BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF052M15

Length=679
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009774328.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    328   6e-107   Nicotiana sylvestris
ref|XP_006348606.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    327   2e-106   Solanum tuberosum [potatoes]
ref|XP_009610999.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    327   2e-106   Nicotiana tomentosiformis
ref|XP_004238989.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    327   2e-106   Solanum lycopersicum
ref|XP_004237068.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    325   2e-105   Solanum lycopersicum
gb|KEH21786.1|  decarboxylating-like 6-phosphogluconate dehydroge...    325   3e-105   Medicago truncatula
ref|XP_006363551.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    323   7e-105   Solanum tuberosum [potatoes]
ref|XP_009619672.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    323   8e-105   Nicotiana tomentosiformis
ref|XP_009773713.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    323   1e-104   Nicotiana sylvestris
ref|XP_006379723.1|  hypothetical protein POPTR_0008s112802g            311   2e-104   
gb|KJB22742.1|  hypothetical protein B456_004G063900                    319   3e-103   Gossypium raimondii
ref|XP_010261653.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    319   3e-103   
ref|XP_010261649.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    319   5e-103   Nelumbo nucifera [Indian lotus]
ref|XP_006601856.1|  PREDICTED: 6-phosphogluconate dehydrogenase ...    318   7e-103   
ref|XP_010261635.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    319   7e-103   Nelumbo nucifera [Indian lotus]
ref|XP_010257854.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    318   7e-103   Nelumbo nucifera [Indian lotus]
ref|XP_007032950.1|  6-phosphogluconate dehydrogenase family prot...    318   9e-103   
gb|KDP24308.1|  hypothetical protein JCGZ_25604                         318   1e-102   Jatropha curcas
ref|XP_008341826.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    317   2e-102   Malus domestica [apple tree]
ref|XP_004491970.1|  PREDICTED: LOW QUALITY PROTEIN: 6-phosphoglu...    317   2e-102   
ref|XP_010463641.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    318   2e-102   Camelina sativa [gold-of-pleasure]
ref|XP_009373738.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    317   3e-102   Pyrus x bretschneideri [bai li]
ref|XP_003531895.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    317   3e-102   Glycine max [soybeans]
ref|XP_004304174.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    317   3e-102   Fragaria vesca subsp. vesca
ref|XP_002270984.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    317   3e-102   Vitis vinifera
ref|XP_007032948.1|  6-phosphogluconate dehydrogenase family prot...    316   4e-102   Theobroma cacao [chocolate]
ref|XP_002530803.1|  6-phosphogluconate dehydrogenase, putative         316   5e-102   Ricinus communis
ref|XP_010029445.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    316   5e-102   Eucalyptus grandis [rose gum]
ref|XP_007032949.1|  6-phosphogluconate dehydrogenase family prot...    316   6e-102   
ref|XP_011085569.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    315   8e-102   Sesamum indicum [beniseed]
ref|XP_011099073.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    315   1e-101   Sesamum indicum [beniseed]
gb|AAB41553.1|  6-phosphogluconate dehydrogenase                        315   1e-101   Medicago sativa [alfalfa]
gb|KCW56358.1|  hypothetical protein EUGRSUZ_I02092                     315   2e-101   Eucalyptus grandis [rose gum]
ref|XP_009378306.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    314   3e-101   Pyrus x bretschneideri [bai li]
gb|KDO70202.1|  hypothetical protein CISIN_1g0115012mg                  314   3e-101   Citrus sinensis [apfelsine]
ref|XP_006484295.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    314   3e-101   Citrus sinensis [apfelsine]
ref|XP_008379478.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    314   4e-101   Malus domestica [apple tree]
emb|CDP00510.1|  unnamed protein product                                313   4e-101   Coffea canephora [robusta coffee]
ref|XP_002305978.2|  phosphogluconate dehydrogenase family protein      314   4e-101   
ref|XP_008459418.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    313   5e-101   Cucumis melo [Oriental melon]
ref|XP_011021140.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    313   9e-101   Populus euphratica
ref|XP_004141482.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    313   9e-101   Cucumis sativus [cucumbers]
ref|XP_007045684.1|  6-phosphogluconate dehydrogenase family prot...    313   1e-100   Theobroma cacao [chocolate]
ref|XP_010549952.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    313   1e-100   Tarenaya hassleriana [spider flower]
ref|XP_006373519.1|  phosphogluconate dehydrogenase family protein      312   1e-100   Populus trichocarpa [western balsam poplar]
ref|XP_002882225.1|  6-phosphogluconate dehydrogenase family protein    312   1e-100   
ref|XP_010091678.1|  6-phosphogluconate dehydrogenase                   312   1e-100   Morus notabilis
ref|XP_006297535.1|  hypothetical protein CARUB_v10013557mg             312   1e-100   Capsella rubella
emb|CDY34724.1|  BnaA01g33010D                                          309   2e-100   Brassica napus [oilseed rape]
ref|NP_186885.1|  6-phosphogluconate dehydrogenase, decarboxylati...    311   3e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010477172.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    311   3e-100   Camelina sativa [gold-of-pleasure]
ref|XP_010681308.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    311   4e-100   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009147357.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    311   5e-100   Brassica rapa
gb|KDO38967.1|  hypothetical protein CISIN_1g011394mg                   311   5e-100   Citrus sinensis [apfelsine]
ref|XP_007151436.1|  hypothetical protein PHAVU_004G046100g             311   5e-100   Phaseolus vulgaris [French bean]
emb|CDY43238.1|  BnaC05g48310D                                          308   6e-100   Brassica napus [oilseed rape]
gb|KDO38968.1|  hypothetical protein CISIN_1g011394mg                   310   6e-100   Citrus sinensis [apfelsine]
emb|CDY57527.1|  BnaA05g33580D                                          308   6e-100   Brassica napus [oilseed rape]
ref|XP_006430886.1|  hypothetical protein CICLE_v10011597mg             310   7e-100   Citrus clementina [clementine]
ref|XP_006437811.1|  hypothetical protein CICLE_v10031373mg             310   7e-100   Citrus clementina [clementine]
gb|EYU44260.1|  hypothetical protein MIMGU_mgv1a005435mg                310   7e-100   Erythranthe guttata [common monkey flower]
ref|XP_010485479.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    310   9e-100   Camelina sativa [gold-of-pleasure]
ref|XP_006482343.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    310   1e-99    Citrus sinensis [apfelsine]
ref|XP_008230333.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    309   2e-99    Prunus mume [ume]
gb|EPS70190.1|  hypothetical protein M569_04567                         309   5e-99    Genlisea aurea
ref|XP_007217218.1|  hypothetical protein PRUPE_ppa004860mg             308   5e-99    Prunus persica
gb|AAC79957.1|  6-phosphogluconate dehydrogenase isoenzyme A            297   5e-99    Zea mays [maize]
sp|Q94KU1.1|6PGD1_SPIOL  RecName: Full=6-phosphogluconate dehydro...    308   7e-99    Spinacia oleracea
ref|XP_006857727.1|  hypothetical protein AMTR_s00061p00182310          308   7e-99    Amborella trichopoda
ref|XP_006603945.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    308   8e-99    
ref|XP_010933404.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    308   9e-99    Elaeis guineensis
ref|XP_003555038.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    309   1e-98    Glycine max [soybeans]
ref|XP_009388425.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    307   1e-98    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006408422.1|  hypothetical protein EUTSA_v10020604mg             307   1e-98    
ref|XP_009399427.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    306   3e-98    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010558538.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    306   4e-98    Tarenaya hassleriana [spider flower]
gb|AAC79949.1|  6-phosphogluconate dehydrogenase isoenzyme A            295   5e-98    Zea mays [maize]
ref|XP_008803614.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    305   9e-98    Phoenix dactylifera
ref|XP_010920025.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    305   1e-97    Elaeis guineensis
ref|NP_001266302.1|  6-phosphogluconate dehydrogenase isoenzyme B...    305   1e-97    Zea mays [maize]
ref|XP_009399426.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    306   1e-97    
ref|XP_006655710.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    304   2e-97    Oryza brachyantha
ref|XP_008788546.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    304   2e-97    Phoenix dactylifera
ref|XP_004964329.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    303   4e-97    Setaria italica
gb|KDP31431.1|  hypothetical protein JCGZ_11807                         303   4e-97    Jatropha curcas
gb|AHM10416.1|  6-phosphogluconate dehydrogenase                        303   4e-97    Saccharum hybrid cultivar Yacheng05-179
ref|NP_001056586.1|  Os06g0111500                                       303   6e-97    
ref|XP_007139369.1|  hypothetical protein PHAVU_008G023700g             302   1e-96    Phaseolus vulgaris [French bean]
ref|XP_004971196.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    301   2e-96    Setaria italica
ref|NP_001104911.1|  6-phosphogluconate dehydrogenase2                  300   8e-96    
ref|XP_010100892.1|  6-phosphogluconate dehydrogenase                   300   9e-96    Morus notabilis
gb|KJB10517.1|  hypothetical protein B456_001G205600                    300   2e-95    Gossypium raimondii
gb|KJB10518.1|  hypothetical protein B456_001G205600                    299   2e-95    Gossypium raimondii
tpg|DAA55929.1|  TPA: 6-phosphogluconate dehydrogenase2                 298   3e-95    
gb|ACN35899.1|  unknown                                                 298   3e-95    Zea mays [maize]
ref|NP_001104910.1|  NADPH producing dehydrogenase of the oxidati...    298   3e-95    
ref|XP_003557150.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    298   6e-95    Brachypodium distachyon [annual false brome]
gb|AHL19963.1|  6-phosphogluconate dehydrogenase                        297   9e-95    Hibiscus cannabinus [bimli-jute]
emb|CDM86736.1|  unnamed protein product                                297   9e-95    Triticum aestivum [Canadian hard winter wheat]
ref|XP_009117953.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    296   3e-94    Brassica rapa
gb|EMT22120.1|  6-phosphogluconate dehydrogenase, decarboxylating       297   1e-93    
ref|XP_011011766.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    290   5e-92    Populus euphratica
gb|ADP03065.1|  6-phosphogluconate dehydrogenase                        288   3e-91    Pinus sylvestris [Scotch pine]
gb|ADP03058.1|  6-phosphogluconate dehydrogenase                        288   3e-91    Pinus sylvestris [Scotch pine]
gb|ADP03055.1|  6-phosphogluconate dehydrogenase                        288   3e-91    Pinus sylvestris [Scotch pine]
gb|ADP03083.1|  6-phosphogluconate dehydrogenase                        288   3e-91    Pinus sylvestris [Scotch pine]
gb|ADP03059.1|  6-phosphogluconate dehydrogenase                        288   3e-91    Pinus sylvestris [Scotch pine]
gb|ADP03070.1|  6-phosphogluconate dehydrogenase                        288   3e-91    Pinus sylvestris [Scotch pine]
gb|ADP03057.1|  6-phosphogluconate dehydrogenase                        288   3e-91    Pinus sylvestris [Scotch pine]
gb|ADP03318.1|  6-phosphogluconate dehydrogenase                        287   8e-91    Pinus pinaster [cluster pine]
gb|EMT33408.1|  6-phosphogluconate dehydrogenase, decarboxylating       298   8e-91    
gb|AAC79950.1|  6-phosphogluconate dehydrogenase isoenzyme B            273   1e-89    Zea mays [maize]
ref|NP_001236726.1|  6-phosphogluconate dehydrogenase                   284   2e-89    
ref|XP_001764215.1|  predicted protein                                  283   5e-89    
ref|XP_001759464.1|  predicted protein                                  281   2e-88    
ref|XP_001770880.1|  predicted protein                                  281   2e-88    
ref|XP_001785214.1|  predicted protein                                  276   4e-86    
ref|XP_002972874.1|  hypothetical protein SELMODRAFT_98399              271   1e-84    
ref|XP_002305977.2|  hypothetical protein POPTR_0004s10870g             271   1e-84    
ref|XP_010261979.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    271   2e-84    Nelumbo nucifera [Indian lotus]
ref|XP_010273961.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    271   3e-84    Nelumbo nucifera [Indian lotus]
ref|XP_002988062.1|  hypothetical protein SELMODRAFT_127384             269   7e-84    
ref|XP_002966753.1|  hypothetical protein SELMODRAFT_168478             268   2e-83    Selaginella moellendorffii
ref|XP_006856410.1|  hypothetical protein AMTR_s00047p00215210          268   4e-83    Amborella trichopoda
gb|AFF18789.1|  cytosolic 6-phosphogluconate dehydrogenase              255   6e-83    Dimocarpus longan [longan]
ref|XP_006849590.1|  hypothetical protein AMTR_s00024p00196750          266   2e-82    
gb|KEH21177.1|  decarboxylating-like 6-phosphogluconate dehydroge...    265   6e-82    Medicago truncatula
gb|AFF18788.1|  6-phosphogluconate dehydrogenase                        251   1e-81    Dimocarpus longan [longan]
gb|KJB52238.1|  hypothetical protein B456_008G251800                    262   1e-81    Gossypium raimondii
ref|XP_002275970.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    263   2e-81    Vitis vinifera
emb|CAN63456.1|  hypothetical protein VITISV_008240                     263   3e-81    Vitis vinifera
ref|XP_004503648.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    262   6e-81    Cicer arietinum [garbanzo]
ref|XP_007040418.1|  6-phosphogluconate dehydrogenase family prot...    262   6e-81    
ref|XP_008238987.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    262   7e-81    Prunus mume [ume]
ref|XP_009140108.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    261   7e-81    Brassica rapa
gb|AIU64845.1|  6-phosphogluconate dehydrogenase                        261   8e-81    Prunus sibirica [Siberian apricot]
ref|NP_176601.1|  6-phosphogluconate dehydrogenase, decarboxylati...    261   9e-81    Arabidopsis thaliana [mouse-ear cress]
emb|CDY44457.1|  BnaCnng11100D                                          261   9e-81    Brassica napus [oilseed rape]
emb|CDY39725.1|  BnaA04g11280D                                          261   9e-81    Brassica napus [oilseed rape]
ref|XP_010545301.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    261   9e-81    Tarenaya hassleriana [spider flower]
gb|KCW77439.1|  hypothetical protein EUGRSUZ_D01779                     253   1e-80    Eucalyptus grandis [rose gum]
ref|XP_010533610.1|  PREDICTED: LOW QUALITY PROTEIN: 6-phosphoglu...    261   1e-80    
ref|XP_010054765.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    253   1e-80    Eucalyptus grandis [rose gum]
ref|XP_002868582.1|  6-phosphogluconate dehydrogenase family protein    261   2e-80    
ref|XP_004168459.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    261   2e-80    
gb|ACM68927.1|  6-phosphogluconate dehydrogenase                        261   2e-80    Cucumis sativus [cucumbers]
ref|XP_006301732.1|  hypothetical protein CARUB_v10022193mg             260   2e-80    Capsella rubella
ref|XP_007040417.1|  6-phosphogluconate dehydrogenase family prot...    261   2e-80    
ref|XP_002886358.1|  6-phosphogluconate dehydrogenase family protein    260   2e-80    Arabidopsis lyrata subsp. lyrata
ref|XP_008451978.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    260   3e-80    Cucumis melo [Oriental melon]
ref|XP_010430539.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    260   3e-80    Camelina sativa [gold-of-pleasure]
ref|XP_010473675.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    260   3e-80    Camelina sativa [gold-of-pleasure]
emb|CDY25568.1|  BnaC09g11930D                                          260   3e-80    Brassica napus [oilseed rape]
ref|XP_009112895.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    259   3e-80    Brassica rapa
ref|XP_010105006.1|  6-phosphogluconate dehydrogenase                   259   4e-80    Morus notabilis
ref|NP_198982.1|  6-phosphogluconate dehydrogenase, decarboxylati...    259   5e-80    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009336262.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    259   6e-80    Pyrus x bretschneideri [bai li]
ref|XP_004149760.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    259   6e-80    
ref|XP_009334464.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    259   7e-80    Pyrus x bretschneideri [bai li]
ref|XP_010418473.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    259   8e-80    Camelina sativa [gold-of-pleasure]
gb|ACE96470.1|  expressed protein                                       249   1e-79    Populus tremula [European aspen]
gb|ACE96443.1|  expressed protein                                       248   1e-79    Populus tremula [European aspen]
ref|XP_011462415.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    258   1e-79    Fragaria vesca subsp. vesca
gb|ACE96441.1|  expressed protein                                       248   2e-79    Populus tremula [European aspen]
ref|XP_006439417.1|  hypothetical protein CICLE_v10019859mg             258   2e-79    Citrus clementina [clementine]
gb|ACE96440.1|  expressed protein                                       248   2e-79    Populus tremula [European aspen]
ref|XP_006476447.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    258   2e-79    Citrus sinensis [apfelsine]
gb|ACE96439.1|  expressed protein                                       248   2e-79    Populus tremula [European aspen]
ref|XP_002517676.1|  6-phosphogluconate dehydrogenase, putative         258   2e-79    
ref|XP_006476449.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    258   2e-79    Citrus sinensis [apfelsine]
gb|KDO76415.1|  hypothetical protein CISIN_1g010652mg                   258   2e-79    Citrus sinensis [apfelsine]
ref|XP_010447780.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    258   2e-79    Camelina sativa [gold-of-pleasure]
ref|XP_010436115.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    258   2e-79    Camelina sativa [gold-of-pleasure]
gb|KDO76416.1|  hypothetical protein CISIN_1g010652mg                   258   3e-79    Citrus sinensis [apfelsine]
gb|KDO76417.1|  hypothetical protein CISIN_1g010652mg                   258   4e-79    Citrus sinensis [apfelsine]
gb|AAM61057.1|  6-phosphogluconate dehydrogenase                        257   4e-79    Arabidopsis thaliana [mouse-ear cress]
gb|ACE96462.1|  expressed protein                                       247   5e-79    Populus tremula [European aspen]
emb|CDP12110.1|  unnamed protein product                                257   5e-79    Coffea canephora [robusta coffee]
ref|XP_006391656.1|  hypothetical protein EUTSA_v10023427mg             256   6e-79    Eutrema salsugineum [saltwater cress]
ref|XP_004252580.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    256   1e-78    Solanum lycopersicum
ref|XP_011026944.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    256   1e-78    Populus euphratica
ref|XP_003533072.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    256   1e-78    Glycine max [soybeans]
ref|XP_006360699.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    256   1e-78    Solanum tuberosum [potatoes]
ref|XP_002509902.1|  6-phosphogluconate dehydrogenase, putative         256   2e-78    Ricinus communis
gb|KDP25346.1|  hypothetical protein JCGZ_20502                         256   2e-78    Jatropha curcas
ref|XP_008805334.1|  PREDICTED: LOW QUALITY PROTEIN: 6-phosphoglu...    255   2e-78    
ref|XP_007160132.1|  hypothetical protein PHAVU_002G295300g             254   4e-78    Phaseolus vulgaris [French bean]
ref|XP_010441331.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    254   6e-78    Camelina sativa [gold-of-pleasure]
gb|EPS67575.1|  hypothetical protein M569_07199                         254   7e-78    Genlisea aurea
ref|XP_009392493.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    254   9e-78    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010905189.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    253   1e-77    Elaeis guineensis
ref|XP_002304540.1|  6-phosphogluconate dehydrogenase family protein    252   5e-77    Populus trichocarpa [western balsam poplar]
ref|XP_009386035.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    252   5e-77    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011073556.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    251   6e-77    Sesamum indicum [beniseed]
ref|XP_003525354.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    251   7e-77    Glycine max [soybeans]
ref|XP_009789896.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    251   1e-76    Nicotiana sylvestris
ref|XP_002297992.1|  6-phosphogluconate dehydrogenase family protein    250   2e-76    Populus trichocarpa [western balsam poplar]
ref|XP_009626290.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    250   2e-76    Nicotiana tomentosiformis
ref|XP_010917535.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    250   2e-76    Elaeis guineensis
ref|XP_011022562.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    250   3e-76    Populus euphratica
ref|XP_011080880.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    249   4e-76    Sesamum indicum [beniseed]
ref|XP_008811378.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    249   5e-76    Phoenix dactylifera
ref|XP_010676957.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    251   5e-76    Beta vulgaris subsp. vulgaris [field beet]
sp|Q94KU2.1|6PGD2_SPIOL  RecName: Full=6-phosphogluconate dehydro...    249   2e-75    Spinacia oleracea
gb|KFK36587.1|  hypothetical protein AALP_AA4G143200                    245   1e-74    Arabis alpina [alpine rockcress]
gb|EMS64512.1|  6-phosphogluconate dehydrogenase, decarboxylating       245   2e-72    Triticum urartu
ref|XP_007513389.1|  6-phosphogluconate dehydrogenase                   237   5e-71    Bathycoccus prasinos
ref|XP_006286028.1|  hypothetical protein CARUB_v10007559mg             234   1e-70    
ref|XP_001418779.1|  predicted protein                                  234   4e-70    Ostreococcus lucimarinus CCE9901
ref|NP_001241786.1|  6-phosphogluconate dehydrogenase, decarboxyl...    232   2e-69    
gb|AFW60760.1|  putative 6-phosphogluconate dehydrogenase               231   5e-69    
dbj|BAK00156.1|  predicted protein                                      230   2e-68    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFB34823.1|  hypothetical protein UMN_5272_01                        218   2e-68    Pinus mugo [mountain pine]
gb|AFB34821.1|  hypothetical protein UMN_5272_01                        218   2e-68    Pinus mugo [mountain pine]
gb|AEW09340.1|  hypothetical protein UMN_5272_01                        217   7e-68    Pinus radiata
emb|CEF98862.1|  6-phosphogluconate dehydrogenase,decarboxylating       229   9e-68    Ostreococcus tauri
ref|NP_001067912.1|  Os11g0484500                                       228   1e-67    
ref|XP_002449496.1|  hypothetical protein SORBIDRAFT_05g016740          228   1e-67    Sorghum bicolor [broomcorn]
ref|XP_003557402.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    227   2e-67    Brachypodium distachyon [annual false brome]
ref|XP_001696880.1|  6-phosphogluconate dehydrogenase, decarboxyl...    228   2e-67    Chlamydomonas reinhardtii
ref|XP_004979278.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    225   8e-67    Setaria italica
ref|XP_002953515.1|  hypothetical protein VOLCADRAFT_109207             227   1e-66    Volvox carteri f. nagariensis
gb|AFB34817.1|  hypothetical protein UMN_5272_01                        214   1e-66    Abies alba [abete-blanco]
ref|XP_003080519.1|  6-phosphogluconate dehydrogenase (ISS)             229   2e-66    
ref|XP_001696881.1|  6-phosphogluconate dehydrogenase, decarboxyl...    224   2e-66    Chlamydomonas reinhardtii
dbj|BAG32445.1|  6-phosphogluconate dehydrogenase                       223   3e-66    Gloeochaete wittrockiana
ref|XP_004343090.1|  6-phosphogluconate dehydrogenase                   222   9e-66    Capsaspora owczarzaki ATCC 30864
gb|AFB34819.1|  hypothetical protein UMN_5272_01                        209   6e-65    Larix decidua
dbj|BAG32444.1|  6-phosphogluconate dehydrogenase                       219   7e-65    Cyanophora paradoxa
ref|XP_002502811.1|  predicted protein                                  216   5e-63    Micromonas commoda
dbj|BAG32446.1|  6-phosphogluconate dehydrogenase                       213   1e-62    Cyanoptyche gloeocystis
gb|EEE52109.1|  hypothetical protein OsJ_33909                          214   1e-62    Oryza sativa Japonica Group [Japonica rice]
ref|XP_005709029.1|  6-phosphogluconate dehydrogenase (decarboxyl...    216   2e-62    Galdieria sulphuraria
gb|EYU40043.1|  hypothetical protein MIMGU_mgv1a019477mg                211   8e-62    Erythranthe guttata [common monkey flower]
dbj|BAG32441.1|  6-phosphogluconate dehydrogenase                       212   1e-61    Euglena gracilis
gb|AAP33506.2|  cytosolic 6-phosphogluconate dehydrogenase              211   1e-61    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003060927.1|  predicted protein                                  212   1e-61    Micromonas pusilla CCMP1545
gb|EWM28595.1|  6-phosphogluconate dehydrogenase                        211   2e-61    Nannochloropsis gaditana
ref|XP_002289820.1|  6-phosphogluconate dehydrogenase                   210   4e-61    Thalassiosira pseudonana CCMP1335
ref|XP_005651440.1|  decarboxylating 6-phosphogluconate dehydroge...    212   4e-61    Coccomyxa subellipsoidea C-169
emb|CAQ52407.1|  6-phosphogluconate dehydrogenase                       209   6e-61    Laminaria digitata
ref|XP_002681464.1|  6-phosphogluconate dehydrogenase                   209   8e-61    Naegleria gruberi strain NEG-M
emb|CAB61332.1|  6-phosphogluconate dehydrogenase                       209   1e-60    Laminaria digitata
ref|XP_002179525.1|  6-phosphogluconate dehydrogenase                   209   2e-60    Phaeodactylum tricornutum CCAP 1055/1
gb|KDD75074.1|  6-phosphogluconate dehydrogenase                        209   2e-60    Helicosporidium sp. ATCC 50920
ref|XP_011400114.1|  6-phosphogluconate dehydrogenase, decarboxyl...    207   3e-60    Auxenochlorella protothecoides
ref|XP_008872677.1|  6-phosphogluconate dehydrogenase (decarboxyl...    207   8e-60    Aphanomyces invadans
gb|ETL93890.1|  6-phosphogluconate dehydrogenase (decarboxylating)      207   8e-60    Phytophthora parasitica
gb|EJK45824.1|  hypothetical protein THAOC_35540                        203   9e-60    Thalassiosira oceanica
ref|XP_008905173.1|  6-phosphogluconate dehydrogenase (decarboxyl...    206   1e-59    Phytophthora parasitica INRA-310
ref|XP_002179526.1|  6-phosphogluconate dehydrogenase                   206   1e-59    Phaeodactylum tricornutum CCAP 1055/1
ref|XP_002902568.1|  6-phosphogluconate dehydrogenase                   206   1e-59    Phytophthora infestans T30-4
emb|CCA16382.1|  6phosphogluconate dehydrogenase putative               206   2e-59    Albugo laibachii Nc14
ref|XP_007209994.1|  hypothetical protein PRUPE_ppa005270mg             205   2e-59    
emb|CBJ29697.1|  6-phosphogluconate dehydrogenase                       205   5e-59    Ectocarpus siliculosus
ref|XP_009524396.1|  hypothetical protein PHYSODRAFT_557596             204   5e-59    Phytophthora sojae
gb|EJK62811.1|  hypothetical protein THAOC_16563                        203   2e-58    Thalassiosira oceanica
emb|CCI10945.1|  unnamed protein product                                202   3e-58    Albugo candida
ref|XP_009832556.1|  6-phosphogluconate dehydrogenase (decarboxyl...    202   3e-58    Aphanomyces astaci
ref|XP_008610309.1|  6-phosphogluconate dehydrogenase (decarboxyl...    201   2e-57    Saprolegnia diclina VS20
gb|KDO26201.1|  6-phosphogluconate dehydrogenase                        199   5e-57    Saprolegnia parasitica CBS 223.65
ref|WP_009609959.1|  6-phosphogluconate dehydrogenase                   198   1e-56    Caldanaerobacter subterraneus
ref|WP_011026083.1|  6-phosphogluconate dehydrogenase                   198   1e-56    Caldanaerobacter subterraneus
ref|WP_022588483.1|  6-phosphogluconate dehydrogenase                   198   1e-56    Caldanaerobacter subterraneus
gb|EMS57148.1|  6-phosphogluconate dehydrogenase, decarboxylating       198   2e-56    Triticum urartu
gb|AAL76317.1|AF394507_1  6-phosphogluconate dehydrogenase              193   5e-56    Naegleria andersoni
gb|AAL76318.1|AF394508_1  6-phosphogluconate dehydrogenase              194   2e-55    Naegleria gruberi
ref|WP_012995708.1|  6-phosphogluconate dehydrogenase                   194   3e-55    Thermoanaerobacter italicus
ref|WP_013150654.1|  6-phosphogluconate dehydrogenase                   194   3e-55    Thermoanaerobacter mathranii
ref|WP_028991998.1|  6-phosphogluconate dehydrogenase                   194   3e-55    Thermoanaerobacter thermocopriae
dbj|BAD36765.1|  6-phosphogluconate dehydrogenase                       193   1e-53    Cyanidioschyzon merolae
ref|XP_005537109.1|  6-phosphogluconate dehydrogenase                   193   1e-53    Cyanidioschyzon merolae strain 10D
ref|XP_005536718.1|  6-phosphogluconate dehydrogenase                   192   2e-53    Cyanidioschyzon merolae strain 10D
ref|WP_042833553.1|  6-phosphogluconate dehydrogenase                   189   2e-53    Thermoanaerobacter sp. YS13
ref|WP_008192055.1|  MULTISPECIES: 6-phosphogluconate dehydrogenase     189   3e-53    Thermotoga
ref|WP_006569466.1|  6-phosphogluconate dehydrogenase                   189   3e-53    Thermoanaerobacter siderophilus
ref|WP_029689386.1|  6-phosphogluconate dehydrogenase                   189   3e-53    
ref|XP_002260328.1|  6-phosphogluconate dehydrogenase,decarboxyla...    189   4e-53    Plasmodium knowlesi strain H
ref|WP_012310577.1|  MULTISPECIES: 6-phosphogluconate dehydrogenase     187   1e-52    Thermotoga
ref|WP_011943120.1|  6-phosphogluconate dehydrogenase                   187   1e-52    
dbj|BAG32442.1|  6-phosphogluconate dehydrogenase                       187   1e-52    
ref|XP_008814076.1|  6-phosphogluconate dehydrogenase (decarboxyl...    187   2e-52    
ref|WP_004081528.1|  6-phosphogluconate dehydrogenase                   187   2e-52    
ref|WP_012895867.1|  6-phosphogluconate dehydrogenase                   186   4e-52    
ref|WP_012548791.1|  6-phosphogluconate dehydrogenase                   186   4e-52    
ref|WP_041843932.1|  6-phosphogluconate dehydrogenase                   186   6e-52    
ref|WP_038066411.1|  6-phosphogluconate dehydrogenase                   186   6e-52    
gb|ACM22410.1|  6-phosphogluconate dehydrogenase, decarboxylating       185   7e-52    
ref|WP_012582611.1|  6-phosphogluconate dehydrogenase                   185   7e-52    
ref|XP_745765.1|  6-phosphogluconate dehydrogenase, decarboxylating     185   9e-52    
emb|CDR15451.1|  6-phosphogluconate dehydrogenase, decarboxylatin...    185   1e-51    
ref|WP_038033579.1|  MULTISPECIES: 6-phosphogluconate dehydrogenase     185   1e-51    
ref|WP_004404778.1|  MULTISPECIES: 6-phosphogluconate dehydrogena...    185   1e-51    
ref|WP_014063253.1|  6-phosphogluconate dehydrogenase                   184   1e-51    
ref|WP_003866631.1|  6-phosphogluconate dehydrogenase                   184   2e-51    
ref|XP_008622096.1|  6-phosphogluconate dehydrogenase (decarboxyl...    184   2e-51    
ref|XP_680159.1|  6-phosphogluconate dehydrogenase, decarboxylating     184   2e-51    
emb|CDS50254.1|  6-phosphogluconate dehydrogenase, decarboxylatin...    184   2e-51    
ref|XP_001615843.1|  6-phosphogluconate dehydrogenase, decarboxyl...    184   2e-51    
emb|CBI27441.3|  unnamed protein product                                174   3e-51    
gb|EUD71418.1|  6-phosphogluconate dehydrogenase (decarboxylating)      184   3e-51    
ref|WP_009052747.1|  MULTISPECIES: 6-phosphogluconate dehydrogenase     183   4e-51    
gb|AAL76321.1|AF394511_1  6-phosphogluconate dehydrogenase              182   6e-51    
gb|EEC79860.1|  hypothetical protein OsI_21345                          183   7e-51    
ref|XP_727409.1|  6-phosphogluconate dehydrogenase                      182   1e-50    
gb|EUR62398.1|  6-phosphogluconate dehydrogenase (decarboxylating)      181   3e-50    
ref|XP_001348694.1|  6-phosphogluconate dehydrogenase, decarboxyl...    181   3e-50    
ref|WP_015312449.1|  6-phosphogluconate dehydrogenase, decarboxyl...    181   4e-50    
ref|WP_013298810.1|  6-phosphogluconate dehydrogenase                   181   4e-50    
gb|AAL76319.1|AF394509_1  6-phosphogluconate dehydrogenase              180   4e-50    
ref|WP_021828275.1|  MULTISPECIES: 6-phosphogluconate dehydrogenase     180   6e-50    
ref|XP_002185945.1|  G6PDH/6PGDH fusion protein                         185   6e-50    
ref|XP_004223987.1|  6-phosphogluconate dehydrogenase decarboxyla...    178   2e-49    
ref|WP_031505071.1|  6-phosphogluconate dehydrogenase                   179   2e-49    
ref|WP_007328138.1|  6-phosphogluconate dehydrogenase                   179   3e-49    
emb|CDI83931.1|  6-phosphogluconate dehydrogenase, putative             175   3e-49    
ref|WP_007335167.1|  6-phosphogluconate dehydrogenase                   179   3e-49    
ref|WP_008655870.1|  6-phosphogluconate dehydrogenase, decarboxyl...    179   3e-49    
ref|WP_011119037.1|  6-phosphogluconate dehydrogenase                   179   3e-49    
ref|WP_007339488.1|  6-phosphogluconate dehydrogenase, decarboxyl...    179   3e-49    
ref|WP_039729172.1|  MULTISPECIES: 6-phosphogluconate dehydrogenase     178   6e-49    
gb|AHK63107.1|  6-phosphogluconate dehydrogenase, decarboxylating       177   6e-49    
emb|CDY34406.1|  BnaA09g11480D                                          167   6e-49    
ref|WP_011458128.1|  6-phosphogluconate dehydrogenase                   177   7e-49    
ref|WP_008668939.1|  6-phosphogluconate dehydrogenase, decarboxyl...    177   9e-49    
ref|WP_011141117.1|  6-phosphogluconate dehydrogenase                   177   9e-49    
ref|WP_041083056.1|  6-phosphogluconate dehydrogenase                   177   1e-48    
ref|WP_011006394.1|  6-phosphogluconate dehydrogenase                   177   1e-48    
ref|WP_041077363.1|  6-phosphogluconate dehydrogenase                   177   1e-48    
gb|ACS24987.1|  6-phosphogluconate dehydrogenase, decarboxylating       177   1e-48    
ref|WP_025601829.1|  hypothetical protein                               169   2e-48    
ref|WP_015183400.1|  6-phosphogluconate dehydrogenase                   176   2e-48    
ref|WP_038500275.1|  6-phosphogluconate dehydrogenase                   176   2e-48    
ref|WP_033885463.1|  6-phosphogluconate dehydrogenase                   169   2e-48    
ref|WP_010230184.1|  6-phosphogluconate dehydrogenase                   176   3e-48    
ref|WP_015218502.1|  6-phosphogluconate dehydrogenase                   176   3e-48    
ref|WP_012002921.1|  MULTISPECIES: 6-phosphogluconate dehydrogenase     176   3e-48    
ref|WP_035469547.1|  6-phosphogluconate dehydrogenase                   176   4e-48    
ref|WP_020356123.1|  6-phosphogluconate dehydrogenase                   176   4e-48    
emb|CDZ79546.1|  6-phosphogluconate dehydrogenase, NADP(+)-depend...    176   4e-48    
ref|WP_020960457.1|  6-phosphogluconate dehydrogenase                   175   4e-48    
gb|AGY57488.1|  6-phosphogluconate dehydrogenase                        175   5e-48    
ref|WP_041269706.1|  6-phosphogluconate dehydrogenase                   175   5e-48    
ref|WP_013788784.1|  6-phosphogluconate dehydrogenase                   175   6e-48    
ref|WP_007305738.1|  6-phosphogluconate dehydrogenase                   174   9e-48    
gb|EED06433.1|  6-phosphogluconate dehydrogenase, decarboxylating       175   9e-48    
ref|XP_007160131.1|  hypothetical protein PHAVU_002G295200g             171   1e-47    
ref|WP_033016466.1|  6-phosphogluconate dehydrogenase                   174   1e-47    
ref|WP_011231826.1|  6-phosphogluconate dehydrogenase                   174   1e-47    
gb|ACB53094.1|  6-phosphogluconate dehydrogenase                        175   1e-47    
ref|WP_041244422.1|  6-phosphogluconate dehydrogenase                   174   1e-47    
ref|WP_042382474.1|  6-phosphogluconate dehydrogenase                   174   1e-47    
ref|WP_015506596.1|  6-phosphogluconate dehydrogenase                   174   1e-47    
gb|ETW28151.1|  6-phosphogluconate dehydrogenase (decarboxylating)      174   1e-47    
ref|WP_013932410.1|  6-phosphogluconate dehydrogenase                   174   1e-47    
ref|WP_033009036.1|  MULTISPECIES: 6-phosphogluconate dehydrogenase     174   1e-47    
ref|WP_009873531.1|  6-phosphogluconate dehydrogenase                   174   1e-47    
ref|WP_031408437.1|  6-phosphogluconate dehydrogenase                   174   1e-47    
ref|WP_023633514.1|  6-phosphogluconate dehydrogenase                   174   1e-47    
ref|WP_033844132.1|  6-phosphogluconate dehydrogenase                   174   1e-47    
ref|WP_020755289.1|  MULTISPECIES: 6-phosphogluconate dehydrogenase     174   1e-47    
ref|WP_015375340.1|  6-phosphogluconate dehydrogenase                   174   1e-47    
ref|WP_014196285.1|  MULTISPECIES: 6-phosphogluconate dehydrogenase     174   1e-47    
ref|WP_043905384.1|  6-phosphogluconate dehydrogenase                   174   1e-47    
ref|WP_015143759.1|  6-phosphogluconate dehydrogenase                   174   1e-47    
ref|WP_012810440.1|  6-phosphogluconate dehydrogenase                   174   1e-47    
ref|WP_009873031.1|  6-phosphogluconate dehydrogenase                   174   1e-47    
ref|WP_003249346.1|  MULTISPECIES: 6-phosphogluconate dehydrogenase     174   2e-47    
ref|WP_026073246.1|  6-phosphogluconate dehydrogenase                   174   2e-47    
ref|WP_044730912.1|  6-phosphogluconate dehydrogenase                   174   2e-47    
ref|WP_017305533.1|  6-phosphogluconate dehydrogenase                   174   2e-47    
ref|WP_033023567.1|  6-phosphogluconate dehydrogenase                   173   2e-47    
ref|WP_026587774.1|  6-phosphogluconate dehydrogenase                   173   2e-47    
gb|AEJ43046.1|  6-phosphogluconate dehydrogenase, decarboxylating       174   2e-47    
pdb|2W90|A  Chain A, Geobacillus Stearothermophilus 6-Phosphogluc...    173   2e-47    
ref|WP_017713841.1|  6-phosphogluconate dehydrogenase                   173   2e-47    
gb|EHL73831.1|  6-phosphogluconate dehydrogenase, decarboxylating 2     173   3e-47    
ref|WP_017435253.1|  6-phosphogluconate dehydrogenase                   173   3e-47    
pdb|2W8Z|A  Chain A, Geobacillus Stearothermophilus 6-Phosphogluc...    173   3e-47    
ref|WP_041695712.1|  6-phosphogluconate dehydrogenase                   173   3e-47    
ref|WP_044390365.1|  6-phosphogluconate dehydrogenase                   173   3e-47    
ref|WP_009051959.1|  MULTISPECIES: 6-phosphogluconate dehydrogenase     173   3e-47    
ref|WP_012269743.1|  MULTISPECIES: 6-phosphogluconate dehydrogenase     173   3e-47    
gb|AAV65350.1|  plastid 6-phosphogluconate 2-dehydrogenase              174   3e-47    
ref|WP_012820646.1|  MULTISPECIES: 6-phosphogluconate dehydrogenase     172   4e-47    
ref|WP_008273861.1|  6-phosphogluconate dehydrogenase                   173   4e-47    
ref|WP_009545097.1|  MULTISPECIES: 6-phosphogluconate dehydrogenase     172   4e-47    
ref|WP_035405560.1|  6-phosphogluconate dehydrogenase                   173   4e-47    
ref|WP_006669299.1|  MULTISPECIES: 6-phosphogluconate dehydrogenase     172   4e-47    
ref|WP_021756584.1|  6-phosphogluconate dehydrogenase, decarboxyl...    172   5e-47    
ref|WP_008879769.1|  MULTISPECIES: 6-phosphogluconate dehydrogenase     172   5e-47    
ref|WP_028991997.1|  6-phosphogluconate dehydrogenase                   172   5e-47    
ref|WP_044747917.1|  6-phosphogluconate dehydrogenase                   172   5e-47    
ref|WP_006626188.1|  6-phosphogluconate dehydrogenase                   172   5e-47    
gb|AFF18854.1|  6-phosphogluconate dehydrogenase                        163   5e-47    
gb|KIA77379.1|  hypothetical protein DB43_GK00100                       165   6e-47    
ref|WP_015506153.1|  6-phosphogluconate dehydrogenase                   172   6e-47    
ref|WP_004097883.1|  6-phosphogluconate dehydrogenase                   172   6e-47    
ref|WP_012874785.1|  6-phosphogluconate dehydrogenase                   172   6e-47    
ref|WP_011324548.1|  6-phosphogluconate dehydrogenase                   172   6e-47    
ref|XP_003885663.1|  6-phosphogluconate dehydrogenase, decarboxyl...    173   6e-47    
ref|WP_012994341.1|  6-phosphogluconate dehydrogenase                   172   6e-47    
ref|WP_014315982.1|  6-phosphogluconate dehydrogenase                   172   6e-47    
ref|WP_009872355.1|  6-phosphogluconate dehydrogenase                   172   6e-47    
ref|WP_010725014.1|  6-phosphogluconate dehydrogenase                   172   6e-47    
ref|WP_036487934.1|  6-phosphogluconate dehydrogenase                   172   6e-47    
ref|WP_012728040.1|  6-phosphogluconate dehydrogenase                   172   6e-47    
ref|WP_006637460.1|  6-phosphogluconate dehydrogenase                   172   7e-47    
ref|WP_044340081.1|  6-phosphogluconate dehydrogenase                   172   7e-47    
ref|WP_012954080.1|  6-phosphogluconate dehydrogenase                   172   7e-47    
ref|WP_015192371.1|  6-phosphogluconate dehydrogenase, decarboxyl...    172   8e-47    
emb|CBK22626.2|  unnamed protein product                                172   8e-47    
ref|WP_035996428.1|  6-phosphogluconate dehydrogenase                   172   9e-47    
ref|WP_034661210.1|  6-phosphogluconate dehydrogenase                   172   9e-47    
ref|WP_006529013.1|  6-phosphogluconate dehydrogenase, decarboxyl...    172   1e-46    
gb|EEC79859.1|  hypothetical protein OsI_21344                          161   1e-46    
ref|WP_025910295.1|  6-phosphogluconate dehydrogenase                   171   1e-46    
ref|WP_039179776.1|  6-phosphogluconate dehydrogenase                   171   1e-46    
ref|WP_040341911.1|  6-phosphogluconate dehydrogenase                   171   1e-46    
ref|WP_014757113.1|  MULTISPECIES: 6-phosphogluconate dehydrogenase     171   1e-46    
ref|WP_026794863.1|  MULTISPECIES: 6-phosphogluconate dehydrogenase     171   1e-46    
ref|WP_026788582.1|  MULTISPECIES: 6-phosphogluconate dehydrogenase     171   1e-46    
ref|WP_020452102.1|  MULTISPECIES: NADP+-dependent 6-P-gluconate ...    171   1e-46    
ref|WP_003394229.1|  6-phosphogluconate dehydrogenase                   171   1e-46    
ref|WP_042155473.1|  6-phosphogluconate dehydrogenase                   171   1e-46    
ref|WP_041967959.1|  6-phosphogluconate dehydrogenase                   171   1e-46    
gb|EJT46444.1|  phosphogluconate dehydrogenase (decarboxylating)        171   2e-46    
ref|WP_025948594.1|  6-phosphogluconate dehydrogenase                   171   2e-46    
gb|AFS27994.1|  6-phosphogluconate dehydrogenase, decarboxylating       171   2e-46    
ref|WP_011097055.1|  6-phosphogluconate dehydrogenase                   171   2e-46    
ref|WP_006344066.1|  6-phosphogluconate dehydrogenase                   171   2e-46    
ref|XP_008889473.1|  6-phosphogluconate dehydrogenase                   171   2e-46    
ref|WP_011611465.1|  6-phosphogluconate dehydrogenase                   171   2e-46    
ref|WP_034319791.1|  6-phosphogluconate dehydrogenase                   171   2e-46    
ref|WP_006619367.1|  6-phosphogluconate dehydrogenase                   171   2e-46    
ref|WP_020370046.1|  MULTISPECIES: 6-phosphogluconate dehydrogenase     171   2e-46    
dbj|BAD67774.1|  putative phosphogluconate dehydrogenase                169   2e-46    
ref|WP_003183299.1|  MULTISPECIES: 6-phosphogluconate dehydrogenase     171   2e-46    
ref|WP_017716214.1|  6-phosphogluconate dehydrogenase                   171   2e-46    
ref|WP_040948521.1|  6-phosphogluconate dehydrogenase                   171   2e-46    
ref|WP_034758126.1|  6-phosphogluconate dehydrogenase                   171   2e-46    
ref|WP_008678388.1|  6-phosphogluconate dehydrogenase, decarboxyl...    171   2e-46    
gb|KFN92506.1|  6-phosphogluconate dehydrogenase, decarboxylating       167   2e-46    
ref|WP_003215871.1|  6-phosphogluconate dehydrogenase                   171   2e-46    
emb|CCJ31454.1|  unnamed protein product                                173   2e-46    
ref|WP_009871411.1|  6-phosphogluconate dehydrogenase                   171   2e-46    
emb|CBK24405.2|  unnamed protein product                                171   3e-46    
ref|WP_044141026.1|  6-phosphogluconate dehydrogenase                   171   3e-46    
ref|WP_015132636.1|  6-phosphogluconate dehydrogenase                   171   3e-46    
ref|WP_016886716.1|  6-phosphogluconate dehydrogenase                   170   3e-46    
gb|KIL70626.1|  hypothetical protein M378DRAFT_155567                   171   3e-46    
ref|WP_016594541.1|  hypothetical protein                               162   3e-46    
ref|WP_029419400.1|  6-phosphogluconate dehydrogenase                   170   3e-46    
ref|WP_043968384.1|  6-phosphogluconate dehydrogenase                   170   3e-46    
ref|WP_041638168.1|  6-phosphogluconate dehydrogenase                   170   3e-46    
ref|WP_015403596.1|  6-phosphogluconate dehydrogenase (decarboxyl...    171   3e-46    
gb|AFS21151.1|  6-phosphogluconate dehydrogenase, decarboxylating       171   3e-46    
ref|WP_006102718.1|  6-phosphogluconate dehydrogenase                   170   3e-46    
ref|WP_010883003.1|  6-phosphogluconate dehydrogenase                   170   4e-46    
gb|AFS26906.1|  6-phosphogluconate dehydrogenase, decarboxylating       170   4e-46    
ref|WP_015065735.1|  6-phosphogluconate dehydrogenase,decarboxyla...    170   4e-46    
ref|WP_044237456.1|  6-phosphogluconate dehydrogenase                   170   4e-46    
ref|WP_040933845.1|  6-phosphogluconate dehydrogenase                   170   4e-46    
ref|WP_035992882.1|  6-phosphogluconate dehydrogenase                   170   4e-46    
ref|WP_041460315.1|  6-phosphogluconate dehydrogenase                   170   4e-46    
ref|WP_040944808.1|  6-phosphogluconate dehydrogenase                   170   4e-46    
ref|WP_018400058.1|  6-phosphogluconate dehydrogenase                   170   4e-46    
ref|WP_032099984.1|  6-phosphogluconate dehydrogenase                   170   4e-46    
ref|WP_004889642.1|  6-phosphogluconate dehydrogenase,decarboxyla...    170   4e-46    
gb|EPJ24793.1|  6-phosphogluconate dehydrogenase                        170   4e-46    
ref|WP_034280291.1|  6-phosphogluconate dehydrogenase                   170   4e-46    
ref|WP_012010492.1|  6-phosphogluconate dehydrogenase                   170   4e-46    
ref|WP_025093007.1|  6-phosphogluconate dehydrogenase                   170   4e-46    
ref|WP_024428028.1|  MULTISPECIES: 6-phosphogluconate dehydrogenase     170   4e-46    
ref|WP_032740648.1|  6-phosphogluconate dehydrogenase                   170   4e-46    
ref|WP_034622350.1|  6-phosphogluconate dehydrogenase                   170   4e-46    
ref|WP_041086071.1|  6-phosphogluconate dehydrogenase                   170   4e-46    
ref|WP_028579242.1|  6-phosphogluconate dehydrogenase                   170   4e-46    
gb|AAX26733.2|  SJCHGC05652 protein                                     166   4e-46    
ref|WP_024422907.1|  6-phosphogluconate dehydrogenase                   170   4e-46    
ref|WP_040055125.1|  6-phosphogluconate dehydrogenase                   170   4e-46    
ref|WP_015130850.1|  6-phosphogluconate dehydrogenase                   170   5e-46    
gb|AGE75018.1|  6-phosphogluconate dehydrogenase                        170   5e-46    
ref|WP_042534346.1|  6-phosphogluconate dehydrogenase                   170   5e-46    
ref|WP_019714886.1|  6-phosphogluconate dehydrogenase                   170   5e-46    
ref|WP_021095873.1|  6-phosphogluconate dehydrogenase                   170   5e-46    
ref|WP_006343110.1|  6-phosphogluconate dehydrogenase                   170   5e-46    
emb|CEG24957.1|  6-phosphogluconate dehydrogenase                       170   5e-46    
gb|AFS24827.1|  6-phosphogluconate dehydrogenase, decarboxylating       170   5e-46    
ref|WP_006318084.1|  6-phosphogluconate dehydrogenase                   170   5e-46    
ref|WP_041460225.1|  6-phosphogluconate dehydrogenase                   170   5e-46    
ref|XP_010941448.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    162   5e-46    
ref|WP_006511144.1|  6-phosphogluconate dehydrogenase, decarboxyl...    170   5e-46    
ref|WP_013462654.1|  6-phosphogluconate dehydrogenase                   170   5e-46    
ref|WP_038459101.1|  MULTISPECIES: 6-phosphogluconate dehydrogenase     169   6e-46    
ref|WP_017367561.1|  6-phosphogluconate dehydrogenase                   169   6e-46    
ref|WP_003325524.1|  MULTISPECIES: 6-phosphogluconate dehydrogenase     169   6e-46    
ref|WP_009373845.1|  6-phosphogluconate dehydrogenase                   169   6e-46    
ref|WP_006978115.1|  6-phosphogluconate dehydrogenase                   170   6e-46    
ref|WP_007408395.1|  MULTISPECIES: 6-phosphogluconate dehydrogenase     169   6e-46    



>ref|XP_009774328.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Nicotiana sylvestris]
 ref|XP_009774330.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Nicotiana sylvestris]
 ref|XP_009774331.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Nicotiana sylvestris]
Length=485

 Score =   328 bits (842),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 157/167 (94%), Positives = 164/167 (98%), Gaps = 0/167 (0%)
 Frame = +2

Query  179  MATPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHD  358
            MA+PTRIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETVERAK EG+LPLYGFHD
Sbjct  1    MASPTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKKEGDLPLYGFHD  60

Query  359  PESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVA  538
            PESF+ SIQKPRV+IILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKE+A
Sbjct  61   PESFVNSIQKPRVIIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEMA  120

Query  539  ELGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            ELGLLYLGMGVSGGEEGAR GPSLMPGGSFEAYKYIEDI+LKVAAQV
Sbjct  121  ELGLLYLGMGVSGGEEGARNGPSLMPGGSFEAYKYIEDILLKVAAQV  167



>ref|XP_006348606.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like [Solanum tuberosum]
Length=485

 Score =   327 bits (839),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 157/167 (94%), Positives = 163/167 (98%), Gaps = 0/167 (0%)
 Frame = +2

Query  179  MATPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHD  358
            MATPTRIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETVERAK EGNLPLYGFHD
Sbjct  1    MATPTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKKEGNLPLYGFHD  60

Query  359  PESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVA  538
            PESF+ SIQKPRV+IILVKAGAPVDQTIKTLS+YMEKGDCIIDGGNEWYENTERREKE+A
Sbjct  61   PESFVLSIQKPRVIIILVKAGAPVDQTIKTLSSYMEKGDCIIDGGNEWYENTERREKEMA  120

Query  539  ELGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            ELGL YLGMGVSGGEEGAR GPSLMPGGSFEAYKYIEDI+LKVAAQV
Sbjct  121  ELGLRYLGMGVSGGEEGARNGPSLMPGGSFEAYKYIEDILLKVAAQV  167



>ref|XP_009610999.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like [Nicotiana tomentosiformis]
 ref|XP_009611000.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like [Nicotiana tomentosiformis]
 ref|XP_009611001.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like [Nicotiana tomentosiformis]
Length=485

 Score =   327 bits (839),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 157/167 (94%), Positives = 163/167 (98%), Gaps = 0/167 (0%)
 Frame = +2

Query  179  MATPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHD  358
            MA+PTRIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETVERAK EG+LPLYGFHD
Sbjct  1    MASPTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKKEGDLPLYGFHD  60

Query  359  PESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVA  538
            PESF+ SIQKPRV IILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKE+A
Sbjct  61   PESFVNSIQKPRVTIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEMA  120

Query  539  ELGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            ELGLLYLGMGVSGGEEGAR GPSLMPGGSFEAYKYIEDI+LKVAAQV
Sbjct  121  ELGLLYLGMGVSGGEEGARNGPSLMPGGSFEAYKYIEDILLKVAAQV  167



>ref|XP_004238989.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Solanum lycopersicum]
Length=485

 Score =   327 bits (838),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 157/167 (94%), Positives = 163/167 (98%), Gaps = 0/167 (0%)
 Frame = +2

Query  179  MATPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHD  358
            MATPTRIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETVERAK EGNLPLYGFHD
Sbjct  1    MATPTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKNEGNLPLYGFHD  60

Query  359  PESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVA  538
            PESF+ SIQKPRV+IILVKAGAPVDQTIKTLS+YMEKGDCIIDGGNEWYENTERREKE+A
Sbjct  61   PESFVLSIQKPRVIIILVKAGAPVDQTIKTLSSYMEKGDCIIDGGNEWYENTERREKEMA  120

Query  539  ELGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            ELGL YLGMGVSGGEEGAR GPSLMPGGSFEAYKYIEDI+LKVAAQV
Sbjct  121  ELGLRYLGMGVSGGEEGARNGPSLMPGGSFEAYKYIEDILLKVAAQV  167



>ref|XP_004237068.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like [Solanum lycopersicum]
 ref|XP_010319490.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like [Solanum lycopersicum]
Length=485

 Score =   325 bits (832),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 155/167 (93%), Positives = 163/167 (98%), Gaps = 0/167 (0%)
 Frame = +2

Query  179  MATPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHD  358
            MATPTRIGLAGLAVMGQNLALNIA+KGFPISVYNR+TSKVDETVERAK EGNLPLYGFHD
Sbjct  1    MATPTRIGLAGLAVMGQNLALNIAEKGFPISVYNRSTSKVDETVERAKKEGNLPLYGFHD  60

Query  359  PESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVA  538
            PESF+ SIQKPRV+IILVKAG PVDQTIKTLSA+MEKGDCIIDGGNEWYENTERREKE+A
Sbjct  61   PESFVLSIQKPRVIIILVKAGLPVDQTIKTLSAFMEKGDCIIDGGNEWYENTERREKEMA  120

Query  539  ELGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            ELGLLYLGMGVSGGEEGAR GPS+MPGGSFEAYKYIEDI+LKVAAQV
Sbjct  121  ELGLLYLGMGVSGGEEGARNGPSMMPGGSFEAYKYIEDILLKVAAQV  167



>gb|KEH21786.1| decarboxylating-like 6-phosphogluconate dehydrogenase [Medicago 
truncatula]
Length=486

 Score =   325 bits (832),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 157/168 (93%), Positives = 164/168 (98%), Gaps = 1/168 (1%)
 Frame = +2

Query  179  MATP-TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFH  355
            MA P TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAK EGNLPLYGFH
Sbjct  1    MAQPLTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKQEGNLPLYGFH  60

Query  356  DPESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEV  535
            DPE+F+ SIQKPRV+I+LVKAGAPVDQTIKTLSAY+EKGDCIIDGGNEWYENTERREKEV
Sbjct  61   DPEAFVNSIQKPRVIIMLVKAGAPVDQTIKTLSAYLEKGDCIIDGGNEWYENTERREKEV  120

Query  536  AELGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            AELGLLYLGMGVSGGEEGARRGPS+MPGGSFEAYKYIEDI+LKVAAQV
Sbjct  121  AELGLLYLGMGVSGGEEGARRGPSMMPGGSFEAYKYIEDILLKVAAQV  168



>ref|XP_006363551.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like isoform X1 [Solanum tuberosum]
 ref|XP_006363552.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like isoform X2 [Solanum tuberosum]
Length=485

 Score =   323 bits (828),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 154/167 (92%), Positives = 163/167 (98%), Gaps = 0/167 (0%)
 Frame = +2

Query  179  MATPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHD  358
            MATPTRIGLAGLAVMGQNLALNIA+KGFPISVYNR+TSKVDETVERAK EGNLPLYGFHD
Sbjct  1    MATPTRIGLAGLAVMGQNLALNIAEKGFPISVYNRSTSKVDETVERAKKEGNLPLYGFHD  60

Query  359  PESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVA  538
            PESF+ SIQKPRV+IILVKAG PVDQTIKTLSA+M+KGDCIIDGGNEWYENTERREKE+A
Sbjct  61   PESFVLSIQKPRVIIILVKAGLPVDQTIKTLSAFMDKGDCIIDGGNEWYENTERREKEMA  120

Query  539  ELGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            ELGLLYLGMGVSGGEEGAR GPS+MPGGSFEAYKYIEDI+LKVAAQV
Sbjct  121  ELGLLYLGMGVSGGEEGARNGPSMMPGGSFEAYKYIEDILLKVAAQV  167



>ref|XP_009619672.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1 [Nicotiana tomentosiformis]
 ref|XP_009619673.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1 [Nicotiana tomentosiformis]
 ref|XP_009619674.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1 [Nicotiana tomentosiformis]
Length=484

 Score =   323 bits (828),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 156/167 (93%), Positives = 162/167 (97%), Gaps = 0/167 (0%)
 Frame = +2

Query  179  MATPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHD  358
            MATPTRIGLAGLAVMGQNLALNIA+KGFPISVYNR+TSKVDETVERAK EGNLPLYGFHD
Sbjct  1    MATPTRIGLAGLAVMGQNLALNIAEKGFPISVYNRSTSKVDETVERAKKEGNLPLYGFHD  60

Query  359  PESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVA  538
            PESF+ SIQKPRV+IILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKE+A
Sbjct  61   PESFVLSIQKPRVIIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEMA  120

Query  539  ELGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            E GLLYLGMGVSGGEEGAR GPSLMPGGSFEAYK IEDI+LKVAAQV
Sbjct  121  EKGLLYLGMGVSGGEEGARNGPSLMPGGSFEAYKNIEDILLKVAAQV  167



>ref|XP_009773713.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1 [Nicotiana sylvestris]
 ref|XP_009773720.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1 [Nicotiana sylvestris]
 ref|XP_009773725.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1 [Nicotiana sylvestris]
Length=484

 Score =   323 bits (827),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 156/167 (93%), Positives = 162/167 (97%), Gaps = 0/167 (0%)
 Frame = +2

Query  179  MATPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHD  358
            MATPTRIGLAGLAVMGQNLALNIA+KGFPISVYNR+TSKVDETVERAK EGNLPLYGFHD
Sbjct  1    MATPTRIGLAGLAVMGQNLALNIAEKGFPISVYNRSTSKVDETVERAKKEGNLPLYGFHD  60

Query  359  PESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVA  538
            PESF+ SIQKPRV+IILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKE+A
Sbjct  61   PESFVLSIQKPRVIIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEMA  120

Query  539  ELGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            E GLLYLGMGVSGGEEGAR GPSLMPGGSFEAYK IEDI+LKVAAQV
Sbjct  121  EKGLLYLGMGVSGGEEGARNGPSLMPGGSFEAYKNIEDILLKVAAQV  167



>ref|XP_006379723.1| hypothetical protein POPTR_0008s112802g, partial [Populus trichocarpa]
 gb|ERP57520.1| hypothetical protein POPTR_0008s112802g, partial [Populus trichocarpa]
Length=185

 Score =   311 bits (798),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 151/167 (90%), Positives = 160/167 (96%), Gaps = 0/167 (0%)
 Frame = +2

Query  179  MATPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHD  358
            MA  TRIGLAGLAVMGQNLALNIA+KGFPISVYNRTT KVDETVERAK EG+LPLYGFHD
Sbjct  1    MAPLTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTLKVDETVERAKQEGDLPLYGFHD  60

Query  359  PESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVA  538
            PESF++SIQKPRV+IILVKAGAPVDQTIKTLS YMEKGDCIIDGGNEWYENTERREK +A
Sbjct  61   PESFVKSIQKPRVIIILVKAGAPVDQTIKTLSVYMEKGDCIIDGGNEWYENTERREKALA  120

Query  539  ELGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            ELGLLYLGMGVSGGE+GAR GPSLMPGGSFEAYK+IEDI+LKVAAQV
Sbjct  121  ELGLLYLGMGVSGGEDGARHGPSLMPGGSFEAYKHIEDILLKVAAQV  167



>gb|KJB22742.1| hypothetical protein B456_004G063900 [Gossypium raimondii]
 gb|KJB22743.1| hypothetical protein B456_004G063900 [Gossypium raimondii]
Length=485

 Score =   319 bits (818),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 152/167 (91%), Positives = 163/167 (98%), Gaps = 0/167 (0%)
 Frame = +2

Query  179  MATPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHD  358
            MA PTRIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETVERAK EG+LP+YGFHD
Sbjct  1    MAPPTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKKEGDLPVYGFHD  60

Query  359  PESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVA  538
            PESF++SIQKPRVVI+LVKAGAPVDQTIKTLSAY+EKGDCIIDGGNEWYENTERR+KE++
Sbjct  61   PESFVQSIQKPRVVIMLVKAGAPVDQTIKTLSAYLEKGDCIIDGGNEWYENTERRQKEMS  120

Query  539  ELGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
             LGLLYLGMGVSGGEEGAR GPSLMPGGSFEAYKYIEDI+LKVAAQV
Sbjct  121  ALGLLYLGMGVSGGEEGARNGPSLMPGGSFEAYKYIEDILLKVAAQV  167



>ref|XP_010261653.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like isoform X3 [Nelumbo nucifera]
Length=486

 Score =   319 bits (817),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 154/168 (92%), Positives = 162/168 (96%), Gaps = 1/168 (1%)
 Frame = +2

Query  179  MATP-TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFH  355
            MA P TRIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETVERAK EGNLPLYGFH
Sbjct  1    MAVPLTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKREGNLPLYGFH  60

Query  356  DPESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEV  535
            DPESF+RSIQ+PRV+I+LVKAGAPVDQTIKTLS YMEKGDCIIDGGNEWYENTERREK +
Sbjct  61   DPESFVRSIQRPRVIIMLVKAGAPVDQTIKTLSVYMEKGDCIIDGGNEWYENTERREKAM  120

Query  536  AELGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            AELGLLYLGMGVSGGEEGAR GPSLMPGGSF+AYKYIEDI+LKVAAQV
Sbjct  121  AELGLLYLGMGVSGGEEGARNGPSLMPGGSFQAYKYIEDILLKVAAQV  168



>ref|XP_010261649.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like isoform X2 [Nelumbo nucifera]
Length=490

 Score =   319 bits (817),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 154/168 (92%), Positives = 162/168 (96%), Gaps = 1/168 (1%)
 Frame = +2

Query  179  MATP-TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFH  355
            MA P TRIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETVERAK EGNLPLYGFH
Sbjct  1    MAVPLTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKREGNLPLYGFH  60

Query  356  DPESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEV  535
            DPESF+RSIQ+PRV+I+LVKAGAPVDQTIKTLS YMEKGDCIIDGGNEWYENTERREK +
Sbjct  61   DPESFVRSIQRPRVIIMLVKAGAPVDQTIKTLSVYMEKGDCIIDGGNEWYENTERREKAM  120

Query  536  AELGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            AELGLLYLGMGVSGGEEGAR GPSLMPGGSF+AYKYIEDI+LKVAAQV
Sbjct  121  AELGLLYLGMGVSGGEEGARNGPSLMPGGSFQAYKYIEDILLKVAAQV  168



>ref|XP_006601856.1| PREDICTED: 6-phosphogluconate dehydrogenase isoform X1 [Glycine 
max]
 gb|KHN13784.1| 6-phosphogluconate dehydrogenase, decarboxylating [Glycine soja]
Length=486

 Score =   318 bits (815),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 154/168 (92%), Positives = 163/168 (97%), Gaps = 1/168 (1%)
 Frame = +2

Query  179  MATPT-RIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFH  355
            MA PT RIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETVERAK EGNLP+YG+H
Sbjct  1    MAQPTTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKQEGNLPVYGYH  60

Query  356  DPESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEV  535
            DPE+F+ SIQKPRV+I+LVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEV
Sbjct  61   DPEAFVHSIQKPRVIIMLVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEV  120

Query  536  AELGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            AELGLLYLGMGVSGGEEGAR GPSLMPGGSFEA+KYIEDI+LKVAAQV
Sbjct  121  AELGLLYLGMGVSGGEEGARNGPSLMPGGSFEAFKYIEDILLKVAAQV  168



>ref|XP_010261635.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like isoform X1 [Nelumbo nucifera]
 ref|XP_010261644.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like isoform X1 [Nelumbo nucifera]
Length=511

 Score =   319 bits (817),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 154/168 (92%), Positives = 162/168 (96%), Gaps = 1/168 (1%)
 Frame = +2

Query  179  MATP-TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFH  355
            MA P TRIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETVERAK EGNLPLYGFH
Sbjct  1    MAVPLTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKREGNLPLYGFH  60

Query  356  DPESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEV  535
            DPESF+RSIQ+PRV+I+LVKAGAPVDQTIKTLS YMEKGDCIIDGGNEWYENTERREK +
Sbjct  61   DPESFVRSIQRPRVIIMLVKAGAPVDQTIKTLSVYMEKGDCIIDGGNEWYENTERREKAM  120

Query  536  AELGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            AELGLLYLGMGVSGGEEGAR GPSLMPGGSF+AYKYIEDI+LKVAAQV
Sbjct  121  AELGLLYLGMGVSGGEEGARNGPSLMPGGSFQAYKYIEDILLKVAAQV  168



>ref|XP_010257854.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Nelumbo nucifera]
Length=486

 Score =   318 bits (815),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 154/168 (92%), Positives = 162/168 (96%), Gaps = 1/168 (1%)
 Frame = +2

Query  179  MATP-TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFH  355
            MA P TRIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETVERAK EGNLPLYGFH
Sbjct  1    MAAPLTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKQEGNLPLYGFH  60

Query  356  DPESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEV  535
            DPE+F++SIQKPRV+IILVKAGAPVDQTIKTLS YMEKGDCIIDGGNEWYENTERR++ V
Sbjct  61   DPEAFVQSIQKPRVIIILVKAGAPVDQTIKTLSVYMEKGDCIIDGGNEWYENTERRQEAV  120

Query  536  AELGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            AELGLLYLGMGVSGGEEGAR GPSLMPGGSFEAYKYIEDI+LKVAAQV
Sbjct  121  AELGLLYLGMGVSGGEEGARNGPSLMPGGSFEAYKYIEDILLKVAAQV  168



>ref|XP_007032950.1| 6-phosphogluconate dehydrogenase family protein isoform 3, partial 
[Theobroma cacao]
 gb|EOY03876.1| 6-phosphogluconate dehydrogenase family protein isoform 3, partial 
[Theobroma cacao]
Length=476

 Score =   318 bits (814),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = +2

Query  143  ILSAPN*LEENSMATPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAK  322
            I+   + L   +MA PTRIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETVERAK
Sbjct  9    IIEKSDFLRFGNMAPPTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAK  68

Query  323  AEGNLPLYGFHDPESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEW  502
             EG+LP++GFHDPESF++SIQKPRV+I+LVKAGAPVDQTIKTLS YMEKGDCIIDGGNEW
Sbjct  69   QEGDLPVFGFHDPESFVQSIQKPRVIIMLVKAGAPVDQTIKTLSKYMEKGDCIIDGGNEW  128

Query  503  YENTERREKEVAELGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            YENTERR K +AELGLLYLGMGVSGGEEGAR GPSLMPGGSFEAYKYIEDI+LKVAAQV
Sbjct  129  YENTERRAKAMAELGLLYLGMGVSGGEEGARNGPSLMPGGSFEAYKYIEDILLKVAAQV  187



>gb|KDP24308.1| hypothetical protein JCGZ_25604 [Jatropha curcas]
Length=488

 Score =   318 bits (814),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 152/164 (93%), Positives = 161/164 (98%), Gaps = 0/164 (0%)
 Frame = +2

Query  188  PTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPES  367
            PTRIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETVERAK EG+LPLYGFHDPE+
Sbjct  7    PTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKREGDLPLYGFHDPEA  66

Query  368  FIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELG  547
            F++SIQKPRV+I+LVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREK +AELG
Sbjct  67   FVQSIQKPRVIIMLVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKAMAELG  126

Query  548  LLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LLYLGMGVSGGEEGAR GPSLMPGGSFEAYKYIEDI+LKVAAQV
Sbjct  127  LLYLGMGVSGGEEGARNGPSLMPGGSFEAYKYIEDILLKVAAQV  170



>ref|XP_008341826.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Malus domestica]
Length=488

 Score =   317 bits (813),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 151/164 (92%), Positives = 160/164 (98%), Gaps = 0/164 (0%)
 Frame = +2

Query  188  PTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPES  367
            PTRIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETVERAK EGNLPLYGFHDPES
Sbjct  7    PTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKKEGNLPLYGFHDPES  66

Query  368  FIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELG  547
            F++SIQKPRVVI+LVKAGAPVDQTIKTLS Y+EKGDCIIDGGNEWYENTERREK +AELG
Sbjct  67   FVKSIQKPRVVIMLVKAGAPVDQTIKTLSVYLEKGDCIIDGGNEWYENTERREKAMAELG  126

Query  548  LLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LLYLGMGVSGGEEGAR GPS+MPGGSFEAYKYIEDI+LKV+AQV
Sbjct  127  LLYLGMGVSGGEEGARYGPSMMPGGSFEAYKYIEDILLKVSAQV  170



>ref|XP_004491970.1| PREDICTED: LOW QUALITY PROTEIN: 6-phosphogluconate dehydrogenase, 
decarboxylating 3-like [Cicer arietinum]
Length=493

 Score =   317 bits (812),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 153/170 (90%), Positives = 163/170 (96%), Gaps = 3/170 (2%)
 Frame = +2

Query  179  MATPT---RIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYG  349
            MA PT   RIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAK EGNLPLYG
Sbjct  1    MAQPTELTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKQEGNLPLYG  60

Query  350  FHDPESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREK  529
            FHDP++F+ SIQKPRV+I+LVKAGAPVDQTIKTLS ++EKGDCIIDGGNEWYENTERREK
Sbjct  61   FHDPKAFVESIQKPRVIIMLVKAGAPVDQTIKTLSVFLEKGDCIIDGGNEWYENTERREK  120

Query  530  EVAELGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            EVAELGLLYLGMGVSGGEEGARRGPS+MPGGSFEAYK+IEDI+LKVAAQV
Sbjct  121  EVAELGLLYLGMGVSGGEEGARRGPSMMPGGSFEAYKHIEDILLKVAAQV  170



>ref|XP_010463641.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like [Camelina sativa]
Length=538

 Score =   318 bits (816),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 152/171 (89%), Positives = 161/171 (94%), Gaps = 0/171 (0%)
 Frame = +2

Query  167  EENSMATPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLY  346
            EE     PTRIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETVERAK EGNLPLY
Sbjct  50   EEIMAVQPTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKKEGNLPLY  109

Query  347  GFHDPESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERRE  526
            GFHDPESF++SIQKPRV+I+LVKAGAPVDQTIKTLSAY+EKGDCI+DGGNEWYENT+RRE
Sbjct  110  GFHDPESFVKSIQKPRVIIMLVKAGAPVDQTIKTLSAYLEKGDCIVDGGNEWYENTDRRE  169

Query  527  KEVAELGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            K VAE G LYLGMGVSGGEEGAR GPS+MPGGSFEAYKYIEDIVLKVAAQV
Sbjct  170  KAVAENGFLYLGMGVSGGEEGARNGPSMMPGGSFEAYKYIEDIVLKVAAQV  220



>ref|XP_009373738.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Pyrus x bretschneideri]
Length=488

 Score =   317 bits (812),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 151/164 (92%), Positives = 160/164 (98%), Gaps = 0/164 (0%)
 Frame = +2

Query  188  PTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPES  367
            PTRIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETVERAK EGNLPLYGFHDPES
Sbjct  7    PTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKKEGNLPLYGFHDPES  66

Query  368  FIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELG  547
            F++SIQKPRVVI+LVKAGAPVDQTIKTLS Y+EKGDCIIDGGNEWYENTERREK +AELG
Sbjct  67   FVKSIQKPRVVIMLVKAGAPVDQTIKTLSVYLEKGDCIIDGGNEWYENTERREKAMAELG  126

Query  548  LLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LLYLGMGVSGGEEGAR GPS+MPGGSFEAYKYIEDI+LKV+AQV
Sbjct  127  LLYLGMGVSGGEEGARYGPSMMPGGSFEAYKYIEDILLKVSAQV  170



>ref|XP_003531895.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like isoform 1 [Glycine max]
 gb|KHN14455.1| 6-phosphogluconate dehydrogenase, decarboxylating [Glycine soja]
Length=486

 Score =   317 bits (811),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 153/168 (91%), Positives = 162/168 (96%), Gaps = 1/168 (1%)
 Frame = +2

Query  179  MATP-TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFH  355
            MA P TRIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETVERAK EGNLP+YG+H
Sbjct  1    MAQPSTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKQEGNLPVYGYH  60

Query  356  DPESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEV  535
            DPE+F+ SIQKPRV+I+LVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREK V
Sbjct  61   DPEAFVHSIQKPRVIIMLVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKSV  120

Query  536  AELGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            AELGLLYLGMGVSGGEEGAR GPSLMPGGSFEA+KYIEDI+LKVAAQV
Sbjct  121  AELGLLYLGMGVSGGEEGARNGPSLMPGGSFEAFKYIEDILLKVAAQV  168



>ref|XP_004304174.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Fragaria vesca subsp. vesca]
Length=488

 Score =   317 bits (811),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 151/165 (92%), Positives = 160/165 (97%), Gaps = 0/165 (0%)
 Frame = +2

Query  185  TPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPE  364
             PTRIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETVERAK EGNLPLYGFHDPE
Sbjct  6    NPTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKKEGNLPLYGFHDPE  65

Query  365  SFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAEL  544
            SF++SIQKPRVVI+LVKAGAPVDQTIKTLS Y+EKGDCIIDGGNEWYENTERREK +AEL
Sbjct  66   SFVKSIQKPRVVIMLVKAGAPVDQTIKTLSVYLEKGDCIIDGGNEWYENTERREKAMAEL  125

Query  545  GLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            GLLYLGMGVSGGEEGAR GPS+MPGGSFEAYKYIEDI+LKV+AQV
Sbjct  126  GLLYLGMGVSGGEEGARYGPSMMPGGSFEAYKYIEDILLKVSAQV  170



>ref|XP_002270984.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Vitis vinifera]
 ref|XP_010654343.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Vitis vinifera]
Length=485

 Score =   317 bits (811),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 151/167 (90%), Positives = 160/167 (96%), Gaps = 0/167 (0%)
 Frame = +2

Query  179  MATPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHD  358
            MA  +RIGL+GLAVMGQNLALNIA+KGFPISVYNRTTSKVDETVERAK EGNLPLYGFHD
Sbjct  1    MAPVSRIGLSGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKQEGNLPLYGFHD  60

Query  359  PESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVA  538
            PESF+ SIQKPRV+I+LVKAGAPVDQTIKTLS Y+EKGDCIIDGGNEWYENTERREK +A
Sbjct  61   PESFVNSIQKPRVIIMLVKAGAPVDQTIKTLSGYLEKGDCIIDGGNEWYENTERREKAMA  120

Query  539  ELGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            ELGLLYLGMGVSGGEEGAR GPSLMPGGSFEAYKYIEDI+LKVAAQV
Sbjct  121  ELGLLYLGMGVSGGEEGARHGPSLMPGGSFEAYKYIEDILLKVAAQV  167



>ref|XP_007032948.1| 6-phosphogluconate dehydrogenase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY03874.1| 6-phosphogluconate dehydrogenase family protein isoform 1 [Theobroma 
cacao]
Length=485

 Score =   316 bits (810),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 151/167 (90%), Positives = 161/167 (96%), Gaps = 0/167 (0%)
 Frame = +2

Query  179  MATPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHD  358
            MA PTRIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETVERAK EG+LP++GFHD
Sbjct  1    MAPPTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKQEGDLPVFGFHD  60

Query  359  PESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVA  538
            PESF++SIQKPRV+I+LVKAGAPVDQTIKTLS YMEKGDCIIDGGNEWYENTERR K +A
Sbjct  61   PESFVQSIQKPRVIIMLVKAGAPVDQTIKTLSKYMEKGDCIIDGGNEWYENTERRAKAMA  120

Query  539  ELGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            ELGLLYLGMGVSGGEEGAR GPSLMPGGSFEAYKYIEDI+LKVAAQV
Sbjct  121  ELGLLYLGMGVSGGEEGARNGPSLMPGGSFEAYKYIEDILLKVAAQV  167



>ref|XP_002530803.1| 6-phosphogluconate dehydrogenase, putative [Ricinus communis]
 gb|EEF31571.1| 6-phosphogluconate dehydrogenase, putative [Ricinus communis]
Length=488

 Score =   316 bits (810),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 151/164 (92%), Positives = 160/164 (98%), Gaps = 0/164 (0%)
 Frame = +2

Query  188  PTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPES  367
            PTRIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETVERAK EG+LPLYGFHDPES
Sbjct  7    PTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKREGDLPLYGFHDPES  66

Query  368  FIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELG  547
            F++SIQKPRV+I+LVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREK +A+LG
Sbjct  67   FVKSIQKPRVIIMLVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKAMADLG  126

Query  548  LLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            L YLGMGVSGGEEGAR GPSLMPGGSFEAYKYIEDI+LKVAAQV
Sbjct  127  LQYLGMGVSGGEEGARNGPSLMPGGSFEAYKYIEDILLKVAAQV  170



>ref|XP_010029445.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1 [Eucalyptus grandis]
 gb|KCW56359.1| hypothetical protein EUGRSUZ_I02092 [Eucalyptus grandis]
Length=487

 Score =   316 bits (810),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 149/166 (90%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = +2

Query  182  ATPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDP  361
            + PTRIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETVERAK EGNLP+YGFHDP
Sbjct  5    SQPTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKVEGNLPVYGFHDP  64

Query  362  ESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAE  541
            ESF+ S+QKPRV+I+LVKAGAPVDQTIKTLSA+MEKGDCIIDGGNEWYENTERREK +AE
Sbjct  65   ESFVNSVQKPRVIIMLVKAGAPVDQTIKTLSAHMEKGDCIIDGGNEWYENTERREKAMAE  124

Query  542  LGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LGLLYLGMGVSGGEEGAR GPSLMPGGSF+AYKYIEDI++KVAAQV
Sbjct  125  LGLLYLGMGVSGGEEGARNGPSLMPGGSFDAYKYIEDILVKVAAQV  170



>ref|XP_007032949.1| 6-phosphogluconate dehydrogenase family protein isoform 2, partial 
[Theobroma cacao]
 gb|EOY03875.1| 6-phosphogluconate dehydrogenase family protein isoform 2, partial 
[Theobroma cacao]
Length=486

 Score =   316 bits (809),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 151/167 (90%), Positives = 161/167 (96%), Gaps = 0/167 (0%)
 Frame = +2

Query  179  MATPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHD  358
            MA PTRIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETVERAK EG+LP++GFHD
Sbjct  1    MAPPTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKQEGDLPVFGFHD  60

Query  359  PESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVA  538
            PESF++SIQKPRV+I+LVKAGAPVDQTIKTLS YMEKGDCIIDGGNEWYENTERR K +A
Sbjct  61   PESFVQSIQKPRVIIMLVKAGAPVDQTIKTLSKYMEKGDCIIDGGNEWYENTERRAKAMA  120

Query  539  ELGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            ELGLLYLGMGVSGGEEGAR GPSLMPGGSFEAYKYIEDI+LKVAAQV
Sbjct  121  ELGLLYLGMGVSGGEEGARNGPSLMPGGSFEAYKYIEDILLKVAAQV  167



>ref|XP_011085569.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Sesamum indicum]
Length=489

 Score =   315 bits (808),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 150/163 (92%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
            TRIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETVERAK EGNLP++GFHDPESF
Sbjct  9    TRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKVEGNLPVFGFHDPESF  68

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            ++SIQKPRV+++LVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREK +AELGL
Sbjct  69   VQSIQKPRVIVMLVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKAMAELGL  128

Query  551  LYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LYLGMGVSGGEEGAR GPSLMPGGSFEAYKYIEDI+LKVAAQV
Sbjct  129  LYLGMGVSGGEEGARNGPSLMPGGSFEAYKYIEDILLKVAAQV  171



>ref|XP_011099073.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Sesamum indicum]
 ref|XP_011099074.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Sesamum indicum]
 ref|XP_011099075.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Sesamum indicum]
 ref|XP_011099076.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Sesamum indicum]
Length=487

 Score =   315 bits (808),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 151/163 (93%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
            TRIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDET ERAKAEGNLP++GFHDPESF
Sbjct  9    TRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETTERAKAEGNLPVFGFHDPESF  68

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            ++SIQKPRV+I+LVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREK + ELGL
Sbjct  69   VQSIQKPRVIIMLVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKAMTELGL  128

Query  551  LYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LYLGMGVSGGEEGAR GPSLMPGGSFEAYKYIEDIVLKVAAQV
Sbjct  129  LYLGMGVSGGEEGARNGPSLMPGGSFEAYKYIEDIVLKVAAQV  171



>gb|AAB41553.1| 6-phosphogluconate dehydrogenase [Medicago sativa]
Length=486

 Score =   315 bits (807),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 152/168 (90%), Positives = 162/168 (96%), Gaps = 1/168 (1%)
 Frame = +2

Query  179  MATP-TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFH  355
            MA P TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAK EGNLPLYGFH
Sbjct  1    MAPPLTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKQEGNLPLYGFH  60

Query  356  DPESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEV  535
            DPE+F+ SI+KPRV+I+LVKAGAPV+QT KTLSAY+EKGDCIIDG NEWYENTERREKEV
Sbjct  61   DPEAFVNSIEKPRVIIMLVKAGAPVEQTTKTLSAYLEKGDCIIDGDNEWYENTERREKEV  120

Query  536  AELGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            AELG+LYLGMGVSGGEEGARRGPS+MPGGSFEAYKYIEDI+LKVAAQV
Sbjct  121  AELGILYLGMGVSGGEEGARRGPSMMPGGSFEAYKYIEDILLKVAAQV  168



>gb|KCW56358.1| hypothetical protein EUGRSUZ_I02092 [Eucalyptus grandis]
Length=496

 Score =   315 bits (806),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 149/166 (90%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = +2

Query  182  ATPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDP  361
            + PTRIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETVERAK EGNLP+YGFHDP
Sbjct  5    SQPTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKVEGNLPVYGFHDP  64

Query  362  ESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAE  541
            ESF+ S+QKPRV+I+LVKAGAPVDQTIKTLSA+MEKGDCIIDGGNEWYENTERREK +AE
Sbjct  65   ESFVNSVQKPRVIIMLVKAGAPVDQTIKTLSAHMEKGDCIIDGGNEWYENTERREKAMAE  124

Query  542  LGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LGLLYLGMGVSGGEEGAR GPSLMPGGSF+AYKYIEDI++KVAAQV
Sbjct  125  LGLLYLGMGVSGGEEGARNGPSLMPGGSFDAYKYIEDILVKVAAQV  170



>ref|XP_009378306.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like [Pyrus x bretschneideri]
 ref|XP_009378308.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like [Pyrus x bretschneideri]
Length=488

 Score =   314 bits (805),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 149/164 (91%), Positives = 160/164 (98%), Gaps = 0/164 (0%)
 Frame = +2

Query  188  PTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPES  367
            PTRIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETVERAK EGNLPLYGFHDP+S
Sbjct  7    PTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKKEGNLPLYGFHDPQS  66

Query  368  FIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELG  547
            F++SIQKPRVVI+LVKAGAPVDQTIKTLS ++EKGDCIIDGGNEWYENTERREK +AELG
Sbjct  67   FVKSIQKPRVVIMLVKAGAPVDQTIKTLSVHLEKGDCIIDGGNEWYENTERREKAMAELG  126

Query  548  LLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LLYLGMGVSGGEEGAR GPS+MPGGSFEAYKYIEDI+LKV+AQV
Sbjct  127  LLYLGMGVSGGEEGARYGPSMMPGGSFEAYKYIEDILLKVSAQV  170



>gb|KDO70202.1| hypothetical protein CISIN_1g0115012mg [Citrus sinensis]
Length=484

 Score =   314 bits (804),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 150/163 (92%), Positives = 158/163 (97%), Gaps = 0/163 (0%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
            TRIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETVERAK EGNLPLYGFHDPESF
Sbjct  4    TRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKQEGNLPLYGFHDPESF  63

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            + SIQKPRV+I+LVKAG+PVDQTIKTLS YMEKGDCIIDGGNEWYENTERR+K VAELGL
Sbjct  64   VHSIQKPRVIIMLVKAGSPVDQTIKTLSVYMEKGDCIIDGGNEWYENTERRQKAVAELGL  123

Query  551  LYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LYLGMGVSGGEEGAR GPSLMPGGSFEAYK+IEDI+LKVAAQV
Sbjct  124  LYLGMGVSGGEEGARYGPSLMPGGSFEAYKHIEDILLKVAAQV  166



>ref|XP_006484295.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like [Citrus sinensis]
Length=484

 Score =   314 bits (804),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 150/163 (92%), Positives = 158/163 (97%), Gaps = 0/163 (0%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
            TRIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETVERAK EGNLPLYGFHDPESF
Sbjct  4    TRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKQEGNLPLYGFHDPESF  63

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            + SIQKPRV+I+LVKAG+PVDQTIKTLS YMEKGDCIIDGGNEWYENTERR+K VAELGL
Sbjct  64   VHSIQKPRVIIMLVKAGSPVDQTIKTLSVYMEKGDCIIDGGNEWYENTERRQKAVAELGL  123

Query  551  LYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LYLGMGVSGGEEGAR GPSLMPGGSFEAYK+IEDI+LKVAAQV
Sbjct  124  LYLGMGVSGGEEGARYGPSLMPGGSFEAYKHIEDILLKVAAQV  166



>ref|XP_008379478.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Malus domestica]
 ref|XP_008379479.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Malus domestica]
Length=488

 Score =   314 bits (804),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 149/164 (91%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = +2

Query  188  PTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPES  367
            P+RIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETVERAK EGNLPLYGFHDPES
Sbjct  7    PSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKKEGNLPLYGFHDPES  66

Query  368  FIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELG  547
            F++SIQKPRVVI+LVKAG PVDQTIKTLS Y+EKGDCIIDGGNEWYENTERREK +AELG
Sbjct  67   FVKSIQKPRVVIMLVKAGVPVDQTIKTLSVYLEKGDCIIDGGNEWYENTERREKAMAELG  126

Query  548  LLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LLYLGMGVSGGEEGAR GPS+MPGGSFEAYKYIEDI+LKV+AQV
Sbjct  127  LLYLGMGVSGGEEGARYGPSMMPGGSFEAYKYIEDILLKVSAQV  170



>emb|CDP00510.1| unnamed protein product [Coffea canephora]
Length=485

 Score =   313 bits (803),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 149/167 (89%), Positives = 159/167 (95%), Gaps = 0/167 (0%)
 Frame = +2

Query  179  MATPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHD  358
            MATPTRIGL GLAVMGQNLALNIA+KGFPISVYNRTTSKVDETVERAK EGNLP++GFHD
Sbjct  1    MATPTRIGLCGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKLEGNLPVFGFHD  60

Query  359  PESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVA  538
            PE+F++SIQKPRV+IILVKAG+PVDQTIKTLSAYMEKGDCIIDGGNEWYENTERR K V 
Sbjct  61   PEAFVQSIQKPRVIIILVKAGSPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERRAKAVN  120

Query  539  ELGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            E GLLYLGMGVSGGEEGAR GPSLMPGGSFE +KYIEDI+LKVAAQV
Sbjct  121  EKGLLYLGMGVSGGEEGARHGPSLMPGGSFEGFKYIEDILLKVAAQV  167



>ref|XP_002305978.2| phosphogluconate dehydrogenase family protein [Populus trichocarpa]
 gb|EEE86489.2| phosphogluconate dehydrogenase family protein [Populus trichocarpa]
Length=488

 Score =   314 bits (804),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 148/164 (90%), Positives = 161/164 (98%), Gaps = 0/164 (0%)
 Frame = +2

Query  188  PTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPES  367
            PTRIGLAGLAVMGQNLALNIA+KGFPISVYNR+TSKVDETVERAK EG+LPLYGFHDPES
Sbjct  7    PTRIGLAGLAVMGQNLALNIAEKGFPISVYNRSTSKVDETVERAKKEGDLPLYGFHDPES  66

Query  368  FIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELG  547
            F++SIQKPRV+I+LVKAG+PVDQTIKTLSAY+EKGDCIIDGGNEWYENTERREK +AELG
Sbjct  67   FVKSIQKPRVIIMLVKAGSPVDQTIKTLSAYLEKGDCIIDGGNEWYENTERREKAMAELG  126

Query  548  LLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LLYLGMGVSGGEEGAR GPS+MPGGSFEA+KYIEDI+LKVAAQV
Sbjct  127  LLYLGMGVSGGEEGARNGPSMMPGGSFEAFKYIEDILLKVAAQV  170



>ref|XP_008459418.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Cucumis melo]
 ref|XP_008459420.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Cucumis melo]
Length=487

 Score =   313 bits (803),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 152/170 (89%), Positives = 163/170 (96%), Gaps = 3/170 (2%)
 Frame = +2

Query  179  MATP---TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYG  349
            MA P   TRIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETVERAKAEGNLPLYG
Sbjct  1    MAAPGKLTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKAEGNLPLYG  60

Query  350  FHDPESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREK  529
            FHDPESF++SIQKPRV+I+LVKAGAPVDQTIKTLSAY+EKGDCIIDGGNEWYENTERREK
Sbjct  61   FHDPESFVQSIQKPRVIIMLVKAGAPVDQTIKTLSAYLEKGDCIIDGGNEWYENTERREK  120

Query  530  EVAELGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
             +AELGLLYLGMGVSGGEEGAR GPSLMPGGS+EA+K IEDI++KVAAQV
Sbjct  121  AMAELGLLYLGMGVSGGEEGARNGPSLMPGGSYEAFKNIEDILVKVAAQV  170



>ref|XP_011021140.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Populus euphratica]
 ref|XP_011021141.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Populus euphratica]
Length=488

 Score =   313 bits (801),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 149/164 (91%), Positives = 160/164 (98%), Gaps = 0/164 (0%)
 Frame = +2

Query  188  PTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPES  367
            PTRIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETV RAK EG+LPLYGFHDPES
Sbjct  7    PTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVVRAKKEGDLPLYGFHDPES  66

Query  368  FIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELG  547
            F++SIQKPRV+I+LVKAG+PVDQTIKTLSAY+EKGDCIIDGGNEWYENTERREK +AELG
Sbjct  67   FVKSIQKPRVIIMLVKAGSPVDQTIKTLSAYLEKGDCIIDGGNEWYENTERREKAMAELG  126

Query  548  LLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LLYLGMGVSGGEEGAR GPSLMPGGSFEA+KYIEDI+LKVAAQV
Sbjct  127  LLYLGMGVSGGEEGARNGPSLMPGGSFEAFKYIEDILLKVAAQV  170



>ref|XP_004141482.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating-like 
[Cucumis sativus]
 ref|XP_004171525.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating-like 
[Cucumis sativus]
 gb|KGN52541.1| hypothetical protein Csa_5G642720 [Cucumis sativus]
Length=487

 Score =   313 bits (801),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 149/164 (91%), Positives = 160/164 (98%), Gaps = 0/164 (0%)
 Frame = +2

Query  188  PTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPES  367
            PTRIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPES
Sbjct  7    PTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPES  66

Query  368  FIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELG  547
            F++SIQKPRV+I+LVKAGAPVDQTIKTLSAY+EKGDCIIDGGNEWYENTERREK + ELG
Sbjct  67   FVQSIQKPRVIIMLVKAGAPVDQTIKTLSAYLEKGDCIIDGGNEWYENTERREKAMGELG  126

Query  548  LLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LLYLGMGVSGGEEGAR GPSLMPGGS+EA+K IEDI++KVAAQV
Sbjct  127  LLYLGMGVSGGEEGARNGPSLMPGGSYEAFKNIEDILVKVAAQV  170



>ref|XP_007045684.1| 6-phosphogluconate dehydrogenase family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007045685.1| 6-phosphogluconate dehydrogenase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY01516.1| 6-phosphogluconate dehydrogenase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY01517.1| 6-phosphogluconate dehydrogenase family protein isoform 1 [Theobroma 
cacao]
Length=485

 Score =   313 bits (801),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 150/167 (90%), Positives = 158/167 (95%), Gaps = 0/167 (0%)
 Frame = +2

Query  179  MATPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHD  358
            M   TRIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETVERAK EGNLPLYGFHD
Sbjct  1    MVGLTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKQEGNLPLYGFHD  60

Query  359  PESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVA  538
            PESF+ SIQKPRV+I+LVKAG PVDQTIKTLS Y+EKGDCIIDGGNEWYENTERREK +A
Sbjct  61   PESFVHSIQKPRVIIMLVKAGPPVDQTIKTLSVYLEKGDCIIDGGNEWYENTERREKAMA  120

Query  539  ELGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            ELGLLYLGMGVSGGEEGAR GPSLMPGGS+EAYKYIEDI+LKVAAQV
Sbjct  121  ELGLLYLGMGVSGGEEGARHGPSLMPGGSYEAYKYIEDILLKVAAQV  167



>ref|XP_010549952.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Tarenaya hassleriana]
 gb|ABD96861.1| hypothetical protein [Cleome spinosa]
Length=485

 Score =   313 bits (801),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 150/164 (91%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = +2

Query  188  PTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPES  367
            PTRIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETVERAK EGNLP+YGFHDPES
Sbjct  5    PTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKREGNLPVYGFHDPES  64

Query  368  FIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELG  547
            F+ SIQKPRV+I+LVKAGAPVDQTIKTLSAYME+GDCIIDGGNEWYENTERREK V E G
Sbjct  65   FVNSIQKPRVIIMLVKAGAPVDQTIKTLSAYMEEGDCIIDGGNEWYENTERREKAVTEQG  124

Query  548  LLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LLYLGMGVSGGEEGAR GPSLMPGGS+EAYKYIEDI+LKVAAQV
Sbjct  125  LLYLGMGVSGGEEGARNGPSLMPGGSYEAYKYIEDILLKVAAQV  168



>ref|XP_006373519.1| phosphogluconate dehydrogenase family protein [Populus trichocarpa]
 gb|ERP51316.1| phosphogluconate dehydrogenase family protein [Populus trichocarpa]
Length=488

 Score =   312 bits (800),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 149/164 (91%), Positives = 160/164 (98%), Gaps = 0/164 (0%)
 Frame = +2

Query  188  PTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPES  367
            PTRIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETV RAK EG+LPLYGFHDPES
Sbjct  7    PTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVVRAKKEGDLPLYGFHDPES  66

Query  368  FIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELG  547
            F++SIQKPRVVI+LVKAG+PVDQTIKTLSAY+EKGDCIIDGGNEWYENTERREK +AELG
Sbjct  67   FVKSIQKPRVVIMLVKAGSPVDQTIKTLSAYLEKGDCIIDGGNEWYENTERREKAMAELG  126

Query  548  LLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LLYLGMGVSGGEEGAR GPS+MPGGSFEA+KYIEDI+LKVAAQV
Sbjct  127  LLYLGMGVSGGEEGARNGPSMMPGGSFEAFKYIEDILLKVAAQV  170



>ref|XP_002882225.1| 6-phosphogluconate dehydrogenase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH58484.1| 6-phosphogluconate dehydrogenase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=486

 Score =   312 bits (800),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 149/164 (91%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = +2

Query  188  PTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPES  367
            PTRIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETVERAK EGNLPLYGFHDPES
Sbjct  5    PTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKKEGNLPLYGFHDPES  64

Query  368  FIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELG  547
            F++SIQKPRV+I+LVKAGAPVDQTIKTLSAY+EKGDCI+DGGNEWYENTERREK VAE G
Sbjct  65   FVKSIQKPRVIIMLVKAGAPVDQTIKTLSAYLEKGDCIVDGGNEWYENTERREKAVAENG  124

Query  548  LLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
             LYLGMGVSGGEEGAR GPS+MPGGS+EAYK IEDIVLKVAAQV
Sbjct  125  FLYLGMGVSGGEEGARNGPSMMPGGSYEAYKNIEDIVLKVAAQV  168



>ref|XP_010091678.1| 6-phosphogluconate dehydrogenase [Morus notabilis]
 gb|EXB44944.1| 6-phosphogluconate dehydrogenase [Morus notabilis]
Length=485

 Score =   312 bits (800),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 149/167 (89%), Positives = 159/167 (95%), Gaps = 0/167 (0%)
 Frame = +2

Query  179  MATPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHD  358
            M  P RIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETVERAK EGNLPLYGFHD
Sbjct  1    MVGPIRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKQEGNLPLYGFHD  60

Query  359  PESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVA  538
            PESF++SIQKPRV+I+LVKAG PVDQTIKTLS Y+EKGDCIIDGGNEWYENTERREK +A
Sbjct  61   PESFVQSIQKPRVIIMLVKAGPPVDQTIKTLSVYLEKGDCIIDGGNEWYENTERREKAMA  120

Query  539  ELGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            ELGLLYLGMGVSGGEEGAR GPSLMPGGSF+AY+YIEDI+LKVAAQV
Sbjct  121  ELGLLYLGMGVSGGEEGARNGPSLMPGGSFKAYEYIEDILLKVAAQV  167



>ref|XP_006297535.1| hypothetical protein CARUB_v10013557mg [Capsella rubella]
 gb|EOA30433.1| hypothetical protein CARUB_v10013557mg [Capsella rubella]
Length=486

 Score =   312 bits (800),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 149/164 (91%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = +2

Query  188  PTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPES  367
            PTRIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETVERAK EGNLPLYGFHDPES
Sbjct  5    PTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKKEGNLPLYGFHDPES  64

Query  368  FIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELG  547
            F++SIQKPRV+I+LVKAGAPVDQTIKTLSAY+EKGDCI+DGGNEWYENTERREK VAE G
Sbjct  65   FVKSIQKPRVIIMLVKAGAPVDQTIKTLSAYLEKGDCIVDGGNEWYENTERREKAVAENG  124

Query  548  LLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
             LYLGMGVSGGEEGAR GPS+MPGGS+EAYK IEDIVLKVAAQV
Sbjct  125  FLYLGMGVSGGEEGARNGPSMMPGGSYEAYKNIEDIVLKVAAQV  168



>emb|CDY34724.1| BnaA01g33010D [Brassica napus]
Length=404

 Score =   309 bits (792),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 148/164 (90%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = +2

Query  188  PTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPES  367
            PTRIGLAGLAVMGQNLALNIA KGFPISVYNRTTSKVDETVERAK EGNLP+YGFHDPES
Sbjct  5    PTRIGLAGLAVMGQNLALNIASKGFPISVYNRTTSKVDETVERAKKEGNLPVYGFHDPES  64

Query  368  FIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELG  547
            F+ SIQKPRV+I+LVKAGAPVDQTIKTLSAY+EKGDCI+DGGNEWYENTERREK VAE G
Sbjct  65   FVNSIQKPRVIIMLVKAGAPVDQTIKTLSAYLEKGDCIVDGGNEWYENTERREKAVAENG  124

Query  548  LLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
             LYLGMGVSGGEEGAR GPS+MPGGSFEAYK IEDI+LKVAAQV
Sbjct  125  FLYLGMGVSGGEEGARNGPSMMPGGSFEAYKNIEDILLKVAAQV  168



>ref|NP_186885.1| 6-phosphogluconate dehydrogenase, decarboxylating 3 [Arabidopsis 
thaliana]
 ref|NP_850502.1| 6-phosphogluconate dehydrogenase, decarboxylating 3 [Arabidopsis 
thaliana]
 sp|Q9FWA3.1|6GPD3_ARATH RecName: Full=6-phosphogluconate dehydrogenase, decarboxylating 
3 [Arabidopsis thaliana]
 gb|AAG12595.1|AC068900_1 6-phosphogluconate dehydrogenase, putative; 13029-14489 [Arabidopsis 
thaliana]
 gb|AAL11585.1|AF424591_1 AT3g02360/F11A12_104 [Arabidopsis thaliana]
 gb|AAM64891.1| 6-phosphogluconate dehydrogenase, putative [Arabidopsis thaliana]
 gb|AAN73296.1| At3g02360/F11A12_104 [Arabidopsis thaliana]
 dbj|BAE99202.1| putative 6-phosphogluconate dehydrogenase [Arabidopsis thaliana]
 gb|AEE73796.1| 6-phosphogluconate dehydrogenase, decarboxylating 3 [Arabidopsis 
thaliana]
 gb|AEE73797.1| 6-phosphogluconate dehydrogenase, decarboxylating 3 [Arabidopsis 
thaliana]
Length=486

 Score =   311 bits (798),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 148/164 (90%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = +2

Query  188  PTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPES  367
            PTRIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETVERAK EGNLPLYGFHDPES
Sbjct  5    PTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKKEGNLPLYGFHDPES  64

Query  368  FIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELG  547
            F++SIQKPRV+I+LVKAG+PVDQTIKTLSAY+EKGDCI+DGGNEWYENTERREK VAE G
Sbjct  65   FVKSIQKPRVIIMLVKAGSPVDQTIKTLSAYLEKGDCIVDGGNEWYENTERREKAVAENG  124

Query  548  LLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
             LYLGMGVSGGEEGAR GPS+MPGGS+EAYK IEDIVLKVAAQV
Sbjct  125  FLYLGMGVSGGEEGARNGPSMMPGGSYEAYKNIEDIVLKVAAQV  168



>ref|XP_010477172.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Camelina sativa]
 ref|XP_010478251.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 isoform X1 [Camelina sativa]
 ref|XP_010478914.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 isoform X2 [Camelina sativa]
Length=486

 Score =   311 bits (797),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 149/164 (91%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = +2

Query  188  PTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPES  367
            PTRIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETVERAK EGNLPLYGFHDPES
Sbjct  5    PTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKKEGNLPLYGFHDPES  64

Query  368  FIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELG  547
            F++SIQKPRV+I+LVKAGAPVDQTIKTLSAY+EKGDCI+DGGNEWYENTERREK VAE G
Sbjct  65   FVKSIQKPRVIIMLVKAGAPVDQTIKTLSAYLEKGDCIVDGGNEWYENTERREKAVAENG  124

Query  548  LLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
             LYLGMGVSGGEEGAR GPS+MPGGS EAYK IEDIVLKVAAQV
Sbjct  125  FLYLGMGVSGGEEGARNGPSMMPGGSLEAYKNIEDIVLKVAAQV  168



>ref|XP_010681308.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1 [Beta vulgaris subsp. vulgaris]
Length=485

 Score =   311 bits (797),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 149/167 (89%), Positives = 157/167 (94%), Gaps = 0/167 (0%)
 Frame = +2

Query  179  MATPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHD  358
            MA PTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAK EGNLP+YGFHD
Sbjct  1    MAPPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKQEGNLPVYGFHD  60

Query  359  PESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVA  538
            PESF+ SIQKPRV+I+LVKAGAPVD TIKTLS Y+EKGDCIIDGGNEWYENTERREK + 
Sbjct  61   PESFVNSIQKPRVIIMLVKAGAPVDATIKTLSVYLEKGDCIIDGGNEWYENTERREKAME  120

Query  539  ELGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            E GLLYLGMGVSGGEEGAR GPSLMPGGSF+AYK IEDI+LKVAAQV
Sbjct  121  EKGLLYLGMGVSGGEEGARHGPSLMPGGSFDAYKNIEDILLKVAAQV  167



>ref|XP_009147357.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Brassica rapa]
 ref|XP_009147358.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Brassica rapa]
Length=488

 Score =   311 bits (797),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 149/164 (91%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = +2

Query  188  PTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPES  367
            PTRIGLAGLAVMGQNLALNIA KGFPISVYNRTTSKVDETVERAK EGNLP+YGFHDPES
Sbjct  5    PTRIGLAGLAVMGQNLALNIASKGFPISVYNRTTSKVDETVERAKKEGNLPVYGFHDPES  64

Query  368  FIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELG  547
            F+ SIQKPRV+I+LVKAGAPVDQTIKTLSAY+EKGDCI+DGGNEWYENTERREK V+E G
Sbjct  65   FVNSIQKPRVIIMLVKAGAPVDQTIKTLSAYLEKGDCIVDGGNEWYENTERREKAVSENG  124

Query  548  LLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
             LYLGMGVSGGEEGAR GPSLMPGGSFEAYK IEDIVLKVAAQV
Sbjct  125  FLYLGMGVSGGEEGARNGPSLMPGGSFEAYKNIEDIVLKVAAQV  168



>gb|KDO38967.1| hypothetical protein CISIN_1g011394mg [Citrus sinensis]
Length=487

 Score =   311 bits (796),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 149/163 (91%), Positives = 158/163 (97%), Gaps = 0/163 (0%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
            TRIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETVERAK EG+LPL+GF DPESF
Sbjct  8    TRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKKEGDLPLFGFRDPESF  67

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            + SIQKPRV+I+LVKAGAPVD+TIKTLSAYMEKGDCIIDGGNEWYENTERREK +AELGL
Sbjct  68   VNSIQKPRVIIMLVKAGAPVDETIKTLSAYMEKGDCIIDGGNEWYENTERREKAMAELGL  127

Query  551  LYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LYLGMGVSGGEEGAR GPSLMPGGSFEAYKYIEDI+LKVAAQV
Sbjct  128  LYLGMGVSGGEEGARHGPSLMPGGSFEAYKYIEDILLKVAAQV  170



>ref|XP_007151436.1| hypothetical protein PHAVU_004G046100g [Phaseolus vulgaris]
 gb|ESW23430.1| hypothetical protein PHAVU_004G046100g [Phaseolus vulgaris]
Length=490

 Score =   311 bits (796),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 149/170 (88%), Positives = 162/170 (95%), Gaps = 3/170 (2%)
 Frame = +2

Query  179  MATPT---RIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYG  349
            MA PT   RIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETVERA+ EG LP+YG
Sbjct  1    MAQPTNLTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAQKEGKLPVYG  60

Query  350  FHDPESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREK  529
            +HDP+SF++SIQKPRV+I+LVKAGAPVDQTIKTLSAY+EKGDCIIDGGNEWYENTERREK
Sbjct  61   YHDPKSFVQSIQKPRVIIMLVKAGAPVDQTIKTLSAYLEKGDCIIDGGNEWYENTERREK  120

Query  530  EVAELGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
             ++ELGLLYLGMGVSGGEEGAR GPSLMPGGSFEAYKYIEDI+LKVAAQV
Sbjct  121  AMSELGLLYLGMGVSGGEEGARHGPSLMPGGSFEAYKYIEDILLKVAAQV  170



>emb|CDY43238.1| BnaC05g48310D [Brassica napus]
Length=403

 Score =   308 bits (789),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 147/164 (90%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = +2

Query  188  PTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPES  367
            PTRIGLAGLAVMGQNLALNIA KGFPISVYNRTTSKVDETVERAK EGNLP+YGFHDPES
Sbjct  5    PTRIGLAGLAVMGQNLALNIASKGFPISVYNRTTSKVDETVERAKKEGNLPVYGFHDPES  64

Query  368  FIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELG  547
            F+ SIQKPRV+I+LVKAGAPVDQTIKTLSAY+EKGDCI+DGGNEWYENTERREK V+E G
Sbjct  65   FVNSIQKPRVIIMLVKAGAPVDQTIKTLSAYLEKGDCIVDGGNEWYENTERREKAVSENG  124

Query  548  LLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
             LYLGMGVSGGEEGAR GPSLMPGGSF+AYK IEDI+LKVAAQV
Sbjct  125  FLYLGMGVSGGEEGARNGPSLMPGGSFDAYKNIEDILLKVAAQV  168



>gb|KDO38968.1| hypothetical protein CISIN_1g011394mg [Citrus sinensis]
Length=474

 Score =   310 bits (795),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 149/163 (91%), Positives = 158/163 (97%), Gaps = 0/163 (0%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
            TRIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETVERAK EG+LPL+GF DPESF
Sbjct  8    TRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKKEGDLPLFGFRDPESF  67

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            + SIQKPRV+I+LVKAGAPVD+TIKTLSAYMEKGDCIIDGGNEWYENTERREK +AELGL
Sbjct  68   VNSIQKPRVIIMLVKAGAPVDETIKTLSAYMEKGDCIIDGGNEWYENTERREKAMAELGL  127

Query  551  LYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LYLGMGVSGGEEGAR GPSLMPGGSFEAYKYIEDI+LKVAAQV
Sbjct  128  LYLGMGVSGGEEGARHGPSLMPGGSFEAYKYIEDILLKVAAQV  170



>emb|CDY57527.1| BnaA05g33580D [Brassica napus]
Length=404

 Score =   308 bits (789),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 147/164 (90%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = +2

Query  188  PTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPES  367
            PTRIGLAGLAVMGQNLALNIA KGFPISVYNRTTSKVDETVERAK EGNLP+YGFHDPES
Sbjct  5    PTRIGLAGLAVMGQNLALNIASKGFPISVYNRTTSKVDETVERAKKEGNLPVYGFHDPES  64

Query  368  FIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELG  547
            F+ SIQKPRV+I+LVKAG+PVDQTIKTLSAY+EKGDCI+DGGNEWYENTERREK V+E G
Sbjct  65   FVNSIQKPRVIIMLVKAGSPVDQTIKTLSAYLEKGDCIVDGGNEWYENTERREKAVSENG  124

Query  548  LLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
             LYLGMGVSGGEEGAR GPSLMPGGSFEAYK IEDI+LKVAAQV
Sbjct  125  FLYLGMGVSGGEEGARNGPSLMPGGSFEAYKNIEDILLKVAAQV  168



>ref|XP_006430886.1| hypothetical protein CICLE_v10011597mg [Citrus clementina]
 gb|ESR44126.1| hypothetical protein CICLE_v10011597mg [Citrus clementina]
Length=487

 Score =   310 bits (795),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 149/163 (91%), Positives = 158/163 (97%), Gaps = 0/163 (0%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
            TRIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETVERAK EG+LPL+GF DPESF
Sbjct  8    TRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKKEGDLPLFGFRDPESF  67

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            + SIQKPRV+I+LVKAGAPVD+TIKTLSAYMEKGDCIIDGGNEWYENTERREK +AELGL
Sbjct  68   VNSIQKPRVIIMLVKAGAPVDETIKTLSAYMEKGDCIIDGGNEWYENTERREKAMAELGL  127

Query  551  LYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LYLGMGVSGGEEGAR GPSLMPGGSFEAYKYIEDI+LKVAAQV
Sbjct  128  LYLGMGVSGGEEGARHGPSLMPGGSFEAYKYIEDILLKVAAQV  170



>ref|XP_006437811.1| hypothetical protein CICLE_v10031373mg [Citrus clementina]
 gb|ESR51051.1| hypothetical protein CICLE_v10031373mg [Citrus clementina]
Length=484

 Score =   310 bits (795),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 149/163 (91%), Positives = 157/163 (96%), Gaps = 0/163 (0%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
            TRIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETVERAK EGNLPL GFHDPESF
Sbjct  4    TRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKQEGNLPLCGFHDPESF  63

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            + SIQKPRV+I+LVKAG+PVDQTIKTLS YMEKGDCIIDGGNEWYENTERR+K VAELGL
Sbjct  64   VHSIQKPRVIIMLVKAGSPVDQTIKTLSVYMEKGDCIIDGGNEWYENTERRQKAVAELGL  123

Query  551  LYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LYLGMGVSGGEEGAR GPSLMPGGSFEAYK+IEDI+LKVAAQV
Sbjct  124  LYLGMGVSGGEEGARYGPSLMPGGSFEAYKHIEDILLKVAAQV  166



>gb|EYU44260.1| hypothetical protein MIMGU_mgv1a005435mg [Erythranthe guttata]
 gb|EYU44261.1| hypothetical protein MIMGU_mgv1a005435mg [Erythranthe guttata]
Length=483

 Score =   310 bits (795),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 148/163 (91%), Positives = 158/163 (97%), Gaps = 0/163 (0%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
             RIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETVERAK EGNLPL+GFHDPESF
Sbjct  9    NRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKLEGNLPLFGFHDPESF  68

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            ++SIQKPRV+I+LVKAG+PVDQTIKTLSAY+EKGDCIIDGGNEWYENTERREK +AELGL
Sbjct  69   VQSIQKPRVIIMLVKAGSPVDQTIKTLSAYLEKGDCIIDGGNEWYENTERREKAMAELGL  128

Query  551  LYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LYLGMGVSGGEEGAR GPS+MPGGS EAYKYIEDIVLKVAAQV
Sbjct  129  LYLGMGVSGGEEGARNGPSMMPGGSLEAYKYIEDIVLKVAAQV  171



>ref|XP_010485479.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like [Camelina sativa]
 ref|XP_010485480.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like [Camelina sativa]
Length=486

 Score =   310 bits (794),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 148/164 (90%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = +2

Query  188  PTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPES  367
            PTRIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETVERAK EGNLPLYGFHDPES
Sbjct  5    PTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKKEGNLPLYGFHDPES  64

Query  368  FIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELG  547
            F++SIQKPRV+I+LVKAGAPVDQTIKTLSAY+EKGDCI+DGGNEWYENT+RREK VAE G
Sbjct  65   FVKSIQKPRVIIMLVKAGAPVDQTIKTLSAYLEKGDCIVDGGNEWYENTDRREKAVAENG  124

Query  548  LLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
             LYLGMGVSGGEEGAR GPS+MPGGS EAYK IEDIVLKVAAQV
Sbjct  125  FLYLGMGVSGGEEGARNGPSMMPGGSLEAYKNIEDIVLKVAAQV  168



>ref|XP_006482343.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like isoform X1 [Citrus sinensis]
 ref|XP_006482344.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like isoform X2 [Citrus sinensis]
Length=487

 Score =   310 bits (793),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 149/163 (91%), Positives = 158/163 (97%), Gaps = 0/163 (0%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
            TRIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETVERAK EG+LPL+GF DPESF
Sbjct  8    TRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKKEGDLPLFGFLDPESF  67

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            + SIQKPRV+I+LVKAGAPVD+TIKTLSAYMEKGDCIIDGGNEWYENTERREK +AELGL
Sbjct  68   VNSIQKPRVIIMLVKAGAPVDETIKTLSAYMEKGDCIIDGGNEWYENTERREKAMAELGL  127

Query  551  LYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LYLGMGVSGGEEGAR GPSLMPGGSFEAYKYIEDI+LKVAAQV
Sbjct  128  LYLGMGVSGGEEGARHGPSLMPGGSFEAYKYIEDILLKVAAQV  170



>ref|XP_008230333.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Prunus mume]
 ref|XP_008230334.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Prunus mume]
Length=488

 Score =   309 bits (792),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 148/164 (90%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = +2

Query  188  PTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPES  367
            PTRIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETVERAK EGNLPLYGFHDPES
Sbjct  7    PTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKNEGNLPLYGFHDPES  66

Query  368  FIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELG  547
            F++SIQKPRV+I+LVKAGAPVDQTIKTLS Y+EKGD IIDGGNEWYENTERR K +AELG
Sbjct  67   FVKSIQKPRVIIMLVKAGAPVDQTIKTLSVYLEKGDSIIDGGNEWYENTERRAKAMAELG  126

Query  548  LLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LLYLGMGVSGGEEGAR GPS+MPGGSFEAYKYIEDI+LKV+AQV
Sbjct  127  LLYLGMGVSGGEEGARYGPSMMPGGSFEAYKYIEDILLKVSAQV  170



>gb|EPS70190.1| hypothetical protein M569_04567, partial [Genlisea aurea]
Length=504

 Score =   309 bits (791),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 153/187 (82%), Positives = 165/187 (88%), Gaps = 1/187 (1%)
 Frame = +2

Query  122  YSSIPCTILSAPN*LEENSMATP-TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKV  298
            + S P T++ A   +       P TRIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKV
Sbjct  1    FISQPLTLVVAIRGVVMAESTKPLTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKV  60

Query  299  DETVERAKAEGNLPLYGFHDPESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDC  478
            DETVERAK EGNLPL+GFHDPESF+ SIQKPRV+I+LVKAGAPVD TIKTL+AY+EKGDC
Sbjct  61   DETVERAKLEGNLPLFGFHDPESFVNSIQKPRVIIMLVKAGAPVDATIKTLTAYLEKGDC  120

Query  479  IIDGGNEWYENTERREKEVAELGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIV  658
            IIDGGNEWYENTERREK VAE G LYLGMGVSGGEEGAR GPSLMPGGSFEAYKYIEDI+
Sbjct  121  IIDGGNEWYENTERREKAVAESGFLYLGMGVSGGEEGARHGPSLMPGGSFEAYKYIEDIL  180

Query  659  LKVAAQV  679
            LKVAAQV
Sbjct  181  LKVAAQV  187



>ref|XP_007217218.1| hypothetical protein PRUPE_ppa004860mg [Prunus persica]
 gb|EMJ18417.1| hypothetical protein PRUPE_ppa004860mg [Prunus persica]
Length=488

 Score =   308 bits (790),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 148/164 (90%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = +2

Query  188  PTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPES  367
            PTRIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETVERAK EGNLPLYGFHDPES
Sbjct  7    PTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKNEGNLPLYGFHDPES  66

Query  368  FIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELG  547
            F+ SIQKPRV+I+LVKAGAPVDQTIKTLS Y+EKGD IIDGGNEWYENTERR K +AELG
Sbjct  67   FVNSIQKPRVIIMLVKAGAPVDQTIKTLSVYLEKGDSIIDGGNEWYENTERRAKAMAELG  126

Query  548  LLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LLYLGMGVSGGEEGAR GPS+MPGGSFEAYKYIEDI+LKV+AQV
Sbjct  127  LLYLGMGVSGGEEGARYGPSMMPGGSFEAYKYIEDILLKVSAQV  170



>gb|AAC79957.1| 6-phosphogluconate dehydrogenase isoenzyme A [Zea mays]
Length=178

 Score =   297 bits (761),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 141/163 (87%), Positives = 155/163 (95%), Gaps = 0/163 (0%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
            TRIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETV+RAK EGNLP++GFHDP SF
Sbjct  4    TRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVQRAKVEGNLPVFGFHDPASF  63

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            + SIQKPRVVI+LVKAGAPVDQTI TL+A++++GDCI+DGGNEWYENTERREK + E GL
Sbjct  64   VSSIQKPRVVIMLVKAGAPVDQTIATLAAHLDQGDCIVDGGNEWYENTERREKAMEERGL  123

Query  551  LYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LYLGMGVSGGEEGAR GPSLMPGGSFEAYKYIEDI+LKVAAQV
Sbjct  124  LYLGMGVSGGEEGARNGPSLMPGGSFEAYKYIEDILLKVAAQV  166



>sp|Q94KU1.1|6PGD1_SPIOL RecName: Full=6-phosphogluconate dehydrogenase, decarboxylating 
1 [Spinacia oleracea]
 gb|AAK51690.1|AF307144_1 cytosolic 6-phosphogluconate dehydrogenase [Spinacia oleracea]
Length=483

 Score =   308 bits (788),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 148/167 (89%), Positives = 157/167 (94%), Gaps = 0/167 (0%)
 Frame = +2

Query  179  MATPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHD  358
            MA PTRIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETVERAK EGNLPLYGFHD
Sbjct  1    MAPPTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKQEGNLPLYGFHD  60

Query  359  PESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVA  538
            PESF+ SIQKPRV+I+LVKAGAPVD TIKTLSAY+EKGDCIIDGGNEWYENTERREK + 
Sbjct  61   PESFVNSIQKPRVIIMLVKAGAPVDATIKTLSAYLEKGDCIIDGGNEWYENTERREKAME  120

Query  539  ELGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            E GLLYLGMGVSGGEEGAR GPS+MPGGSF+AYK IEDI+ KVAAQV
Sbjct  121  EKGLLYLGMGVSGGEEGARNGPSMMPGGSFDAYKNIEDILTKVAAQV  167



>ref|XP_006857727.1| hypothetical protein AMTR_s00061p00182310 [Amborella trichopoda]
 gb|ERN19194.1| hypothetical protein AMTR_s00061p00182310 [Amborella trichopoda]
Length=488

 Score =   308 bits (789),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 149/163 (91%), Positives = 156/163 (96%), Gaps = 0/163 (0%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
            +RIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETVERAK EGNL L GFHDP+SF
Sbjct  6    SRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKREGNLHLRGFHDPKSF  65

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            ++SIQKPRVVI+LVKAGAPVDQTI+TLS YMEKGDCIIDGGNEWYENTERREK  AELGL
Sbjct  66   VQSIQKPRVVIMLVKAGAPVDQTIQTLSTYMEKGDCIIDGGNEWYENTERREKAAAELGL  125

Query  551  LYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LYLGMGVSGGEEGAR GPSLMPGGSFEAYKYIEDIVLKVAAQV
Sbjct  126  LYLGMGVSGGEEGARHGPSLMPGGSFEAYKYIEDIVLKVAAQV  168



>ref|XP_006603945.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like isoform X2 [Glycine max]
 gb|KHN30764.1| 6-phosphogluconate dehydrogenase, decarboxylating [Glycine soja]
Length=488

 Score =   308 bits (788),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 148/170 (87%), Positives = 161/170 (95%), Gaps = 3/170 (2%)
 Frame = +2

Query  179  MATP---TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYG  349
            MA P   TRIGLAGLAVMGQNLALNIA+KGFPISVYNRT SKVDETVERAK EGNLP+YG
Sbjct  1    MAQPASLTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTASKVDETVERAKQEGNLPVYG  60

Query  350  FHDPESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREK  529
            +HDP+ F++SIQKPRV+I+LVKAGAPVDQTIKTLSA++EKGDCIIDGGNEWYENTERREK
Sbjct  61   YHDPKFFVQSIQKPRVIIMLVKAGAPVDQTIKTLSAHLEKGDCIIDGGNEWYENTERREK  120

Query  530  EVAELGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
             ++ELGLLYLGMGVSGGEEGAR GPSLMPGGSFEAYKYIEDI+LKVAAQV
Sbjct  121  AMSELGLLYLGMGVSGGEEGARHGPSLMPGGSFEAYKYIEDILLKVAAQV  170



>ref|XP_010933404.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1-like [Elaeis guineensis]
 ref|XP_010933405.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1-like [Elaeis guineensis]
Length=488

 Score =   308 bits (788),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 148/163 (91%), Positives = 156/163 (96%), Gaps = 0/163 (0%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
            TRIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETVERAK EGNLP+YGFHDP SF
Sbjct  4    TRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKLEGNLPIYGFHDPASF  63

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            + SIQKPRV+I+LVKAGAPVDQTI TLSAYMEKGDCIIDGGNEWYENTERREK +AELGL
Sbjct  64   VNSIQKPRVIIMLVKAGAPVDQTIATLSAYMEKGDCIIDGGNEWYENTERREKAMAELGL  123

Query  551  LYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LYLGMGVSGGEEGAR GPSLMPGGS+EAYK IEDI+LKVAAQV
Sbjct  124  LYLGMGVSGGEEGARHGPSLMPGGSYEAYKNIEDILLKVAAQV  166



>ref|XP_003555038.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like isoformX1 [Glycine max]
Length=533

 Score =   309 bits (791),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 148/171 (87%), Positives = 162/171 (95%), Gaps = 3/171 (2%)
 Frame = +2

Query  176  SMATP---TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLY  346
            +MA P   TRIGLAGLAVMGQNLALNIA+KGFPISVYNRT SKVDETVERAK EGNLP+Y
Sbjct  45   TMAQPASLTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTASKVDETVERAKQEGNLPVY  104

Query  347  GFHDPESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERRE  526
            G+HDP+ F++SIQKPRV+I+LVKAGAPVDQTIKTLSA++EKGDCIIDGGNEWYENTERRE
Sbjct  105  GYHDPKFFVQSIQKPRVIIMLVKAGAPVDQTIKTLSAHLEKGDCIIDGGNEWYENTERRE  164

Query  527  KEVAELGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            K ++ELGLLYLGMGVSGGEEGAR GPSLMPGGSFEAYKYIEDI+LKVAAQV
Sbjct  165  KAMSELGLLYLGMGVSGGEEGARHGPSLMPGGSFEAYKYIEDILLKVAAQV  215



>ref|XP_009388425.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1-like [Musa acuminata subsp. malaccensis]
 ref|XP_009388426.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1-like [Musa acuminata subsp. malaccensis]
Length=484

 Score =   307 bits (787),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 147/163 (90%), Positives = 157/163 (96%), Gaps = 0/163 (0%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
            TRIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETVERAK EGNLP+YGFHDP SF
Sbjct  4    TRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKREGNLPVYGFHDPASF  63

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            + SIQKPRV+I+LVKAGAPVDQTI TLS++MEKGDCIIDGGNEWYENTERREK +AELGL
Sbjct  64   VNSIQKPRVIIMLVKAGAPVDQTIATLSSHMEKGDCIIDGGNEWYENTERREKAMAELGL  123

Query  551  LYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LYLGMGVSGGEEGAR GPSLMPGGS+EAYKYIEDI+LKVAAQV
Sbjct  124  LYLGMGVSGGEEGARNGPSLMPGGSYEAYKYIEDILLKVAAQV  166



>ref|XP_006408422.1| hypothetical protein EUTSA_v10020604mg [Eutrema salsugineum]
 ref|XP_006408423.1| hypothetical protein EUTSA_v10020604mg [Eutrema salsugineum]
 gb|ESQ49875.1| hypothetical protein EUTSA_v10020604mg [Eutrema salsugineum]
 gb|ESQ49876.1| hypothetical protein EUTSA_v10020604mg [Eutrema salsugineum]
Length=488

 Score =   307 bits (787),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 146/164 (89%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = +2

Query  188  PTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPES  367
            PTRIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETVERAK EGNLPLYGFHDP+S
Sbjct  5    PTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKKEGNLPLYGFHDPKS  64

Query  368  FIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELG  547
            F+ SIQKPRV+I+LVKAGAPVDQTIKTLSAY+EKGDCI+DGGNEWYENTERREK VA+ G
Sbjct  65   FVNSIQKPRVIIMLVKAGAPVDQTIKTLSAYLEKGDCIVDGGNEWYENTERREKAVADNG  124

Query  548  LLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
             LYLGMGVSGGEEGAR GPS+MPGGS+EAYK IEDI+LKVAAQV
Sbjct  125  FLYLGMGVSGGEEGARNGPSMMPGGSYEAYKNIEDILLKVAAQV  168



>ref|XP_009399427.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1 isoform X2 [Musa acuminata subsp. malaccensis]
 ref|XP_009399428.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1 isoform X2 [Musa acuminata subsp. malaccensis]
Length=484

 Score =   306 bits (785),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 145/163 (89%), Positives = 157/163 (96%), Gaps = 0/163 (0%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
            TRIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETVERAK EGNLP+YGFHDP SF
Sbjct  4    TRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKVEGNLPVYGFHDPASF  63

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            + SIQKPRV+I+LVKAGAPVDQTI TLSA++EKGDCIIDGGNEWYENTERREK +AELGL
Sbjct  64   VNSIQKPRVIIMLVKAGAPVDQTIATLSAHLEKGDCIIDGGNEWYENTERREKAMAELGL  123

Query  551  LYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LYLGMGVSGGEEGAR GPSLMPGGS+EA++YIEDI+LKVAAQV
Sbjct  124  LYLGMGVSGGEEGARNGPSLMPGGSYEAFRYIEDILLKVAAQV  166



>ref|XP_010558538.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like [Tarenaya hassleriana]
 ref|XP_010558539.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like [Tarenaya hassleriana]
 ref|XP_010558540.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like [Tarenaya hassleriana]
 ref|XP_010558541.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like [Tarenaya hassleriana]
 ref|XP_010558542.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like [Tarenaya hassleriana]
 gb|ABD96905.1| hypothetical protein [Cleome spinosa]
Length=483

 Score =   306 bits (784),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 146/163 (90%), Positives = 158/163 (97%), Gaps = 0/163 (0%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
            TRIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETV+RAK EGNLP+YGFHDPESF
Sbjct  3    TRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVQRAKKEGNLPVYGFHDPESF  62

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            + SIQKPRV+I+LVKAGAPVDQTIKTLSAYME+GDCIIDGGNEWYENTERREK VAE GL
Sbjct  63   VNSIQKPRVIIMLVKAGAPVDQTIKTLSAYMEEGDCIIDGGNEWYENTERREKAVAERGL  122

Query  551  LYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LYLGMGVSGGEEGAR GPSLMPGGS++AY+YI+DI+LKVAAQV
Sbjct  123  LYLGMGVSGGEEGARNGPSLMPGGSYKAYEYIKDILLKVAAQV  165



>gb|AAC79949.1| 6-phosphogluconate dehydrogenase isoenzyme A [Zea mays]
Length=178

 Score =   295 bits (755),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 140/163 (86%), Positives = 155/163 (95%), Gaps = 0/163 (0%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
            TRIGLAGLAVMGQNLALNIA+KGFPISVY+RTTSKVDETV+RAK EGNLP++GFHDP SF
Sbjct  4    TRIGLAGLAVMGQNLALNIAEKGFPISVYDRTTSKVDETVQRAKVEGNLPVFGFHDPASF  63

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            + SIQKPRVVI+LVKAGAPVDQTI TL+A++++GDCI+DGGNEWYENTERREK + E GL
Sbjct  64   VSSIQKPRVVIMLVKAGAPVDQTIATLAAHLDQGDCIVDGGNEWYENTERREKAMEERGL  123

Query  551  LYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LYLGMGVSGGEEGAR GPSLMPGGSFEAYKYIEDI+LKVAAQV
Sbjct  124  LYLGMGVSGGEEGARDGPSLMPGGSFEAYKYIEDILLKVAAQV  166



>ref|XP_008803614.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1-like [Phoenix dactylifera]
Length=488

 Score =   305 bits (781),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 146/163 (90%), Positives = 157/163 (96%), Gaps = 0/163 (0%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
            TRIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETVERAK EGNLP+YGFHDP SF
Sbjct  4    TRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKREGNLPVYGFHDPASF  63

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            ++SIQKPRV+I+LVKAGAPVDQTI TLSA+MEKGDCIIDGGNEWYENTERREK ++ELGL
Sbjct  64   VKSIQKPRVIIMLVKAGAPVDQTIATLSAHMEKGDCIIDGGNEWYENTERREKAMSELGL  123

Query  551  LYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LYLGMGVSGGEEGAR GPSLMPGGS+EAYK IEDI+LKVAAQV
Sbjct  124  LYLGMGVSGGEEGARHGPSLMPGGSYEAYKNIEDILLKVAAQV  166



>ref|XP_010920025.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1 [Elaeis guineensis]
Length=488

 Score =   305 bits (781),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 147/163 (90%), Positives = 156/163 (96%), Gaps = 0/163 (0%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
            TRIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETVERAK EGNLP+YGFHDP SF
Sbjct  4    TRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKVEGNLPVYGFHDPASF  63

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            + SIQKPRV+IILVKAGAPVDQTI TLSA+ME+GDCIIDGGNEWYENTERREK VAELGL
Sbjct  64   VHSIQKPRVIIILVKAGAPVDQTIATLSAHMEEGDCIIDGGNEWYENTERREKAVAELGL  123

Query  551  LYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LYLGMGVSGGE+GAR GPSLMPGGS+EAYK IEDI+LKVAAQV
Sbjct  124  LYLGMGVSGGEDGARNGPSLMPGGSYEAYKNIEDILLKVAAQV  166



>ref|NP_001266302.1| 6-phosphogluconate dehydrogenase isoenzyme B isoform 1 [Zea mays]
 gb|ACF85199.1| unknown [Zea mays]
 gb|ACF87821.1| unknown [Zea mays]
 gb|ACR36789.1| unknown [Zea mays]
 gb|AFW75252.1| 6-phosphogluconate dehydrogenase isoenzyme B isoform 1 [Zea mays]
 gb|AFW75253.1| 6-phosphogluconate dehydrogenase isoenzyme B isoform 2 [Zea mays]
 gb|AFW75254.1| 6-phosphogluconate dehydrogenase isoenzyme B isoform 3 [Zea mays]
Length=482

 Score =   305 bits (780),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 145/163 (89%), Positives = 157/163 (96%), Gaps = 0/163 (0%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
            TRIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETV+RAKAEGNLP+YGFHDP SF
Sbjct  4    TRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVQRAKAEGNLPVYGFHDPASF  63

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            ++SIQKPRVVI+LVKAGAPVDQTI TL+A++E+GDCIIDGGNEWYENTERREK + E GL
Sbjct  64   VKSIQKPRVVIMLVKAGAPVDQTIATLAAHLEQGDCIIDGGNEWYENTERREKAMEERGL  123

Query  551  LYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LYLGMGVSGGEEGAR GPSLMPGGSFEAYKY+EDIVLKVAAQV
Sbjct  124  LYLGMGVSGGEEGARNGPSLMPGGSFEAYKYVEDIVLKVAAQV  166



>ref|XP_009399426.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1 isoform X1 [Musa acuminata subsp. malaccensis]
Length=541

 Score =   306 bits (785),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 145/163 (89%), Positives = 157/163 (96%), Gaps = 0/163 (0%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
            TRIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETVERAK EGNLP+YGFHDP SF
Sbjct  61   TRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKVEGNLPVYGFHDPASF  120

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            + SIQKPRV+I+LVKAGAPVDQTI TLSA++EKGDCIIDGGNEWYENTERREK +AELGL
Sbjct  121  VNSIQKPRVIIMLVKAGAPVDQTIATLSAHLEKGDCIIDGGNEWYENTERREKAMAELGL  180

Query  551  LYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LYLGMGVSGGEEGAR GPSLMPGGS+EA++YIEDI+LKVAAQV
Sbjct  181  LYLGMGVSGGEEGARNGPSLMPGGSYEAFRYIEDILLKVAAQV  223



>ref|XP_006655710.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1-like isoform X1 [Oryza brachyantha]
 ref|XP_006655711.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1-like isoform X2 [Oryza brachyantha]
Length=481

 Score =   304 bits (779),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 145/163 (89%), Positives = 156/163 (96%), Gaps = 0/163 (0%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
            TRIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETV+RAKAEGNLP+YGFHDP SF
Sbjct  4    TRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVQRAKAEGNLPVYGFHDPASF  63

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            + SIQKPRVVI+LVKAGAPVDQTI TL+A++E+GDCIIDGGNEWYENTERREK + E GL
Sbjct  64   VNSIQKPRVVIMLVKAGAPVDQTIATLAAHLEQGDCIIDGGNEWYENTERREKAMEERGL  123

Query  551  LYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LYLGMGVSGGEEGAR GPSLMPGGSFEAYKYIEDI+LKVAAQV
Sbjct  124  LYLGMGVSGGEEGARNGPSLMPGGSFEAYKYIEDILLKVAAQV  166



>ref|XP_008788546.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1 [Phoenix dactylifera]
Length=488

 Score =   304 bits (779),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 146/163 (90%), Positives = 155/163 (95%), Gaps = 0/163 (0%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
            TRIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETVERAK EGNLP+YGFHDP SF
Sbjct  4    TRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKLEGNLPVYGFHDPASF  63

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            + SIQKPRV+I+LVKAGAPVDQTI TLS +MEKGDCIIDGGNEWYENTERREK +AELGL
Sbjct  64   VHSIQKPRVIIMLVKAGAPVDQTIATLSTHMEKGDCIIDGGNEWYENTERREKAMAELGL  123

Query  551  LYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LYLGMGVSGGEEGAR GPSLMPGGS+EAYK IEDI+LKVAAQV
Sbjct  124  LYLGMGVSGGEEGARHGPSLMPGGSYEAYKNIEDILLKVAAQV  166



>ref|XP_004964329.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1-like isoform X1 [Setaria italica]
 ref|XP_004964330.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1-like isoform X2 [Setaria italica]
Length=481

 Score =   303 bits (776),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 145/163 (89%), Positives = 155/163 (95%), Gaps = 0/163 (0%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
            TRIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETV+RAKAEGNLP+YGFHDP SF
Sbjct  4    TRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVQRAKAEGNLPVYGFHDPASF  63

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            + SIQKPRVVI+LVKAGAPVDQTI TL+A++E+GDCIIDGGNEWYENTERREK   E GL
Sbjct  64   VNSIQKPRVVIMLVKAGAPVDQTIATLAAHLEQGDCIIDGGNEWYENTERREKATEERGL  123

Query  551  LYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LYLGMGVSGGEEGAR GPSLMPGGSFEAYKYIEDI+LKVAAQV
Sbjct  124  LYLGMGVSGGEEGARNGPSLMPGGSFEAYKYIEDILLKVAAQV  166



>gb|KDP31431.1| hypothetical protein JCGZ_11807 [Jatropha curcas]
Length=485

 Score =   303 bits (777),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 147/167 (88%), Positives = 155/167 (93%), Gaps = 0/167 (0%)
 Frame = +2

Query  179  MATPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHD  358
            MA   RIGLAGLAVMGQNLALNIA+KGFPISVYNRT SKVDETV RAK EG+LPLYGF D
Sbjct  1    MAPLIRIGLAGLAVMGQNLALNIAEKGFPISVYNRTASKVDETVARAKQEGDLPLYGFRD  60

Query  359  PESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVA  538
            PESF+ SIQKPRV+I+LVKAG PVDQTIKTLS YMEKGDCIIDGGNEWYENTERREK +A
Sbjct  61   PESFVNSIQKPRVIIMLVKAGPPVDQTIKTLSVYMEKGDCIIDGGNEWYENTERREKAMA  120

Query  539  ELGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            +LGLLYLGMGVSGGEEGAR GPSLMPGGSFEAYKYIEDI+LKVAAQV
Sbjct  121  DLGLLYLGMGVSGGEEGARHGPSLMPGGSFEAYKYIEDILLKVAAQV  167



>gb|AHM10416.1| 6-phosphogluconate dehydrogenase [Saccharum hybrid cultivar Yacheng05-179]
Length=480

 Score =   303 bits (776),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 145/163 (89%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
            TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETV+RAK EGNLP++GFHDP SF
Sbjct  4    TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVQRAKVEGNLPVFGFHDPASF  63

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            + SIQKPRVVIILVKAGAPVDQTI TL+A++E GDCIIDGGNEWYENTERREK + E GL
Sbjct  64   VSSIQKPRVVIILVKAGAPVDQTIATLAAHLEHGDCIIDGGNEWYENTERREKAMEERGL  123

Query  551  LYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LYLGMGVSGGEEGAR GPSLMPGGSFEAYKYIEDI+LKVAAQV
Sbjct  124  LYLGMGVSGGEEGARNGPSLMPGGSFEAYKYIEDILLKVAAQV  166



>ref|NP_001056586.1| Os06g0111500 [Oryza sativa Japonica Group]
 sp|Q9LI00.1|6PGD1_ORYSJ RecName: Full=6-phosphogluconate dehydrogenase, decarboxylating 
1; Short=OsG6PGH1 [Oryza sativa Japonica Group]
 gb|AAL92029.1|AF486280_1 cytosolic 6-phosphogluconate dehydrogenase [Oryza sativa Japonica 
Group]
 dbj|BAA93024.1| putative phosphogluconate dehydrogenase [Oryza sativa Japonica 
Group]
 dbj|BAF18500.1| Os06g0111500 [Oryza sativa Japonica Group]
 gb|EAZ35578.1| hypothetical protein OsJ_19864 [Oryza sativa Japonica Group]
 dbj|BAG89736.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AJB98434.1| 6-phosphogluconate dehydrogenase, partial [Oryza sativa]
Length=480

 Score =   303 bits (775),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 144/163 (88%), Positives = 155/163 (95%), Gaps = 0/163 (0%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
            TRIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETV+RAK EGNLP+YGFHDP SF
Sbjct  4    TRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVQRAKVEGNLPVYGFHDPASF  63

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            + SIQKPRVVI+LVKAGAPVDQTI TL+A++E+GDCIIDGGNEWYENTERREK + E GL
Sbjct  64   VNSIQKPRVVIMLVKAGAPVDQTIATLAAHLEQGDCIIDGGNEWYENTERREKAMEERGL  123

Query  551  LYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LYLGMGVSGGEEGAR GPSLMPGGSFEAYKYIEDI+LKVAAQV
Sbjct  124  LYLGMGVSGGEEGARNGPSLMPGGSFEAYKYIEDILLKVAAQV  166



>ref|XP_007139369.1| hypothetical protein PHAVU_008G023700g [Phaseolus vulgaris]
 ref|XP_007139370.1| hypothetical protein PHAVU_008G023700g [Phaseolus vulgaris]
 gb|ESW11363.1| hypothetical protein PHAVU_008G023700g [Phaseolus vulgaris]
 gb|ESW11364.1| hypothetical protein PHAVU_008G023700g [Phaseolus vulgaris]
Length=483

 Score =   302 bits (774),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 146/168 (87%), Positives = 160/168 (95%), Gaps = 1/168 (1%)
 Frame = +2

Query  179  MATPT-RIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFH  355
            MA PT RIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETVERAK EGNLP+YG+H
Sbjct  1    MALPTTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKLEGNLPVYGYH  60

Query  356  DPESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEV  535
            DP++F+ SI+KPRVVI+LVKAGAPVDQTIKTLSA+MEKGDCIIDGGNEWYENTERRE+ +
Sbjct  61   DPKAFVLSIRKPRVVIMLVKAGAPVDQTIKTLSAFMEKGDCIIDGGNEWYENTERREEAM  120

Query  536  AELGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            +ELG LYLGMGVSGGEEGAR GPSLMPGGSFEA+K IEDI+LKVAAQV
Sbjct  121  SELGFLYLGMGVSGGEEGARNGPSLMPGGSFEAFKNIEDILLKVAAQV  168



>ref|XP_004971196.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1-like [Setaria italica]
Length=480

 Score =   301 bits (772),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 144/163 (88%), Positives = 155/163 (95%), Gaps = 0/163 (0%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
            TRIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETV+RAK EGNLP+YGFHDP SF
Sbjct  4    TRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVQRAKVEGNLPVYGFHDPASF  63

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            + SIQKPRVVI+LVKAGAPVDQTI TL+A++E+GDCIIDGGNEWYENTERREK + E GL
Sbjct  64   VSSIQKPRVVIMLVKAGAPVDQTIATLAAHLEQGDCIIDGGNEWYENTERREKAMEERGL  123

Query  551  LYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LYLGMGVSGGEEGAR GPSLMPGGSFEAYKYIEDI+LKVAAQV
Sbjct  124  LYLGMGVSGGEEGARNGPSLMPGGSFEAYKYIEDILLKVAAQV  166



>ref|NP_001104911.1| 6-phosphogluconate dehydrogenase2 [Zea mays]
 gb|AAC27703.1| putative cytosolic 6-phosphogluconate dehydrogenase [Zea mays]
Length=482

 Score =   300 bits (768),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 143/163 (88%), Positives = 156/163 (96%), Gaps = 0/163 (0%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
            TRIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETV+RAKAEGNLP+YGFHDP SF
Sbjct  4    TRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVQRAKAEGNLPVYGFHDPASF  63

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            ++SIQKPRVVI+LVKAGAPVDQTI TL+A++E+GDCIIDGGNEWYENTERREK + E GL
Sbjct  64   VKSIQKPRVVIMLVKAGAPVDQTIATLAAHLEQGDCIIDGGNEWYENTERREKAMEERGL  123

Query  551  LYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LYLGM VSGGEEGAR GPSLMPGGSFEAYKY++DIVLKVAAQV
Sbjct  124  LYLGMVVSGGEEGARNGPSLMPGGSFEAYKYVKDIVLKVAAQV  166



>ref|XP_010100892.1| 6-phosphogluconate dehydrogenase [Morus notabilis]
 gb|EXB85816.1| 6-phosphogluconate dehydrogenase [Morus notabilis]
Length=488

 Score =   300 bits (768),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 145/170 (85%), Positives = 158/170 (93%), Gaps = 3/170 (2%)
 Frame = +2

Query  179  MATP---TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYG  349
            MA P   TRIGL+GLAVMGQNLALNIA+KGFPISVYNRT SKVDETVERAK EGNLPL+G
Sbjct  1    MAPPSNLTRIGLSGLAVMGQNLALNIAEKGFPISVYNRTPSKVDETVERAKQEGNLPLFG  60

Query  350  FHDPESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREK  529
            FHDPESF+ SIQKPRV+I+LVKAGAPVD+TIKTLSAY+EKGDCI+DGGNEWYENTERREK
Sbjct  61   FHDPESFVNSIQKPRVIIMLVKAGAPVDETIKTLSAYLEKGDCIVDGGNEWYENTERREK  120

Query  530  EVAELGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
             + ELGLLYLGMGVSGGEEGAR GPSLMPGGS +AYK+IEDI+ KVAAQV
Sbjct  121  AMTELGLLYLGMGVSGGEEGARNGPSLMPGGSKDAYKHIEDILHKVAAQV  170



>gb|KJB10517.1| hypothetical protein B456_001G205600 [Gossypium raimondii]
Length=504

 Score =   300 bits (768),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 153/168 (91%), Positives = 164/168 (98%), Gaps = 0/168 (0%)
 Frame = +2

Query  176  SMATPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFH  355
            +MA PTRIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETVERAK EG+LPL+GFH
Sbjct  19   TMAPPTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKQEGDLPLFGFH  78

Query  356  DPESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEV  535
            DPESF++SIQKPRV+I+LVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKE+
Sbjct  79   DPESFVQSIQKPRVIIMLVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEM  138

Query  536  AELGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            + LGLLYLGMGVSGGEEGAR GPSLMPGGSFEAYKYIEDI+LKVAAQV
Sbjct  139  SGLGLLYLGMGVSGGEEGARNGPSLMPGGSFEAYKYIEDILLKVAAQV  186



>gb|KJB10518.1| hypothetical protein B456_001G205600 [Gossypium raimondii]
Length=485

 Score =   299 bits (765),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 153/167 (92%), Positives = 163/167 (98%), Gaps = 0/167 (0%)
 Frame = +2

Query  179  MATPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHD  358
            MA PTRIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETVERAK EG+LPL+GFHD
Sbjct  1    MAPPTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKQEGDLPLFGFHD  60

Query  359  PESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVA  538
            PESF++SIQKPRV+I+LVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKE++
Sbjct  61   PESFVQSIQKPRVIIMLVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEMS  120

Query  539  ELGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
             LGLLYLGMGVSGGEEGAR GPSLMPGGSFEAYKYIEDI+LKVAAQV
Sbjct  121  GLGLLYLGMGVSGGEEGARNGPSLMPGGSFEAYKYIEDILLKVAAQV  167



>tpg|DAA55929.1| TPA: 6-phosphogluconate dehydrogenase2 [Zea mays]
Length=480

 Score =   298 bits (764),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 141/163 (87%), Positives = 155/163 (95%), Gaps = 0/163 (0%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
            TRIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETV+RAK EGNLP++GFHDP SF
Sbjct  4    TRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVQRAKVEGNLPVFGFHDPASF  63

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            + SIQKPRVVI+LVKAGAPVDQTI TL+A++++GDCI+DGGNEWYENTERREK + E GL
Sbjct  64   VSSIQKPRVVIMLVKAGAPVDQTIATLAAHLDQGDCIVDGGNEWYENTERREKAMEERGL  123

Query  551  LYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LYLGMGVSGGEEGAR GPSLMPGGSFEAYKYIEDI+LKVAAQV
Sbjct  124  LYLGMGVSGGEEGARNGPSLMPGGSFEAYKYIEDILLKVAAQV  166



>gb|ACN35899.1| unknown [Zea mays]
Length=480

 Score =   298 bits (764),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 141/163 (87%), Positives = 155/163 (95%), Gaps = 0/163 (0%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
            TRIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETV+RAK EGNLP++GFHDP SF
Sbjct  4    TRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVQRAKVEGNLPVFGFHDPASF  63

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            + SIQKPRVVI+LVKAGAPVDQTI TL+A++++GDCI+DGGNEWYENTERREK + E GL
Sbjct  64   VSSIQKPRVVIMLVKAGAPVDQTIATLAAHLDQGDCIVDGGNEWYENTERREKAMEERGL  123

Query  551  LYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LYLGMGVSGGEEGAR GPSLMPGGSFEAYKYIEDI+LKVAAQV
Sbjct  124  LYLGMGVSGGEEGARNGPSLMPGGSFEAYKYIEDILLKVAAQV  166



>ref|NP_001104910.1| NADPH producing dehydrogenase of the oxidative pentose phosphate 
pathway [Zea mays]
 gb|AAC27702.1| putative cytosolic 6-phosphogluconate dehydrogenase [Zea mays]
Length=484

 Score =   298 bits (764),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 141/163 (87%), Positives = 155/163 (95%), Gaps = 0/163 (0%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
            TRIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETV+RAK EGNLP++GFHDP SF
Sbjct  4    TRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVQRAKVEGNLPVFGFHDPASF  63

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            + SIQKPRVVI+LVKAGAPVDQTI TL+A++++GDCI+DGGNEWYENTERREK + E GL
Sbjct  64   VSSIQKPRVVIMLVKAGAPVDQTIATLAAHLDQGDCIVDGGNEWYENTERREKAMEERGL  123

Query  551  LYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LYLGMGVSGGEEGAR GPSLMPGGSFEAYKYIEDI+LKVAAQV
Sbjct  124  LYLGMGVSGGEEGARNGPSLMPGGSFEAYKYIEDILLKVAAQV  166



>ref|XP_003557150.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1 [Brachypodium distachyon]
Length=479

 Score =   298 bits (762),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 141/163 (87%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
            TRIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETV+RAK EGNLPLYGFHDP SF
Sbjct  4    TRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVQRAKIEGNLPLYGFHDPASF  63

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            + SIQKPRVVI+LVKAGAPVDQTI TL+A++E+GDCIIDGGNEWYENTERREK + E GL
Sbjct  64   VNSIQKPRVVIMLVKAGAPVDQTIATLAAHLEQGDCIIDGGNEWYENTERREKAMEERGL  123

Query  551  LYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LYLGMGVSGGEEGAR GPS+MPGGS EAY+YIEDI+LKV+AQV
Sbjct  124  LYLGMGVSGGEEGARHGPSMMPGGSLEAYQYIEDILLKVSAQV  166



>gb|AHL19963.1| 6-phosphogluconate dehydrogenase [Hibiscus cannabinus]
Length=485

 Score =   297 bits (761),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 154/167 (92%), Positives = 162/167 (97%), Gaps = 0/167 (0%)
 Frame = +2

Query  179  MATPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHD  358
            MA PTRIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETVERAK EG+LP+YGFHD
Sbjct  1    MAPPTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKQEGDLPVYGFHD  60

Query  359  PESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVA  538
            PESFI+SIQKPRVVI+LVKAGAPVDQTIKTLSAYM+KGDCIIDGGNEWYENTERREKE+ 
Sbjct  61   PESFIQSIQKPRVVIMLVKAGAPVDQTIKTLSAYMDKGDCIIDGGNEWYENTERREKEMP  120

Query  539  ELGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
             LGLLYLGMGVSGGEEGAR GPSLMPGGSFEAYKYIEDI+LKVAAQV
Sbjct  121  GLGLLYLGMGVSGGEEGARNGPSLMPGGSFEAYKYIEDILLKVAAQV  167



>emb|CDM86736.1| unnamed protein product [Triticum aestivum]
Length=479

 Score =   297 bits (760),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 140/163 (86%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
            TRIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETV+RAK EGNLPLYGFHDP SF
Sbjct  4    TRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVQRAKLEGNLPLYGFHDPASF  63

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            + SIQKPRVVI+LVKAGAPVDQTI TL+A++E+GDCI+DGGNEWYENTERREK + E GL
Sbjct  64   VNSIQKPRVVIMLVKAGAPVDQTIATLAAHLEQGDCIVDGGNEWYENTERREKAMEERGL  123

Query  551  LYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LYLGMGVSGGEEGAR GPS+MPGGS EAY+YIEDI+LKV+AQV
Sbjct  124  LYLGMGVSGGEEGARHGPSMMPGGSLEAYQYIEDILLKVSAQV  166



>ref|XP_009117953.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like [Brassica rapa]
 ref|XP_009117961.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like [Brassica rapa]
 ref|XP_009117968.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like [Brassica rapa]
Length=486

 Score =   296 bits (758),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 144/164 (88%), Positives = 152/164 (93%), Gaps = 0/164 (0%)
 Frame = +2

Query  188  PTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPES  367
            PTRIGLAGLAVMGQNLALNIA KG PISV NRTTSKVD+TVERAK EGNLP+ GFH PES
Sbjct  5    PTRIGLAGLAVMGQNLALNIASKGCPISVSNRTTSKVDKTVERAKKEGNLPVCGFHAPES  64

Query  368  FIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELG  547
            F+ SIQKPRVVI+LVKAGAPVDQTIKTLSAY+EKGDCI+DGGNEWYENTERREK VAE G
Sbjct  65   FVNSIQKPRVVIMLVKAGAPVDQTIKTLSAYLEKGDCIVDGGNEWYENTERREKAVAENG  124

Query  548  LLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
             LYLGMGVSGGEEGAR GPS+MPGGSFEAYK IEDI+LKVAAQV
Sbjct  125  FLYLGMGVSGGEEGARNGPSMMPGGSFEAYKNIEDILLKVAAQV  168



>gb|EMT22120.1| 6-phosphogluconate dehydrogenase, decarboxylating [Aegilops tauschii]
Length=595

 Score =   297 bits (761),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 140/163 (86%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
            TRIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETV+RAK EGNLPLYGFHDP SF
Sbjct  120  TRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVQRAKLEGNLPLYGFHDPASF  179

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            + SIQKPRVVI+LVKAGAPVDQTI TL+A++E+GDCI+DGGNEWYENTERREK + E GL
Sbjct  180  VNSIQKPRVVIMLVKAGAPVDQTIATLAAHLEQGDCIVDGGNEWYENTERREKAMEERGL  239

Query  551  LYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LYLGMGVSGGEEGAR GPS+MPGGS EAY+YIEDI+LKV+AQV
Sbjct  240  LYLGMGVSGGEEGARHGPSMMPGGSLEAYQYIEDILLKVSAQV  282



>ref|XP_011011766.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like [Populus euphratica]
 ref|XP_011011767.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like [Populus euphratica]
Length=471

 Score =   290 bits (742),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 136/153 (89%), Positives = 149/153 (97%), Gaps = 0/153 (0%)
 Frame = +2

Query  221  MGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESFIRSIQKPRVV  400
            MGQNLALNIA+KGFPISVYNR+TSKVDETVERAK EG+LPLYGFHDPESF++SIQKPRV+
Sbjct  1    MGQNLALNIAEKGFPISVYNRSTSKVDETVERAKKEGDLPLYGFHDPESFVKSIQKPRVI  60

Query  401  IILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGLLYLGMGVSGG  580
            I+LVKAG+PVDQTIKTLSAY+EKGDCIIDGGNEWYENTERREK +AELGLLYLGMGVSGG
Sbjct  61   IMLVKAGSPVDQTIKTLSAYLEKGDCIIDGGNEWYENTERREKAMAELGLLYLGMGVSGG  120

Query  581  EEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            EEGAR GPS+MPGGS EA+KYIEDI+LKVAAQV
Sbjct  121  EEGARNGPSMMPGGSLEAFKYIEDILLKVAAQV  153



>gb|ADP03065.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
Length=483

 Score =   288 bits (738),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 135/163 (83%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
            +RIGLAGLAVMGQNLALNIA+KGFPISVYNR++ KVDETVERAK EGNLP+ GFHDP+ F
Sbjct  7    SRIGLAGLAVMGQNLALNIAEKGFPISVYNRSSEKVDETVERAKVEGNLPVKGFHDPKDF  66

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            + SIQKPRV+I+LVKAG PVD+TI+TLSA+ME+GDCI+DGGNEWYENTERR++   + GL
Sbjct  67   VNSIQKPRVIILLVKAGLPVDKTIETLSAHMEEGDCIVDGGNEWYENTERRQEAAKQKGL  126

Query  551  LYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LYLGMGVSGGEEGAR GPSLMPGGSFEAYKYIEDIVLKVAAQV
Sbjct  127  LYLGMGVSGGEEGARHGPSLMPGGSFEAYKYIEDIVLKVAAQV  169



>gb|ADP03058.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03074.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03084.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03086.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
Length=483

 Score =   288 bits (738),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 135/163 (83%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
            +RIGLAGLAVMGQNLALNIA+KGFPISVYNR++ KVDETVERAK EGNLP+ GFHDP+ F
Sbjct  7    SRIGLAGLAVMGQNLALNIAEKGFPISVYNRSSEKVDETVERAKVEGNLPVKGFHDPKDF  66

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            + SIQKPRV+I+LVKAG PVD+TI+TLSA+ME+GDCI+DGGNEWYENTERR++   + GL
Sbjct  67   VNSIQKPRVIILLVKAGLPVDKTIETLSAHMEEGDCIVDGGNEWYENTERRQEAAKQKGL  126

Query  551  LYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LYLGMGVSGGEEGAR GPSLMPGGSFEAYKYIEDIVLKVAAQV
Sbjct  127  LYLGMGVSGGEEGARHGPSLMPGGSFEAYKYIEDIVLKVAAQV  169



>gb|ADP03055.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03056.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03060.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03061.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03062.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03063.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03064.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03069.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03071.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03072.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03073.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03075.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03077.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03078.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03081.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03085.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03087.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03089.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
Length=483

 Score =   288 bits (738),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 135/163 (83%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
            +RIGLAGLAVMGQNLALNIA+KGFPISVYNR++ KVDETVERAK EGNLP+ GFHDP+ F
Sbjct  7    SRIGLAGLAVMGQNLALNIAEKGFPISVYNRSSEKVDETVERAKVEGNLPVKGFHDPKDF  66

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            + SIQKPRV+I+LVKAG PVD+TI+TLSA+ME+GDCI+DGGNEWYENTERR++   + GL
Sbjct  67   VNSIQKPRVIILLVKAGLPVDKTIETLSAHMEEGDCIVDGGNEWYENTERRQEAAKQKGL  126

Query  551  LYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LYLGMGVSGGEEGAR GPSLMPGGSFEAYKYIEDIVLKVAAQV
Sbjct  127  LYLGMGVSGGEEGARHGPSLMPGGSFEAYKYIEDIVLKVAAQV  169



>gb|ADP03083.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
Length=483

 Score =   288 bits (738),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 135/163 (83%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
            +RIGLAGLAVMGQNLALNIA+KGFPISVYNR++ KVDETVERAK EGNLP+ GFHDP+ F
Sbjct  7    SRIGLAGLAVMGQNLALNIAEKGFPISVYNRSSEKVDETVERAKVEGNLPVKGFHDPKDF  66

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            + SIQKPRV+I+LVKAG PVD+TI+TLSA+ME+GDCI+DGGNEWYENTERR++   + GL
Sbjct  67   VNSIQKPRVIILLVKAGLPVDKTIETLSAHMEEGDCIVDGGNEWYENTERRQEAAKQKGL  126

Query  551  LYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LYLGMGVSGGEEGAR GPSLMPGGSFEAYKYIEDIVLKVAAQV
Sbjct  127  LYLGMGVSGGEEGARHGPSLMPGGSFEAYKYIEDIVLKVAAQV  169



>gb|ADP03059.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03067.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03068.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03076.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03079.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03082.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03088.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
Length=483

 Score =   288 bits (737),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 135/163 (83%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
            +RIGLAGLAVMGQNLALNIA+KGFPISVYNR++ KVDETVERAK EGNLP+ GFHDP+ F
Sbjct  7    SRIGLAGLAVMGQNLALNIAEKGFPISVYNRSSEKVDETVERAKVEGNLPVKGFHDPKDF  66

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            + SIQKPRV+I+LVKAG PVD+TI+TLSA+ME+GDCI+DGGNEWYENTERR++   + GL
Sbjct  67   VNSIQKPRVIILLVKAGLPVDKTIETLSAHMEEGDCIVDGGNEWYENTERRQEAAKQKGL  126

Query  551  LYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LYLGMGVSGGEEGAR GPSLMPGGSFEAYKYIEDIVLKVAAQV
Sbjct  127  LYLGMGVSGGEEGARHGPSLMPGGSFEAYKYIEDIVLKVAAQV  169



>gb|ADP03070.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
Length=483

 Score =   288 bits (737),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 135/163 (83%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
            +RIGLAGLAVMGQNLALNIA+KGFPISVYNR++ KVDETVERAK EGNLP+ GFHDP+ F
Sbjct  7    SRIGLAGLAVMGQNLALNIAEKGFPISVYNRSSEKVDETVERAKVEGNLPVKGFHDPKDF  66

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            + SIQKPRV+I+LVKAG PVD+TI+TLSA+ME+GDCI+DGGNEWYENTERR++   + GL
Sbjct  67   VNSIQKPRVIILLVKAGLPVDKTIETLSAHMEEGDCIVDGGNEWYENTERRQEAAKQKGL  126

Query  551  LYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LYLGMGVSGGEEGAR GPSLMPGGSFEAYKYIEDIVLKVAAQV
Sbjct  127  LYLGMGVSGGEEGARHGPSLMPGGSFEAYKYIEDIVLKVAAQV  169



>gb|ADP03057.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03066.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03080.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
Length=483

 Score =   288 bits (737),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 135/163 (83%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
            +RIGLAGLAVMGQNLALNIA+KGFPISVYNR++ KVDETVERAK EGNLP+ GFHDP+ F
Sbjct  7    SRIGLAGLAVMGQNLALNIAEKGFPISVYNRSSEKVDETVERAKVEGNLPVRGFHDPKDF  66

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            + SIQKPRV+I+LVKAG PVD+TI+TLSA+ME+GDCI+DGGNEWYENTERR++   + GL
Sbjct  67   VNSIQKPRVIILLVKAGLPVDKTIETLSAHMEEGDCIVDGGNEWYENTERRQEAAKQKGL  126

Query  551  LYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LYLGMGVSGGEEGAR GPSLMPGGSFEAYKYIEDIVLKVAAQV
Sbjct  127  LYLGMGVSGGEEGARHGPSLMPGGSFEAYKYIEDIVLKVAAQV  169



>gb|ADP03318.1| 6-phosphogluconate dehydrogenase [Pinus pinaster]
Length=483

 Score =   287 bits (734),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
            +RIGLAGLAVMGQNLALNIA+KGFPISVYNR++ KVDETVERAK EGNLP+ GFHDP+ F
Sbjct  7    SRIGLAGLAVMGQNLALNIAEKGFPISVYNRSSEKVDETVERAKVEGNLPVKGFHDPKDF  66

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            + SIQKPRV+I+LVKAG PVD+TI+TLSA+ME+GDCI+DGGNEWYENTERR++   + GL
Sbjct  67   VNSIQKPRVIILLVKAGLPVDKTIETLSAHMEEGDCIVDGGNEWYENTERRQEAAKQKGL  126

Query  551  LYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LYLGMGVSGGEEGAR GPSLMPGGSFEAYKYIEDI+LKVAAQV
Sbjct  127  LYLGMGVSGGEEGARHGPSLMPGGSFEAYKYIEDILLKVAAQV  169



>gb|EMT33408.1| 6-phosphogluconate dehydrogenase, decarboxylating [Aegilops tauschii]
Length=996

 Score =   298 bits (764),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 140/163 (86%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
            TRIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETV+RAK EGNLPLYGFHDP SF
Sbjct  4    TRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVQRAKLEGNLPLYGFHDPASF  63

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            + SIQKPRVVI+LVKAGAPVDQTI TL+A++E+GDCI+DGGNEWYENTERREK + E GL
Sbjct  64   VNSIQKPRVVIMLVKAGAPVDQTIATLAAHLEQGDCIVDGGNEWYENTERREKAMEERGL  123

Query  551  LYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LYLGMGVSGGEEGAR GPS+MPGGS EAY+YIEDI+LKV+AQV
Sbjct  124  LYLGMGVSGGEEGARHGPSMMPGGSLEAYQYIEDILLKVSAQV  166



>gb|AAC79950.1| 6-phosphogluconate dehydrogenase isoenzyme B [Zea mays]
Length=178

 Score =   273 bits (699),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 142/163 (87%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
            TRIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETV+RAKAEGNLP+YGFHDP SF
Sbjct  4    TRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVQRAKAEGNLPVYGFHDPASF  63

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            + SIQKPRVVI+LVKAGAPVDQTI TL+A++E+GDCIIDGGNE YENTERREK + E GL
Sbjct  64   VNSIQKPRVVIMLVKAGAPVDQTIATLAAHLEQGDCIIDGGNERYENTERREKAMEERGL  123

Query  551  LYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LYLGMGVSGG EGAR GPSLMPGGSF+AYKY+EDIVLKVAAQV
Sbjct  124  LYLGMGVSGGGEGARNGPSLMPGGSFDAYKYVEDIVLKVAAQV  166



>ref|NP_001236726.1| 6-phosphogluconate dehydrogenase [Glycine max]
 dbj|BAA22812.1| 6-phosphogluconate dehydrogenase [Glycine max]
Length=511

 Score =   284 bits (727),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 152/168 (90%), Positives = 162/168 (96%), Gaps = 1/168 (1%)
 Frame = +2

Query  179  MATP-TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFH  355
            MA P T IGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETVERAK EGNLP+YG+H
Sbjct  1    MAQPSTGIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKQEGNLPVYGYH  60

Query  356  DPESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEV  535
            DPE+F+ SIQKPRV+I+LVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEV
Sbjct  61   DPEAFVHSIQKPRVIIMLVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEV  120

Query  536  AELGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            AELGLLYLG+GVSGGEEGAR GPSLMPGGSFEA+KYIEDI+LKVAAQV
Sbjct  121  AELGLLYLGLGVSGGEEGARNGPSLMPGGSFEAFKYIEDILLKVAAQV  168



>ref|XP_001764215.1| predicted protein [Physcomitrella patens]
 gb|EDQ71056.1| predicted protein [Physcomitrella patens]
Length=500

 Score =   283 bits (724),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 137/163 (84%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
            +RIGLAGLAVMGQNLALNIA+KGFPISVYNRT SKVDETVERAK EG+LPL GF DP+ F
Sbjct  12   SRIGLAGLAVMGQNLALNIAEKGFPISVYNRTDSKVDETVERAKEEGDLPLVGFKDPKEF  71

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            + SIQKPR +IILVKAGAPVDQTI+TLS YME GDCIIDGGNEWYENTERR K+VAE GL
Sbjct  72   VLSIQKPRSIIILVKAGAPVDQTIQTLSQYMEPGDCIIDGGNEWYENTERRAKQVAEKGL  131

Query  551  LYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LYLGMGVSGGEEGAR GPS+MPGG+ EAY YIED+V KVAAQV
Sbjct  132  LYLGMGVSGGEEGARNGPSMMPGGTEEAYHYIEDVVSKVAAQV  174



>ref|XP_001759464.1| predicted protein [Physcomitrella patens]
 gb|EDQ75766.1| predicted protein [Physcomitrella patens]
Length=504

 Score =   281 bits (720),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 135/163 (83%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
            +RIGLAGLAVMGQNLALNIA+KGFPISVYNR+ SKVDETVERAK EGNLP+ GF DP  F
Sbjct  7    SRIGLAGLAVMGQNLALNIAEKGFPISVYNRSASKVDETVERAKEEGNLPVKGFKDPCEF  66

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            ++SIQKPR +IILVKAG+PVDQTI+ LS Y+EKGDCIIDGGNEWYENTERR ++V E GL
Sbjct  67   VKSIQKPRCIIILVKAGSPVDQTIELLSKYLEKGDCIIDGGNEWYENTERRAEKVKEKGL  126

Query  551  LYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LYLGMGVSGGEEGAR GPSLMPGG+ EAYKYIEDIV KVAAQV
Sbjct  127  LYLGMGVSGGEEGARHGPSLMPGGTLEAYKYIEDIVQKVAAQV  169



>ref|XP_001770880.1| predicted protein [Physcomitrella patens]
 gb|EDQ64210.1| predicted protein [Physcomitrella patens]
Length=500

 Score =   281 bits (720),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
            +RIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETVERAK EG+LPL G+ DP+ F
Sbjct  12   SRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKEEGDLPLTGYKDPKEF  71

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            + SIQKPR +I+LVKAGAPVDQTI+TL+ YME GDCIIDGGNEWYENTERR K++AE GL
Sbjct  72   VMSIQKPRSIILLVKAGAPVDQTIQTLAQYMEPGDCIIDGGNEWYENTERRAKQIAEKGL  131

Query  551  LYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LYLGMGVSGGEEGAR GPS+MPGG+ EAY YIED+V KVAAQV
Sbjct  132  LYLGMGVSGGEEGARNGPSMMPGGTEEAYHYIEDVVKKVAAQV  174



>ref|XP_001785214.1| predicted protein [Physcomitrella patens]
 gb|EDQ49993.1| predicted protein [Physcomitrella patens]
Length=506

 Score =   276 bits (705),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 133/163 (82%), Positives = 144/163 (88%), Gaps = 0/163 (0%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
            +RIGLAGLAVMGQNLALNIA KGFPISVYNR+ +KVDETVERAK EGNLP+ GF DP  F
Sbjct  7    SRIGLAGLAVMGQNLALNIAQKGFPISVYNRSANKVDETVERAKEEGNLPVKGFKDPAEF  66

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            + SIQKPR VIILVKAG+PVDQTI+ LS Y+E+GDCIIDGGNEWYENTERR + V   GL
Sbjct  67   VNSIQKPRCVIILVKAGSPVDQTIELLSKYLEEGDCIIDGGNEWYENTERRAETVKAKGL  126

Query  551  LYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LYLGMGVSGGEEGAR GPSLMPGG+ EAYKYIEDIV KVAAQV
Sbjct  127  LYLGMGVSGGEEGARHGPSLMPGGTLEAYKYIEDIVQKVAAQV  169



>ref|XP_002972874.1| hypothetical protein SELMODRAFT_98399 [Selaginella moellendorffii]
 gb|EFJ26095.1| hypothetical protein SELMODRAFT_98399 [Selaginella moellendorffii]
Length=491

 Score =   271 bits (694),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 130/163 (80%), Positives = 144/163 (88%), Gaps = 0/163 (0%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
            +RIGLAGLAVMGQNLALNI +KGFPISVYNRT SKVDETVERAKAEGNLPL G+ +P+ F
Sbjct  7    SRIGLAGLAVMGQNLALNIGEKGFPISVYNRTASKVDETVERAKAEGNLPLAGYRNPQDF  66

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            + SIQ+PR VIILVKAGAPVDQTI TL+ +ME GDCIIDGGNEWYENTERR     E GL
Sbjct  67   VLSIQRPRSVIILVKAGAPVDQTIATLAQFMEPGDCIIDGGNEWYENTERRIAAAKEKGL  126

Query  551  LYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LYLGMGVSGGEEGAR GPSLMPGG+ EAY+Y+ED+V K+AAQV
Sbjct  127  LYLGMGVSGGEEGARHGPSLMPGGTPEAYRYVEDVVKKIAAQV  169



>ref|XP_002305977.2| hypothetical protein POPTR_0004s10870g [Populus trichocarpa]
 gb|EEE86488.2| hypothetical protein POPTR_0004s10870g [Populus trichocarpa]
Length=472

 Score =   271 bits (693),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 143/164 (87%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = +2

Query  188  PTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPES  367
            PTRIGLAGLAVMGQNLALNIA+KGFP+SVYNR+TSKVDETVERAK EG+LPLYGFHDPES
Sbjct  7    PTRIGLAGLAVMGQNLALNIAEKGFPVSVYNRSTSKVDETVERAKKEGDLPLYGFHDPES  66

Query  368  FIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELG  547
            F++SIQKPRV+I+LV AG+PVDQTIKTLSAY+EKGDCIIDGGNEWYENTERREK +AELG
Sbjct  67   FVKSIQKPRVIIMLVMAGSPVDQTIKTLSAYLEKGDCIIDGGNEWYENTERREKAMAELG  126

Query  548  LLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LLYLGMG+SGGEEGAR G SL PGGSFEA+K IEDI+LKVAAQV
Sbjct  127  LLYLGMGLSGGEEGARNGISLTPGGSFEAFKSIEDILLKVAAQV  170



>ref|XP_010261979.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1, chloroplastic [Nelumbo nucifera]
Length=495

 Score =   271 bits (693),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 130/163 (80%), Positives = 145/163 (89%), Gaps = 0/163 (0%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
            +RIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDET+ERAK EGNLPL G + P  F
Sbjct  8    SRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETLERAKEEGNLPLTGHYSPRDF  67

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            + S+Q+PR VIILVKAG+PVDQTI  LS +M+ GDCIIDGGNEWYENTERR +EVA+ G+
Sbjct  68   VLSLQRPRSVIILVKAGSPVDQTIGALSQFMDPGDCIIDGGNEWYENTERRMREVADKGI  127

Query  551  LYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LYLGMGVSGGEEGAR GPSLMPGGS++AY  IEDIV KVAAQV
Sbjct  128  LYLGMGVSGGEEGARHGPSLMPGGSYQAYSNIEDIVKKVAAQV  170



>ref|XP_010273961.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic [Nelumbo nucifera]
 ref|XP_010273962.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic [Nelumbo nucifera]
 ref|XP_010273963.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic [Nelumbo nucifera]
Length=518

 Score =   271 bits (693),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 133/170 (78%), Positives = 149/170 (88%), Gaps = 1/170 (1%)
 Frame = +2

Query  170  ENSMATPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYG  349
            E SM T +RIGLAGLAVMGQNLALNIA+KGFPISVYNRTT+KVDET+ERA+ EGNLPL G
Sbjct  2    EASM-TLSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTTKVDETLERAQQEGNLPLTG  60

Query  350  FHDPESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREK  529
             + P  F+ S+Q+PR VIILVKAG+PVDQTI  LS +ME GDCIIDGGNEWYENTERR +
Sbjct  61   HYSPRDFVLSLQRPRSVIILVKAGSPVDQTIAALSEFMEAGDCIIDGGNEWYENTERRMR  120

Query  530  EVAELGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            EVA+ G+LYLGMGVSGGEEGAR GPSLMPGGS++AY  IEDIV KVAAQV
Sbjct  121  EVADRGILYLGMGVSGGEEGARHGPSLMPGGSYQAYLNIEDIVKKVAAQV  170



>ref|XP_002988062.1| hypothetical protein SELMODRAFT_127384 [Selaginella moellendorffii]
 gb|EFJ10854.1| hypothetical protein SELMODRAFT_127384 [Selaginella moellendorffii]
Length=491

 Score =   269 bits (688),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 129/163 (79%), Positives = 143/163 (88%), Gaps = 0/163 (0%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
            +RIGLAGLAVMGQNLALNI +KGFPISVYNRT  KVDETVERAKAEGNLPL G+ +P+ F
Sbjct  7    SRIGLAGLAVMGQNLALNIGEKGFPISVYNRTAGKVDETVERAKAEGNLPLAGYRNPQDF  66

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            + SIQ+PR VIILVKAGAPVDQTI TL+ +ME GDCIIDGGNEWYENTERR     E GL
Sbjct  67   VLSIQRPRSVIILVKAGAPVDQTIATLAQFMEPGDCIIDGGNEWYENTERRIAAAKEKGL  126

Query  551  LYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LYLGMGVSGGEEGAR GPSLMPGG+ EAY+Y+ED+V K+AAQV
Sbjct  127  LYLGMGVSGGEEGARHGPSLMPGGTPEAYRYVEDVVKKIAAQV  169



>ref|XP_002966753.1| hypothetical protein SELMODRAFT_168478 [Selaginella moellendorffii]
 ref|XP_002977996.1| hypothetical protein SELMODRAFT_268134 [Selaginella moellendorffii]
 gb|EFJ20653.1| hypothetical protein SELMODRAFT_268134 [Selaginella moellendorffii]
 gb|EFJ32780.1| hypothetical protein SELMODRAFT_168478 [Selaginella moellendorffii]
Length=487

 Score =   268 bits (686),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/163 (77%), Positives = 146/163 (90%), Gaps = 0/163 (0%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
            +R+GLAGLAVMGQNLALN+A+KGFPISVYNRT SKVD+TV+RA  EGNLPLYGF DP  F
Sbjct  10   SRLGLAGLAVMGQNLALNVAEKGFPISVYNRTASKVDDTVDRAAREGNLPLYGFKDPGEF  69

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            + S+QKPRV+IILVKAG PVD+TI+ LS+++E GDCIIDGGNEWYENTERR + V + GL
Sbjct  70   VASLQKPRVIIILVKAGRPVDETIELLSSFLEPGDCIIDGGNEWYENTERRAEAVRQKGL  129

Query  551  LYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LYLGMGVSGGEEGAR GPSLMPGG+ EA+KYIED+V K+AAQV
Sbjct  130  LYLGMGVSGGEEGARYGPSLMPGGAVEAFKYIEDVVKKIAAQV  172



>ref|XP_006856410.1| hypothetical protein AMTR_s00047p00215210 [Amborella trichopoda]
 gb|ERN17877.1| hypothetical protein AMTR_s00047p00215210 [Amborella trichopoda]
Length=492

 Score =   268 bits (684),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 131/167 (78%), Positives = 145/167 (87%), Gaps = 0/167 (0%)
 Frame = +2

Query  179  MATPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHD  358
            +AT +RIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVD+TV RA AEG LPL G   
Sbjct  3    VATLSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDDTVHRADAEGGLPLLGHRS  62

Query  359  PESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVA  538
            P+ FI SIQ+PR V+ILVKAG PVDQTI TLSA+ME GDC+IDGGNEWYENTERR +E +
Sbjct  63   PQDFILSIQRPRSVVILVKAGRPVDQTIATLSAFMEPGDCLIDGGNEWYENTERRIEEAS  122

Query  539  ELGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
              GLLYLGMGVSGGEEGAR GPSLMPGGSF+AY+ I DI+ KVAAQV
Sbjct  123  ARGLLYLGMGVSGGEEGARNGPSLMPGGSFDAYQNIRDILEKVAAQV  169



>gb|AFF18789.1| cytosolic 6-phosphogluconate dehydrogenase, partial [Dimocarpus 
longan]
Length=135

 Score =   255 bits (651),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 121/135 (90%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = +2

Query  179  MATPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHD  358
            M +PTRIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETVERAK EGNLPLYGF D
Sbjct  1    MVSPTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKQEGNLPLYGFRD  60

Query  359  PESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVA  538
            PESF++SIQKPRV+I+LVKAGAPVDQTIKTLS YMEKGDCIIDGGNEWYENTERR + +A
Sbjct  61   PESFVQSIQKPRVIIMLVKAGAPVDQTIKTLSVYMEKGDCIIDGGNEWYENTERRAQAMA  120

Query  539  ELGLLYLGMGVSGGE  583
            ELGLLYLGMGVSGGE
Sbjct  121  ELGLLYLGMGVSGGE  135



>ref|XP_006849590.1| hypothetical protein AMTR_s00024p00196750 [Amborella trichopoda]
 gb|ERN11171.1| hypothetical protein AMTR_s00024p00196750 [Amborella trichopoda]
Length=492

 Score =   266 bits (680),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 144/166 (87%), Gaps = 0/166 (0%)
 Frame = +2

Query  182  ATPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDP  361
            AT +RIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVD+TV RA AEG LPL+G   P
Sbjct  4    ATLSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDDTVHRANAEGGLPLFGHRSP  63

Query  362  ESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAE  541
            + FI SIQ+PR ++ILVKAG PVDQTI+TLS +ME GDC+IDGGNEWYENTERR +E + 
Sbjct  64   QDFILSIQRPRSIVILVKAGRPVDQTIETLSTFMEPGDCLIDGGNEWYENTERRIEEASA  123

Query  542  LGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
             GLLYLGMGVSGGEEGAR GPSLMPGGSF+AY+ I DI+ K AAQV
Sbjct  124  RGLLYLGMGVSGGEEGARNGPSLMPGGSFDAYQNIRDILEKAAAQV  169



>gb|KEH21177.1| decarboxylating-like 6-phosphogluconate dehydrogenase [Medicago 
truncatula]
Length=495

 Score =   265 bits (676),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 146/166 (88%), Gaps = 0/166 (0%)
 Frame = +2

Query  182  ATPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDP  361
            +T +RIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETV+RA  EG+LPL G + P
Sbjct  4    STLSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVDRAHREGSLPLTGQYSP  63

Query  362  ESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAE  541
              F+ S+Q+PR VIILVKAGAPVDQTI  LS +ME GDCIIDGGNEWYENTERR ++++E
Sbjct  64   REFVLSLQRPRSVIILVKAGAPVDQTISALSDHMEPGDCIIDGGNEWYENTERRIQQISE  123

Query  542  LGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
             G+LYLGMGVSGGEEGAR GPSLMPGGS++AY  I+DI+ KVAAQV
Sbjct  124  KGILYLGMGVSGGEEGARNGPSLMPGGSYQAYSNIQDILTKVAAQV  169



>gb|AFF18788.1| 6-phosphogluconate dehydrogenase, partial [Dimocarpus longan]
Length=131

 Score =   251 bits (642),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 119/131 (91%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
            TRIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETVERAK EG+LP+YG+HDPE+F
Sbjct  1    TRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKQEGDLPVYGYHDPEAF  60

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            ++SIQKPRV+I+LVKAGAPVDQTIKTLS YMEKGDCIIDGGNEWYENTERREK VAELGL
Sbjct  61   VQSIQKPRVIIMLVKAGAPVDQTIKTLSTYMEKGDCIIDGGNEWYENTERREKAVAELGL  120

Query  551  LYLGMGVSGGE  583
            LYLGMGVSGGE
Sbjct  121  LYLGMGVSGGE  131



>gb|KJB52238.1| hypothetical protein B456_008G251800 [Gossypium raimondii]
Length=444

 Score =   262 bits (670),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 127/168 (76%), Positives = 146/168 (87%), Gaps = 2/168 (1%)
 Frame = +2

Query  182  ATP--TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFH  355
            A+P  +RIGLAGLAVMGQNLALN+A+KGFPISVYNRTTSKVDETV+RA+ EG LPL+G +
Sbjct  3    ASPALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVQRAQDEGQLPLFGHY  62

Query  356  DPESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEV  535
             P  F+ SI++PR V+ILVKAG+PVDQTI  LS +ME GDCIIDGGNEWYENTERR +EV
Sbjct  63   TPREFVLSIKRPRSVVILVKAGSPVDQTIAALSDHMEPGDCIIDGGNEWYENTERRIQEV  122

Query  536  AELGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            +  GLLYLGMGVSGGEEGAR GPSLMPGGS +AY  I+DI+ KVAAQV
Sbjct  123  SNKGLLYLGMGVSGGEEGARNGPSLMPGGSHQAYSNIQDILEKVAAQV  170



>ref|XP_002275970.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1, chloroplastic [Vitis vinifera]
Length=494

 Score =   263 bits (673),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 144/166 (87%), Gaps = 0/166 (0%)
 Frame = +2

Query  182  ATPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDP  361
            +T +RIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDET++RA  EG+LPL G + P
Sbjct  4    STLSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETLDRAHREGHLPLSGHYSP  63

Query  362  ESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAE  541
              F+ SIQ+PR ++ILVKAGAPVDQTI  LS +ME GDCIIDGGNEWYENTERR  E + 
Sbjct  64   RDFVLSIQRPRSIVILVKAGAPVDQTIAALSEHMEAGDCIIDGGNEWYENTERRIVEASG  123

Query  542  LGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
             G+LYLGMGVSGGEEGAR GPSLMPGGS++AY+ IEDIV KVAAQV
Sbjct  124  KGILYLGMGVSGGEEGARHGPSLMPGGSYQAYQNIEDIVKKVAAQV  169



>emb|CAN63456.1| hypothetical protein VITISV_008240 [Vitis vinifera]
Length=494

 Score =   263 bits (672),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 144/166 (87%), Gaps = 0/166 (0%)
 Frame = +2

Query  182  ATPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDP  361
            +T +RIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDET++RA  EG+LPL G + P
Sbjct  4    STLSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETLDRAHREGHLPLSGHYXP  63

Query  362  ESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAE  541
              F+ SIQ+PR ++ILVKAGAPVDQTI  LS +ME GDCIIDGGNEWYENTERR  E + 
Sbjct  64   RDFVLSIQRPRSIVILVKAGAPVDQTIAALSEHMEAGDCIIDGGNEWYENTERRIVEASG  123

Query  542  LGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
             G+LYLGMGVSGGEEGAR GPSLMPGGS++AY+ IEDIV KVAAQV
Sbjct  124  KGILYLGMGVSGGEEGARHGPSLMPGGSYQAYQNIEDIVKKVAAQV  169



>ref|XP_004503648.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1, chloroplastic-like [Cicer arietinum]
Length=494

 Score =   262 bits (669),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 125/166 (75%), Positives = 145/166 (87%), Gaps = 0/166 (0%)
 Frame = +2

Query  182  ATPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDP  361
            +T +RIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETV+RA  EG+LPL G + P
Sbjct  4    STLSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVDRAHREGSLPLTGQYSP  63

Query  362  ESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAE  541
              F+ S+Q+PR VIILVKAG PVDQTI  LS +ME GDCIIDGGNEWYENTERR ++++ 
Sbjct  64   REFVLSLQRPRSVIILVKAGNPVDQTIAALSDHMEPGDCIIDGGNEWYENTERRIQQISN  123

Query  542  LGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
             G+LYLGMGVSGGEEGAR GPSLMPGGS++AY  I+DI++KVAAQV
Sbjct  124  KGILYLGMGVSGGEEGARNGPSLMPGGSYQAYSNIQDILMKVAAQV  169



>ref|XP_007040418.1| 6-phosphogluconate dehydrogenase family protein isoform 2 [Theobroma 
cacao]
 gb|EOY24919.1| 6-phosphogluconate dehydrogenase family protein isoform 2 [Theobroma 
cacao]
Length=492

 Score =   262 bits (669),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 127/168 (76%), Positives = 146/168 (87%), Gaps = 2/168 (1%)
 Frame = +2

Query  182  ATP--TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFH  355
            A+P  +RIGLAGLAVMGQNLALN+A+KGFPISVYNRTTSKVDETV+RA+ EG LPL+G +
Sbjct  3    ASPALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVQRAQEEGQLPLFGQY  62

Query  356  DPESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEV  535
             P  F+ S+Q+PR V+ILVKAG+PVDQTI  LS +ME GDCIIDGGNEWYENTERR +EV
Sbjct  63   SPREFVLSVQRPRSVVILVKAGSPVDQTIAALSDHMEPGDCIIDGGNEWYENTERRIQEV  122

Query  536  AELGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            +  GLLYLGMGVSGGEEGAR GPSLMPGGS +AY  I+DI+ KVAAQV
Sbjct  123  SNKGLLYLGMGVSGGEEGARNGPSLMPGGSHQAYSNIKDILEKVAAQV  170



>ref|XP_008238987.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic [Prunus mume]
Length=495

 Score =   262 bits (669),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 130/168 (77%), Positives = 144/168 (86%), Gaps = 2/168 (1%)
 Frame = +2

Query  182  ATP--TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFH  355
            A+P  +RIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETV+RA  EGNLPL+G +
Sbjct  3    ASPALSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVDRAHNEGNLPLFGQY  62

Query  356  DPESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEV  535
            +P  F+ SIQ+PR VIILVKAGAPVDQTI  LSA+ME GD IIDGGNEWYENTERR  E 
Sbjct  63   NPRDFVLSIQRPRSVIILVKAGAPVDQTIAALSAHMEPGDAIIDGGNEWYENTERRIAEA  122

Query  536  AELGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
               GLLYLGMGVSGGEEGAR GPSLMPGGS +AY  ++DI+ KVAAQV
Sbjct  123  TGRGLLYLGMGVSGGEEGARHGPSLMPGGSHQAYTNVQDILHKVAAQV  170



>ref|XP_009140108.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic [Brassica rapa]
Length=487

 Score =   261 bits (668),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 141/166 (85%), Gaps = 0/166 (0%)
 Frame = +2

Query  182  ATPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDP  361
            A  +RIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDET++RA  EG LP+ G + P
Sbjct  4    AALSRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETLDRASEEGKLPVSGQYSP  63

Query  362  ESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAE  541
              F+ SIQ+PR VIILVKAGAPVDQTI  LS YME GDCIIDGGNEWY+NTERR  E  +
Sbjct  64   RDFVLSIQRPRSVIILVKAGAPVDQTISALSEYMEPGDCIIDGGNEWYQNTERRIVEAEK  123

Query  542  LGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
             GLLYLGMGVSGGEEGAR GPSLMPGGSF+AY  ++DI+ KVAAQV
Sbjct  124  KGLLYLGMGVSGGEEGARNGPSLMPGGSFQAYNNVKDILEKVAAQV  169



>gb|AIU64845.1| 6-phosphogluconate dehydrogenase [Prunus sibirica]
Length=495

 Score =   261 bits (668),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 130/168 (77%), Positives = 144/168 (86%), Gaps = 2/168 (1%)
 Frame = +2

Query  182  ATP--TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFH  355
            A+P  +RIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETV+RA  EGNLPL+G +
Sbjct  3    ASPALSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVDRAHNEGNLPLFGQY  62

Query  356  DPESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEV  535
            +P  F+ SIQ+PR VIILVKAGAPVDQTI  LSA+ME GD IIDGGNEWYENTERR  E 
Sbjct  63   NPRDFVLSIQRPRSVIILVKAGAPVDQTIAALSAHMEPGDAIIDGGNEWYENTERRIAEA  122

Query  536  AELGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
               GLLYLGMGVSGGEEGAR GPSLMPGGS +AY  ++DI+ KVAAQV
Sbjct  123  TGRGLLYLGMGVSGGEEGARHGPSLMPGGSHQAYTNVQDILHKVAAQV  170



>ref|NP_176601.1| 6-phosphogluconate dehydrogenase, decarboxylating 1 [Arabidopsis 
thaliana]
 sp|Q9SH69.1|6PGD1_ARATH RecName: Full=6-phosphogluconate dehydrogenase, decarboxylating 
1, chloroplastic [Arabidopsis thaliana]
 gb|AAF24560.1|AC007764_2 F22C12.5 [Arabidopsis thaliana]
 gb|AAO42814.1| At1g64190 [Arabidopsis thaliana]
 dbj|BAE99587.1| putative 6-phosphogluconate dehydrogenase [Arabidopsis thaliana]
 gb|AEE34207.1| 6-phosphogluconate dehydrogenase, decarboxylating 1 [Arabidopsis 
thaliana]
Length=487

 Score =   261 bits (667),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 141/166 (85%), Gaps = 0/166 (0%)
 Frame = +2

Query  182  ATPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDP  361
            A  +RIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDET++RA  EGNLP+ G + P
Sbjct  4    AALSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETLDRAAVEGNLPVSGQYSP  63

Query  362  ESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAE  541
              F+ SIQ+PR +IILVKAGAPVDQTI   S YME GDCIIDGGNEWY+NTERR  E  +
Sbjct  64   RDFVLSIQRPRSLIILVKAGAPVDQTIDAFSEYMEPGDCIIDGGNEWYQNTERRISEAEQ  123

Query  542  LGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
             GLLYLGMGVSGGEEGAR GPSLMPGGSF+AY  I+DI+ KVAAQV
Sbjct  124  KGLLYLGMGVSGGEEGARNGPSLMPGGSFQAYDNIKDILEKVAAQV  169



>emb|CDY44457.1| BnaCnng11100D [Brassica napus]
Length=487

 Score =   261 bits (667),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 141/166 (85%), Gaps = 0/166 (0%)
 Frame = +2

Query  182  ATPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDP  361
            A  +RIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDET++RA  EG LP+ G + P
Sbjct  4    AALSRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETLDRASEEGKLPVSGQYSP  63

Query  362  ESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAE  541
              F+ SIQ+PR VIILVKAGAPVDQTI  LS YME GDCIIDGGNEWY+NTERR  E  +
Sbjct  64   RDFVLSIQRPRSVIILVKAGAPVDQTISALSEYMEPGDCIIDGGNEWYQNTERRIVEAEK  123

Query  542  LGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
             GLLYLGMGVSGGEEGAR GPSLMPGGSF+AY  ++DI+ KVAAQV
Sbjct  124  KGLLYLGMGVSGGEEGARNGPSLMPGGSFQAYNNVKDILEKVAAQV  169



>emb|CDY39725.1| BnaA04g11280D [Brassica napus]
Length=487

 Score =   261 bits (667),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 141/166 (85%), Gaps = 0/166 (0%)
 Frame = +2

Query  182  ATPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDP  361
            A  +RIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDET++RA  EG LP+ G + P
Sbjct  4    AALSRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETLDRASEEGKLPVSGQYSP  63

Query  362  ESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAE  541
              F+ SIQ+PR VIILVKAGAPVDQTI  LS YME GDCIIDGGNEWY+NTERR  E  +
Sbjct  64   RDFVLSIQRPRSVIILVKAGAPVDQTISALSEYMEPGDCIIDGGNEWYQNTERRIVEAEK  123

Query  542  LGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
             GLLYLGMGVSGGEEGAR GPSLMPGGSF+AY  ++DI+ KVAAQV
Sbjct  124  KGLLYLGMGVSGGEEGARNGPSLMPGGSFQAYNNVKDILEKVAAQV  169



>ref|XP_010545301.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic [Tarenaya hassleriana]
Length=491

 Score =   261 bits (668),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 143/166 (86%), Gaps = 0/166 (0%)
 Frame = +2

Query  182  ATPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDP  361
            AT +RIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDET++RA  EG LP+ G + P
Sbjct  4    ATLSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETLDRAAEEGKLPVSGQYSP  63

Query  362  ESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAE  541
              F+ SIQ+PR V+ILVKAGAPVDQTI  LS +ME GDCIIDGGNEWY+NTERR +E  +
Sbjct  64   RDFVLSIQRPRSVVILVKAGAPVDQTIAALSEHMEPGDCIIDGGNEWYQNTERRIQEAEQ  123

Query  542  LGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
             GLLYLGMGVSGGEEGAR GPSLMPGGSF+AY  I+DI+ KVAAQV
Sbjct  124  KGLLYLGMGVSGGEEGARHGPSLMPGGSFQAYNNIKDILGKVAAQV  169



>gb|KCW77439.1| hypothetical protein EUGRSUZ_D01779, partial [Eucalyptus grandis]
Length=246

 Score =   253 bits (646),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 123/163 (75%), Positives = 138/163 (85%), Gaps = 0/163 (0%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
            +RIGLAGLAVMGQNLALN+ADKGFPISVYNRT SKVDET++RA AEG LPL G + P  F
Sbjct  8    SRIGLAGLAVMGQNLALNVADKGFPISVYNRTASKVDETLDRAAAEGGLPLSGHYSPRDF  67

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            + SI+ PR VIILVKAGAPVDQTI  L+ +M  GDCIIDGGNEWYENTERR  E +  GL
Sbjct  68   VLSIRPPRSVIILVKAGAPVDQTIAALADHMSPGDCIIDGGNEWYENTERRIAEASRRGL  127

Query  551  LYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LYLGMGVSGGEEGAR GPSLMPGGS EAY+ +++I+ KVAAQV
Sbjct  128  LYLGMGVSGGEEGARHGPSLMPGGSLEAYENVKEILHKVAAQV  170



>ref|XP_010533610.1| PREDICTED: LOW QUALITY PROTEIN: 6-phosphogluconate dehydrogenase, 
decarboxylating 2, chloroplastic [Tarenaya hassleriana]
Length=481

 Score =   261 bits (666),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 142/166 (86%), Gaps = 0/166 (0%)
 Frame = +2

Query  182  ATPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDP  361
            AT +RIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDET++RA  EGNLP+ G + P
Sbjct  4    ATLSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETLDRAADEGNLPVSGQYSP  63

Query  362  ESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAE  541
              F+ SIQ+PR VIILVKAGAPVDQTI  LS +ME GDCIIDGGNEWY+NTERR +E  +
Sbjct  64   RDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDCIIDGGNEWYQNTERRIQEAEQ  123

Query  542  LGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
             GLLYLGMGVSGGEEGAR GPSLMPGGS +AY  I DI+ KVAAQV
Sbjct  124  KGLLYLGMGVSGGEEGARHGPSLMPGGSIQAYNNINDILEKVAAQV  169



>ref|XP_010054765.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic-like, partial [Eucalyptus grandis]
Length=248

 Score =   253 bits (646),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 123/163 (75%), Positives = 138/163 (85%), Gaps = 0/163 (0%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
            +RIGLAGLAVMGQNLALN+ADKGFPISVYNRT SKVDET++RA AEG LPL G + P  F
Sbjct  8    SRIGLAGLAVMGQNLALNVADKGFPISVYNRTASKVDETLDRAAAEGGLPLSGHYSPRDF  67

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            + SI+ PR VIILVKAGAPVDQTI  L+ +M  GDCIIDGGNEWYENTERR  E +  GL
Sbjct  68   VLSIRPPRSVIILVKAGAPVDQTIAALADHMSPGDCIIDGGNEWYENTERRIAEASRRGL  127

Query  551  LYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LYLGMGVSGGEEGAR GPSLMPGGS EAY+ +++I+ KVAAQV
Sbjct  128  LYLGMGVSGGEEGARHGPSLMPGGSLEAYENVKEILHKVAAQV  170



>ref|XP_002868582.1| 6-phosphogluconate dehydrogenase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH44841.1| 6-phosphogluconate dehydrogenase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=487

 Score =   261 bits (666),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 141/166 (85%), Gaps = 0/166 (0%)
 Frame = +2

Query  182  ATPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDP  361
            A  +RIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDET++RA  EGNLP+ G + P
Sbjct  4    AALSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETLDRASDEGNLPVAGQYSP  63

Query  362  ESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAE  541
              F+ SIQ+PR VIILVKAGAPVDQTI  LS YME GDCIIDGGNEWY+NTERR  E  +
Sbjct  64   RDFVLSIQRPRSVIILVKAGAPVDQTISALSEYMEPGDCIIDGGNEWYQNTERRIVEAEK  123

Query  542  LGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
             GLLYLGMGVSGGEEGAR GPSLMPGGSF AY  ++DI+ KVAAQV
Sbjct  124  KGLLYLGMGVSGGEEGARNGPSLMPGGSFTAYNNVKDILEKVAAQV  169



>ref|XP_004168459.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating-like 
[Cucumis sativus]
Length=495

 Score =   261 bits (666),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/163 (77%), Positives = 143/163 (88%), Gaps = 0/163 (0%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
            +RIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETV+RA  EGNLPL+G ++P  F
Sbjct  8    SRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVDRAHNEGNLPLFGQYNPRDF  67

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            + SIQ+PR VIILVKAG PVDQTI  LS ++E GD IIDGGNEWYENTERR ++ +E GL
Sbjct  68   VLSIQRPRSVIILVKAGLPVDQTIAALSDHLEPGDAIIDGGNEWYENTERRIEQASERGL  127

Query  551  LYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LYLGMGVSGGE+GAR GPSLMPGGSF+AY  ++DI+ KVAAQV
Sbjct  128  LYLGMGVSGGEDGARHGPSLMPGGSFQAYSNVQDILKKVAAQV  170



>gb|ACM68927.1| 6-phosphogluconate dehydrogenase [Cucumis sativus]
Length=495

 Score =   261 bits (666),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/163 (77%), Positives = 143/163 (88%), Gaps = 0/163 (0%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
            +RIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETV+RA  EGNLPL+G ++P  F
Sbjct  8    SRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVDRAHNEGNLPLFGQYNPRDF  67

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            + SIQ+PR VIILVKAG PVDQTI  LS ++E GD IIDGGNEWYENTERR ++ +E GL
Sbjct  68   VLSIQRPRSVIILVKAGLPVDQTIAALSDHLEPGDAIIDGGNEWYENTERRIEQASERGL  127

Query  551  LYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LYLGMGVSGGE+GAR GPSLMPGGSF+AY  ++DI+ KVAAQV
Sbjct  128  LYLGMGVSGGEDGARHGPSLMPGGSFQAYSNVQDILKKVAAQV  170



>ref|XP_006301732.1| hypothetical protein CARUB_v10022193mg [Capsella rubella]
 gb|EOA34630.1| hypothetical protein CARUB_v10022193mg [Capsella rubella]
Length=487

 Score =   260 bits (665),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 141/166 (85%), Gaps = 0/166 (0%)
 Frame = +2

Query  182  ATPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDP  361
            A  +RIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDET++RA  EGNLP+ G + P
Sbjct  4    AALSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETLDRAAVEGNLPVSGQYSP  63

Query  362  ESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAE  541
              F+ SIQ+PR +IILVKAGAPVDQTI   S YME GDCIIDGGNEWY+NTERR  E  +
Sbjct  64   RDFVLSIQRPRSLIILVKAGAPVDQTIDAFSEYMEPGDCIIDGGNEWYQNTERRISEAEQ  123

Query  542  LGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
             GLLYLGMGVSGGEEGAR GPSLMPGGSF+AY  I+DI+ KVAAQV
Sbjct  124  KGLLYLGMGVSGGEEGARNGPSLMPGGSFQAYDNIKDILGKVAAQV  169



>ref|XP_007040417.1| 6-phosphogluconate dehydrogenase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY24918.1| 6-phosphogluconate dehydrogenase family protein isoform 1 [Theobroma 
cacao]
Length=520

 Score =   261 bits (667),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 127/168 (76%), Positives = 146/168 (87%), Gaps = 2/168 (1%)
 Frame = +2

Query  182  ATP--TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFH  355
            A+P  +RIGLAGLAVMGQNLALN+A+KGFPISVYNRTTSKVDETV+RA+ EG LPL+G +
Sbjct  3    ASPALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVQRAQEEGQLPLFGQY  62

Query  356  DPESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEV  535
             P  F+ S+Q+PR V+ILVKAG+PVDQTI  LS +ME GDCIIDGGNEWYENTERR +EV
Sbjct  63   SPREFVLSVQRPRSVVILVKAGSPVDQTIAALSDHMEPGDCIIDGGNEWYENTERRIQEV  122

Query  536  AELGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            +  GLLYLGMGVSGGEEGAR GPSLMPGGS +AY  I+DI+ KVAAQV
Sbjct  123  SNKGLLYLGMGVSGGEEGARNGPSLMPGGSHQAYSNIKDILEKVAAQV  170



>ref|XP_002886358.1| 6-phosphogluconate dehydrogenase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH62617.1| 6-phosphogluconate dehydrogenase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=487

 Score =   260 bits (665),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 141/166 (85%), Gaps = 0/166 (0%)
 Frame = +2

Query  182  ATPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDP  361
            A  +RIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDET++RA  EGNLP+ G + P
Sbjct  4    AALSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETLDRAAVEGNLPVSGQYSP  63

Query  362  ESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAE  541
              F+ SIQ+PR +IILVKAGAPVDQTI   S YME GDCIIDGGNEWY+NTERR  E  +
Sbjct  64   RDFVLSIQRPRSLIILVKAGAPVDQTIDAFSEYMEPGDCIIDGGNEWYQNTERRISEAEQ  123

Query  542  LGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
             GLLYLGMGVSGGEEGAR GPSLMPGGSF+AY  I+DI+ KVAAQV
Sbjct  124  KGLLYLGMGVSGGEEGARNGPSLMPGGSFQAYDNIKDILGKVAAQV  169



>ref|XP_008451978.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic [Cucumis melo]
Length=495

 Score =   260 bits (665),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 127/168 (76%), Positives = 145/168 (86%), Gaps = 2/168 (1%)
 Frame = +2

Query  182  ATP--TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFH  355
            A+P  +RIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETV+RA  EGNLPL+G +
Sbjct  3    ASPALSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVDRAHNEGNLPLFGQY  62

Query  356  DPESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEV  535
            +P  F+ SIQ+PR VIILVKAG PVDQTI  LS ++E GD IIDGGNEWYENTERR  + 
Sbjct  63   NPRDFVLSIQRPRSVIILVKAGLPVDQTIAALSDHLEPGDAIIDGGNEWYENTERRIAQA  122

Query  536  AELGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            +E G+LYLGMGVSGGE+GAR GPSLMPGGSF+AY  +EDI+ KVAAQV
Sbjct  123  SERGILYLGMGVSGGEDGARHGPSLMPGGSFQAYSNVEDILKKVAAQV  170



>ref|XP_010430539.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1, chloroplastic [Camelina sativa]
Length=487

 Score =   260 bits (664),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 141/166 (85%), Gaps = 0/166 (0%)
 Frame = +2

Query  182  ATPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDP  361
            A  +RIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDET++RA  EGNLP+ G + P
Sbjct  4    AALSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETLDRAAVEGNLPVSGQYSP  63

Query  362  ESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAE  541
              F+ SIQ+PR +IILVKAGAPVDQTI   S YME GDCIIDGGNEWY+NTERR  E  +
Sbjct  64   RDFVLSIQRPRSLIILVKAGAPVDQTIDAFSEYMEPGDCIIDGGNEWYQNTERRISEAEK  123

Query  542  LGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
             GLLYLGMGVSGGEEGAR GPSLMPGGSF+AY  I+DI+ KVAAQV
Sbjct  124  KGLLYLGMGVSGGEEGARNGPSLMPGGSFQAYDNIKDILGKVAAQV  169



>ref|XP_010473675.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1, chloroplastic [Camelina sativa]
Length=487

 Score =   260 bits (664),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 141/166 (85%), Gaps = 0/166 (0%)
 Frame = +2

Query  182  ATPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDP  361
            A  +RIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDET++RA  EGNLP+ G + P
Sbjct  4    AALSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETLDRAAVEGNLPVSGQYSP  63

Query  362  ESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAE  541
              F+ SIQ+PR +IILVKAGAPVDQTI   S YME GDCIIDGGNEWY+NTERR  E  +
Sbjct  64   RDFVLSIQRPRSLIILVKAGAPVDQTIDAFSEYMEPGDCIIDGGNEWYQNTERRISEAEK  123

Query  542  LGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
             GLLYLGMGVSGGEEGAR GPSLMPGGSF+AY  I+DI+ KVAAQV
Sbjct  124  KGLLYLGMGVSGGEEGARNGPSLMPGGSFQAYDNIKDILGKVAAQV  169



>emb|CDY25568.1| BnaC09g11930D [Brassica napus]
Length=487

 Score =   260 bits (664),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 126/166 (76%), Positives = 141/166 (85%), Gaps = 0/166 (0%)
 Frame = +2

Query  182  ATPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDP  361
            A  +RIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDET++RA  EGNLP+ G + P
Sbjct  4    AALSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETLDRAAVEGNLPVSGQYSP  63

Query  362  ESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAE  541
              F+ S+Q+PR +IILVKAGAPVDQTI   S YME GDCIIDGGNEWY+NTERR  E  +
Sbjct  64   RDFVLSLQRPRSLIILVKAGAPVDQTIAAFSEYMEPGDCIIDGGNEWYQNTERRISEAEQ  123

Query  542  LGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
             GLLYLGMGVSGGEEGAR GPSLMPGGSF+AY  I+DI+ KVAAQV
Sbjct  124  KGLLYLGMGVSGGEEGARNGPSLMPGGSFQAYDNIKDILGKVAAQV  169



>ref|XP_009112895.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1, chloroplastic [Brassica rapa]
Length=487

 Score =   259 bits (663),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 126/166 (76%), Positives = 141/166 (85%), Gaps = 0/166 (0%)
 Frame = +2

Query  182  ATPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDP  361
            A  +RIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDET++RA  EGNLP+ G + P
Sbjct  4    AALSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETLDRAAVEGNLPVSGQYSP  63

Query  362  ESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAE  541
              F+ S+Q+PR +IILVKAGAPVDQTI   S YME GDCIIDGGNEWY+NTERR  E  +
Sbjct  64   RDFVLSLQRPRSLIILVKAGAPVDQTIAAFSEYMEPGDCIIDGGNEWYQNTERRISEAEQ  123

Query  542  LGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
             GLLYLGMGVSGGEEGAR GPSLMPGGSF+AY  I+DI+ KVAAQV
Sbjct  124  KGLLYLGMGVSGGEEGARNGPSLMPGGSFQAYDNIKDILGKVAAQV  169



>ref|XP_010105006.1| 6-phosphogluconate dehydrogenase [Morus notabilis]
 gb|EXC02963.1| 6-phosphogluconate dehydrogenase [Morus notabilis]
Length=495

 Score =   259 bits (663),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 127/168 (76%), Positives = 147/168 (88%), Gaps = 2/168 (1%)
 Frame = +2

Query  182  ATP--TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFH  355
            A+P  +RIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETV+RA  EGNLPL+G +
Sbjct  3    ASPALSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVDRAHNEGNLPLFGQY  62

Query  356  DPESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEV  535
            +P  F+ SIQ+PR VIILVKAGAPVDQTI  L+ ++E GD IIDGGNEWYENTERR +EV
Sbjct  63   NPRDFVLSIQRPRSVIILVKAGAPVDQTIAALADHLEPGDAIIDGGNEWYENTERRIREV  122

Query  536  AELGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            ++ G+LYLGMGVSGGEEGAR GPSLMPGGS +AY  ++DI+ KVAAQV
Sbjct  123  SDRGILYLGMGVSGGEEGARNGPSLMPGGSHQAYLNVQDILHKVAAQV  170



>ref|NP_198982.1| 6-phosphogluconate dehydrogenase, decarboxylating 2 [Arabidopsis 
thaliana]
 ref|NP_851113.1| 6-phosphogluconate dehydrogenase, decarboxylating 2 [Arabidopsis 
thaliana]
 sp|Q9FFR3.1|6PGD2_ARATH RecName: Full=6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic [Arabidopsis thaliana]
 dbj|BAB11473.1| 6-phosphogluconate dehydrogenase [Arabidopsis thaliana]
 gb|AAM78095.1| AT5g41670/MBK23_20 [Arabidopsis thaliana]
 gb|AAN72272.1| At5g41670/MBK23_20 [Arabidopsis thaliana]
 gb|AED94705.1| 6-phosphogluconate dehydrogenase, decarboxylating 2 [Arabidopsis 
thaliana]
 gb|AED94706.1| 6-phosphogluconate dehydrogenase, decarboxylating 2 [Arabidopsis 
thaliana]
Length=487

 Score =   259 bits (663),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 127/163 (78%), Positives = 139/163 (85%), Gaps = 0/163 (0%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
            +RIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDET++RA  EG LP+ G + P  F
Sbjct  7    SRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETLDRASNEGKLPVAGQYSPRDF  66

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            + SIQ+PR VIILVKAGAPVDQTI  LS YME GDCIIDGGNEWY+NTERR  E  + GL
Sbjct  67   VLSIQRPRSVIILVKAGAPVDQTISALSEYMEPGDCIIDGGNEWYQNTERRIVEAEKKGL  126

Query  551  LYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LYLGMGVSGGEEGAR GPSLMPGGSF AY  ++DI+ KVAAQV
Sbjct  127  LYLGMGVSGGEEGARNGPSLMPGGSFTAYNNVKDILEKVAAQV  169



>ref|XP_009336262.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic isoform X1 [Pyrus x bretschneideri]
 ref|XP_009336264.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic isoform X2 [Pyrus x bretschneideri]
Length=495

 Score =   259 bits (662),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 144/168 (86%), Gaps = 2/168 (1%)
 Frame = +2

Query  182  ATP--TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFH  355
            A+P  +RIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETV+RA  EGNLPL+G +
Sbjct  3    ASPALSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVDRAHNEGNLPLFGQY  62

Query  356  DPESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEV  535
            +P  F+ SI++PR VIILVKAGAPVDQTI  LSA+ME GD IIDGGNEWYENTERR  E 
Sbjct  63   NPRDFVLSIERPRSVIILVKAGAPVDQTIAALSAHMEPGDAIIDGGNEWYENTERRIAEA  122

Query  536  AELGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
               GLLYLGMGVSGGEEGAR GPSLMPGGS +AY  ++DI+ KVAAQV
Sbjct  123  NGRGLLYLGMGVSGGEEGARHGPSLMPGGSHQAYTNVQDILRKVAAQV  170



>ref|XP_004149760.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating-like 
[Cucumis sativus]
 gb|KGN53379.1| 6-phosphogluconate dehydrogenase, decarboxylating [Cucumis sativus]
Length=495

 Score =   259 bits (662),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 124/163 (76%), Positives = 142/163 (87%), Gaps = 0/163 (0%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
            +RIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETV+RA  EGNLPL+G ++P  F
Sbjct  8    SRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVDRAHNEGNLPLFGQYNPRDF  67

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            + SIQ+PR VIILVKAG PVDQTI  LS ++E GD IIDGGNEWYENTERR  + +E G+
Sbjct  68   VLSIQRPRSVIILVKAGLPVDQTIAALSDHLEPGDAIIDGGNEWYENTERRIAQASERGI  127

Query  551  LYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LYLGMGVSGGE+GAR GPSLMPGGSF+AY  ++DI+ KVAAQV
Sbjct  128  LYLGMGVSGGEDGARHGPSLMPGGSFQAYSNVQDILKKVAAQV  170



>ref|XP_009334464.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic-like [Pyrus x bretschneideri]
Length=495

 Score =   259 bits (662),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 127/163 (78%), Positives = 141/163 (87%), Gaps = 0/163 (0%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
            +RIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETVERA  EGNLPL+G ++P  F
Sbjct  8    SRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAHNEGNLPLFGQYNPRDF  67

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            + SI++PR VIILVKAGAPVDQTI  LSA+ME GD IIDGGNEWYENTERR  E    GL
Sbjct  68   VLSIERPRSVIILVKAGAPVDQTIAALSAHMEPGDAIIDGGNEWYENTERRIAEANGRGL  127

Query  551  LYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LYLGMGVSGGE+GAR GPSLMPGGS +AY  ++DI+ KVAAQV
Sbjct  128  LYLGMGVSGGEDGARHGPSLMPGGSHQAYTNVQDILHKVAAQV  170



>ref|XP_010418473.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1, chloroplastic-like [Camelina sativa]
Length=487

 Score =   259 bits (661),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 126/166 (76%), Positives = 141/166 (85%), Gaps = 0/166 (0%)
 Frame = +2

Query  182  ATPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDP  361
            A  +RIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDET++RA  EGNLP+ G + P
Sbjct  4    AALSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETLDRAAVEGNLPVSGQYSP  63

Query  362  ESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAE  541
              F+ SIQ+PR +IILVKAGAPVDQTI   S YM+ GDCIIDGGNEWY+NTERR  E  +
Sbjct  64   RDFVLSIQRPRSLIILVKAGAPVDQTIDAFSEYMDPGDCIIDGGNEWYQNTERRISEAEK  123

Query  542  LGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
             GLLYLGMGVSGGEEGAR GPSLMPGGSF+AY  I+DI+ KVAAQV
Sbjct  124  KGLLYLGMGVSGGEEGARNGPSLMPGGSFQAYDNIKDILGKVAAQV  169



>gb|ACE96470.1| expressed protein, partial [Populus tremula]
Length=194

 Score =   249 bits (635),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +2

Query  287  TSKVDETVERAKAEGNLPLYGFHDPESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYME  466
            TSKVDETVERAK EG+LPLYGFHDPESF++SIQKPRV+I+LVKAG+PVDQTIKTLSAY+E
Sbjct  1    TSKVDETVERAKKEGDLPLYGFHDPESFVKSIQKPRVIIMLVKAGSPVDQTIKTLSAYLE  60

Query  467  KGDCIIDGGNEWYENTERREKEVAELGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYI  646
            KGDCIIDGGNEWYENTERREK +AELGLLYLGMGVSGGEEGAR GPS+MPGGSFEA+KYI
Sbjct  61   KGDCIIDGGNEWYENTERREKAMAELGLLYLGMGVSGGEEGARNGPSMMPGGSFEAFKYI  120

Query  647  EDIVLKVAAQV  679
            EDI+LKVAAQV
Sbjct  121  EDILLKVAAQV  131



>gb|ACE96443.1| expressed protein, partial [Populus tremula]
 gb|ACE96447.1| expressed protein, partial [Populus tremula]
 gb|ACE96467.1| expressed protein, partial [Populus tremula]
 gb|ACE96468.1| expressed protein, partial [Populus tremula]
 gb|ACE96469.1| expressed protein, partial [Populus tremula]
 gb|ACE96471.1| expressed protein, partial [Populus tremula]
 gb|ACE96472.1| expressed protein, partial [Populus tremula]
 gb|ACE96473.1| expressed protein, partial [Populus tremula]
 gb|ACE96474.1| expressed protein, partial [Populus tremula]
Length=194

 Score =   248 bits (634),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +2

Query  287  TSKVDETVERAKAEGNLPLYGFHDPESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYME  466
            TSKVDETVERAK EG+LPLYGFHDPESF++SIQKPRV+I+LVKAG+PVDQTIKTLSAY+E
Sbjct  1    TSKVDETVERAKKEGDLPLYGFHDPESFVKSIQKPRVIIMLVKAGSPVDQTIKTLSAYLE  60

Query  467  KGDCIIDGGNEWYENTERREKEVAELGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYI  646
            KGDCIIDGGNEWYENTERREK +AELGLLYLGMGVSGGEEGAR GPS+MPGGSFEA+KYI
Sbjct  61   KGDCIIDGGNEWYENTERREKAMAELGLLYLGMGVSGGEEGARNGPSMMPGGSFEAFKYI  120

Query  647  EDIVLKVAAQV  679
            EDI+LKVAAQV
Sbjct  121  EDILLKVAAQV  131



>ref|XP_011462415.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic [Fragaria vesca subsp. vesca]
Length=494

 Score =   258 bits (660),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 126/163 (77%), Positives = 140/163 (86%), Gaps = 0/163 (0%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
            +RIGLAGLAVMGQNLALNIA+KGFPISVYNRT+SKVDETV RA  EG+LPL G + P+ F
Sbjct  8    SRIGLAGLAVMGQNLALNIAEKGFPISVYNRTSSKVDETVHRAATEGDLPLSGQYTPKDF  67

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            + S+Q+PR VIILVKAGAPVDQTI  LSAYME GD IIDGGNEWYENTERR  E +  GL
Sbjct  68   VLSLQRPRSVIILVKAGAPVDQTIAALSAYMEPGDAIIDGGNEWYENTERRIHEASAKGL  127

Query  551  LYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LYLGMGVSGGEEGAR GPSLMPGGS +AY  ++DI+ KVAAQV
Sbjct  128  LYLGMGVSGGEEGARHGPSLMPGGSHQAYSNVQDILHKVAAQV  170



>gb|ACE96441.1| expressed protein, partial [Populus tremula]
 gb|ACE96445.1| expressed protein, partial [Populus tremula]
 gb|ACE96449.1| expressed protein, partial [Populus tremula]
 gb|ACE96451.1| expressed protein, partial [Populus tremula]
 gb|ACE96457.1| expressed protein, partial [Populus tremula]
 gb|ACE96460.1| expressed protein, partial [Populus tremula]
Length=194

 Score =   248 bits (634),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +2

Query  287  TSKVDETVERAKAEGNLPLYGFHDPESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYME  466
            TSKVDETVERAK EG+LPLYGFHDPESF++SIQKPRV+I+LVKAG+PVDQTIKTLSAY+E
Sbjct  1    TSKVDETVERAKKEGDLPLYGFHDPESFVKSIQKPRVIIMLVKAGSPVDQTIKTLSAYLE  60

Query  467  KGDCIIDGGNEWYENTERREKEVAELGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYI  646
            KGDCIIDGGNEWYENTERREK +AELGLLYLGMGVSGGEEGAR GPS+MPGGSFEA+KYI
Sbjct  61   KGDCIIDGGNEWYENTERREKAMAELGLLYLGMGVSGGEEGARNGPSMMPGGSFEAFKYI  120

Query  647  EDIVLKVAAQV  679
            EDI+LKVAAQV
Sbjct  121  EDILLKVAAQV  131



>ref|XP_006439417.1| hypothetical protein CICLE_v10019859mg [Citrus clementina]
 gb|ESR52657.1| hypothetical protein CICLE_v10019859mg [Citrus clementina]
Length=494

 Score =   258 bits (659),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 125/163 (77%), Positives = 138/163 (85%), Gaps = 0/163 (0%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
            +RIGLAGLAVMGQNLALN+A+KGFPISVYNRTTSKVDET++RA  EG LPL G + P  F
Sbjct  7    SRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETLDRAHREGQLPLTGHYTPRDF  66

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            + SIQ+PR VIILVKAG+PVDQTI  LS +M  GDCIIDGGNEWY NTERR  E ++ GL
Sbjct  67   VLSIQRPRSVIILVKAGSPVDQTIAALSEHMSPGDCIIDGGNEWYLNTERRIHEASQKGL  126

Query  551  LYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LYLGMGVSGGEEGAR GPSLMPGGSFEAY  I DI+ KVAAQV
Sbjct  127  LYLGMGVSGGEEGARHGPSLMPGGSFEAYNNIRDILQKVAAQV  169



>gb|ACE96440.1| expressed protein, partial [Populus tremula]
 gb|ACE96442.1| expressed protein, partial [Populus tremula]
 gb|ACE96444.1| expressed protein, partial [Populus tremula]
 gb|ACE96446.1| expressed protein, partial [Populus tremula]
 gb|ACE96448.1| expressed protein, partial [Populus tremula]
 gb|ACE96450.1| expressed protein, partial [Populus tremula]
 gb|ACE96452.1| expressed protein, partial [Populus tremula]
 gb|ACE96454.1| expressed protein, partial [Populus tremula]
 gb|ACE96455.1| expressed protein, partial [Populus tremula]
 gb|ACE96458.1| expressed protein, partial [Populus tremula]
 gb|ACE96459.1| expressed protein, partial [Populus tremula]
 gb|ACE96463.1| expressed protein, partial [Populus tremula]
 gb|ACE96466.1| expressed protein, partial [Populus tremula]
Length=194

 Score =   248 bits (634),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +2

Query  287  TSKVDETVERAKAEGNLPLYGFHDPESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYME  466
            TSKVDETVERAK EG+LPLYGFHDPESF++SIQKPRV+I+LVKAG+PVDQTIKTLSAY+E
Sbjct  1    TSKVDETVERAKKEGDLPLYGFHDPESFVKSIQKPRVIIMLVKAGSPVDQTIKTLSAYLE  60

Query  467  KGDCIIDGGNEWYENTERREKEVAELGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYI  646
            KGDCIIDGGNEWYENTERREK +AELGLLYLGMGVSGGEEGAR GPS+MPGGSFEA+KYI
Sbjct  61   KGDCIIDGGNEWYENTERREKAMAELGLLYLGMGVSGGEEGARNGPSMMPGGSFEAFKYI  120

Query  647  EDIVLKVAAQV  679
            EDI+LKVAAQV
Sbjct  121  EDILLKVAAQV  131



>ref|XP_006476447.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1, chloroplastic-like isoform X1 [Citrus sinensis]
 ref|XP_006476448.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1, chloroplastic-like isoform X2 [Citrus sinensis]
Length=494

 Score =   258 bits (659),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 125/163 (77%), Positives = 138/163 (85%), Gaps = 0/163 (0%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
            +RIGLAGLAVMGQNLALN+A+KGFPISVYNRTTSKVDET++RA  EG LPL G + P  F
Sbjct  7    SRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETLDRAHREGQLPLTGHYTPRDF  66

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            + SIQ+PR VIILVKAG+PVDQTI  LS +M  GDCIIDGGNEWY NTERR  E ++ GL
Sbjct  67   VLSIQRPRSVIILVKAGSPVDQTIAALSEHMSPGDCIIDGGNEWYLNTERRIHEASQKGL  126

Query  551  LYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LYLGMGVSGGEEGAR GPSLMPGGSFEAY  I DI+ KVAAQV
Sbjct  127  LYLGMGVSGGEEGARHGPSLMPGGSFEAYNNIRDILQKVAAQV  169



>gb|ACE96439.1| expressed protein, partial [Populus tremula]
 gb|ACE96453.1| expressed protein, partial [Populus tremula]
 gb|ACE96456.1| expressed protein, partial [Populus tremula]
 gb|ACE96461.1| expressed protein, partial [Populus tremula]
 gb|ACE96464.1| expressed protein, partial [Populus tremula]
 gb|ACE96465.1| expressed protein, partial [Populus tremula]
Length=194

 Score =   248 bits (634),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +2

Query  287  TSKVDETVERAKAEGNLPLYGFHDPESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYME  466
            TSKVDETVERAK EG+LPLYGFHDPESF++SIQKPRV+I+LVKAG+PVDQTIKTLSAY+E
Sbjct  1    TSKVDETVERAKKEGDLPLYGFHDPESFVKSIQKPRVIIMLVKAGSPVDQTIKTLSAYLE  60

Query  467  KGDCIIDGGNEWYENTERREKEVAELGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYI  646
            KGDCIIDGGNEWYENTERREK +AELGLLYLGMGVSGGEEGAR GPS+MPGGSFEA+KYI
Sbjct  61   KGDCIIDGGNEWYENTERREKAMAELGLLYLGMGVSGGEEGARNGPSMMPGGSFEAFKYI  120

Query  647  EDIVLKVAAQV  679
            EDI+LKVAAQV
Sbjct  121  EDILLKVAAQV  131



>ref|XP_002517676.1| 6-phosphogluconate dehydrogenase, putative [Ricinus communis]
 gb|EEF44840.1| 6-phosphogluconate dehydrogenase, putative [Ricinus communis]
Length=495

 Score =   258 bits (659),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 125/163 (77%), Positives = 139/163 (85%), Gaps = 0/163 (0%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
            +RIGLAGLAVMGQNLALNIA+KGFPISVYNR+TSKVDET+ RA+ EG  PL G + P  F
Sbjct  8    SRIGLAGLAVMGQNLALNIAEKGFPISVYNRSTSKVDETIHRAQNEGPFPLTGHYTPRDF  67

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            + S+Q+PR VIILVKAGAPVDQTI  LS +ME GDCIIDGGNEWY+NTERR  E  + GL
Sbjct  68   VLSLQRPRSVIILVKAGAPVDQTIAALSEHMEAGDCIIDGGNEWYQNTERRIDEANQKGL  127

Query  551  LYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LYLGMGVSGGEEGAR GPSLMPGGSFEAY  I+DI+ KVAAQV
Sbjct  128  LYLGMGVSGGEEGARFGPSLMPGGSFEAYNNIKDILQKVAAQV  170



>ref|XP_006476449.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1, chloroplastic-like isoform X3 [Citrus sinensis]
Length=493

 Score =   258 bits (659),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 125/163 (77%), Positives = 138/163 (85%), Gaps = 0/163 (0%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
            +RIGLAGLAVMGQNLALN+A+KGFPISVYNRTTSKVDET++RA  EG LPL G + P  F
Sbjct  7    SRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETLDRAHREGQLPLTGHYTPRDF  66

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            + SIQ+PR VIILVKAG+PVDQTI  LS +M  GDCIIDGGNEWY NTERR  E ++ GL
Sbjct  67   VLSIQRPRSVIILVKAGSPVDQTIAALSEHMSPGDCIIDGGNEWYLNTERRIHEASQKGL  126

Query  551  LYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LYLGMGVSGGEEGAR GPSLMPGGSFEAY  I DI+ KVAAQV
Sbjct  127  LYLGMGVSGGEEGARHGPSLMPGGSFEAYNNIRDILQKVAAQV  169



>gb|KDO76415.1| hypothetical protein CISIN_1g010652mg [Citrus sinensis]
Length=503

 Score =   258 bits (659),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 125/163 (77%), Positives = 138/163 (85%), Gaps = 0/163 (0%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
            +RIGLAGLAVMGQNLALN+A+KGFPISVYNRTTSKVDET++RA  EG LPL G + P  F
Sbjct  7    SRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETLDRAHREGQLPLTGHYTPRDF  66

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            + SIQ+PR VIILVKAG+PVDQTI  LS +M  GDCIIDGGNEWY NTERR  E ++ GL
Sbjct  67   VLSIQRPRSVIILVKAGSPVDQTIAALSEHMSPGDCIIDGGNEWYLNTERRIHEASQKGL  126

Query  551  LYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LYLGMGVSGGEEGAR GPSLMPGGSFEAY  I DI+ KVAAQV
Sbjct  127  LYLGMGVSGGEEGARHGPSLMPGGSFEAYNNIRDILQKVAAQV  169



>ref|XP_010447780.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic [Camelina sativa]
Length=487

 Score =   258 bits (658),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 126/163 (77%), Positives = 139/163 (85%), Gaps = 0/163 (0%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
            +RIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDET++RA  EG LP+ G + P  F
Sbjct  7    SRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETLDRASDEGKLPVAGQYSPRDF  66

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            + SIQ+PR VIILVKAGAPVDQTI  LS YME GDCIIDGGNEWY+NTERR  E  + GL
Sbjct  67   VLSIQRPRSVIILVKAGAPVDQTISALSEYMEPGDCIIDGGNEWYQNTERRIVEAEKKGL  126

Query  551  LYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LYLGMGVSGGEEGAR GPSLMPGGSF AY  ++DI+ KVAAQV
Sbjct  127  LYLGMGVSGGEEGARNGPSLMPGGSFTAYNNVKDILEKVAAQV  169



>ref|XP_010436115.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic-like [Camelina sativa]
Length=487

 Score =   258 bits (658),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 126/163 (77%), Positives = 139/163 (85%), Gaps = 0/163 (0%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
            +RIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDET++RA  EG LP+ G + P  F
Sbjct  7    SRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETLDRASDEGKLPVAGQYSPRDF  66

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            + SIQ+PR VIILVKAGAPVDQTI  LS YME GDCIIDGGNEWY+NTERR  E  + GL
Sbjct  67   VLSIQRPRSVIILVKAGAPVDQTISALSEYMEPGDCIIDGGNEWYQNTERRIVEAEKKGL  126

Query  551  LYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LYLGMGVSGGEEGAR GPSLMPGGSF AY  ++DI+ KVAAQV
Sbjct  127  LYLGMGVSGGEEGARNGPSLMPGGSFTAYNNVKDILEKVAAQV  169



>gb|KDO76416.1| hypothetical protein CISIN_1g010652mg [Citrus sinensis]
Length=505

 Score =   258 bits (659),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 125/163 (77%), Positives = 138/163 (85%), Gaps = 0/163 (0%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
            +RIGLAGLAVMGQNLALN+A+KGFPISVYNRTTSKVDET++RA  EG LPL G + P  F
Sbjct  7    SRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETLDRAHREGQLPLTGHYTPRDF  66

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            + SIQ+PR VIILVKAG+PVDQTI  LS +M  GDCIIDGGNEWY NTERR  E ++ GL
Sbjct  67   VLSIQRPRSVIILVKAGSPVDQTIAALSEHMSPGDCIIDGGNEWYLNTERRIHEASQKGL  126

Query  551  LYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LYLGMGVSGGEEGAR GPSLMPGGSFEAY  I DI+ KVAAQV
Sbjct  127  LYLGMGVSGGEEGARHGPSLMPGGSFEAYNNIRDILQKVAAQV  169



>gb|KDO76417.1| hypothetical protein CISIN_1g010652mg [Citrus sinensis]
Length=505

 Score =   258 bits (658),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 125/163 (77%), Positives = 138/163 (85%), Gaps = 0/163 (0%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
            +RIGLAGLAVMGQNLALN+A+KGFPISVYNRTTSKVDET++RA  EG LPL G + P  F
Sbjct  7    SRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETLDRAHREGQLPLTGHYTPRDF  66

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            + SIQ+PR VIILVKAG+PVDQTI  LS +M  GDCIIDGGNEWY NTERR  E ++ GL
Sbjct  67   VLSIQRPRSVIILVKAGSPVDQTIAALSEHMSPGDCIIDGGNEWYLNTERRIHEASQKGL  126

Query  551  LYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LYLGMGVSGGEEGAR GPSLMPGGSFEAY  I DI+ KVAAQV
Sbjct  127  LYLGMGVSGGEEGARHGPSLMPGGSFEAYNNIRDILQKVAAQV  169



>gb|AAM61057.1| 6-phosphogluconate dehydrogenase [Arabidopsis thaliana]
Length=486

 Score =   257 bits (656),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 126/163 (77%), Positives = 138/163 (85%), Gaps = 0/163 (0%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
            +RIGLAGLAVMGQNLALNIADKGFPISVYNRTT KVDET++RA  EG LP+ G + P  F
Sbjct  7    SRIGLAGLAVMGQNLALNIADKGFPISVYNRTTPKVDETLDRASNEGKLPVAGQYSPRDF  66

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            + SIQ+PR VIILVKAGAPVDQTI  LS YME GDCIIDGGNEWY+NTERR  E  + GL
Sbjct  67   VLSIQRPRSVIILVKAGAPVDQTITALSEYMEPGDCIIDGGNEWYQNTERRIVEAEKKGL  126

Query  551  LYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LYLGMGVSGGEEGAR GPSLMPGGSF AY  ++DI+ KVAAQV
Sbjct  127  LYLGMGVSGGEEGARNGPSLMPGGSFTAYNNVKDILEKVAAQV  169



>gb|ACE96462.1| expressed protein, partial [Populus tremula]
Length=194

 Score =   247 bits (631),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +2

Query  287  TSKVDETVERAKAEGNLPLYGFHDPESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYME  466
            TSKVDETVERAK EG+LPLYGFHDPESF++SIQKPRV+I+LVKAG+PVDQTIKTLSAY+E
Sbjct  1    TSKVDETVERAKKEGDLPLYGFHDPESFVKSIQKPRVIIMLVKAGSPVDQTIKTLSAYLE  60

Query  467  KGDCIIDGGNEWYENTERREKEVAELGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYI  646
            KGDCIIDGGNEWYENTERREK +AELGLLYLGMGVSGGEEGAR GPS+MPGGSFEA+KYI
Sbjct  61   KGDCIIDGGNEWYENTERREKAMAELGLLYLGMGVSGGEEGARIGPSMMPGGSFEAFKYI  120

Query  647  EDIVLKVAAQV  679
            EDI+LKVAAQV
Sbjct  121  EDILLKVAAQV  131



>emb|CDP12110.1| unnamed protein product [Coffea canephora]
Length=489

 Score =   257 bits (656),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 129/170 (76%), Positives = 144/170 (85%), Gaps = 3/170 (2%)
 Frame = +2

Query  179  MATP---TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYG  349
            MAT    +RIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETV+RA  EG+LPL+G
Sbjct  1    MATADALSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVDRADREGHLPLFG  60

Query  350  FHDPESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREK  529
             ++P+ F+ SIQ+PR VIILVKAGAPVDQTI  LS YME GD IIDGGNEWYENTERR  
Sbjct  61   QYNPKDFVLSIQRPRSVIILVKAGAPVDQTIAALSQYMEPGDTIIDGGNEWYENTERRIS  120

Query  530  EVAELGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            + +  GLLYLGMGVSGGE+GAR GPSLMPGGS  AY  I+DI+ KVAAQV
Sbjct  121  DASSKGLLYLGMGVSGGEDGARHGPSLMPGGSHRAYLNIKDILGKVAAQV  170



>ref|XP_006391656.1| hypothetical protein EUTSA_v10023427mg [Eutrema salsugineum]
 gb|ESQ28942.1| hypothetical protein EUTSA_v10023427mg [Eutrema salsugineum]
Length=487

 Score =   256 bits (655),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 125/166 (75%), Positives = 139/166 (84%), Gaps = 0/166 (0%)
 Frame = +2

Query  182  ATPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDP  361
            A  +RIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDET++RA  EGNLP+ G + P
Sbjct  4    AALSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETLDRASVEGNLPVSGQYSP  63

Query  362  ESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAE  541
              F+ SIQ+PR +IILVKAGAPVD TI   S YME GDCIIDGGNEWY NTERR  E  +
Sbjct  64   RDFVLSIQRPRSLIILVKAGAPVDHTIAAFSEYMEPGDCIIDGGNEWYLNTERRISEAEQ  123

Query  542  LGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
             GLLY+GMGVSGGEEGAR GPSLMPGGSF+AY  I+DI+ KVAAQV
Sbjct  124  KGLLYIGMGVSGGEEGARNGPSLMPGGSFQAYDNIKDILEKVAAQV  169



>ref|XP_004252580.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic [Solanum lycopersicum]
Length=496

 Score =   256 bits (654),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 126/163 (77%), Positives = 140/163 (86%), Gaps = 0/163 (0%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
            +RIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDET++RA+ EG LPL G ++P  F
Sbjct  11   SRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETLDRAQNEGQLPLIGQYNPRDF  70

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            + SIQ+PR VIILVKAG+PVDQTI  LS YME GD IIDGGNEWYENTERR  E +  GL
Sbjct  71   VLSIQRPRSVIILVKAGSPVDQTIAALSEYMEPGDTIIDGGNEWYENTERRIDEASSKGL  130

Query  551  LYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LYLGMGVSGGEEGAR GPSLMPGGS+ AY  I+DI+ KVAAQV
Sbjct  131  LYLGMGVSGGEEGARNGPSLMPGGSYGAYTNIKDILEKVAAQV  173



>ref|XP_011026944.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic [Populus euphratica]
Length=494

 Score =   256 bits (654),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 141/166 (85%), Gaps = 0/166 (0%)
 Frame = +2

Query  182  ATPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDP  361
            +T +RIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDET+ RA++EG  PL G + P
Sbjct  4    STLSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETLHRAQSEGPFPLTGQYSP  63

Query  362  ESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAE  541
              F+ SIQ+PR +IILVKAG PVDQTI  L+ +ME GD IIDGGNEWY+NTERR +EV E
Sbjct  64   RDFVLSIQRPRSIIILVKAGNPVDQTISALTEFMEPGDTIIDGGNEWYQNTERRIQEVGE  123

Query  542  LGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
             G+LYLGMGVSGGEEGAR GPSLMPGGSFEAYK IE ++  VAAQV
Sbjct  124  KGILYLGMGVSGGEEGARHGPSLMPGGSFEAYKNIESVLKSVAAQV  169



>ref|XP_003533072.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic-like [Glycine max]
Length=495

 Score =   256 bits (653),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 142/166 (86%), Gaps = 0/166 (0%)
 Frame = +2

Query  182  ATPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDP  361
            A  +RIGLAGLAVMGQNLALNIA+KGFPISVYNRT SKVDETV+RA+ EG+LPL G + P
Sbjct  4    AALSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTASKVDETVDRARNEGSLPLTGQYTP  63

Query  362  ESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAE  541
              F+ S+Q+PR VIILVKAGAPVDQTI  LS +++ GDCIIDGGNEWYENTERR   VA+
Sbjct  64   RDFVLSLQRPRSVIILVKAGAPVDQTIAALSDHLDPGDCIIDGGNEWYENTERRMSLVAD  123

Query  542  LGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
             GLLYLGMGVSGGE+GAR GPSLMPGGS +AY  ++DI+ K+AAQV
Sbjct  124  KGLLYLGMGVSGGEDGARHGPSLMPGGSHQAYSNVQDILHKIAAQV  169



>ref|XP_006360699.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic-like [Solanum tuberosum]
Length=495

 Score =   256 bits (653),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 126/163 (77%), Positives = 139/163 (85%), Gaps = 0/163 (0%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
            +RIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDET++RA+ EG LPL G ++P  F
Sbjct  11   SRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETLDRAQNEGQLPLIGQYNPRDF  70

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            + SIQ+PR VIILVKAG+PVDQTI  LS YME GD IIDGGNEWYENTERR  E +  GL
Sbjct  71   VLSIQRPRSVIILVKAGSPVDQTIAALSEYMEPGDTIIDGGNEWYENTERRIDEASSKGL  130

Query  551  LYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LYLGMGVSGGEEGAR GPSLMPGGS+ AY  I DI+ KVAAQV
Sbjct  131  LYLGMGVSGGEEGARNGPSLMPGGSYGAYTNIRDILEKVAAQV  173



>ref|XP_002509902.1| 6-phosphogluconate dehydrogenase, putative [Ricinus communis]
 gb|EEF51289.1| 6-phosphogluconate dehydrogenase, putative [Ricinus communis]
Length=495

 Score =   256 bits (653),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 123/163 (75%), Positives = 139/163 (85%), Gaps = 0/163 (0%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
            +RIGLAGLAVMGQNLALNIA+KGFPISVYNR+TSKVD+T+ RA+ EG  PL G + P  F
Sbjct  8    SRIGLAGLAVMGQNLALNIAEKGFPISVYNRSTSKVDDTIHRAQNEGPFPLTGHYTPRDF  67

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            + S+Q+PR VIILVKAGAPVDQTI  LS +ME GDCIIDGGNEWY+NTERR  E  + G+
Sbjct  68   VLSLQRPRSVIILVKAGAPVDQTIAALSEHMEAGDCIIDGGNEWYQNTERRIDEANQKGI  127

Query  551  LYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LYLGMGVSGGEEGAR GPSLMPGGSFEAY  I+DI+ KVAAQV
Sbjct  128  LYLGMGVSGGEEGARFGPSLMPGGSFEAYNNIKDILQKVAAQV  170



>gb|KDP25346.1| hypothetical protein JCGZ_20502 [Jatropha curcas]
Length=492

 Score =   256 bits (653),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 125/163 (77%), Positives = 138/163 (85%), Gaps = 0/163 (0%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
            +RIGLAGLAVMGQNLALNIA+KGFPISVYNRT SKVDET+ RA  EG  PL G + P  F
Sbjct  8    SRIGLAGLAVMGQNLALNIAEKGFPISVYNRTGSKVDETIHRAHNEGPFPLTGHYSPRDF  67

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            + SIQ+PR VIILVKAG PVDQTI  LS ++E GDCIIDGGNEWY+NTERR +EV E G+
Sbjct  68   VLSIQRPRSVIILVKAGKPVDQTIAALSEHLEPGDCIIDGGNEWYQNTERRIQEVNERGI  127

Query  551  LYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LYLGMGVSGGEEGAR GPSLMPGGSFEAY  I+DI+ KVAAQV
Sbjct  128  LYLGMGVSGGEEGARFGPSLMPGGSFEAYNNIKDILEKVAAQV  170



>ref|XP_008805334.1| PREDICTED: LOW QUALITY PROTEIN: 6-phosphogluconate dehydrogenase, 
decarboxylating 1, chloroplastic-like [Phoenix dactylifera]
Length=495

 Score =   255 bits (652),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 137/166 (83%), Gaps = 0/166 (0%)
 Frame = +2

Query  182  ATPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDP  361
            A  +RIGLAGLAVMGQNLALNIADKGFPISVYNRT SKVDETV RA  EG LPL G H P
Sbjct  4    AALSRIGLAGLAVMGQNLALNIADKGFPISVYNRTASKVDETVGRAAVEGGLPLSGHHSP  63

Query  362  ESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAE  541
              F+ SI +PR VIILVKAGAPVDQTI TLS +M+ GD IIDGGNEWYENTERR +E A 
Sbjct  64   RDFVLSIARPRSVIILVKAGAPVDQTIATLSQFMDPGDSIIDGGNEWYENTERRLREAAA  123

Query  542  LGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
             GLLYLGMGVSGGE+GAR GPSLMPGG  +AY  ++D++ +VAAQV
Sbjct  124  RGLLYLGMGVSGGEDGARHGPSLMPGGHLQAYHNVQDVLARVAAQV  169



>ref|XP_007160132.1| hypothetical protein PHAVU_002G295300g [Phaseolus vulgaris]
 gb|ESW32126.1| hypothetical protein PHAVU_002G295300g [Phaseolus vulgaris]
Length=492

 Score =   254 bits (650),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 125/166 (75%), Positives = 141/166 (85%), Gaps = 0/166 (0%)
 Frame = +2

Query  182  ATPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDP  361
            A  +RIGLAGLAVMGQNLALNIA+KGFPISVYNRT SKVDETV+RA+ EG LPL G ++P
Sbjct  4    AALSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTASKVDETVDRARNEGFLPLTGQYNP  63

Query  362  ESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAE  541
              F+ SIQ+PR VIILVKAGAPVDQTI  LS ++E GDCIIDGGNEWYENTERR  +VA+
Sbjct  64   REFVLSIQRPRSVIILVKAGAPVDQTIAALSDHLEPGDCIIDGGNEWYENTERRISQVAD  123

Query  542  LGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
             GLLYLGMGVSGGE+GAR GPSLMPGGS  AY  + DI+ K+AAQV
Sbjct  124  KGLLYLGMGVSGGEDGARYGPSLMPGGSKTAYNNVHDILHKIAAQV  169



>ref|XP_010441331.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic-like [Camelina sativa]
Length=487

 Score =   254 bits (648),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 125/163 (77%), Positives = 138/163 (85%), Gaps = 0/163 (0%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
            +RIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDET++RA  EG L + G + P  F
Sbjct  7    SRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETLDRASDEGKLRVAGQYSPRDF  66

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            + SIQ+PR VIILVKAGAPVDQTI  LS YME GDCIIDGGNEWY+NTERR  E  + GL
Sbjct  67   VLSIQRPRSVIILVKAGAPVDQTISALSEYMEPGDCIIDGGNEWYQNTERRIVEAEKKGL  126

Query  551  LYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LYLGMGVSGGEEGAR GPSLMPGGSF AY  ++DI+ KVAAQV
Sbjct  127  LYLGMGVSGGEEGARNGPSLMPGGSFTAYNNVKDILEKVAAQV  169



>gb|EPS67575.1| hypothetical protein M569_07199, partial [Genlisea aurea]
Length=485

 Score =   254 bits (648),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 125/166 (75%), Positives = 141/166 (85%), Gaps = 0/166 (0%)
 Frame = +2

Query  182  ATPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDP  361
            A  +RIGLAGLAVMGQNLALNIA+KGFPISVYNRTT+KVDETVERA  EG+LPL+G + P
Sbjct  1    AALSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTTKVDETVERAHREGHLPLFGKYSP  60

Query  362  ESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAE  541
            + F+ SIQKPR +IILVKAGAPVDQTI  LSA+M+ GD IIDGGNEWY+NTERR  E + 
Sbjct  61   QEFVLSIQKPRSIIILVKAGAPVDQTIAALSAFMDPGDTIIDGGNEWYQNTERRISEASG  120

Query  542  LGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
             GLLYLGMGVSGGEEGAR GPSLMPGGS +AY  I  ++ KVAAQV
Sbjct  121  KGLLYLGMGVSGGEEGARYGPSLMPGGSHQAYLNIHSVLDKVAAQV  166



>ref|XP_009392493.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic-like [Musa acuminata subsp. malaccensis]
Length=494

 Score =   254 bits (648),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 121/166 (73%), Positives = 139/166 (84%), Gaps = 0/166 (0%)
 Frame = +2

Query  182  ATPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDP  361
            A  +RIGLAGLAVMGQNLALN+A+KGFPISVYNRT SKVDETV RA  EG LPL G   P
Sbjct  4    AALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTASKVDETVSRAATEGGLPLSGHRSP  63

Query  362  ESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAE  541
            + F+ S+++PR V+ILVKAGAPVDQTI  LS +ME GD IIDGGNEWYENTERR +E A 
Sbjct  64   QDFVLSLRRPRAVVILVKAGAPVDQTIAALSHFMEPGDAIIDGGNEWYENTERRIREAAA  123

Query  542  LGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
             G+LYLGMGVSGGE+GAR GPSLMPGGS +AY+ +EDI+ +VAAQV
Sbjct  124  RGILYLGMGVSGGEDGARHGPSLMPGGSLQAYRNVEDILTRVAAQV  169



>ref|XP_010905189.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1, chloroplastic-like [Elaeis guineensis]
Length=496

 Score =   253 bits (647),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 122/166 (73%), Positives = 137/166 (83%), Gaps = 0/166 (0%)
 Frame = +2

Query  182  ATPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDP  361
            A  +RIGLAGLAVMGQNLALNIA+KGFPISVYNRT SKVDETV RA AEG LPL G H P
Sbjct  4    AAMSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTASKVDETVGRASAEGGLPLIGHHTP  63

Query  362  ESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAE  541
              F+ SI +PR +IILVKAGAPVDQTI  LS +M+ GD IIDGGNEWYENTERR +E A 
Sbjct  64   RDFVLSIARPRSIIILVKAGAPVDQTIAALSQFMDPGDAIIDGGNEWYENTERRLREAAA  123

Query  542  LGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
             GLLYLGMGVSGGE+GAR GPSLMPGG  +AY  ++D++ +VAAQV
Sbjct  124  RGLLYLGMGVSGGEDGARHGPSLMPGGHLQAYHNVQDVLARVAAQV  169



>ref|XP_002304540.1| 6-phosphogluconate dehydrogenase family protein [Populus trichocarpa]
 gb|EEE79519.1| 6-phosphogluconate dehydrogenase family protein [Populus trichocarpa]
Length=492

 Score =   252 bits (643),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 122/166 (73%), Positives = 141/166 (85%), Gaps = 0/166 (0%)
 Frame = +2

Query  182  ATPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDP  361
            +T +RIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDET+ RA++EG   L G + P
Sbjct  4    STLSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETLIRAQSEGPFSLTGHYSP  63

Query  362  ESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAE  541
              F+ SIQ+PR +IILVKAG PVDQTI  L+ +ME GD IIDGGNEWY+NTERR ++VA+
Sbjct  64   RDFVLSIQRPRSIIILVKAGNPVDQTISALTEFMEPGDTIIDGGNEWYQNTERRIQQVAD  123

Query  542  LGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
             G+LYLGMGVSGGEEGAR GPSLMPGGSFEAYK IE ++  VAAQV
Sbjct  124  KGILYLGMGVSGGEEGARHGPSLMPGGSFEAYKNIESVLKSVAAQV  169



>ref|XP_009386035.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic-like [Musa acuminata subsp. malaccensis]
Length=496

 Score =   252 bits (643),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 122/166 (73%), Positives = 139/166 (84%), Gaps = 0/166 (0%)
 Frame = +2

Query  182  ATPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDP  361
            A  +RIGLAGLAVMGQNLALNIA+KGFPISVYNRT SKVDETV RA AEG LP+ G    
Sbjct  6    AVLSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTASKVDETVSRAAAEGGLPMSGHRSA  65

Query  362  ESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAE  541
            + F+ S+++PR VIILVKAGAPVDQTI  LS +ME GD IIDGGNEWYENTERR +E A 
Sbjct  66   QDFVLSLRRPRSVIILVKAGAPVDQTIAALSHFMEPGDAIIDGGNEWYENTERRIREAAA  125

Query  542  LGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
             G+LYLGMGVSGGE+GAR GPSLMPGGS +AY+ +EDI+ +VAAQV
Sbjct  126  RGILYLGMGVSGGEDGARNGPSLMPGGSLQAYQNVEDILTRVAAQV  171



>ref|XP_011073556.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic-like [Sesamum indicum]
Length=488

 Score =   251 bits (642),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 125/166 (75%), Positives = 140/166 (84%), Gaps = 0/166 (0%)
 Frame = +2

Query  182  ATPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDP  361
            AT ++IGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDET++RA  EG LPL G + P
Sbjct  4    ATLSQIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETLDRAHREGQLPLSGHYTP  63

Query  362  ESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAE  541
            + F+ SI+KPR +IILVKAGAPVDQTI  LSAYME GD IIDGGNEWYENTERR  + + 
Sbjct  64   KDFVLSIKKPRSIIILVKAGAPVDQTIAALSAYMEPGDTIIDGGNEWYENTERRMVDASA  123

Query  542  LGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
             GLLYLGMGVSGGE+GAR GPSLMPGGS  AY  I +I+ KVAAQV
Sbjct  124  SGLLYLGMGVSGGEDGARNGPSLMPGGSHRAYLNIHNILEKVAAQV  169



>ref|XP_003525354.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic-like [Glycine max]
Length=495

 Score =   251 bits (642),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 120/166 (72%), Positives = 140/166 (84%), Gaps = 0/166 (0%)
 Frame = +2

Query  182  ATPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDP  361
            A  +RIGLAGLAVMGQNLALNIA+KGFPISVYNRT SKVD+TV+RA+ EG+LPL G + P
Sbjct  4    AALSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTASKVDQTVDRARNEGSLPLTGQYTP  63

Query  362  ESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAE  541
              F+ S+Q+PR VIILVKAG+PVD TI  LS +++ GDCIIDGGNEWYENTERR   VA+
Sbjct  64   RDFVLSLQRPRSVIILVKAGSPVDHTIAALSDHLDPGDCIIDGGNEWYENTERRMNLVAD  123

Query  542  LGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
             GLLYLGMGVSGGE+GAR GPSLMPGGS  AY  ++DI+ K+AAQV
Sbjct  124  KGLLYLGMGVSGGEDGARHGPSLMPGGSHHAYSNVQDILHKIAAQV  169



>ref|XP_009789896.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic-like [Nicotiana sylvestris]
Length=495

 Score =   251 bits (640),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 124/163 (76%), Positives = 139/163 (85%), Gaps = 0/163 (0%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
            +RIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDET++RA+ EG LPL G ++P  F
Sbjct  11   SRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETLDRAQREGQLPLTGQYNPRDF  70

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            + SIQ+PR VIILVKAGAPVDQTI  L+ +ME GD IIDGGNEWYENTERR  E +  GL
Sbjct  71   VLSIQRPRSVIILVKAGAPVDQTIAALAEHMEPGDTIIDGGNEWYENTERRIGEASSKGL  130

Query  551  LYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LYLGMGVSGGE+GAR GPSLMPGGS  AY  I+DI+ KVAAQV
Sbjct  131  LYLGMGVSGGEDGARNGPSLMPGGSHGAYMNIKDILEKVAAQV  173



>ref|XP_002297992.1| 6-phosphogluconate dehydrogenase family protein [Populus trichocarpa]
 gb|EEE82797.1| 6-phosphogluconate dehydrogenase family protein [Populus trichocarpa]
Length=494

 Score =   250 bits (639),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 121/166 (73%), Positives = 139/166 (84%), Gaps = 0/166 (0%)
 Frame = +2

Query  182  ATPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDP  361
            +T +RIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDET+ RA++EG  PL G + P
Sbjct  4    STLSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETLHRAQSEGPFPLTGQYSP  63

Query  362  ESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAE  541
              F+ SIQ+PR +IILVKAG PVDQTI  L+ +ME GD IIDGGNEWY+NTERR +EV +
Sbjct  64   RDFVLSIQRPRSIIILVKAGNPVDQTISALTEFMEPGDTIIDGGNEWYQNTERRIQEVGD  123

Query  542  LGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
             G+LYLGMGVSGGEEGAR GPSLMPGGS EAY  IE ++  VAAQV
Sbjct  124  KGILYLGMGVSGGEEGARHGPSLMPGGSLEAYNNIESVLKSVAAQV  169



>ref|XP_009626290.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic [Nicotiana tomentosiformis]
Length=495

 Score =   250 bits (639),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 124/163 (76%), Positives = 139/163 (85%), Gaps = 0/163 (0%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
            +RIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDET++RA+ EG LPL G ++P  F
Sbjct  11   SRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETLDRAQREGQLPLTGQYNPRDF  70

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            + SIQ+PR VIILVKAGAPVDQTI  L+ +ME GD IIDGGNEWYENTERR  E +  GL
Sbjct  71   VLSIQRPRSVIILVKAGAPVDQTIAALAEHMEPGDTIIDGGNEWYENTERRIGEASSKGL  130

Query  551  LYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LYLGMGVSGGE+GAR GPSLMPGGS  AY  I+DI+ KVAAQV
Sbjct  131  LYLGMGVSGGEDGARNGPSLMPGGSHGAYMNIKDILEKVAAQV  173



>ref|XP_010917535.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic-like [Elaeis guineensis]
Length=496

 Score =   250 bits (638),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/166 (72%), Positives = 137/166 (83%), Gaps = 0/166 (0%)
 Frame = +2

Query  182  ATPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDP  361
            A  +RIGLAGLAVMGQNLALN+A+KGFPISVYNRT SKVDETV RA AEG  PL G H P
Sbjct  4    AALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTASKVDETVGRAAAEGGPPLSGHHSP  63

Query  362  ESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAE  541
              F+ SI +PR +IILVKAGAPVDQTI TLS +M+ GD IIDGGNEWYENTERR ++ A 
Sbjct  64   RDFVLSIARPRSIIILVKAGAPVDQTIATLSQFMDPGDSIIDGGNEWYENTERRLRDAAA  123

Query  542  LGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
             GLLYLGMGVSGGE+GAR GPSLMPGG  +AY  ++D++ +VAAQV
Sbjct  124  RGLLYLGMGVSGGEDGARHGPSLMPGGHLQAYHNVQDVLARVAAQV  169



>ref|XP_011022562.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic-like [Populus euphratica]
Length=494

 Score =   250 bits (638),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 121/166 (73%), Positives = 141/166 (85%), Gaps = 0/166 (0%)
 Frame = +2

Query  182  ATPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDP  361
            +T +RIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDET+ RA++EG   L G + P
Sbjct  4    STLSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETLIRAQSEGPFSLTGQYSP  63

Query  362  ESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAE  541
              F+ SIQ+PR +IILVKAG PVDQTI  L+ +ME GD IIDGGNEWY+NTERR ++V++
Sbjct  64   RDFVLSIQRPRSIIILVKAGNPVDQTISALTEFMEPGDTIIDGGNEWYQNTERRIQQVSD  123

Query  542  LGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
             G+LYLGMGVSGGEEGAR GPSLMPGGSFEAYK IE ++  VAAQV
Sbjct  124  KGILYLGMGVSGGEEGARHGPSLMPGGSFEAYKNIESVLKSVAAQV  169



>ref|XP_011080880.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic-like [Sesamum indicum]
Length=488

 Score =   249 bits (636),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 139/166 (84%), Gaps = 0/166 (0%)
 Frame = +2

Query  182  ATPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDP  361
            A  ++IGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDET++RA  EG LPL+G + P
Sbjct  4    AAMSQIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETLDRAHREGQLPLFGQYTP  63

Query  362  ESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAE  541
            + F+ SI+KPR +IILVKAGAPVDQTI  LSAYME GD IIDGGNEWYENTERR  + + 
Sbjct  64   KDFVLSIKKPRSIIILVKAGAPVDQTIAALSAYMEPGDTIIDGGNEWYENTERRMVDASA  123

Query  542  LGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
             GLLYLGMGVSGGE+GAR GPSLMPGG+  AY  I  I+ KVAAQV
Sbjct  124  SGLLYLGMGVSGGEDGARHGPSLMPGGAHRAYLNIHHILEKVAAQV  169



>ref|XP_008811378.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1, chloroplastic-like [Phoenix dactylifera]
Length=496

 Score =   249 bits (636),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 118/166 (71%), Positives = 136/166 (82%), Gaps = 0/166 (0%)
 Frame = +2

Query  182  ATPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDP  361
            A  +RIGLAGLAVMGQNLALNIA+KGFPISVYNRT SKVDETV RA  EG LPL G H P
Sbjct  4    AALSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTASKVDETVGRASVEGGLPLTGHHSP  63

Query  362  ESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAE  541
              F+ SI +PR ++ILVKAGAPVDQT+  LS +M+ GD IIDGGNEWYENTERR +E + 
Sbjct  64   RDFVLSISRPRSIVILVKAGAPVDQTVAALSQFMDPGDSIIDGGNEWYENTERRLREASA  123

Query  542  LGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
             GLLYLGMGVSGGE+GAR GPSLMPGG  +AY  ++D++ +VAAQV
Sbjct  124  RGLLYLGMGVSGGEDGARHGPSLMPGGHLKAYHNVQDVLARVAAQV  169



>ref|XP_010676957.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic [Beta vulgaris subsp. vulgaris]
Length=582

 Score =   251 bits (642),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 120/165 (73%), Positives = 140/165 (85%), Gaps = 0/165 (0%)
 Frame = +2

Query  185  TPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPE  364
            +P +IGLAGLAVMGQNLALNIA+KGFPISVYNRT+SKVDET+ RAK EG+LPL G + P 
Sbjct  92   SPAQIGLAGLAVMGQNLALNIAEKGFPISVYNRTSSKVDETLNRAKIEGDLPLIGHYTPR  151

Query  365  SFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAEL  544
             F+ SIQ+PR +IILVKAG+PVDQTI +LS++ME GD IIDGGNEWY+NTERR  +    
Sbjct  152  DFVLSIQRPRSIIILVKAGSPVDQTINSLSSFMEPGDTIIDGGNEWYQNTERRLNDAHSN  211

Query  545  GLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            GLLYLGMGVSGGE+GAR GPSLMPGG F+AY  +E I+ KVAAQV
Sbjct  212  GLLYLGMGVSGGEDGARYGPSLMPGGDFKAYDNVEKILKKVAAQV  256



>sp|Q94KU2.1|6PGD2_SPIOL RecName: Full=6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic; Flags: Precursor [Spinacia oleracea]
 gb|AAK49897.1|AF295670_1 plastidic 6-phosphogluconate dehydrogenase [Spinacia oleracea]
Length=537

 Score =   249 bits (635),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 124/199 (62%), Positives = 153/199 (77%), Gaps = 8/199 (4%)
 Frame = +2

Query  107  FIFLPYSSIPCTILSAPN*LEENSMA--------TPTRIGLAGLAVMGQNLALNIADKGF  262
            F+  P+  +P   LS+P  L  +S +          ++IGL GLAVMGQNLALNIA+KGF
Sbjct  13   FLSPPFIHLPLLSLSSPTPLPHSSSSTFSLFSTMAASQIGLVGLAVMGQNLALNIAEKGF  72

Query  263  PISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESFIRSIQKPRVVIILVKAGAPVDQTI  442
            PISVYNRT SKVDET++RAK+EG+LPL G + P  F+ SI++PR ++ILVKAG+PVDQTI
Sbjct  73   PISVYNRTASKVDETLDRAKSEGDLPLSGHYTPRDFVLSIERPRSIVILVKAGSPVDQTI  132

Query  443  KTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGLLYLGMGVSGGEEGARRGPSLMPGG  622
             +L+++ME GD IIDGGNEWY+NTERR  +    GLLYLGMGVSGGEEGAR GPSLMPGG
Sbjct  133  ASLASFMEPGDTIIDGGNEWYQNTERRLSDAHSNGLLYLGMGVSGGEEGARFGPSLMPGG  192

Query  623  SFEAYKYIEDIVLKVAAQV  679
             F+AY  I+ I+ KVAAQV
Sbjct  193  DFQAYDNIQHILKKVAAQV  211



>gb|KFK36587.1| hypothetical protein AALP_AA4G143200 [Arabis alpina]
Length=488

 Score =   245 bits (626),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 122/166 (73%), Positives = 137/166 (83%), Gaps = 0/166 (0%)
 Frame = +2

Query  182  ATPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDP  361
            A  +RIGLAGLAVMGQNLALNIA+KGFPISVYNRTT+KVDET++RA  EG LP+ G + P
Sbjct  4    AALSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTTKVDETLDRAIIEGKLPVTGQYSP  63

Query  362  ESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAE  541
              FI SIQ+PR +IILVKAG+PVDQTI   S YME GD IIDGGNEWY NTERR  E  +
Sbjct  64   RDFILSIQRPRSIIILVKAGSPVDQTIDAFSQYMEPGDTIIDGGNEWYLNTERRIVEAEK  123

Query  542  LGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
             GLLYLGMGVSGGEEGAR GPSLMPGGS +AY  ++DI+ KVAAQV
Sbjct  124  KGLLYLGMGVSGGEEGARNGPSLMPGGSLQAYDNVKDILGKVAAQV  169



>gb|EMS64512.1| 6-phosphogluconate dehydrogenase, decarboxylating [Triticum urartu]
Length=737

 Score =   245 bits (626),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 121/163 (74%), Positives = 135/163 (83%), Gaps = 21/163 (13%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
            TRIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETV+RAK EGNLPLYGFHDP SF
Sbjct  4    TRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVQRAKLEGNLPLYGFHDPASF  63

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            + SIQKPRVVI+LVKAGAPVDQTI TL+A++E+GDCI+DGGNEWYENT+RREK + E GL
Sbjct  64   VNSIQKPRVVIMLVKAGAPVDQTIATLAAHLEQGDCIVDGGNEWYENTKRREKAMEERGL  123

Query  551  LYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LYLGMGVSGGE                     EDI+LKV+AQ+
Sbjct  124  LYLGMGVSGGE---------------------EDILLKVSAQI  145


 Score =   200 bits (508),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESF  370
            TRIGLAGLAVMGQNLALNIA+KGFPISVYNRTTSKVDETV+RAK EGNLPLYGFHDP SF
Sbjct  446  TRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVQRAKLEGNLPLYGFHDPASF  505

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVA  538
            + SIQKPRVVI+LVKAGAPVDQTI TL+A++E+GDCI+DGGNEW+ +  + E+  A
Sbjct  506  VNSIQKPRVVIMLVKAGAPVDQTIATLAAHLEQGDCIVDGGNEWFLSGLKDERVAA  561



>ref|XP_007513389.1| 6-phosphogluconate dehydrogenase [Bathycoccus prasinos]
 emb|CCO15914.1| 6-phosphogluconate dehydrogenase [Bathycoccus prasinos]
Length=518

 Score =   237 bits (604),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 117/170 (69%), Positives = 136/170 (80%), Gaps = 1/170 (1%)
 Frame = +2

Query  173  NSMATPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEG-NLPLYG  349
            N+    +RIGL GLAVMGQNLALN+A+KGFPISVYNR+  K D  V RA+ EG +  L G
Sbjct  20   NADGQKSRIGLCGLAVMGQNLALNVAEKGFPISVYNRSADKTDGCVNRAEKEGLSSKLRG  79

Query  350  FHDPESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREK  529
            + D + F+ SI+KPR +IILVKAGAPVD TI+ LS ++E GDCI+DGGNEWYENTERR K
Sbjct  80   YKDLKEFVESIEKPRHIIILVKAGAPVDATIEGLSQFLEPGDCIVDGGNEWYENTERRMK  139

Query  530  EVAELGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            EV E GLLYLGMGVSGGEEGAR GPS+MPGGS EAYK IEDI+  V+AQ 
Sbjct  140  EVQEKGLLYLGMGVSGGEEGARNGPSMMPGGSEEAYKRIEDILKPVSAQT  189



>ref|XP_006286028.1| hypothetical protein CARUB_v10007559mg [Capsella rubella]
 gb|EOA18926.1| hypothetical protein CARUB_v10007559mg [Capsella rubella]
Length=476

 Score =   234 bits (598),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 120/166 (72%), Positives = 131/166 (79%), Gaps = 11/166 (7%)
 Frame = +2

Query  182  ATPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDP  361
            A  +RIGLA LAVMGQNLALNIA+KGFPISVYNRTTSKVDET++RA  EG LP+ G + P
Sbjct  4    AALSRIGLASLAVMGQNLALNIAEKGFPISVYNRTTSKVDETLDRASDEGKLPVAGQYSP  63

Query  362  ESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAE  541
              F+ SIQ+PR VIILVKAGAPVDQTI  LS YME GDCIIDGGNEWY+NTERR  E  +
Sbjct  64   RDFVLSIQRPRSVIILVKAGAPVDQTISALSEYMEPGDCIIDGGNEWYQNTERRIVEAEK  123

Query  542  LGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
             GLLYLGMGVSGGEEGAR GPSLMP           DI+ KVAAQV
Sbjct  124  KGLLYLGMGVSGGEEGARNGPSLMP-----------DILEKVAAQV  158



>ref|XP_001418779.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO97072.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=507

 Score =   234 bits (597),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 116/170 (68%), Positives = 132/170 (78%), Gaps = 1/170 (1%)
 Frame = +2

Query  173  NSMATPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEG-NLPLYG  349
            N     +RIGL GLAVMGQNLALN+A+KGF ISVYNR++ K D  VERAK EG    L G
Sbjct  11   NGAGEKSRIGLCGLAVMGQNLALNVAEKGFDISVYNRSSDKTDVCVERAKKEGLGAKLRG  70

Query  350  FHDPESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREK  529
            +H+ + F+ S+ KPR VIILVKAGAPVD TI  LS ++E GDCIIDGGNEWYENTERR K
Sbjct  71   YHEMKDFVASLAKPRCVIILVKAGAPVDATIAGLSQFLEPGDCIIDGGNEWYENTERRSK  130

Query  530  EVAELGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            E AE GLLY+GMGVSGGEEGAR GPS+MPGGS EAY  I DI+  V+AQ 
Sbjct  131  EAAEKGLLYVGMGVSGGEEGARNGPSMMPGGSKEAYDIIADILKPVSAQT  180



>ref|NP_001241786.1| 6-phosphogluconate dehydrogenase, decarboxylating [Zea mays]
 gb|ACG41643.1| 6-phosphogluconate dehydrogenase, decarboxylating [Zea mays]
Length=507

 Score =   232 bits (592),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/162 (69%), Positives = 130/162 (80%), Gaps = 0/162 (0%)
 Frame = +2

Query  194  RIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESFI  373
            RIGLAGLA MGQNLALNIA+KGFPISVYNRT +KVD T+ RA+ EG+LP+ G  DP  F+
Sbjct  20   RIGLAGLATMGQNLALNIAEKGFPISVYNRTAAKVDSTLSRARDEGSLPVLGHRDPRGFV  79

Query  374  RSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGLL  553
             S+ +PR V++LV+AG  VD TI+ LS Y+E GD I+DGGNEWY+NTERR +E A  GLL
Sbjct  80   LSLARPRAVVLLVQAGPAVDATIQALSPYLEPGDAIVDGGNEWYQNTERRIEEAAARGLL  139

Query  554  YLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            YLGMGVSGGEEGAR GPSLMPGGS +AY  I DI+ K AAQ 
Sbjct  140  YLGMGVSGGEEGARNGPSLMPGGSADAYANIRDILQKAAAQT  181



>gb|AFW60760.1| putative 6-phosphogluconate dehydrogenase [Zea mays]
Length=507

 Score =   231 bits (589),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 110/162 (68%), Positives = 130/162 (80%), Gaps = 0/162 (0%)
 Frame = +2

Query  194  RIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESFI  373
            RIGLAGLA MGQNLALNIA+KGFPISVYNRT +KVD T+ RA+ EG+LP+ G  DP  F+
Sbjct  20   RIGLAGLATMGQNLALNIAEKGFPISVYNRTAAKVDSTLSRARDEGSLPVLGHRDPRGFV  79

Query  374  RSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGLL  553
             S+ +PR V++LV+AG  VD TI+ LS Y+E GD I+DGGNEWY+NTERR +E A  G+L
Sbjct  80   LSLARPRAVVLLVQAGPAVDATIQALSPYLEPGDAIVDGGNEWYQNTERRIQEAAARGVL  139

Query  554  YLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            YLGMGVSGGEEGAR GPSLMPGGS +AY  I DI+ K AAQ 
Sbjct  140  YLGMGVSGGEEGARNGPSLMPGGSADAYANIRDILQKAAAQT  181



>dbj|BAK00156.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=501

 Score =   230 bits (586),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/162 (67%), Positives = 127/162 (78%), Gaps = 0/162 (0%)
 Frame = +2

Query  194  RIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESFI  373
            RIGLAGLA MGQNLALNIA+KGFPISVYNRT +KVD T+ RA AEG LP+ G  DP  F+
Sbjct  20   RIGLAGLATMGQNLALNIAEKGFPISVYNRTAAKVDSTLSRAAAEGALPVLGHRDPRDFV  79

Query  374  RSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGLL  553
             S+ +PR V++LV+AG  VD TI  LS Y++ GD I+DGGNEWY+NTERR  + A  G+L
Sbjct  80   LSLARPRTVVLLVQAGPAVDATIDALSPYLDAGDAIVDGGNEWYQNTERRIHQAASRGVL  139

Query  554  YLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            YLGMGVSGGEEGAR GPSLMPGG F+AY  + DI+ K AAQ 
Sbjct  140  YLGMGVSGGEEGARNGPSLMPGGDFQAYANVRDILEKAAAQT  181



>gb|AFB34823.1| hypothetical protein UMN_5272_01, partial [Pinus mugo]
 gb|AFB34824.1| hypothetical protein UMN_5272_01, partial [Pinus mugo]
 gb|AFB34825.1| hypothetical protein UMN_5272_01, partial [Pinus mugo]
Length=147

 Score =   218 bits (556),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +2

Query  305  TVERAKAEGNLPLYGFHDPESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCII  484
            TVERAK EGNLP+ GFHDP+ F+ SIQKPRV+I+LVKAG PVD+TI+TLSA+ME+GDCI+
Sbjct  1    TVERAKVEGNLPVKGFHDPKDFVNSIQKPRVIILLVKAGLPVDKTIETLSAHMEEGDCIV  60

Query  485  DGGNEWYENTERREKEVAELGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLK  664
            DGGNEWYENTERR++   + GLLYLGMGVSGGEEGAR GPSLMPGGSFEAYKYIEDIVLK
Sbjct  61   DGGNEWYENTERRQEAAKQKGLLYLGMGVSGGEEGARHGPSLMPGGSFEAYKYIEDIVLK  120

Query  665  VAAQV  679
            VAAQV
Sbjct  121  VAAQV  125



>gb|AFB34821.1| hypothetical protein UMN_5272_01, partial [Pinus mugo]
 gb|AFB34822.1| hypothetical protein UMN_5272_01, partial [Pinus mugo]
Length=147

 Score =   218 bits (556),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +2

Query  305  TVERAKAEGNLPLYGFHDPESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCII  484
            TVERAK EGNLP+ GFHDP+ F+ SIQKPRV+I+LVKAG PVD+TI+TLSA+ME+GDCI+
Sbjct  1    TVERAKVEGNLPVRGFHDPKDFVNSIQKPRVIILLVKAGLPVDKTIETLSAHMEEGDCIV  60

Query  485  DGGNEWYENTERREKEVAELGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLK  664
            DGGNEWYENTERR++   + GLLYLGMGVSGGEEGAR GPSLMPGGSFEAYKYIEDIVLK
Sbjct  61   DGGNEWYENTERRQEAAKQKGLLYLGMGVSGGEEGARHGPSLMPGGSFEAYKYIEDIVLK  120

Query  665  VAAQV  679
            VAAQV
Sbjct  121  VAAQV  125



>gb|AEW09340.1| hypothetical protein UMN_5272_01, partial [Pinus radiata]
 gb|AFG55113.1| hypothetical protein UMN_5272_01, partial [Pinus taeda]
 gb|AFG55114.1| hypothetical protein UMN_5272_01, partial [Pinus taeda]
 gb|AFG55115.1| hypothetical protein UMN_5272_01, partial [Pinus taeda]
 gb|AFG55116.1| hypothetical protein UMN_5272_01, partial [Pinus taeda]
 gb|AFG55117.1| hypothetical protein UMN_5272_01, partial [Pinus taeda]
 gb|AFG55118.1| hypothetical protein UMN_5272_01, partial [Pinus taeda]
 gb|AFG55119.1| hypothetical protein UMN_5272_01, partial [Pinus taeda]
 gb|AFG55120.1| hypothetical protein UMN_5272_01, partial [Pinus taeda]
 gb|AFG55121.1| hypothetical protein UMN_5272_01, partial [Pinus taeda]
 gb|AFG55122.1| hypothetical protein UMN_5272_01, partial [Pinus taeda]
Length=147

 Score =   217 bits (553),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +2

Query  305  TVERAKAEGNLPLYGFHDPESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCII  484
            TVERAK EGNLP+ GFHDP+ F+ SIQKPRV+I+LVKAG PVD+TI+TLSA+ME+GDCI+
Sbjct  1    TVERAKVEGNLPVKGFHDPKDFVNSIQKPRVIILLVKAGLPVDKTIETLSAHMEEGDCIV  60

Query  485  DGGNEWYENTERREKEVAELGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLK  664
            DGGNEWYENTERR++   + GLLYLGMGVSGGEEGAR GPSLMPGGSFEAYKYIEDI+LK
Sbjct  61   DGGNEWYENTERRQEAAKQKGLLYLGMGVSGGEEGARHGPSLMPGGSFEAYKYIEDILLK  120

Query  665  VAAQV  679
            VAAQV
Sbjct  121  VAAQV  125



>emb|CEF98862.1| 6-phosphogluconate dehydrogenase,decarboxylating [Ostreococcus 
tauri]
Length=538

 Score =   229 bits (583),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 115/171 (67%), Positives = 131/171 (77%), Gaps = 1/171 (1%)
 Frame = +2

Query  170  ENSMATPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEG-NLPLY  346
            E+     +RIGL GLAVMGQNLALN+A KGF ISVYNR+  K +  VERAK EG    L 
Sbjct  42   EHGSLKKSRIGLCGLAVMGQNLALNVASKGFDISVYNRSGDKTETCVERAKKEGLGEKLR  101

Query  347  GFHDPESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERRE  526
            G+ D   F+ S+ KPR VIILVKAGAPVD TI+ LS ++E GDCIIDGGNEWYENTERR 
Sbjct  102  GYQDVGDFVDSLAKPRCVIILVKAGAPVDATIEKLSQFLEPGDCIIDGGNEWYENTERRA  161

Query  527  KEVAELGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            +EVAE GLLY+GMGVSGGEEGAR GPS+MPGGS EAY  I DI+  V+AQ 
Sbjct  162  REVAEKGLLYIGMGVSGGEEGARNGPSMMPGGSREAYDIIADILKPVSAQT  212



>ref|NP_001067912.1| Os11g0484500 [Oryza sativa Japonica Group]
 sp|Q2R480.1|6PGD2_ORYSJ RecName: Full=6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic; Short=OsG6PGH2; Flags: Precursor [Oryza 
sativa Japonica Group]
 gb|ABA93694.1| 6-phosphogluconate dehydrogenase, decarboxylating, putative, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF28275.1| Os11g0484500 [Oryza sativa Japonica Group]
Length=508

 Score =   228 bits (581),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 109/162 (67%), Positives = 127/162 (78%), Gaps = 0/162 (0%)
 Frame = +2

Query  194  RIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESFI  373
            RIGLAGLA MGQNLALNIA+KGFPISVYNRT +KVD TV RA+AEG LP+ G  DP  F+
Sbjct  23   RIGLAGLATMGQNLALNIAEKGFPISVYNRTAAKVDATVSRAEAEGALPVLGHRDPRGFV  82

Query  374  RSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGLL  553
             S+ +PR V++LV+AG  VD TI  L  Y++ GD I+DGGNEWY+NTERR +E A  G+L
Sbjct  83   LSLSRPRTVVLLVQAGRAVDATIDALVPYLDAGDAIVDGGNEWYQNTERRIEEAAARGIL  142

Query  554  YLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            YLGMGVSGGEEGAR GPSLMPGG  +AY  I DI+ K AAQ 
Sbjct  143  YLGMGVSGGEEGARNGPSLMPGGHIDAYNNIRDILEKAAAQT  184



>ref|XP_002449496.1| hypothetical protein SORBIDRAFT_05g016740 [Sorghum bicolor]
 gb|EES08484.1| hypothetical protein SORBIDRAFT_05g016740 [Sorghum bicolor]
Length=504

 Score =   228 bits (580),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 108/162 (67%), Positives = 128/162 (79%), Gaps = 0/162 (0%)
 Frame = +2

Query  194  RIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESFI  373
            RIGLAGLA MGQNLALNIA+KGFPISVYNRT +KVD T+ RA+ EG LP+ G  DP  F+
Sbjct  20   RIGLAGLATMGQNLALNIAEKGFPISVYNRTAAKVDSTLSRARDEGALPVLGHRDPRGFV  79

Query  374  RSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGLL  553
             S+ +PR V++LV+AG  VD TI+ L+ Y+E GD I+DGGNEWY+NTERR +E A  G+L
Sbjct  80   LSLARPRTVVLLVQAGPAVDATIQALTPYLEPGDAIVDGGNEWYQNTERRIEEAAARGIL  139

Query  554  YLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            YLGMGVSGGEEGAR GPSLMPGG  +AY  I DI+ K AAQ 
Sbjct  140  YLGMGVSGGEEGARNGPSLMPGGHVDAYNNIRDILEKAAAQT  181



>ref|XP_003557402.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic [Brachypodium distachyon]
Length=501

 Score =   227 bits (579),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 128/162 (79%), Gaps = 0/162 (0%)
 Frame = +2

Query  194  RIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESFI  373
            RIGLAGLA MGQNLALNIA+KGFPISVYNRT +KVD T+ RA AEG LP+ G  DP  F+
Sbjct  20   RIGLAGLATMGQNLALNIAEKGFPISVYNRTAAKVDSTLSRAAAEGALPVLGHRDPRDFV  79

Query  374  RSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGLL  553
             S+ +PR V++LV+AG  VD TI  LS Y++ GD I+DGGNEWY+NTERR ++ +  G+L
Sbjct  80   LSLARPRTVVLLVQAGPAVDATIDALSPYLDAGDAIVDGGNEWYQNTERRIEQASSRGIL  139

Query  554  YLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            YLGMGVSGGEEGAR GPSLMPGG  +AY  I+DI+ K AAQ 
Sbjct  140  YLGMGVSGGEEGARNGPSLMPGGHVDAYNNIKDILEKAAAQT  181



>ref|XP_001696880.1| 6-phosphogluconate dehydrogenase, decarboxylating [Chlamydomonas 
reinhardtii]
 gb|EDP00572.1| 6-phosphogluconate dehydrogenase, decarboxylating [Chlamydomonas 
reinhardtii]
Length=566

 Score =   228 bits (582),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 115/182 (63%), Positives = 139/182 (76%), Gaps = 1/182 (1%)
 Frame = +2

Query  137  CTILSAPN*LEENSMATPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVER  316
             +  SAP   + N+      IGL GLAVMGQNLALNIA+KGFPISVYNR+  K +  V+R
Sbjct  62   ASTASAPKSSKGNAPMAVAEIGLVGLAVMGQNLALNIAEKGFPISVYNRSYDKTEAAVKR  121

Query  317  AKAEG-NLPLYGFHDPESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGG  493
            A+ EG    L+G+   + F++S+Q+PR VIILVKAGAPVDQTI  L  +ME GD IIDGG
Sbjct  122  AQKEGLGEKLHGYEQVKDFVQSLQRPRRVIILVKAGAPVDQTIDQLCEFMEPGDIIIDGG  181

Query  494  NEWYENTERREKEVAELGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAA  673
            NEWYENTE+R  +VA  G+LY+GMGVSGGEEGARRGPS+MPGGS EAY +I+ +V KVAA
Sbjct  182  NEWYENTEKRMAKVAAKGILYMGMGVSGGEEGARRGPSMMPGGSPEAYSHIKSVVEKVAA  241

Query  674  QV  679
            QV
Sbjct  242  QV  243



>ref|XP_004979278.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic-like [Setaria italica]
Length=504

 Score =   225 bits (574),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 108/162 (67%), Positives = 127/162 (78%), Gaps = 0/162 (0%)
 Frame = +2

Query  194  RIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESFI  373
            RIGLAGLA MGQNLALNIA+KGFPISVYNRT +KVD T+ RA+ EG LP+ G  DP  F+
Sbjct  20   RIGLAGLATMGQNLALNIAEKGFPISVYNRTAAKVDSTLVRARDEGALPVLGHRDPRGFV  79

Query  374  RSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGLL  553
             S+ +PR V++LV+AG  VD TI  L+ Y+E GD I+DGGNEWY+NTERR +E A  G+L
Sbjct  80   LSLARPRTVVLLVQAGPAVDATIDALTPYLEPGDAIVDGGNEWYQNTERRIEEAAARGIL  139

Query  554  YLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            YLGMGVSGGEEGAR GPSLMPGG  +AY  I DI+ K AAQ 
Sbjct  140  YLGMGVSGGEEGARNGPSLMPGGHVDAYNNIRDILEKAAAQT  181



>ref|XP_002953515.1| hypothetical protein VOLCADRAFT_109207 [Volvox carteri f. nagariensis]
 gb|EFJ45488.1| hypothetical protein VOLCADRAFT_109207 [Volvox carteri f. nagariensis]
Length=566

 Score =   227 bits (578),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 118/210 (56%), Positives = 146/210 (70%), Gaps = 20/210 (10%)
 Frame = +2

Query  110  IFLPYSSIPCTIL-------------------SAPN*LEENSMATPTRIGLAGLAVMGQN  232
              +P++++P  +L                    AP   +++S    + IGL GLAVMGQN
Sbjct  34   FHVPWTAVPAVLLLPRPAPFVRRVVPHAASTAEAPRASDKSSPMAVSEIGLVGLAVMGQN  93

Query  233  LALNIADKGFPISVYNRTTSKVDETVERAKAEG-NLPLYGFHDPESFIRSIQKPRVVIIL  409
            +ALN+A+KGFPISVYNR+  K +  V+RA+ EG    L G+   + F+ S+QKPR VIIL
Sbjct  94   MALNVAEKGFPISVYNRSYDKTEAAVKRAQKEGLGDKLRGYESVKDFVASLQKPRRVIIL  153

Query  410  VKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGLLYLGMGVSGGEEG  589
            VKAGAPVDQTI  L  YME GD IIDGGNEWYENTE+R  +VA  G+LY+GMGVSGGEEG
Sbjct  154  VKAGAPVDQTIDALCEYMEPGDIIIDGGNEWYENTEKRVAKVASKGILYMGMGVSGGEEG  213

Query  590  ARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            ARRGPS+MPGGS EAY +I+ IV KVAAQV
Sbjct  214  ARRGPSMMPGGSPEAYTHIKSIVEKVAAQV  243



>gb|AFB34817.1| hypothetical protein UMN_5272_01, partial [Abies alba]
 gb|AFB34818.1| hypothetical protein UMN_5272_01, partial [Abies alba]
Length=147

 Score =   214 bits (545),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +2

Query  305  TVERAKAEGNLPLYGFHDPESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCII  484
            TVERAK EGNLP+ GFHDP+ F++SIQKPRV+I+LVKAGAPVD+TI+TLS +ME+GDCI+
Sbjct  1    TVERAKIEGNLPVKGFHDPKDFVKSIQKPRVIILLVKAGAPVDKTIETLSTHMEEGDCIV  60

Query  485  DGGNEWYENTERREKEVAELGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLK  664
            DGGNEWYENTERR++   + GLLYLGMGVSGGEEGAR GPSLMPGGS+E YKYI+DIV+K
Sbjct  61   DGGNEWYENTERRQEAAKQKGLLYLGMGVSGGEEGARHGPSLMPGGSYEGYKYIQDIVVK  120

Query  665  VAAQV  679
            VAAQV
Sbjct  121  VAAQV  125



>ref|XP_003080519.1| 6-phosphogluconate dehydrogenase (ISS) [Ostreococcus tauri]
Length=702

 Score =   229 bits (583),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 115/172 (67%), Positives = 131/172 (76%), Gaps = 1/172 (1%)
 Frame = +2

Query  167  EENSMATPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEG-NLPL  343
             E+     +RIGL GLAVMGQNLALN+A KGF ISVYNR+  K +  VERAK EG    L
Sbjct  205  REHGSLKKSRIGLCGLAVMGQNLALNVASKGFDISVYNRSGDKTETCVERAKKEGLGEKL  264

Query  344  YGFHDPESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERR  523
             G+ D   F+ S+ KPR VIILVKAGAPVD TI+ LS ++E GDCIIDGGNEWYENTERR
Sbjct  265  RGYQDVGDFVDSLAKPRCVIILVKAGAPVDATIEKLSQFLEPGDCIIDGGNEWYENTERR  324

Query  524  EKEVAELGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
             +EVAE GLLY+GMGVSGGEEGAR GPS+MPGGS EAY  I DI+  V+AQ 
Sbjct  325  AREVAEKGLLYIGMGVSGGEEGARNGPSMMPGGSREAYDIIADILKPVSAQT  376



>ref|XP_001696881.1| 6-phosphogluconate dehydrogenase, decarboxylating [Chlamydomonas 
reinhardtii]
 gb|AAL76323.1|AF394513_1 6-phosphogluconate dehydrogenase [Chlamydomonas reinhardtii]
 gb|EDP00573.1| 6-phosphogluconate dehydrogenase, decarboxylating [Chlamydomonas 
reinhardtii]
Length=490

 Score =   224 bits (571),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 111/162 (69%), Positives = 132/162 (81%), Gaps = 1/162 (1%)
 Frame = +2

Query  197  IGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEG-NLPLYGFHDPESFI  373
            IGL GLAVMGQNLALNIA+KGFPISVYNR+  K +  V+RA+ EG    L+G+   + F+
Sbjct  6    IGLVGLAVMGQNLALNIAEKGFPISVYNRSYDKTEAAVKRAQKEGLGEKLHGYEQVKDFV  65

Query  374  RSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGLL  553
            +S+Q+PR VIILVKAGAPVDQTI  L  +ME GD IIDGGNEWYENTE+R  +VA  G+L
Sbjct  66   QSLQRPRRVIILVKAGAPVDQTIDQLCEFMEPGDIIIDGGNEWYENTEKRMAKVAAKGIL  125

Query  554  YLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            Y+GMGVSGGEEGARRGPS+MPGGS EAY +I+ +V KVAAQV
Sbjct  126  YMGMGVSGGEEGARRGPSMMPGGSPEAYSHIKSVVEKVAAQV  167



>dbj|BAG32445.1| 6-phosphogluconate dehydrogenase, partial [Gloeochaete wittrockiana]
Length=440

 Score =   223 bits (567),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 107/157 (68%), Positives = 131/157 (83%), Gaps = 0/157 (0%)
 Frame = +2

Query  209  GLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESFIRSIQK  388
            GLAVMGQNLALNIA++G PISV+NR+ +KVD+TV RA+ EG LPLYG+ D + F+ SI++
Sbjct  1    GLAVMGQNLALNIAEEGIPISVFNRSANKVDDTVLRAEREGQLPLYGYKDVKDFVASIER  60

Query  389  PRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGLLYLGMG  568
            PR +IILVKAGAPVD TI  LS Y+E+GD IIDGGNEWY+NTERR  E+A  G+ Y+GMG
Sbjct  61   PRAIIILVKAGAPVDDTIAALSQYLEEGDLIIDGGNEWYKNTERRGVELAAKGIEYMGMG  120

Query  569  VSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            VSGGEEGAR GPS+MPGG  EAY+ ++ I+ KVAAQV
Sbjct  121  VSGGEEGARNGPSMMPGGPIEAYERVKPILEKVAAQV  157



>ref|XP_004343090.1| 6-phosphogluconate dehydrogenase [Capsaspora owczarzaki ATCC 
30864]
 gb|KJE97355.1| 6-phosphogluconate dehydrogenase [Capsaspora owczarzaki ATCC 
30864]
Length=473

 Score =   222 bits (565),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 107/165 (65%), Positives = 129/165 (78%), Gaps = 0/165 (0%)
 Frame = +2

Query  185  TPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPE  364
            T +++GL GLAVMGQNLALN+A KGF ISV+NR+  K  +T  RAK EGNLPL GF + +
Sbjct  2    TLSKVGLVGLAVMGQNLALNVASKGFQISVFNRSYEKTQDTERRAKEEGNLPLVGFKEMK  61

Query  365  SFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAEL  544
             F+ S++KPR VIILV+AG PVD+TI  LS ++E GD I+DGGNEWYENTERR +EVA  
Sbjct  62   DFVASLEKPRRVIILVQAGKPVDETIAKLSEHLEAGDLIVDGGNEWYENTERRAQEVAAK  121

Query  545  GLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            GLLY+GMGVSGGE GAR GPSLMPGG    Y  +E I+ K+AAQV
Sbjct  122  GLLYMGMGVSGGESGARNGPSLMPGGPKAGYDLMEPIITKIAAQV  166



>gb|AFB34819.1| hypothetical protein UMN_5272_01, partial [Larix decidua]
 gb|AFB34820.1| hypothetical protein UMN_5272_01, partial [Larix decidua]
Length=147

 Score =   209 bits (533),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 96/125 (77%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +2

Query  305  TVERAKAEGNLPLYGFHDPESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCII  484
            TVERAK EGNLP+ GF+DP+ F+ S+QKPRV+I+LVKAGAPVD+TI+TLS +ME+GDCI+
Sbjct  1    TVERAKIEGNLPVKGFYDPKDFVNSLQKPRVIILLVKAGAPVDKTIETLSTHMEEGDCIV  60

Query  485  DGGNEWYENTERREKEVAELGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLK  664
            DGGNEWYENTERR++   + GLLYLGMGVSGGEEGAR GPS+MPGGS+EAYKYIEDIV+K
Sbjct  61   DGGNEWYENTERRQEAAQKRGLLYLGMGVSGGEEGARHGPSMMPGGSYEAYKYIEDIVVK  120

Query  665  VAAQV  679
            V+AQV
Sbjct  121  VSAQV  125



>dbj|BAG32444.1| 6-phosphogluconate dehydrogenase [Cyanophora paradoxa]
Length=439

 Score =   219 bits (557),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = +2

Query  215  AVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESFIRSIQKPR  394
            AVMGQNLALNIA++G PISV+NR+  KVD+TV RA  EGNLPL GF + + F+ SI+KPR
Sbjct  1    AVMGQNLALNIAEEGLPISVFNRSPDKVDDTVARAAREGNLPLTGFKNVKEFVDSIEKPR  60

Query  395  VVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGLLYLGMGVS  574
             +IILVKAGAPVD TI  LS ++E+GD IIDGGNEWYENTERR  E A+ G+ Y+GMGVS
Sbjct  61   SIIILVKAGAPVDATISALSEHLEEGDLIIDGGNEWYENTERRAAECAKRGINYMGMGVS  120

Query  575  GGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            GGEEGAR GPSLMPGG  +AY  I+ I+ KVAAQV
Sbjct  121  GGEEGARNGPSLMPGGPKDAYDRIKPILDKVAAQV  155



>ref|XP_002502811.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO64069.1| predicted protein [Micromonas sp. RCC299]
Length=500

 Score =   216 bits (549),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 108/167 (65%), Positives = 127/167 (76%), Gaps = 1/167 (1%)
 Frame = +2

Query  182  ATPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEG-NLPLYGFHD  358
            A  +++GL GLAVMGQNLALN+A+KGF ISVYNR+  K D  V RA+ EG    L GF D
Sbjct  4    ADKSQVGLCGLAVMGQNLALNVAEKGFKISVYNRSGDKTDNAVARAQKEGLGDNLVGFKD  63

Query  359  PESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVA  538
               F++S+ KPR VIILVKAGAPVD TI+ L+ +ME GD IIDGGNEWYENTERR K + 
Sbjct  64   MGEFVQSLAKPRCVIILVKAGAPVDATIEGLAQHMEPGDIIIDGGNEWYENTERRAKALE  123

Query  539  ELGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            E GLLY+GMGVSGGEEGAR GPS+MPGG+  A+  IE I+ KV AQ 
Sbjct  124  EKGLLYMGMGVSGGEEGARNGPSMMPGGAKAAFDVIEPIITKVCAQT  170



>dbj|BAG32446.1| 6-phosphogluconate dehydrogenase, partial [Cyanoptyche gloeocystis]
Length=444

 Score =   213 bits (543),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 103/158 (65%), Positives = 128/158 (81%), Gaps = 2/158 (1%)
 Frame = +2

Query  212  LAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEG--NLPLYGFHDPESFIRSIQ  385
            LAVMGQN ALN A+KG PISV+NR+ ++VD+TVERA+ EG    PL+GF D + F+ S++
Sbjct  1    LAVMGQNFALNFAEKGIPISVFNRSANRVDDTVERAEKEGGGKYPLHGFKDVKDFVASLE  60

Query  386  KPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGLLYLGM  565
            +PR +IILVKAGAPVD TI+ L  Y+E GD IIDGGNEWY NTERR K+VAE G+LY+GM
Sbjct  61   RPRAIIILVKAGAPVDDTIEQLLQYLEPGDIIIDGGNEWYLNTERRAKQVAEKGILYMGM  120

Query  566  GVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            GVSGGEEGAR GPSLMPGG  +A+  ++ ++ KVAAQV
Sbjct  121  GVSGGEEGARNGPSLMPGGPKDAWTRLQPVLEKVAAQV  158



>gb|EEE52109.1| hypothetical protein OsJ_33909 [Oryza sativa Japonica Group]
Length=477

 Score =   214 bits (544),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 101/153 (66%), Positives = 119/153 (78%), Gaps = 0/153 (0%)
 Frame = +2

Query  221  MGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESFIRSIQKPRVV  400
            MGQNLALNIA+KGFPISVYNRT +KVD TV RA+AEG LP+ G  DP  F+ S+ +PR V
Sbjct  1    MGQNLALNIAEKGFPISVYNRTAAKVDATVSRAEAEGALPVLGHRDPRGFVLSLSRPRTV  60

Query  401  IILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGLLYLGMGVSGG  580
            ++LV+AG  VD TI  L  Y++ GD I+DGGNEWY+NTERR +E A  G+LYLGMGVSGG
Sbjct  61   VLLVQAGRAVDATIDALVPYLDAGDAIVDGGNEWYQNTERRIEEAAARGILYLGMGVSGG  120

Query  581  EEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            EEGAR GPSLMPGG  +AY  I DI+ K AAQ 
Sbjct  121  EEGARNGPSLMPGGHIDAYNNIRDILEKAAAQT  153



>ref|XP_005709029.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Galdieria 
sulphuraria]
 gb|EME32509.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Galdieria 
sulphuraria]
Length=580

 Score =   216 bits (549),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 103/164 (63%), Positives = 130/164 (79%), Gaps = 3/164 (2%)
 Frame = +2

Query  197  IGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNL---PLYGFHDPES  367
            IGL GLAVMGQNLALNIA+KGF +SVYNRT++K D+T+ R + E       L GF+  ES
Sbjct  91   IGLIGLAVMGQNLALNIAEKGFRVSVYNRTSTKTDDTINRFQLEQKNCLGKLQGFYSLES  150

Query  368  FIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELG  547
            F+RS+++PR VII+VKAG+PVD TI TL  Y+E GD I+DGGNEWYENT+RR + ++  G
Sbjct  151  FVRSLKRPRKVIIMVKAGSPVDATISTLENYLEPGDLIVDGGNEWYENTQRRAEALSSKG  210

Query  548  LLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            +LY+GMGVSGGE+GAR GPSLMPGG  EA+  + DI+ K+AAQV
Sbjct  211  ILYMGMGVSGGEDGARHGPSLMPGGPVEAWNLVNDILNKIAAQV  254



>gb|EYU40043.1| hypothetical protein MIMGU_mgv1a019477mg [Erythranthe guttata]
Length=460

 Score =   211 bits (537),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 109/161 (68%), Positives = 127/161 (79%), Gaps = 4/161 (2%)
 Frame = +2

Query  182  ATPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDP  361
            A  ++IGLAGLAVMGQNLALNIA+KGFPISVYNRT SKVDET++RA  EG LPL G ++P
Sbjct  4    AALSQIGLAGLAVMGQNLALNIAEKGFPISVYNRTISKVDETLDRAHREGQLPLTGHYNP  63

Query  362  ESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAE  541
            + F+ SI+KPR +IILVKAGAPVDQTI  LSA+ME GD IIDGGNEWYENTERR  + + 
Sbjct  64   KDFVLSIKKPRSIIILVKAGAPVDQTIAALSAHMEPGDTIIDGGNEWYENTERRIVDASA  123

Query  542  LGLLYLGMGVSGGEEGAR-RGPSLM---PGGSFEAYKYIED  652
             GLLYLGMGVSGGE+GAR  GP +     GGS    K + +
Sbjct  124  NGLLYLGMGVSGGEDGARDDGPCVTYIGEGGSGNFVKMVHN  164



>dbj|BAG32441.1| 6-phosphogluconate dehydrogenase [Euglena gracilis]
Length=488

 Score =   212 bits (539),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 129/161 (80%), Gaps = 0/161 (0%)
 Frame = +2

Query  197  IGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESFIR  376
            +GL GLAVMGQN ALN+A+ GF ++V NR+  KVD+TVERAK EGNLPL GF DP+ F++
Sbjct  5    VGLYGLAVMGQNFALNMAEHGFTVAVCNRSPGKVDDTVERAKGEGNLPLLGFKDPKDFVQ  64

Query  377  SIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGLLY  556
            ++++PR ++ILV+AG PVD TI  LS ++E GD I+DGGNEW+ N++RR + +   G+L+
Sbjct  65   ALKRPRRIVILVQAGKPVDDTIAHLSGFLEAGDLIVDGGNEWFPNSQRRAELLRPKGILF  124

Query  557  LGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            +GMG+SGGEEGAR+GPSLMPGG   AY+ +E I+ K AAQV
Sbjct  125  MGMGISGGEEGARKGPSLMPGGEPGAYELMEPIITKCAAQV  165



>gb|AAP33506.2| cytosolic 6-phosphogluconate dehydrogenase [Oryza sativa Japonica 
Group]
Length=477

 Score =   211 bits (538),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/153 (65%), Positives = 118/153 (77%), Gaps = 0/153 (0%)
 Frame = +2

Query  221  MGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESFIRSIQKPRVV  400
            MGQ LALNIA+KGFPISVYNRT +KVD TV RA+AEG LP+ G  DP  F+ S+ +PR V
Sbjct  1    MGQKLALNIAEKGFPISVYNRTAAKVDATVSRAEAEGALPVLGHRDPRGFVLSLSRPRTV  60

Query  401  IILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGLLYLGMGVSGG  580
            ++LV+AG  VD TI  L  Y++ GD I+DGGNEWY+NTERR +E A  G+LYLGMGVSGG
Sbjct  61   VLLVQAGRAVDATIDALVPYLDAGDAIVDGGNEWYQNTERRIEEAAARGILYLGMGVSGG  120

Query  581  EEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            EEGAR GPSLMPGG  +AY  I DI+ K AAQ 
Sbjct  121  EEGARNGPSLMPGGHIDAYNNIRDILEKAAAQT  153



>ref|XP_003060927.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH54577.1| predicted protein [Micromonas pusilla CCMP1545]
Length=500

 Score =   212 bits (539),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 104/164 (63%), Positives = 125/164 (76%), Gaps = 1/164 (1%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEG-NLPLYGFHDPES  367
            +R+GL GLAVMGQNLALN+A+KGF ISV+NR+  K D  V RA+ EG    L G+ D + 
Sbjct  7    SRVGLVGLAVMGQNLALNVAEKGFKISVFNRSGDKTDNAVARAQKEGLGDKLVGYKDMKE  66

Query  368  FIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELG  547
            F+ S+QKPR VIILVKAGAPVD TIK LS +ME GD IIDGGNEWYENTERR +E     
Sbjct  67   FVNSLQKPRSVIILVKAGAPVDATIKGLSEHMEPGDIIIDGGNEWYENTERRIEEAHAKN  126

Query  548  LLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            LLY+GMGVSGGEEGAR GPS+MPGG  EAY+ +++++    AQ 
Sbjct  127  LLYMGMGVSGGEEGARNGPSMMPGGDVEAYEAVKEVLTASTAQT  170



>gb|EWM28595.1| 6-phosphogluconate dehydrogenase [Nannochloropsis gaditana]
Length=495

 Score =   211 bits (538),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/161 (62%), Positives = 124/161 (77%), Gaps = 0/161 (0%)
 Frame = +2

Query  197  IGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESFIR  376
            +GL GLAVMGQN ALN+A KGF +SV NR+  KVD TV+RA  EGNLPL G+  PE F++
Sbjct  4    VGLYGLAVMGQNFALNMASKGFSVSVCNRSPGKVDTTVQRAVDEGNLPLKGYKQPEEFVK  63

Query  377  SIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGLLY  556
            S+ KPR +++LV AG PVD TI+ LS YME GD +IDGGNEW+ N+ RR + +A  G+++
Sbjct  64   SLAKPRKIVLLVMAGKPVDATIELLSQYMESGDVLIDGGNEWFPNSLRRAETLAPKGIMF  123

Query  557  LGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            +GMG+SGGEEGAR GPSLMPGG  EAY  IE I+ K AAQV
Sbjct  124  MGMGISGGEEGARNGPSLMPGGPREAYDLIEPIITKAAAQV  164



>ref|XP_002289820.1| 6-phosphogluconate dehydrogenase [Thalassiosira pseudonana CCMP1335]
 gb|EED93357.1| 6-phosphogluconate dehydrogenase [Thalassiosira pseudonana CCMP1335]
Length=490

 Score =   210 bits (535),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 102/160 (64%), Positives = 121/160 (76%), Gaps = 0/160 (0%)
 Frame = +2

Query  197  IGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESFIR  376
            +GL GLAVMGQN ALN+A KGF + V NR+ SKV+ TV RAK EGNLPL G  DPE F +
Sbjct  5    VGLYGLAVMGQNFALNMASKGFKVCVGNRSPSKVELTVNRAKEEGNLPLVGSSDPEDFCK  64

Query  377  SIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGLLY  556
             + KPR +IILV AG PVD TI TLS Y+E+GD I+DGGNEW++NT RR KE+   G+ +
Sbjct  65   QLSKPRKIIILVMAGKPVDDTIATLSQYLEEGDVIVDGGNEWFQNTLRRSKELEPKGIHF  124

Query  557  LGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQ  676
            +GMG+SGGEEGAR GPSLMPGG   AY  IE I+ K AAQ
Sbjct  125  VGMGISGGEEGARNGPSLMPGGPRAAYDLIEPIITKCAAQ  164



>ref|XP_005651440.1| decarboxylating 6-phosphogluconate dehydrogenase [Coccomyxa subellipsoidea 
C-169]
 gb|EIE26896.1| decarboxylating 6-phosphogluconate dehydrogenase [Coccomyxa subellipsoidea 
C-169]
Length=575

 Score =   212 bits (540),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 126/164 (77%), Gaps = 1/164 (1%)
 Frame = +2

Query  191  TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEG-NLPLYGFHDPES  367
            + +GL GLAVMGQN ALN+A+KGFPISVYNR+  K +  V RAK EG    L GF D + 
Sbjct  79   SELGLIGLAVMGQNFALNVAEKGFPISVYNRSYEKTEACVTRAKKEGLEANLKGFPDLKE  138

Query  368  FIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELG  547
            F+ S++KPR V+ILVKAGAPVD TI++L   +E GD IIDGGNEWYENTE R  +VAE G
Sbjct  139  FVASLKKPRRVMILVKAGAPVDATIESLIPLLEPGDIIIDGGNEWYENTEARAAKVAEKG  198

Query  548  LLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            L YLGMGVSGGEEGAR GPSLMPGG+ E Y  IE IV KVAAQV
Sbjct  199  LGYLGMGVSGGEEGARNGPSLMPGGTKEGYDAIEKIVTKVAAQV  242



>emb|CAQ52407.1| 6-phosphogluconate dehydrogenase [Laminaria digitata]
Length=490

 Score =   209 bits (533),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 100/168 (60%), Positives = 127/168 (76%), Gaps = 0/168 (0%)
 Frame = +2

Query  176  SMATPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFH  355
            S +  + +GL GLAVMGQN ALN+A  GF +SV NR+  KVD TV RAK EGNLPL GF 
Sbjct  2    SASALSDVGLYGLAVMGQNFALNMASHGFSVSVSNRSPEKVDATVARAKEEGNLPLRGFK  61

Query  356  DPESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEV  535
            DP+SF+ S+ KPR +++LV+AGA VD TI TLS  +E+GD ++DGGNEW+ N++RR KE+
Sbjct  62   DPKSFVDSLSKPRKIVLLVQAGAAVDATIATLSELLEEGDILVDGGNEWFPNSQRRAKEL  121

Query  536  AELGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
                ++++GMGVSGGEEGAR GPSLMPGG  EAY  +  I+ K AAQV
Sbjct  122  EPKKIMFVGMGVSGGEEGARNGPSLMPGGPREAYDALSPIISKCAAQV  169



>ref|XP_002681464.1| 6-phosphogluconate dehydrogenase [Naegleria gruberi]
 gb|EFC48720.1| 6-phosphogluconate dehydrogenase [Naegleria gruberi]
Length=475

 Score =   209 bits (532),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 106/161 (66%), Positives = 125/161 (78%), Gaps = 2/161 (1%)
 Frame = +2

Query  197  IGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEG--NLPLYGFHDPESF  370
            IGL GLAVMGQNLALNIADKGF ISVYNR+  K + TV+RA+ EG  +  L GF   + F
Sbjct  4    IGLIGLAVMGQNLALNIADKGFKISVYNRSYEKTEHTVKRAEDEGKGSYQLAGFKTMQEF  63

Query  371  IRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGL  550
            + S+ KPR VI+LV+AG PVD TI+ LS  +EKGD IIDGGNEW+ NTE+R K+  ELGL
Sbjct  64   VNSLSKPRKVIMLVQAGNPVDSTIELLSPLLEKGDIIIDGGNEWFLNTEKRAKKAVELGL  123

Query  551  LYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAA  673
            LY+GMGVSGGEEGAR GPSLMPGG  EAY  I+ I+ K+AA
Sbjct  124  LYMGMGVSGGEEGARHGPSLMPGGPIEAYDQIKHILEKIAA  164



>emb|CAB61332.1| 6-phosphogluconate dehydrogenase [Laminaria digitata]
Length=530

 Score =   209 bits (533),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 100/168 (60%), Positives = 127/168 (76%), Gaps = 0/168 (0%)
 Frame = +2

Query  176  SMATPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFH  355
            S +  + +GL GLAVMGQN ALN+A  GF +SV NR+  KVD TV RAK EGNLPL GF 
Sbjct  2    SASALSDVGLYGLAVMGQNFALNMASHGFSVSVSNRSPEKVDATVARAKEEGNLPLRGFK  61

Query  356  DPESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEV  535
            DP+SF+ S+ KPR +++LV+AGA VD TI TLS  +E+GD ++DGGNEW+ N++RR KE+
Sbjct  62   DPKSFVDSLSKPRKIVLLVQAGAAVDATIATLSELLEEGDILVDGGNEWFPNSQRRAKEL  121

Query  536  AELGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
                ++++GMGVSGGEEGAR GPSLMPGG  EAY  +  I+ K AAQV
Sbjct  122  EPKKIMFVGMGVSGGEEGARNGPSLMPGGPREAYDALSPIISKCAAQV  169



>ref|XP_002179525.1| 6-phosphogluconate dehydrogenase [Phaeodactylum tricornutum CCAP 
1055/1]
 gb|EEC49348.1| 6-phosphogluconate dehydrogenase [Phaeodactylum tricornutum CCAP 
1055/1]
Length=519

 Score =   209 bits (532),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 103/195 (53%), Positives = 138/195 (71%), Gaps = 2/195 (1%)
 Frame = +2

Query  92   IFVSQFIFLPYSSIPCTILSAPN*LEENSMATPTRIGLAGLAVMGQNLALNIADKGFPIS  271
            +F++  +F  + +     +   +  E N M+    IGL GLAVMGQN ALN+A  GF ++
Sbjct  1    MFLTILLFAAFCTTTLESIQTLSTNEINRMSCD--IGLYGLAVMGQNFALNMASHGFTVA  58

Query  272  VYNRTTSKVDETVERAKAEGNLPLYGFHDPESFIRSIQKPRVVIILVKAGAPVDQTIKTL  451
            V NR+ SKVD TV+RAK EG+LPL G   PE FI  + KPR V+ILV+AG PVD TI+ +
Sbjct  59   VCNRSPSKVDTTVQRAKDEGDLPLIGTKSPEEFISKLSKPRKVVILVQAGKPVDLTIEAI  118

Query  452  SAYMEKGDCIIDGGNEWYENTERREKEVAELGLLYLGMGVSGGEEGARRGPSLMPGGSFE  631
            S +ME+GD IIDGGNEW+ N  RR +E+ + G++++GMG+SGGEEGAR GPSLMPGG  +
Sbjct  119  SEFMEEGDVIIDGGNEWFPNQIRRHEELEKKGIMFIGMGISGGEEGARNGPSLMPGGPRK  178

Query  632  AYKYIEDIVLKVAAQ  676
            AY  IE I++K AA+
Sbjct  179  AYDLIEPIIMKCAAK  193



>gb|KDD75074.1| 6-phosphogluconate dehydrogenase [Helicosporidium sp. ATCC 50920]
Length=529

 Score =   209 bits (532),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 130/167 (78%), Gaps = 1/167 (1%)
 Frame = +2

Query  182  ATPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEG-NLPLYGFHD  358
            A  + IGL GLAVMGQNLALNIA+KG+ ISVYNR++ K D  V+RA  EG    ++GF D
Sbjct  33   APKSTIGLIGLAVMGQNLALNIAEKGYHISVYNRSSEKTDMAVKRAGTEGLGERMHGFKD  92

Query  359  PESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVA  538
               F+ S+++PR VIILVKAGAPVD+TIK L   ME GD I+DGGNEWYENTERR+ ++ 
Sbjct  93   LARFVASLERPRRVIILVKAGAPVDETIKALVPLMEPGDIIVDGGNEWYENTERRQAKLR  152

Query  539  ELGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            E GL+ LGMGVSGGEEGARRGPS+MPGG   AY++++ ++ KVAAQ 
Sbjct  153  ENGLILLGMGVSGGEEGARRGPSMMPGGDPSAYEHLKPVLEKVAAQT  199



>ref|XP_011400114.1| 6-phosphogluconate dehydrogenase, decarboxylating [Auxenochlorella 
protothecoides]
 gb|KFM27147.1| 6-phosphogluconate dehydrogenase, decarboxylating [Auxenochlorella 
protothecoides]
Length=473

 Score =   207 bits (528),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 104/171 (61%), Positives = 131/171 (77%), Gaps = 4/171 (2%)
 Frame = +2

Query  179  MATPT---RIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEG-NLPLY  346
            MA+PT    +GL GLAVMGQNLALN+A+KGF ISVYNR+  K D  V RA  EG    L+
Sbjct  1    MASPTAQSEVGLIGLAVMGQNLALNVAEKGFHISVYNRSGDKTDAAVSRAGKEGVGERLH  60

Query  347  GFHDPESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERRE  526
            G+ + + F+ S+++PR VIILVKAGAPVD TIK L+ ++E GD IIDGGNEWYENTERR+
Sbjct  61   GYKELKDFVASLKRPRRVIILVKAGAPVDATIKQLTQFLEPGDIIIDGGNEWYENTERRQ  120

Query  527  KEVAELGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
             E+A LG+ ++GMGVSGGEEGAR GP++MPGG   AY ++  +V +VAAQ 
Sbjct  121  AELAALGIHHIGMGVSGGEEGARNGPAMMPGGDEGAYSHLRPVVERVAAQT  171



>ref|XP_008872677.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Aphanomyces 
invadans]
 gb|ETV98480.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Aphanomyces 
invadans]
Length=493

 Score =   207 bits (526),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 98/168 (58%), Positives = 129/168 (77%), Gaps = 1/168 (1%)
 Frame = +2

Query  179  MATP-TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFH  355
            M+ P + +GL GLAVMGQN ALN+A+ GF +SV NR+  KVD TV+RAK EGNLPL G+ 
Sbjct  1    MSAPLSDVGLYGLAVMGQNFALNMAEHGFSVSVCNRSPDKVDTTVQRAKDEGNLPLVGYK  60

Query  356  DPESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEV  535
            D + F+ S+ +PR +IILV+AG PVD TI  +S + E+GD I+DGGNEW+ N+ RR KE+
Sbjct  61   DVKDFVLSLSRPRKIIILVQAGKPVDDTIHAISQHCEEGDIIVDGGNEWFPNSIRRSKEL  120

Query  536  AELGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
               G+L++GMG+SGGEEGAR+GPSLMPGG   A+  +E I++K AAQV
Sbjct  121  EPKGILFVGMGISGGEEGARKGPSLMPGGPRAAFDALEPILIKCAAQV  168



>gb|ETL93890.1| 6-phosphogluconate dehydrogenase (decarboxylating), partial [Phytophthora 
parasitica]
Length=524

 Score =   207 bits (528),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 103/168 (61%), Positives = 124/168 (74%), Gaps = 0/168 (0%)
 Frame = +2

Query  176  SMATPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFH  355
            +MA  + IGL GLAVMGQN ALN+A  GF +SV NR+  KVD TV+RAK EGNLPL G+ 
Sbjct  35   AMADLSDIGLFGLAVMGQNFALNMASHGFKVSVCNRSPDKVDATVQRAKDEGNLPLVGYK  94

Query  356  DPESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEV  535
            D + F+ S+ +PR V+ILV AG PVD TI  LS +ME GD IIDGGNEW+ N+ RR  E+
Sbjct  95   DMKEFVASLARPRKVVILVVAGKPVDLTIAALSEFMEPGDIIIDGGNEWFPNSVRRASEL  154

Query  536  AELGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
               G+ ++GMGVSGGEEGAR GPSLMPGG  EAY  +E I+ K AAQV
Sbjct  155  EPKGIHFVGMGVSGGEEGARNGPSLMPGGPKEAYDALEPIITKCAAQV  202



>gb|EJK45824.1| hypothetical protein THAOC_35540, partial [Thalassiosira oceanica]
Length=346

 Score =   203 bits (516),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 98/161 (61%), Positives = 120/161 (75%), Gaps = 0/161 (0%)
 Frame = +2

Query  197  IGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHDPESFIR  376
            +GL GLAVMGQN ALN+A KGF + V NR+ SKV+ TV RAK EG+LPL G   PE F++
Sbjct  5    VGLYGLAVMGQNFALNMASKGFKVCVGNRSPSKVELTVNRAKEEGSLPLVGSSGPEDFVK  64

Query  377  SIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVAELGLLY  556
             + KPR ++ILV AG PVD+TI  LS Y++ GD I+DGGNEW+ NT RR KE+   G+ +
Sbjct  65   QLSKPRKIVILVMAGKPVDETIANLSQYLDAGDVIVDGGNEWFHNTLRRAKELEPKGIHF  124

Query  557  LGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
            +GMG+SGGEEGAR GPSLMPGG   AY  IE I+ K AAQV
Sbjct  125  VGMGISGGEEGARNGPSLMPGGPKAAYDLIEPIISKCAAQV  165



>ref|XP_008905173.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Phytophthora 
parasitica INRA-310]
 gb|ETI47388.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Phytophthora 
parasitica P1569]
 gb|ETK87326.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Phytophthora 
parasitica]
 gb|ETL40753.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Phytophthora 
parasitica]
 gb|ETM47129.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Phytophthora 
parasitica]
 gb|ETN09340.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Phytophthora 
parasitica INRA-310]
 gb|ETO76060.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Phytophthora 
parasitica P1976]
 gb|ETP17184.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Phytophthora 
parasitica CJ01A1]
 gb|ETP45211.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Phytophthora 
parasitica P10297]
Length=489

 Score =   206 bits (525),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 103/167 (62%), Positives = 123/167 (74%), Gaps = 0/167 (0%)
 Frame = +2

Query  179  MATPTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKAEGNLPLYGFHD  358
            MA  + IGL GLAVMGQN ALN+A  GF +SV NR+  KVD TV+RAK EGNLPL G+ D
Sbjct  1    MADLSDIGLFGLAVMGQNFALNMASHGFKVSVCNRSPDKVDATVQRAKDEGNLPLVGYKD  60

Query  359  PESFIRSIQKPRVVIILVKAGAPVDQTIKTLSAYMEKGDCIIDGGNEWYENTERREKEVA  538
             + F+ S+ +PR V+ILV AG PVD TI  LS +ME GD IIDGGNEW+ N+ RR  E+ 
Sbjct  61   MKEFVASLARPRKVVILVVAGKPVDLTIAALSEFMEPGDIIIDGGNEWFPNSVRRASELE  120

Query  539  ELGLLYLGMGVSGGEEGARRGPSLMPGGSFEAYKYIEDIVLKVAAQV  679
              G+ ++GMGVSGGEEGAR GPSLMPGG  EAY  +E I+ K AAQV
Sbjct  121  PKGIHFVGMGVSGGEEGARNGPSLMPGGPKEAYDALEPIITKCAAQV  167



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1104504643240