PKTAENFRALCTGEKG    TG +LHYKG+ 
Sbjct  4    KKNPLVFLDISVDGDRAERMVIELFSDVVPKTAENFRALCTGEKGIGASTGKSLHYKGSI  63

Query  315  FHHIVKGSMAQAGDLLREDG  374
            FH IVK   AQ GD+ + DG
Sbjct  64   FHRIVKRLGAQGGDIAKLDG  83



>ref|XP_010274267.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63-like isoform 
X3 [Nelumbo nucifera]
Length=693

 Score =   108 bits (270),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 49/83 (59%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = +3

Query  129  MSKKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  308
            + K   LVFLD+ I G+P E++V ELF D+ PKTAENFRALCTGEKG    TG  LHYKG
Sbjct  2    VKKMNPLVFLDISIDGNPAEKVVIELFADIVPKTAENFRALCTGEKGIGASTGKPLHYKG  61

Query  309  TFFHHIVKGSMAQAGDLLREDGM  377
            + FH I+KG MAQ GD    +G+
Sbjct  62   SIFHRIIKGFMAQGGDFSHRNGV  84



>ref|XP_008802285.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X2 [Phoenix dactylifera]
Length=684

 Score =   108 bits (270),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 52/80 (65%), Positives = 59/80 (74%), Gaps = 0/80 (0%)
 Frame = +3

Query  135  KKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  314
            KK  LVFLD+ + GD  ERMV ELF+DV PKTAENFRALCTGEKG    TG +LHYKG+ 
Sbjct  4    KKNPLVFLDISVDGDRAERMVIELFSDVVPKTAENFRALCTGEKGIGASTGKSLHYKGSI  63

Query  315  FHHIVKGSMAQAGDLLREDG  374
            FH IVK   AQ GD+ + DG
Sbjct  64   FHRIVKRLGAQGGDIAKLDG  83



>ref|XP_008802283.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X1 [Phoenix dactylifera]
 ref|XP_008802284.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X1 [Phoenix dactylifera]
Length=685

 Score =   108 bits (270),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 52/80 (65%), Positives = 59/80 (74%), Gaps = 0/80 (0%)
 Frame = +3

Query  135  KKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  314
            KK  LVFLD+ + GD  ERMV ELF+DV PKTAENFRALCTGEKG    TG +LHYKG+ 
Sbjct  4    KKNPLVFLDISVDGDRAERMVIELFSDVVPKTAENFRALCTGEKGIGASTGKSLHYKGSI  63

Query  315  FHHIVKGSMAQAGDLLREDG  374
            FH IVK   AQ GD+ + DG
Sbjct  64   FHRIVKRLGAQGGDIAKLDG  83



>ref|XP_006647052.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X1 [Oryza brachyantha]
Length=847

 Score =   108 bits (271),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 49/80 (61%), Positives = 58/80 (73%), Gaps = 0/80 (0%)
 Frame = +3

Query  135  KKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  314
            KK  +VF+DV IG +P ERM+FELF DVAP+TAENFRALCTGE G    T   L+YKG+ 
Sbjct  4    KKNPIVFMDVAIGDEPDERMIFELFADVAPRTAENFRALCTGEMGIGQTTKKPLYYKGSL  63

Query  315  FHHIVKGSMAQAGDLLREDG  374
            FH ++KG MAQ GD    DG
Sbjct  64   FHRVIKGFMAQGGDFSNGDG  83



>ref|XP_006647053.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X2 [Oryza brachyantha]
Length=845

 Score =   108 bits (271),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 49/80 (61%), Positives = 58/80 (73%), Gaps = 0/80 (0%)
 Frame = +3

Query  135  KKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  314
            KK  +VF+DV IG +P ERM+FELF DVAP+TAENFRALCTGE G    T   L+YKG+ 
Sbjct  4    KKNPIVFMDVAIGDEPDERMIFELFADVAPRTAENFRALCTGEMGIGQTTKKPLYYKGSL  63

Query  315  FHHIVKGSMAQAGDLLREDG  374
            FH ++KG MAQ GD    DG
Sbjct  64   FHRVIKGFMAQGGDFSNGDG  83



>emb|CDP03680.1| unnamed protein product [Coffea canephora]
Length=664

 Score =   108 bits (269),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 54/83 (65%), Positives = 59/83 (71%), Gaps = 1/83 (1%)
 Frame = +3

Query  129  MSKKK-VLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            MSKKK  LVF DV I G P ER+  ELF DV PKTAENFRALCTGEKG    TG  LHYK
Sbjct  1    MSKKKNPLVFFDVSIDGSPAERITIELFADVVPKTAENFRALCTGEKGIGSSTGKPLHYK  60

Query  306  GTFFHHIVKGSMAQAGDLLREDG  374
            G+ FH I+KG MAQ GD  + +G
Sbjct  61   GSSFHRIIKGFMAQGGDFSKGNG  83



>ref|XP_004493727.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X1 [Cicer arietinum]
Length=665

 Score =   107 bits (268),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 50/80 (63%), Positives = 58/80 (73%), Gaps = 0/80 (0%)
 Frame = +3

Query  135  KKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  314
            +K   VFLDV + GDP ER+V ELF+ + PKTAENFRALCTGEKG    TG  LHYKGT 
Sbjct  4    EKNPCVFLDVSVDGDPVERIVIELFSSIVPKTAENFRALCTGEKGIGESTGKPLHYKGTC  63

Query  315  FHHIVKGSMAQAGDLLREDG  374
            FH ++KG MAQ GD  R +G
Sbjct  64   FHRVIKGFMAQGGDFSRGNG  83



>gb|KEH23833.1| peptidyl-prolyl cis-trans isomerase [Medicago truncatula]
Length=651

 Score =   107 bits (267),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 51/79 (65%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = +3

Query  138  KKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFF  317
            K   VF DV + GDP ER+V ELF+ V PKTAENFRALCTGEKG    TG  LHYKGT F
Sbjct  5    KNPCVFFDVSVDGDPVERIVIELFSSVVPKTAENFRALCTGEKGIGEATGKPLHYKGTSF  64

Query  318  HHIVKGSMAQAGDLLREDG  374
            H I+KG MAQ GD  R +G
Sbjct  65   HRIIKGFMAQGGDFSRGNG  83



>ref|XP_008355416.1| PREDICTED: peptidyl-prolyl cis-trans isomerase cyp11-like [Malus 
domestica]
 ref|XP_008355417.1| PREDICTED: peptidyl-prolyl cis-trans isomerase cyp11-like [Malus 
domestica]
Length=595

 Score =   107 bits (266),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 65/101 (64%), Gaps = 6/101 (6%)
 Frame = +3

Query  129  MSKKK-VLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            MSKKK   VFLDV I  DP E++V ELF DV PKTAENFRALCTGEKG    TG  LHYK
Sbjct  1    MSKKKNPCVFLDVSIDRDPVEQIVIELFADVVPKTAENFRALCTGEKGIGKSTGKLLHYK  60

Query  306  GTFFHHIVKGSMAQAGDLLREDGM---VIY--FFMDYGFVL  413
            G+ FH ++KG MAQ GD    +G     IY   F D  F L
Sbjct  61   GSTFHRVIKGFMAQGGDFSNGNGTGGESIYGGKFADENFKL  101



>ref|XP_010234011.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X3 [Brachypodium distachyon]
Length=830

 Score =   107 bits (268),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 53/83 (64%), Positives = 59/83 (71%), Gaps = 1/83 (1%)
 Frame = +3

Query  129  MSKKK-VLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            MSKKK  +VFLDV IG  P ERM+FELF DVAP TAENFRALCTGE G    T   L+YK
Sbjct  1    MSKKKNPIVFLDVSIGDGPDERMIFELFADVAPLTAENFRALCTGEMGIGQTTKKPLYYK  60

Query  306  GTFFHHIVKGSMAQAGDLLREDG  374
            G+ FH ++KG MAQ GD    DG
Sbjct  61   GSIFHRVIKGFMAQGGDFSNGDG  83



>emb|CDX93909.1| BnaC04g20680D [Brassica napus]
Length=612

 Score =   107 bits (266),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 62/98 (63%), Gaps = 5/98 (5%)
 Frame = +3

Query  135  KKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  314
            KK   VFLDV IGGDP ER+V ELF  V PKTAENFRALCTGE G    TG  LH+KG+ 
Sbjct  80   KKNPTVFLDVSIGGDPLERIVIELFAHVVPKTAENFRALCTGEAGLGKTTGKPLHFKGSS  139

Query  315  FHHIVKGSMAQAGDLLREDGM---VIY--FFMDYGFVL  413
            FH ++KG MAQ GD    +G     IY   F D  F L
Sbjct  140  FHRVIKGFMAQGGDFSNGNGTGGESIYGGKFPDENFEL  177



>ref|XP_010028210.1| PREDICTED: uncharacterized protein LOC104418535 isoform X2 [Eucalyptus 
grandis]
Length=167

 Score =   101 bits (252),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 63/100 (63%), Gaps = 18/100 (18%)
 Frame = +3

Query  129  MSKKKVLVFLDVCIGGDPFERMVFE------------------LFTDVAPKTAENFRALC  254
            M+KK +LVF+DV I GDP ERMVFE                  LF +VAPKTAENFRAL 
Sbjct  2    MTKKNLLVFMDVSIDGDPAERMVFEILHNPYLLISFLVNPIQQLFPEVAPKTAENFRALY  61

Query  255  TGEKGTSPKTGATLHYKGTFFHHIVKGSMAQAGDLLREDG  374
            T EKG   KTG  LH KG+FFH I++GSMAQ GD  +  G
Sbjct  62   TEEKGIGQKTGRPLHLKGSFFHRIIRGSMAQGGDFHKRHG  101



>ref|XP_002876720.1| hypothetical protein ARALYDRAFT_324764 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52979.1| hypothetical protein ARALYDRAFT_324764 [Arabidopsis lyrata subsp. 
lyrata]
Length=543

 Score =   106 bits (264),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 65/101 (64%), Gaps = 6/101 (6%)
 Frame = +3

Query  129  MSKKKVL-VFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            MSKKK   VFLDV IGGDP +R+V ELF DV PKTAENFRALCTGE G    T   LH+K
Sbjct  1    MSKKKNPNVFLDVSIGGDPVQRIVIELFADVVPKTAENFRALCTGEAGVGKTTRKPLHFK  60

Query  306  GTFFHHIVKGSMAQAGDLLREDGM---VIY--FFMDYGFVL  413
            G+ FH ++KG MAQ GD    +G     IY   F D  F L
Sbjct  61   GSSFHRVIKGFMAQGGDFSNGNGTGGESIYGGKFSDENFRL  101



>ref|XP_010234012.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X4 [Brachypodium distachyon]
Length=829

 Score =   107 bits (267),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 60/105 (57%), Positives = 66/105 (63%), Gaps = 10/105 (10%)
 Frame = +3

Query  129  MSKKK-VLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            MSKKK  +VFLDV IG  P ERM+FELF DVAP TAENFRALCTGE G    T   L+YK
Sbjct  1    MSKKKNPIVFLDVSIGDGPDERMIFELFADVAPLTAENFRALCTGEMGIGQTTKKPLYYK  60

Query  306  GTFFHHIVKGSMAQAGDLLRED-------GMVIYF--FMDYGFVL  413
            G+ FH ++KG MAQ GD    D       G  IY   F D  FVL
Sbjct  61   GSIFHRVIKGFMAQGGDFSNGDVPFSGNGGESIYGEQFEDENFVL  105



>ref|XP_010234010.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X2 [Brachypodium distachyon]
Length=831

 Score =   107 bits (267),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 60/105 (57%), Positives = 66/105 (63%), Gaps = 10/105 (10%)
 Frame = +3

Query  129  MSKKK-VLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            MSKKK  +VFLDV IG  P ERM+FELF DVAP TAENFRALCTGE G    T   L+YK
Sbjct  1    MSKKKNPIVFLDVSIGDGPDERMIFELFADVAPLTAENFRALCTGEMGIGQTTKKPLYYK  60

Query  306  GTFFHHIVKGSMAQAGDLLRED-------GMVIYF--FMDYGFVL  413
            G+ FH ++KG MAQ GD    D       G  IY   F D  FVL
Sbjct  61   GSIFHRVIKGFMAQGGDFSNGDVPFSGNGGESIYGEQFEDENFVL  105



>ref|XP_010234009.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Brachypodium distachyon]
Length=834

 Score =   107 bits (267),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 60/105 (57%), Positives = 66/105 (63%), Gaps = 10/105 (10%)
 Frame = +3

Query  129  MSKKK-VLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            MSKKK  +VFLDV IG  P ERM+FELF DVAP TAENFRALCTGE G    T   L+YK
Sbjct  1    MSKKKNPIVFLDVSIGDGPDERMIFELFADVAPLTAENFRALCTGEMGIGQTTKKPLYYK  60

Query  306  GTFFHHIVKGSMAQAGDLLRED-------GMVIYF--FMDYGFVL  413
            G+ FH ++KG MAQ GD    D       G  IY   F D  FVL
Sbjct  61   GSIFHRVIKGFMAQGGDFSNGDVPFSGNGGESIYGEQFEDENFVL  105



>ref|XP_006402278.1| hypothetical protein EUTSA_v10006033mg [Eutrema salsugineum]
 ref|XP_006402279.1| hypothetical protein EUTSA_v10006033mg [Eutrema salsugineum]
 gb|ESQ43731.1| hypothetical protein EUTSA_v10006033mg [Eutrema salsugineum]
 gb|ESQ43732.1| hypothetical protein EUTSA_v10006033mg [Eutrema salsugineum]
Length=384

 Score =   104 bits (259),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 64/101 (63%), Gaps = 6/101 (6%)
 Frame = +3

Query  129  MSKKKVL-VFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            MSKK    VFLDV +GGDP ER+V ELF DV PKTAENFRALCTGE G    TG  L +K
Sbjct  1    MSKKNNPNVFLDVSLGGDPVERIVIELFADVVPKTAENFRALCTGEAGIGKTTGKPLQFK  60

Query  306  GTFFHHIVKGSMAQAGDLLREDGM---VIY--FFMDYGFVL  413
            G+ FH ++KG MAQ GD    +G     IY   F D  F L
Sbjct  61   GSSFHRVIKGFMAQGGDFSNGNGTGGESIYGGKFSDENFKL  101



>ref|XP_009798520.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009798521.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009798522.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X1 [Nicotiana sylvestris]
Length=660

 Score =   106 bits (265),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 49/80 (61%), Positives = 58/80 (73%), Gaps = 0/80 (0%)
 Frame = +3

Query  135  KKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  314
            KK  LVFLDV I G+P ER+V ELF D+ P+TAENFR+LCTGEKG    TG  LHYKG  
Sbjct  4    KKNPLVFLDVSIDGNPAERIVIELFADIVPRTAENFRSLCTGEKGVGVSTGKPLHYKGCL  63

Query  315  FHHIVKGSMAQAGDLLREDG  374
            FH ++KG MAQ GD  + +G
Sbjct  64   FHRVIKGFMAQGGDFSKGNG  83



>ref|XP_011032623.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 [Populus 
euphratica]
 ref|XP_011032624.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 [Populus 
euphratica]
Length=680

 Score =   106 bits (265),  Expect = 8e-23, Method: Composition-based stats.
 Identities = 51/80 (64%), Positives = 57/80 (71%), Gaps = 0/80 (0%)
 Frame = +3

Query  135  KKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  314
            KK  LVFLDV I GDP ER+  ELF DV P+TAENFRALCTGEKG    TG  LHYKG+ 
Sbjct  4    KKNPLVFLDVSIDGDPAERIFIELFADVVPRTAENFRALCTGEKGIGKTTGKPLHYKGSS  63

Query  315  FHHIVKGSMAQAGDLLREDG  374
            FH I+K  MAQ GD  + +G
Sbjct  64   FHRIIKEFMAQGGDFSKGNG  83



>ref|XP_010268554.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP40 [Nelumbo 
nucifera]
Length=361

 Score =   103 bits (258),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 55/74 (74%), Gaps = 0/74 (0%)
 Frame = +3

Query  153  FLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHIVK  332
            FLDV IGG+   R+V EL+ DV PKTAENFRALCTGEKG  PKTGA LHYKG  FH I+K
Sbjct  7    FLDVSIGGELEGRIVVELYKDVVPKTAENFRALCTGEKGIGPKTGAPLHYKGVRFHRIIK  66

Query  333  GSMAQAGDLLREDG  374
            G M Q GDL   DG
Sbjct  67   GFMIQGGDLSAGDG  80



>ref|XP_009399354.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=694

 Score =   106 bits (264),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 51/81 (63%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = +3

Query  132  SKKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGT  311
            +KK   VFLD+ +  +P ERM  ELF DV PKTAENFRALCTGEKG    T   LHYKG+
Sbjct  3    TKKNPTVFLDISVDRNPAERMEIELFADVVPKTAENFRALCTGEKGIGDSTRLPLHYKGS  62

Query  312  FFHHIVKGSMAQAGDLLREDG  374
            FFH IVKG +AQ GD  R DG
Sbjct  63   FFHRIVKGFVAQGGDFSRRDG  83



>ref|XP_009399355.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=691

 Score =   105 bits (263),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 51/81 (63%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = +3

Query  132  SKKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGT  311
            +KK   VFLD+ +  +P ERM  ELF DV PKTAENFRALCTGEKG    T   LHYKG+
Sbjct  3    TKKNPTVFLDISVDRNPAERMEIELFADVVPKTAENFRALCTGEKGIGDSTRLPLHYKGS  62

Query  312  FFHHIVKGSMAQAGDLLREDG  374
            FFH IVKG +AQ GD  R DG
Sbjct  63   FFHRIVKGFVAQGGDFSRRDG  83



>dbj|BAJ98045.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=440

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 67/104 (64%), Gaps = 6/104 (6%)
 Frame = +3

Query  120  ICKMSKKKV-LVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATL  296
            I KM +KK  +VFLDV IG  P ERM+FELF +VAP TAENFRALCTGE G    T   L
Sbjct  3    IEKMGRKKNPIVFLDVSIGDGPDERMIFELFANVAPLTAENFRALCTGEMGIGQTTKKPL  62

Query  297  HYKGTFFHHIVKGSMAQAGDLLREDGM---VIY--FFMDYGFVL  413
            +YKG+ FH ++KG MAQ GD    DG     IY   F D  FVL
Sbjct  63   YYKGSTFHRVIKGFMAQGGDFSNGDGNGGESIYGEQFEDENFVL  106



>ref|XP_007199724.1| hypothetical protein PRUPE_ppa002435mg [Prunus persica]
 gb|EMJ00923.1| hypothetical protein PRUPE_ppa002435mg [Prunus persica]
Length=673

 Score =   105 bits (263),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 51/80 (64%), Positives = 56/80 (70%), Gaps = 0/80 (0%)
 Frame = +3

Query  135  KKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  314
            KK   VFLDV   GDP ER+V ELF DV PKTAENFRALCTG+KG    TG  LHYKG+ 
Sbjct  4    KKNPCVFLDVSTDGDPMERVVIELFADVVPKTAENFRALCTGDKGIGKSTGKPLHYKGSQ  63

Query  315  FHHIVKGSMAQAGDLLREDG  374
            FH I+KG MAQ GD    +G
Sbjct  64   FHRIIKGFMAQGGDFSNGNG  83



>ref|XP_008235346.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G isoform X2 [Prunus 
mume]
Length=669

 Score =   105 bits (263),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 51/80 (64%), Positives = 56/80 (70%), Gaps = 0/80 (0%)
 Frame = +3

Query  135  KKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  314
            KK   VFLDV   GDP ER+V ELF DV PKTAENFRALCTG+KG    TG  LHYKG+ 
Sbjct  4    KKNPCVFLDVSTDGDPMERVVIELFADVVPKTAENFRALCTGDKGIGKSTGKPLHYKGSQ  63

Query  315  FHHIVKGSMAQAGDLLREDG  374
            FH I+KG MAQ GD    +G
Sbjct  64   FHRIIKGFMAQGGDFSNGNG  83



>ref|XP_008235345.1| PREDICTED: peptidyl-prolyl cis-trans isomerase 8 isoform X1 [Prunus 
mume]
Length=670

 Score =   105 bits (263),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 51/80 (64%), Positives = 56/80 (70%), Gaps = 0/80 (0%)
 Frame = +3

Query  135  KKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  314
            KK   VFLDV   GDP ER+V ELF DV PKTAENFRALCTG+KG    TG  LHYKG+ 
Sbjct  4    KKNPCVFLDVSTDGDPMERVVIELFADVVPKTAENFRALCTGDKGIGKSTGKPLHYKGSQ  63

Query  315  FHHIVKGSMAQAGDLLREDG  374
            FH I+KG MAQ GD    +G
Sbjct  64   FHRIIKGFMAQGGDFSNGNG  83



>ref|XP_006657500.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X2 [Oryza brachyantha]
Length=626

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 63/99 (64%), Gaps = 5/99 (5%)
 Frame = +3

Query  132  SKKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGT  311
            +KK   VFLD+ IGG   ER+ FELF+DV PKTAENFRALCTGE+G    T   LHYKGT
Sbjct  4    AKKNPHVFLDISIGGRAAERITFELFSDVVPKTAENFRALCTGERGLGISTQKPLHYKGT  63

Query  312  FFHHIVKGSMAQAGDLLREDGM---VIY--FFMDYGFVL  413
              H I+KG MAQ GD  R DG     IY   F D  F L
Sbjct  64   TMHRILKGFMAQGGDFSRGDGRGGESIYGAKFKDENFKL  102



>ref|XP_008235347.1| PREDICTED: peptidyl-prolyl cis-trans isomerase 8 isoform X3 [Prunus 
mume]
Length=665

 Score =   105 bits (263),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 51/80 (64%), Positives = 56/80 (70%), Gaps = 0/80 (0%)
 Frame = +3

Query  135  KKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  314
            KK   VFLDV   GDP ER+V ELF DV PKTAENFRALCTG+KG    TG  LHYKG+ 
Sbjct  4    KKNPCVFLDVSTDGDPMERVVIELFADVVPKTAENFRALCTGDKGIGKSTGKPLHYKGSQ  63

Query  315  FHHIVKGSMAQAGDLLREDG  374
            FH I+KG MAQ GD    +G
Sbjct  64   FHRIIKGFMAQGGDFSNGNG  83



>ref|XP_006657499.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X1 [Oryza brachyantha]
Length=627

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 63/99 (64%), Gaps = 5/99 (5%)
 Frame = +3

Query  132  SKKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGT  311
            +KK   VFLD+ IGG   ER+ FELF+DV PKTAENFRALCTGE+G    T   LHYKGT
Sbjct  4    AKKNPHVFLDISIGGRAAERITFELFSDVVPKTAENFRALCTGERGLGISTQKPLHYKGT  63

Query  312  FFHHIVKGSMAQAGDLLREDGM---VIY--FFMDYGFVL  413
              H I+KG MAQ GD  R DG     IY   F D  F L
Sbjct  64   TMHRILKGFMAQGGDFSRGDGRGGESIYGAKFKDENFKL  102



>ref|XP_010935780.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63-like [Elaeis 
guineensis]
Length=703

 Score =   105 bits (263),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 54/84 (64%), Positives = 63/84 (75%), Gaps = 1/84 (1%)
 Frame = +3

Query  126  KMSKKK-VLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHY  302
            KM+KKK  LVFLD+ I G+  ER+V ELF+DV PKTAENFRALCTGEKG    TG +LHY
Sbjct  6    KMAKKKNPLVFLDISIDGNRAERIVIELFSDVVPKTAENFRALCTGEKGIGASTGKSLHY  65

Query  303  KGTFFHHIVKGSMAQAGDLLREDG  374
            KG+ FH IVK   AQ GD+ + DG
Sbjct  66   KGSIFHRIVKRFGAQGGDIAKLDG  89



>ref|XP_006290850.1| hypothetical protein CARUB_v10016960mg [Capsella rubella]
 gb|EOA23748.1| hypothetical protein CARUB_v10016960mg [Capsella rubella]
Length=551

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 62/98 (63%), Gaps = 5/98 (5%)
 Frame = +3

Query  135  KKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  314
            KK   VFLDV IGGDP ER+V ELF DV PKTAENFRALCTGE G    T   LH+KG+ 
Sbjct  4    KKNPHVFLDVSIGGDPVERIVIELFADVVPKTAENFRALCTGEAGVGKTTTKPLHFKGSS  63

Query  315  FHHIVKGSMAQAGDLLREDGM---VIY--FFMDYGFVL  413
            FH ++KG MAQ GD    +G     IY   F D  F L
Sbjct  64   FHRVIKGFMAQGGDFSVGNGTGGESIYGGKFSDENFRL  101



>ref|XP_007162476.1| hypothetical protein PHAVU_001G155500g [Phaseolus vulgaris]
 ref|XP_007162477.1| hypothetical protein PHAVU_001G155500g [Phaseolus vulgaris]
 gb|ESW34470.1| hypothetical protein PHAVU_001G155500g [Phaseolus vulgaris]
 gb|ESW34471.1| hypothetical protein PHAVU_001G155500g [Phaseolus vulgaris]
Length=663

 Score =   105 bits (261),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 50/80 (63%), Positives = 56/80 (70%), Gaps = 0/80 (0%)
 Frame = +3

Query  135  KKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  314
            +K V VF DV I  DP ER+V +LF  + PKTAENFRALCTGEKG    TG  LHYKGT 
Sbjct  4    EKNVRVFFDVSIDADPVERIVIQLFDSIVPKTAENFRALCTGEKGIGESTGKPLHYKGTS  63

Query  315  FHHIVKGSMAQAGDLLREDG  374
            FH I+KG MAQ GD  R +G
Sbjct  64   FHRIIKGFMAQGGDFSRGNG  83



>ref|XP_010468852.1| PREDICTED: LOW QUALITY PROTEIN: peptidyl-prolyl cis-trans isomerase 
CYP63-like [Camelina sativa]
Length=591

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 61/98 (62%), Gaps = 5/98 (5%)
 Frame = +3

Query  135  KKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  314
            KK   VFLDV IG DP ER+V ELF DV PKTAENFRALCTGE G    T   LH+KG+ 
Sbjct  4    KKNPFVFLDVSIGEDPVERIVIELFADVVPKTAENFRALCTGEAGVGKTTAKPLHFKGSS  63

Query  315  FHHIVKGSMAQAGDLLREDGM---VIY--FFMDYGFVL  413
            FH ++KG MAQ GD    +G     IY   F D  F L
Sbjct  64   FHRVIKGFMAQGGDFSNGNGTGGESIYGGKFSDENFRL  101



>ref|XP_008366534.1| PREDICTED: peptidyl-prolyl cis-trans isomerase cyp11-like isoform 
X2 [Malus domestica]
Length=533

 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 64/101 (63%), Gaps = 6/101 (6%)
 Frame = +3

Query  129  MSKKK-VLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            MSKKK   VFLDV I   P E++V ELF DV PKTAENFRALCTGEKG    TG  LHYK
Sbjct  1    MSKKKNPRVFLDVSIDRAPVEQIVIELFADVVPKTAENFRALCTGEKGIGKSTGKPLHYK  60

Query  306  GTFFHHIVKGSMAQAGDLLREDGM---VIY--FFMDYGFVL  413
            G+ FH ++KG MAQ GD    +G     IY   F D  F L
Sbjct  61   GSTFHRVIKGFMAQGGDFSNGNGTGGESIYGGKFADEXFKL  101



>ref|XP_009601160.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X2 [Nicotiana tomentosiformis]
Length=661

 Score =   105 bits (261),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 48/80 (60%), Positives = 58/80 (73%), Gaps = 0/80 (0%)
 Frame = +3

Query  135  KKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  314
            KK  LVFLDV + G+P ER+V ELF D+ P+TAENFR+LCTGEKG    TG  LHYKG  
Sbjct  4    KKNPLVFLDVSMDGNPAERIVIELFADIVPRTAENFRSLCTGEKGVGVSTGKPLHYKGCL  63

Query  315  FHHIVKGSMAQAGDLLREDG  374
            FH ++KG MAQ GD  + +G
Sbjct  64   FHRVIKGFMAQGGDFSKGNG  83



>ref|XP_008366532.1| PREDICTED: peptidyl-prolyl cis-trans isomerase cyp11-like isoform 
X1 [Malus domestica]
 ref|XP_008366533.1| PREDICTED: peptidyl-prolyl cis-trans isomerase cyp11-like isoform 
X1 [Malus domestica]
Length=534

 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 64/101 (63%), Gaps = 6/101 (6%)
 Frame = +3

Query  129  MSKKK-VLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            MSKKK   VFLDV I   P E++V ELF DV PKTAENFRALCTGEKG    TG  LHYK
Sbjct  1    MSKKKNPRVFLDVSIDRAPVEQIVIELFADVVPKTAENFRALCTGEKGIGKSTGKPLHYK  60

Query  306  GTFFHHIVKGSMAQAGDLLREDGM---VIY--FFMDYGFVL  413
            G+ FH ++KG MAQ GD    +G     IY   F D  F L
Sbjct  61   GSTFHRVIKGFMAQGGDFSNGNGTGGESIYGGKFADEXFKL  101



>ref|XP_009601158.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X1 [Nicotiana tomentosiformis]
Length=662

 Score =   105 bits (261),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 48/80 (60%), Positives = 58/80 (73%), Gaps = 0/80 (0%)
 Frame = +3

Query  135  KKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  314
            KK  LVFLDV + G+P ER+V ELF D+ P+TAENFR+LCTGEKG    TG  LHYKG  
Sbjct  4    KKNPLVFLDVSMDGNPAERIVIELFADIVPRTAENFRSLCTGEKGVGVSTGKPLHYKGCL  63

Query  315  FHHIVKGSMAQAGDLLREDG  374
            FH ++KG MAQ GD  + +G
Sbjct  64   FHRVIKGFMAQGGDFSKGNG  83



>ref|XP_006604471.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X3 [Glycine max]
 gb|KHN02546.1| Peptidyl-prolyl cis-trans isomerase [Glycine soja]
Length=659

 Score =   105 bits (261),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 49/80 (61%), Positives = 57/80 (71%), Gaps = 0/80 (0%)
 Frame = +3

Query  135  KKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  314
            +K  LVF DV I GDP ER+V +LF  + P+TAENFRALCTGEKG    TG  LHYKGT 
Sbjct  4    EKNPLVFFDVSIDGDPVERIVIQLFASIVPRTAENFRALCTGEKGIGELTGKPLHYKGTS  63

Query  315  FHHIVKGSMAQAGDLLREDG  374
            FH I++G MAQ GD  R +G
Sbjct  64   FHRIIRGFMAQGGDFSRGNG  83



>ref|XP_006604469.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X1 [Glycine max]
 ref|XP_006604470.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X2 [Glycine max]
Length=664

 Score =   104 bits (260),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 49/80 (61%), Positives = 57/80 (71%), Gaps = 0/80 (0%)
 Frame = +3

Query  135  KKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  314
            +K  LVF DV I GDP ER+V +LF  + P+TAENFRALCTGEKG    TG  LHYKGT 
Sbjct  4    EKNPLVFFDVSIDGDPVERIVIQLFASIVPRTAENFRALCTGEKGIGELTGKPLHYKGTS  63

Query  315  FHHIVKGSMAQAGDLLREDG  374
            FH I++G MAQ GD  R +G
Sbjct  64   FHRIIRGFMAQGGDFSRGNG  83



>ref|XP_003603433.1| Peptidyl-prolyl cis-trans isomerase [Medicago truncatula]
Length=943

 Score =   105 bits (262),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 55/113 (49%), Positives = 66/113 (58%), Gaps = 30/113 (27%)
 Frame = +3

Query  129  MSKKK-VLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTG---------------  260
            M+KKK  LVF+DV I GDP +RMVFELF DVAPKTAENFRALCTG               
Sbjct  4    MTKKKNPLVFMDVSIDGDPVKRMVFELFHDVAPKTAENFRALCTGILNFNLFADYSFLLS  63

Query  261  --------------EKGTSPKTGATLHYKGTFFHHIVKGSMAQAGDLLREDGM  377
                          E+G S  TG  LHYKG+FFH I+KGS+ + GD +  + +
Sbjct  64   KVAFSSIPVFYYPRERGISSNTGKLLHYKGSFFHQIMKGSIVKGGDFVNRNAL  116



>ref|XP_009388658.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009388659.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009388660.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like [Musa 
acuminata subsp. malaccensis]
Length=814

 Score =   105 bits (261),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 50/83 (60%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = +3

Query  126  KMSKKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            K  KK  +VFLDV + G+   RMVFELF D+ PKTAENFRALCTGE G    T   LHYK
Sbjct  3    KKVKKNPIVFLDVSVDGNAARRMVFELFADIVPKTAENFRALCTGEIGFGLMTRKPLHYK  62

Query  306  GTFFHHIVKGSMAQAGDLLREDG  374
            G+ FH I+KG MAQ GD  R +G
Sbjct  63   GSIFHRIIKGFMAQGGDFSRHNG  85



>ref|XP_006604473.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X5 [Glycine max]
Length=635

 Score =   104 bits (260),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 49/80 (61%), Positives = 57/80 (71%), Gaps = 0/80 (0%)
 Frame = +3

Query  135  KKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  314
            +K  LVF DV I GDP ER+V +LF  + P+TAENFRALCTGEKG    TG  LHYKGT 
Sbjct  4    EKNPLVFFDVSIDGDPVERIVIQLFASIVPRTAENFRALCTGEKGIGELTGKPLHYKGTS  63

Query  315  FHHIVKGSMAQAGDLLREDG  374
            FH I++G MAQ GD  R +G
Sbjct  64   FHRIIRGFMAQGGDFSRGNG  83



>ref|XP_006604472.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X4 [Glycine max]
Length=640

 Score =   104 bits (260),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 49/80 (61%), Positives = 57/80 (71%), Gaps = 0/80 (0%)
 Frame = +3

Query  135  KKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  314
            +K  LVF DV I GDP ER+V +LF  + P+TAENFRALCTGEKG    TG  LHYKGT 
Sbjct  4    EKNPLVFFDVSIDGDPVERIVIQLFASIVPRTAENFRALCTGEKGIGELTGKPLHYKGTS  63

Query  315  FHHIVKGSMAQAGDLLREDG  374
            FH I++G MAQ GD  R +G
Sbjct  64   FHRIIRGFMAQGGDFSRGNG  83



>emb|CDY53714.1| BnaAnng12550D [Brassica napus]
Length=556

 Score =   103 bits (258),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 62/103 (60%), Gaps = 5/103 (5%)
 Frame = +3

Query  120  ICKMSKKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLH  299
            +    KK   VFLDV IGGDP ER+V ELF  + PKTAENFRALCTGE G    T   LH
Sbjct  1    MSSSKKKNPTVFLDVSIGGDPLERIVIELFAHLVPKTAENFRALCTGEAGLGKTTSKPLH  60

Query  300  YKGTFFHHIVKGSMAQAGDLLREDGM---VIY--FFMDYGFVL  413
            +KG+ FH ++KG MAQ GD    +G     IY   F D  F L
Sbjct  61   FKGSSFHRVIKGFMAQGGDFSNGNGTGGESIYGGKFPDENFEL  103



>ref|XP_009138664.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 [Brassica 
rapa]
Length=556

 Score =   103 bits (258),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 62/103 (60%), Gaps = 5/103 (5%)
 Frame = +3

Query  120  ICKMSKKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLH  299
            +    KK   VFLDV IGGDP ER+V ELF  + PKTAENFRALCTGE G    T   LH
Sbjct  1    MSSSKKKNPTVFLDVSIGGDPLERIVIELFAHLVPKTAENFRALCTGEAGLGKTTSKPLH  60

Query  300  YKGTFFHHIVKGSMAQAGDLLREDGM---VIY--FFMDYGFVL  413
            +KG+ FH ++KG MAQ GD    +G     IY   F D  F L
Sbjct  61   FKGSSFHRVIKGFMAQGGDFSNGNGTGGESIYGGKFPDENFEL  103



>gb|AIZ68177.1| peptidyl-prolyl cis-trans isomerase CYP40-like protein [Ornithogalum 
saundersiae]
Length=367

 Score =   102 bits (253),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 54/74 (73%), Gaps = 0/74 (0%)
 Frame = +3

Query  153  FLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHIVK  332
            +LD+ IGG+   R+V EL+ DV PKTAENFRALCTGEKGT P TGA LHYKG  FH I K
Sbjct  13   YLDISIGGELDGRIVVELYADVVPKTAENFRALCTGEKGTGPTTGAPLHYKGVRFHRITK  72

Query  333  GSMAQAGDLLREDG  374
            G M Q GD+   DG
Sbjct  73   GFMIQGGDISSSDG  86



>ref|XP_004247203.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X1 [Solanum lycopersicum]
Length=660

 Score =   104 bits (259),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 50/83 (60%), Positives = 59/83 (71%), Gaps = 1/83 (1%)
 Frame = +3

Query  129  MSKKK-VLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            MSKKK  LVFLDV + GD  E++V ELF D  P+TAENFR+LCTGEKG    TG  LHYK
Sbjct  1    MSKKKNPLVFLDVSVDGDAAEKIVIELFADTVPRTAENFRSLCTGEKGVGVSTGKPLHYK  60

Query  306  GTFFHHIVKGSMAQAGDLLREDG  374
            G  FH ++KG MAQ GD  + +G
Sbjct  61   GCLFHRVIKGFMAQGGDFSKGNG  83



>ref|XP_010028504.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP40 [Eucalyptus 
grandis]
 gb|KCW55241.1| hypothetical protein EUGRSUZ_I01174 [Eucalyptus grandis]
 gb|KCW55242.1| hypothetical protein EUGRSUZ_I01174 [Eucalyptus grandis]
Length=361

 Score =   102 bits (253),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = +3

Query  153  FLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHIVK  332
            F+D+ IGG+   R+V EL+TDVAPKTAENFRALCTGEKG  P TGA LHYKG  FH ++K
Sbjct  7    FMDISIGGELEGRIVGELYTDVAPKTAENFRALCTGEKGIGPHTGAPLHYKGVRFHRVIK  66

Query  333  GSMAQAGDLLREDG  374
            G M Q GD+   DG
Sbjct  67   GFMVQGGDISAGDG  80



>gb|EDM00869.1| rCG62684, isoform CRA_b [Rattus norvegicus]
Length=116

 Score = 97.8 bits (242),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 55/81 (68%), Gaps = 0/81 (0%)
 Frame = +3

Query  132  SKKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGT  311
            + K   VF DV IGG+   R+V ELF D+ PKTAENFRALCTGEKGT P TG  LH+KG 
Sbjct  12   NSKNPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGTGPTTGKPLHFKGC  71

Query  312  FFHHIVKGSMAQAGDLLREDG  374
             FH I+K  M Q GD   ++G
Sbjct  72   PFHRIIKKFMIQGGDFSNQNG  92



>gb|EPS61145.1| hypothetical protein M569_13654 [Genlisea aurea]
Length=565

 Score =   103 bits (258),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = +3

Query  138  KKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFF  317
            K   VFLD+ + G+  ER+V ELF D  PKTAENFRALCTGEKG    TG  LHYKG  F
Sbjct  5    KNPFVFLDISVDGNAAERIVIELFADAVPKTAENFRALCTGEKGVGVSTGKPLHYKGITF  64

Query  318  HHIVKGSMAQAGDLLREDGMVI  383
            H I++G MAQ GD  + +GM+I
Sbjct  65   HRIIRGFMAQGGDFSKGNGMLI  86



>ref|XP_011458604.1| PREDICTED: LOW QUALITY PROTEIN: peptidyl-prolyl cis-trans isomerase 
CYP63 [Fragaria vesca subsp. vesca]
Length=652

 Score =   104 bits (259),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 54/83 (65%), Positives = 58/83 (70%), Gaps = 1/83 (1%)
 Frame = +3

Query  129  MSKK-KVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            MSKK    VFLDV I   P ER+V ELF DVAPKTAENFRALCTGEKG    TG  LHYK
Sbjct  1    MSKKANPCVFLDVSINEAPTERIVIELFADVAPKTAENFRALCTGEKGIGKSTGKPLHYK  60

Query  306  GTFFHHIVKGSMAQAGDLLREDG  374
            G+ FH I+KG MAQ GD    +G
Sbjct  61   GSQFHRIIKGFMAQGGDFSAGNG  83



>ref|XP_010512756.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63-like [Camelina 
sativa]
Length=658

 Score =   103 bits (258),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 50/83 (60%), Positives = 58/83 (70%), Gaps = 1/83 (1%)
 Frame = +3

Query  129  MSKKK-VLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            M+K K  LVFLDV IG DP +R+V ELF DV PKTAENFRALCTGE G    T   LH+K
Sbjct  75   MTKNKNPLVFLDVSIGEDPVQRIVIELFADVVPKTAENFRALCTGEAGVGKTTAKPLHFK  134

Query  306  GTFFHHIVKGSMAQAGDLLREDG  374
            G+ FH ++KG MAQ GD    +G
Sbjct  135  GSSFHRVIKGFMAQGGDFSNGNG  157



>ref|XP_008454916.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP40-like isoform 
X2 [Cucumis melo]
Length=269

 Score =   100 bits (250),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 56/78 (72%), Gaps = 0/78 (0%)
 Frame = +3

Query  141  KVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFH  320
            ++  FLD+ IGGD   R+V ELF DV PKTAENFRALCTGEKG  P TG  LH+KG+ FH
Sbjct  3    RIRCFLDISIGGDLEGRIVVELFEDVVPKTAENFRALCTGEKGIGPHTGVPLHFKGSCFH  62

Query  321  HIVKGSMAQAGDLLREDG  374
             ++KG M Q GD+   DG
Sbjct  63   RVIKGFMVQGGDISAGDG  80



>gb|EWM22369.1| Cyclophilin-like peptidyl-prolyl cis-trans isomerase domain protein 
[Nannochloropsis gaditana]
Length=530

 Score =   103 bits (256),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 59/81 (73%), Gaps = 0/81 (0%)
 Frame = +3

Query  132  SKKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGT  311
            +KK V V++D+ IG     RMVFELFT+  P+TAENFRALCTGE+G SP +G  LHYKG+
Sbjct  66   TKKSVQVYMDIKIGPRFAGRMVFELFTEQTPRTAENFRALCTGERGISPLSGHPLHYKGS  125

Query  312  FFHHIVKGSMAQAGDLLREDG  374
             FH ++KG MAQ GD    DG
Sbjct  126  IFHRVIKGFMAQGGDFTAGDG  146



>ref|XP_010999957.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP40 isoform 
X1 [Populus euphratica]
Length=370

 Score =   101 bits (252),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = +3

Query  138  KKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFF  317
            ++   FLD+ IGG+   R+V EL+ DV PKTAENFRALCTGEKG  P TGA LHYKG  F
Sbjct  2    RRSRCFLDISIGGELEGRIVIELYNDVVPKTAENFRALCTGEKGVGPNTGAPLHYKGCCF  61

Query  318  HHIVKGSMAQAGDLLREDG  374
            H ++KG M Q GD+   DG
Sbjct  62   HRVIKGFMVQGGDISAGDG  80



>ref|NP_001232291.1| putative peptidylprolyl isomerase D [Taeniopygia guttata]
 gb|ACH46307.1| putative peptidylprolyl isomerase D [Taeniopygia guttata]
Length=206

 Score = 99.4 bits (246),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 53/74 (72%), Gaps = 0/74 (0%)
 Frame = +3

Query  153  FLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHIVK  332
            F DV IGG+   R+VFELF DV PKTAENFRALCTGEKGT P TG  LHYKG  FH I+K
Sbjct  19   FFDVDIGGERVGRIVFELFADVVPKTAENFRALCTGEKGTGPTTGKPLHYKGCPFHRIIK  78

Query  333  GSMAQAGDLLREDG  374
              M Q GD   ++G
Sbjct  79   QFMVQGGDFSNQNG  92



>ref|XP_006349731.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like [Solanum 
tuberosum]
Length=658

 Score =   103 bits (258),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 51/83 (61%), Positives = 59/83 (71%), Gaps = 1/83 (1%)
 Frame = +3

Query  129  MSKKK-VLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            MSKKK  LVFLDV I GD  E++V ELF D  P+TAENFR+LCTGEKG    TG  LHYK
Sbjct  1    MSKKKNPLVFLDVSIDGDTAEKIVIELFADTVPRTAENFRSLCTGEKGVGVSTGKPLHYK  60

Query  306  GTFFHHIVKGSMAQAGDLLREDG  374
            G  FH ++KG MAQ GD  + +G
Sbjct  61   GCLFHRVIKGFMAQGGDFSKGNG  83



>ref|XP_008454915.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP40-like isoform 
X1 [Cucumis melo]
Length=361

 Score =   101 bits (251),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 56/78 (72%), Gaps = 0/78 (0%)
 Frame = +3

Query  141  KVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFH  320
            ++  FLD+ IGGD   R+V ELF DV PKTAENFRALCTGEKG  P TG  LH+KG+ FH
Sbjct  3    RIRCFLDISIGGDLEGRIVVELFEDVVPKTAENFRALCTGEKGIGPHTGVPLHFKGSCFH  62

Query  321  HIVKGSMAQAGDLLREDG  374
             ++KG M Q GD+   DG
Sbjct  63   RVIKGFMVQGGDISAGDG  80



>gb|KJB17878.1| hypothetical protein B456_003G021400 [Gossypium raimondii]
 gb|KJB17879.1| hypothetical protein B456_003G021400 [Gossypium raimondii]
Length=361

 Score =   101 bits (251),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 55/74 (74%), Gaps = 0/74 (0%)
 Frame = +3

Query  153  FLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHIVK  332
            ++D+ IGG+P  R+V EL+ D+ PKTAENFRALCTGEKG  P TGA+LHYK   FH I++
Sbjct  7    YMDISIGGEPEGRVVIELYKDIVPKTAENFRALCTGEKGIGPNTGASLHYKDVRFHRIIR  66

Query  333  GSMAQAGDLLREDG  374
            G M Q GD+   DG
Sbjct  67   GFMIQGGDISAGDG  80



>emb|CDK25020.1| unnamed protein product [Kuraishia capsulata CBS 1993]
Length=363

 Score =   100 bits (250),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 58/82 (71%), Gaps = 1/82 (1%)
 Frame = +3

Query  129  MSKKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  308
            MS+ +  VF DV IGG+P  R+VFELF DV PKTAENFRALCTGEKG   ++G  LHYKG
Sbjct  1    MSEVRPRVFFDVSIGGEPTRRIVFELFADVVPKTAENFRALCTGEKGVG-QSGKPLHYKG  59

Query  309  TFFHHIVKGSMAQAGDLLREDG  374
            + FH +++  M Q GD    DG
Sbjct  60   SIFHRVIESFMCQGGDFTLGDG  81



>ref|XP_001651471.1| AAEL005799-PA, partial [Aedes aegypti]
 gb|EAT42690.1| AAEL005799-PA, partial [Aedes aegypti]
Length=218

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 55/79 (70%), Gaps = 0/79 (0%)
 Frame = +3

Query  138  KKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFF  317
             K+  F D+ +GG P  R+VFELF D+APKT ENFR+LCTGEKGT  KTG  LHYKG  F
Sbjct  14   NKIRCFFDITLGGLPAGRIVFELFPDIAPKTCENFRSLCTGEKGTGQKTGKPLHYKGIIF  73

Query  318  HHIVKGSMAQAGDLLREDG  374
            H +VK  M Q+GD    +G
Sbjct  74   HRVVKDFMIQSGDFSNGNG  92



>gb|KHN10697.1| Peptidyl-prolyl cis-trans isomerase [Glycine soja]
Length=727

 Score =   103 bits (256),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 50/90 (56%), Positives = 59/90 (66%), Gaps = 5/90 (6%)
 Frame = +3

Query  120  ICKMSK-----KKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKT  284
            +C +SK     K   VF DV I GDP ER+V +LF  + P+TAENFRALCTGEKG    T
Sbjct  53   MCLLSKVMGLEKNPRVFFDVSIDGDPVERIVIQLFASIVPRTAENFRALCTGEKGIGEST  112

Query  285  GATLHYKGTFFHHIVKGSMAQAGDLLREDG  374
            G  LHYKGT  H I++G MAQ GD  R +G
Sbjct  113  GKPLHYKGTSLHRIIRGFMAQGGDFSRGNG  142



>ref|XP_010530877.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP40 isoform 
X1 [Tarenaya hassleriana]
Length=361

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 54/74 (73%), Gaps = 0/74 (0%)
 Frame = +3

Query  153  FLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHIVK  332
            F+D+ IGG+   R+V EL+ DV PKTAENFRALCTGEKG  P TG  LHYKG  FH ++K
Sbjct  7    FVDIAIGGELEGRIVVELYNDVVPKTAENFRALCTGEKGIGPNTGVPLHYKGNRFHRVIK  66

Query  333  GSMAQAGDLLREDG  374
            G M Q GD+  +DG
Sbjct  67   GFMVQGGDISAQDG  80



>ref|XP_002310739.2| hypothetical protein POPTR_0007s11390g [Populus trichocarpa]
 gb|EEE91189.2| hypothetical protein POPTR_0007s11390g [Populus trichocarpa]
Length=279

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 59/82 (72%), Gaps = 2/82 (2%)
 Frame = +3

Query  129  MSKKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  308
            M+K++   FLD+ IGG+   R+V EL+ DV PKTAENFRALCTGEKG  P +G  LHYKG
Sbjct  1    MAKQRC--FLDISIGGELEGRIVVELYKDVVPKTAENFRALCTGEKGIGPNSGVPLHYKG  58

Query  309  TFFHHIVKGSMAQAGDLLREDG  374
            + FH +VKG M Q GD+   DG
Sbjct  59   SRFHRVVKGFMVQGGDISAGDG  80



>ref|XP_010548031.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP40 [Tarenaya 
hassleriana]
 ref|XP_010548032.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP40 [Tarenaya 
hassleriana]
 ref|XP_010548033.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP40 [Tarenaya 
hassleriana]
 ref|XP_010548034.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP40 [Tarenaya 
hassleriana]
Length=361

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 54/74 (73%), Gaps = 0/74 (0%)
 Frame = +3

Query  153  FLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHIVK  332
            F+D+ IGG+   R+V EL+ DV PKTAENFRALCTGEKG  P TG  LHYKG  FH ++K
Sbjct  7    FMDIAIGGELEGRIVVELYDDVVPKTAENFRALCTGEKGIGPDTGVPLHYKGNRFHRVIK  66

Query  333  GSMAQAGDLLREDG  374
            G M Q GD+  +DG
Sbjct  67   GFMVQGGDISAQDG  80



>gb|EYU46533.1| hypothetical protein MIMGU_mgv1a002319mg [Erythranthe guttata]
Length=688

 Score =   102 bits (255),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 50/79 (63%), Positives = 55/79 (70%), Gaps = 0/79 (0%)
 Frame = +3

Query  138  KKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFF  317
            K  LVFL+V I GD  ER+V ELF D  PKTAENFRALCTGEKG    TG  LHYKG  F
Sbjct  5    KNPLVFLEVSIEGDTAERIVIELFADTVPKTAENFRALCTGEKGVGTSTGKPLHYKGCTF  64

Query  318  HHIVKGSMAQAGDLLREDG  374
            H I+KG MAQ GD  + +G
Sbjct  65   HRIIKGFMAQGGDFSKGNG  83



>ref|XP_010028212.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X4 [Eucalyptus grandis]
Length=135

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 59/92 (64%), Gaps = 18/92 (20%)
 Frame = +3

Query  129  MSKKKVLVFLDVCIGGDPFERMVFE------------------LFTDVAPKTAENFRALC  254
            M+KK +LVF+DV I GDP ERMVFE                  LF +VAPKTAENFRAL 
Sbjct  2    MTKKNLLVFMDVSIDGDPAERMVFEILHNPYLLISFLVNPIQQLFPEVAPKTAENFRALY  61

Query  255  TGEKGTSPKTGATLHYKGTFFHHIVKGSMAQA  350
            T EKG   KTG  LH KG+FFH I++GSMAQ 
Sbjct  62   TEEKGIGQKTGRPLHLKGSFFHRIIRGSMAQV  93



>ref|XP_004136993.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP40-like [Cucumis 
sativus]
 gb|KGN43950.1| hypothetical protein Csa_7G074830 [Cucumis sativus]
Length=361

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 56/78 (72%), Gaps = 0/78 (0%)
 Frame = +3

Query  141  KVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFH  320
            ++  FLD+ IGGD   R+V EL+ DV PKTAENFRALCTGEKG  P TG  LH+KG+ FH
Sbjct  3    RIRCFLDISIGGDLEGRIVVELYDDVVPKTAENFRALCTGEKGIGPHTGVPLHFKGSCFH  62

Query  321  HIVKGSMAQAGDLLREDG  374
             ++KG M Q GD+   DG
Sbjct  63   RVIKGFMVQGGDISAGDG  80



>ref|XP_004165805.1| PREDICTED: LOW QUALITY PROTEIN: peptidyl-prolyl cis-trans isomerase 
CYP40-like [Cucumis sativus]
Length=361

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 56/78 (72%), Gaps = 0/78 (0%)
 Frame = +3

Query  141  KVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFH  320
            ++  FLD+ IGGD   R+V EL+ DV PKTAENFRALCTGEKG  P TG  LH+KG+ FH
Sbjct  3    RIRCFLDISIGGDLEGRIVVELYDDVVPKTAENFRALCTGEKGIGPHTGVPLHFKGSCFH  62

Query  321  HIVKGSMAQAGDLLREDG  374
             ++KG M Q GD+   DG
Sbjct  63   RVIKGFMVQGGDISAGDG  80



>ref|XP_010584391.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D isoform X1 [Haliaeetus 
leucocephalus]
Length=370

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 53/74 (72%), Gaps = 0/74 (0%)
 Frame = +3

Query  153  FLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHIVK  332
            F DV IGG+   R+VFELF DV PKTAENFRALCTGEKGT P TG  LHYKG  FH I+K
Sbjct  19   FFDVDIGGERVGRIVFELFADVVPKTAENFRALCTGEKGTGPTTGKPLHYKGCPFHRIIK  78

Query  333  GSMAQAGDLLREDG  374
              M Q GD   ++G
Sbjct  79   QFMVQGGDFSNQNG  92



>ref|XP_005854554.1| myosin light chain kinase [Nannochloropsis gaditana CCMP526]
 gb|EKU21801.1| myosin light chain kinase [Nannochloropsis gaditana CCMP526]
Length=807

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 59/81 (73%), Gaps = 0/81 (0%)
 Frame = +3

Query  132  SKKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGT  311
            +KK V V++D+ IG     RMVFELFT+  P+TAENFRALCTGE+G SP +G  LHYKG+
Sbjct  343  TKKSVQVYMDIKIGPRFAGRMVFELFTEQTPRTAENFRALCTGERGISPLSGHPLHYKGS  402

Query  312  FFHHIVKGSMAQAGDLLREDG  374
             FH ++KG MAQ GD    DG
Sbjct  403  IFHRVIKGFMAQGGDFTAGDG  423



>gb|ACH45652.1| putative peptidylprolyl isomerase D [Taeniopygia guttata]
 gb|ACH45653.1| putative peptidylprolyl isomerase D [Taeniopygia guttata]
Length=370

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 53/75 (71%), Gaps = 0/75 (0%)
 Frame = +3

Query  150  VFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHIV  329
             F DV IGG+   R+VFELF DV PKTAENFRALCTGEKGT P TG  LHYKG  FH I+
Sbjct  18   AFFDVDIGGERVGRIVFELFADVVPKTAENFRALCTGEKGTGPTTGKPLHYKGCPFHRII  77

Query  330  KGSMAQAGDLLREDG  374
            K  M Q GD   ++G
Sbjct  78   KQFMVQGGDFSNQNG  92



>gb|KHG16182.1| Peptidyl-prolyl cis-trans isomerase CYP40 -like protein [Gossypium 
arboreum]
Length=361

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 55/74 (74%), Gaps = 0/74 (0%)
 Frame = +3

Query  153  FLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHIVK  332
            ++D+ IGG+   R+V EL+ D+ PKTAENFRALCTGEKG  P TGA+LHYKG  FH I++
Sbjct  7    YMDISIGGELEGRIVIELYKDIVPKTAENFRALCTGEKGIGPNTGASLHYKGVRFHRIIR  66

Query  333  GSMAQAGDLLREDG  374
            G M Q GD+   DG
Sbjct  67   GFMIQGGDISAGDG  80



>ref|XP_010584392.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D isoform X2 [Haliaeetus 
leucocephalus]
Length=341

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 53/74 (72%), Gaps = 0/74 (0%)
 Frame = +3

Query  153  FLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHIVK  332
            F DV IGG+   R+VFELF DV PKTAENFRALCTGEKGT P TG  LHYKG  FH I+K
Sbjct  19   FFDVDIGGERVGRIVFELFADVVPKTAENFRALCTGEKGTGPTTGKPLHYKGCPFHRIIK  78

Query  333  GSMAQAGDLLREDG  374
              M Q GD   ++G
Sbjct  79   QFMVQGGDFSNQNG  92



>ref|XP_005148983.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D [Melopsittacus 
undulatus]
Length=370

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 53/74 (72%), Gaps = 0/74 (0%)
 Frame = +3

Query  153  FLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHIVK  332
            F DV IGG+   R+VFELF DV PKTAENFRALCTGEKGT P TG  LHYKG  FH I+K
Sbjct  19   FFDVDIGGERVGRIVFELFADVVPKTAENFRALCTGEKGTGPTTGKPLHYKGCPFHRIIK  78

Query  333  GSMAQAGDLLREDG  374
              M Q GD   ++G
Sbjct  79   QFMVQGGDFSNQNG  92



>ref|XP_009350556.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP40 [Pyrus x 
bretschneideri]
 ref|XP_009350557.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP40 [Pyrus x 
bretschneideri]
Length=362

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 53/74 (72%), Gaps = 0/74 (0%)
 Frame = +3

Query  153  FLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHIVK  332
            FLD+ IGG+   R+V ELF DV PKTAENFRALCTGEKG  P TG  LHYKG  FH ++K
Sbjct  7    FLDISIGGELEGRIVVELFDDVVPKTAENFRALCTGEKGIGPNTGVPLHYKGVRFHRVIK  66

Query  333  GSMAQAGDLLREDG  374
            G M Q GD+   DG
Sbjct  67   GFMIQGGDISAGDG  80



>ref|XP_011026088.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63-like [Populus 
euphratica]
Length=694

 Score =   102 bits (254),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 53/83 (64%), Positives = 57/83 (69%), Gaps = 1/83 (1%)
 Frame = +3

Query  129  MSKKK-VLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  305
            MSKKK  LVFLDV I GDP   +  ELF DV PKTAENFRALCTGEKG    TG  L YK
Sbjct  1    MSKKKNPLVFLDVSIDGDPAASIFIELFADVVPKTAENFRALCTGEKGIGKTTGKPLRYK  60

Query  306  GTFFHHIVKGSMAQAGDLLREDG  374
            G  FH I+KG MAQ GD  + +G
Sbjct  61   GCSFHRIIKGFMAQGGDFSKGNG  83



>ref|XP_005486377.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D [Zonotrichia 
albicollis]
Length=370

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 53/75 (71%), Gaps = 0/75 (0%)
 Frame = +3

Query  150  VFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHIV  329
             F DV IGG+   R+VFELF DV PKTAENFRALCTGEKGT P TG  LHYKG  FH I+
Sbjct  18   AFFDVDIGGERVGRIVFELFADVVPKTAENFRALCTGEKGTGPTTGKPLHYKGCPFHRII  77

Query  330  KGSMAQAGDLLREDG  374
            K  M Q GD   ++G
Sbjct  78   KEFMVQGGDFSNQNG  92



>ref|XP_003524582.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP40-like isoform 
X1 [Glycine max]
Length=360

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 53/74 (72%), Gaps = 0/74 (0%)
 Frame = +3

Query  153  FLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHIVK  332
            FLDV IGG+   R+V ELF DV PKTAENFRALCTGEKG  P TG  LHYKG  FH ++K
Sbjct  7    FLDVSIGGELEGRIVVELFHDVVPKTAENFRALCTGEKGIGPNTGVPLHYKGVCFHRVIK  66

Query  333  GSMAQAGDLLREDG  374
            G M Q GD+   DG
Sbjct  67   GFMIQGGDISAGDG  80



>ref|XP_010104462.1| Peptidyl-prolyl cis-trans isomerase [Morus notabilis]
 gb|EXC00995.1| Peptidyl-prolyl cis-trans isomerase [Morus notabilis]
Length=145

 Score = 96.3 bits (238),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 57/82 (70%), Gaps = 3/82 (4%)
 Frame = +3

Query  129  MSKKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  308
            MSK KV  F D+ IGG P  R+V EL+ D+ P+TAENFRALCTGEKGT  ++G  LHYKG
Sbjct  1    MSKSKV--FFDIAIGGSPAGRIVMELYADMTPRTAENFRALCTGEKGTG-RSGKPLHYKG  57

Query  309  TFFHHIVKGSMAQAGDLLREDG  374
            + FH I+ G M Q GD    +G
Sbjct  58   STFHRIIPGFMCQGGDFTAGNG  79



>ref|XP_010104463.1| Peptidyl-prolyl cis-trans isomerase [Morus notabilis]
 gb|EXC00996.1| Peptidyl-prolyl cis-trans isomerase [Morus notabilis]
Length=172

 Score = 97.1 bits (240),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 57/82 (70%), Gaps = 3/82 (4%)
 Frame = +3

Query  129  MSKKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  308
            MSK KV  F D+ IGG P  R+V EL+ DV P+TAENFRALCTGEKGT  ++G  LHYKG
Sbjct  1    MSKSKV--FFDIAIGGSPAGRIVMELYADVTPRTAENFRALCTGEKGTG-RSGKPLHYKG  57

Query  309  TFFHHIVKGSMAQAGDLLREDG  374
            + FH I+ G M Q GD    +G
Sbjct  58   STFHRIIPGFMCQGGDFTAGNG  79



>ref|XP_001761081.1| predicted protein [Physcomitrella patens]
 gb|EDQ74148.1| predicted protein [Physcomitrella patens]
Length=371

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = +3

Query  129  MSKKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  308
            M  +   VF D+ IGGD   R+VFELF DV PKTAENFRALCTGEKG    +G  LHYKG
Sbjct  8    MESRNPKVFFDISIGGDMEGRIVFELFADVVPKTAENFRALCTGEKGIGKISGRPLHYKG  67

Query  309  TFFHHIVKGSMAQAGDLLREDG  374
              FH ++KG M Q GD    +G
Sbjct  68   AVFHRVIKGFMIQGGDFENANG  89



>ref|XP_003436324.1| AGAP002952-PB [Anopheles gambiae str. PEST]
 gb|EGK96689.1| AGAP002952-PB [Anopheles gambiae str. PEST]
Length=158

 Score = 96.7 bits (239),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 55/81 (68%), Gaps = 0/81 (0%)
 Frame = +3

Query  132  SKKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGT  311
             ++K+  F DV +GG P  R+VFELF  VAPKT ENFRALCTGEKG   KTG  LHYKG 
Sbjct  18   QQEKIRCFFDVSLGGLPAGRIVFELFPAVAPKTCENFRALCTGEKGIGQKTGKPLHYKGI  77

Query  312  FFHHIVKGSMAQAGDLLREDG  374
             FH +VK  M Q+GD    +G
Sbjct  78   IFHRVVKDFMIQSGDFSNGNG  98



>ref|XP_002521846.1| peptidyl-prolyl cis-trans isomerase d, ppid, putative [Ricinus 
communis]
 gb|EEF40482.1| peptidyl-prolyl cis-trans isomerase d, ppid, putative [Ricinus 
communis]
Length=361

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 53/74 (72%), Gaps = 0/74 (0%)
 Frame = +3

Query  153  FLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHIVK  332
            FLD+ IGG+   R+V EL+ DV PKTAENFRALCTGEKG  P TG  LHYKG  FH I+K
Sbjct  7    FLDISIGGELEGRIVIELYNDVVPKTAENFRALCTGEKGIGPNTGVPLHYKGCPFHRIIK  66

Query  333  GSMAQAGDLLREDG  374
            G M Q GD+   DG
Sbjct  67   GFMVQGGDISAGDG  80



>gb|ACH45651.1| putative peptidylprolyl isomerase D [Taeniopygia guttata]
Length=374

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 53/75 (71%), Gaps = 0/75 (0%)
 Frame = +3

Query  150  VFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHIV  329
             F DV IGG+   R+VFELF DV PKTAENFRALCTGEKGT P TG  LHYKG  FH I+
Sbjct  18   AFFDVDIGGERVGRIVFELFADVVPKTAENFRALCTGEKGTGPTTGKPLHYKGCPFHRII  77

Query  330  KGSMAQAGDLLREDG  374
            K  M Q GD   ++G
Sbjct  78   KQFMVQGGDFSNQNG  92



>ref|XP_006579808.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP40-like isoform 
X2 [Glycine max]
Length=363

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 53/74 (72%), Gaps = 0/74 (0%)
 Frame = +3

Query  153  FLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHIVK  332
            FLDV IGG+   R+V ELF DV PKTAENFRALCTGEKG  P TG  LHYKG  FH ++K
Sbjct  7    FLDVSIGGELEGRIVVELFHDVVPKTAENFRALCTGEKGIGPNTGVPLHYKGVCFHRVIK  66

Query  333  GSMAQAGDLLREDG  374
            G M Q GD+   DG
Sbjct  67   GFMIQGGDISAGDG  80



>gb|ACO07673.1| 40 kDa peptidyl-prolyl cis-trans isomerase [Oncorhynchus mykiss]
Length=371

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = +3

Query  132  SKKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGT  311
            +K+   VFLDV IGG+   R+VFELF DV PKTAENFRALCTGEKGT   TG  LH+KG 
Sbjct  12   NKENPRVFLDVDIGGERVGRIVFELFADVVPKTAENFRALCTGEKGTGKTTGKPLHFKGC  71

Query  312  FFHHIVKGSMAQAGDLLREDG  374
             FH I+K  M Q GD   ++G
Sbjct  72   PFHRIIKQFMIQGGDFSNQNG  92



>gb|ACH70718.1| peptidylprolyl isomerase D (cyclophilin D) [Salmo salar]
Length=371

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = +3

Query  132  SKKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGT  311
            +K+   VFLDV IGG+   R+VFELF DV PKTAENFRALCTGEKGT   TG  LH+KG 
Sbjct  12   NKENPRVFLDVDIGGERVGRIVFELFADVVPKTAENFRALCTGEKGTGKTTGKPLHFKGC  71

Query  312  FFHHIVKGSMAQAGDLLREDG  374
             FH I+K  M Q GD   ++G
Sbjct  72   PFHRIIKQFMIQGGDFSNQNG  92



>ref|XP_005517649.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D [Pseudopodoces 
humilis]
Length=370

 Score = 99.4 bits (246),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 53/75 (71%), Gaps = 0/75 (0%)
 Frame = +3

Query  150  VFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHIV  329
             F DV IGG+   R+VFELF DV PKTAENFRALCTGEKGT P TG  LHYKG  FH I+
Sbjct  18   AFFDVDIGGERVGRIVFELFADVVPKTAENFRALCTGEKGTGPTTGKPLHYKGCPFHRII  77

Query  330  KGSMAQAGDLLREDG  374
            K  M Q GD   ++G
Sbjct  78   KQFMIQGGDFSNQNG  92



>emb|CDQ63777.1| unnamed protein product [Oncorhynchus mykiss]
Length=371

 Score = 99.4 bits (246),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = +3

Query  132  SKKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGT  311
            +K+   VFLDV IGG+   R+VFELF DV PKTAENFRALCTGEKGT   TG  LH+KG 
Sbjct  12   NKENPRVFLDVDIGGERVGRIVFELFADVVPKTAENFRALCTGEKGTGKTTGKPLHFKGC  71

Query  312  FFHHIVKGSMAQAGDLLREDG  374
             FH I+K  M Q GD   ++G
Sbjct  72   PFHRIIKQFMIQGGDFSNQNG  92



>gb|ACO08154.1| 40 kDa peptidyl-prolyl cis-trans isomerase [Oncorhynchus mykiss]
Length=371

 Score = 99.4 bits (246),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = +3

Query  132  SKKKVLVFLDVCIGGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGT  311
            +K+   VFLDV IGG+   R+VFELF DV PKTAENFRALCTGEKGT   TG  LH+KG 
Sbjct  12   NKENPRVFLDVDIGGERVGRIVFELFADVVPKTAENFRALCTGEKGTGKTTGKPLHFKGC  71

Query  312  FFHHIVKGSMAQAGDLLREDG  374
             FH I+K  M Q GD   ++G
Sbjct  72   PFHRIIKQFMIQGGDFSNQNG  92



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 933768211125