BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF052M01

Length=666
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009614041.1|  PREDICTED: uncharacterized protein LOC104107...    147   8e-37   Nicotiana tomentosiformis
ref|XP_010317412.1|  PREDICTED: uncharacterized protein LOC101266...    143   2e-35   Solanum lycopersicum
ref|XP_004234052.1|  PREDICTED: uncharacterized protein LOC101266...    143   3e-35   Solanum lycopersicum
ref|XP_009785957.1|  PREDICTED: uncharacterized protein LOC104234...    142   4e-35   Nicotiana sylvestris
ref|XP_009614040.1|  PREDICTED: uncharacterized protein LOC104107...    142   5e-35   Nicotiana tomentosiformis
ref|XP_009618326.1|  PREDICTED: uncharacterized protein LOC104110...    140   2e-34   Nicotiana tomentosiformis
ref|XP_009618328.1|  PREDICTED: uncharacterized protein LOC104110...    140   2e-34   Nicotiana tomentosiformis
ref|XP_006356118.1|  PREDICTED: cell wall protein AWA1-like             139   9e-34   Solanum tuberosum [potatoes]
ref|XP_009785950.1|  PREDICTED: uncharacterized protein LOC104234...    137   2e-33   Nicotiana sylvestris
ref|XP_009790935.1|  PREDICTED: uncharacterized protein LOC104238306    137   5e-33   Nicotiana sylvestris
ref|XP_006355598.1|  PREDICTED: signaling mucin HKR1-like               135   2e-32   Solanum tuberosum [potatoes]
ref|XP_004232971.1|  PREDICTED: uncharacterized protein LOC101252351    130   6e-31   Solanum lycopersicum
ref|XP_011096498.1|  PREDICTED: uncharacterized protein LOC105175...    128   4e-30   
ref|XP_011096496.1|  PREDICTED: uncharacterized protein LOC105175...    128   4e-30   Sesamum indicum [beniseed]
gb|KJB57295.1|  hypothetical protein B456_009G157400                    128   6e-30   Gossypium raimondii
gb|KHG18569.1|  Protein translocase subunit SecA                        127   8e-30   Gossypium arboreum [tree cotton]
gb|KDO78063.1|  hypothetical protein CISIN_1g0026402mg                  125   9e-30   Citrus sinensis [apfelsine]
gb|KDO78065.1|  hypothetical protein CISIN_1g0026402mg                  125   9e-30   Citrus sinensis [apfelsine]
gb|KDO78068.1|  hypothetical protein CISIN_1g0026402mg                  125   9e-30   Citrus sinensis [apfelsine]
gb|KDO78064.1|  hypothetical protein CISIN_1g0026402mg                  125   1e-29   Citrus sinensis [apfelsine]
ref|XP_011005847.1|  PREDICTED: uncharacterized protein LOC105112...    126   2e-29   Populus euphratica
ref|XP_011005848.1|  PREDICTED: uncharacterized protein LOC105112...    126   2e-29   Populus euphratica
ref|XP_006597650.1|  PREDICTED: cell wall protein AWA1-like isofo...    126   2e-29   
ref|XP_006597649.1|  PREDICTED: cell wall protein AWA1-like isofo...    125   4e-29   
ref|XP_006467530.1|  PREDICTED: uncharacterized protein LOC102630...    125   4e-29   Citrus sinensis [apfelsine]
ref|XP_006467531.1|  PREDICTED: uncharacterized protein LOC102630...    125   5e-29   
ref|XP_006449625.1|  hypothetical protein CICLE_v10014224mg             124   1e-28   Citrus clementina [clementine]
ref|XP_006449624.1|  hypothetical protein CICLE_v10014224mg             124   1e-28   
ref|XP_002519742.1|  conserved hypothetical protein                     124   1e-28   Ricinus communis
emb|CBI30819.3|  unnamed protein product                                124   2e-28   Vitis vinifera
ref|XP_007025176.1|  Uncharacterized protein TCM_029557                 124   2e-28   
ref|XP_010655630.1|  PREDICTED: protein lingerer-like                   124   2e-28   Vitis vinifera
ref|XP_011045308.1|  PREDICTED: uncharacterized protein LOC105140...    123   3e-28   Populus euphratica
ref|XP_011045309.1|  PREDICTED: uncharacterized protein LOC105140...    123   3e-28   Populus euphratica
ref|XP_006369885.1|  hypothetical protein POPTR_0001s34440g             123   3e-28   
ref|XP_004504230.1|  PREDICTED: serine/threonine-protein kinase p...    122   4e-28   Cicer arietinum [garbanzo]
ref|XP_007159534.1|  hypothetical protein PHAVU_002G245500g             122   5e-28   Phaseolus vulgaris [French bean]
emb|CDP17325.1|  unnamed protein product                                122   6e-28   Coffea canephora [robusta coffee]
gb|KHF99174.1|  hypothetical protein F383_17166                         121   1e-27   Gossypium arboreum [tree cotton]
gb|KHF99173.1|  hypothetical protein F383_17166                         121   2e-27   Gossypium arboreum [tree cotton]
ref|XP_011045310.1|  PREDICTED: uncharacterized protein LOC105140...    120   2e-27   Populus euphratica
gb|KJB69764.1|  hypothetical protein B456_011G041100                    117   9e-27   Gossypium raimondii
ref|XP_004486425.1|  PREDICTED: serine-rich adhesin for platelets...    117   2e-26   Cicer arietinum [garbanzo]
gb|KJB69767.1|  hypothetical protein B456_011G041100                    117   2e-26   Gossypium raimondii
gb|AFK38455.1|  unknown                                                 115   2e-26   Medicago truncatula
ref|XP_006377248.1|  hypothetical protein POPTR_0011s02850g             117   3e-26   
ref|XP_002317304.2|  kinase-related family protein                      117   3e-26   
ref|XP_003534759.1|  PREDICTED: cell wall protein AWA1-like isofo...    117   3e-26   Glycine max [soybeans]
ref|XP_006586817.1|  PREDICTED: cell wall protein AWA1-like isofo...    117   3e-26   Glycine max [soybeans]
ref|XP_003629905.1|  hypothetical protein MTR_8g088190                  117   3e-26   Medicago truncatula
ref|XP_011005845.1|  PREDICTED: uncharacterized protein LOC105112...    117   4e-26   Populus euphratica
ref|XP_011005846.1|  PREDICTED: uncharacterized protein LOC105112...    117   4e-26   Populus euphratica
gb|KJB69766.1|  hypothetical protein B456_011G041100                    116   4e-26   Gossypium raimondii
ref|XP_010243690.1|  PREDICTED: uncharacterized protein LOC104587...    117   4e-26   Nelumbo nucifera [Indian lotus]
ref|XP_011085623.1|  PREDICTED: uncharacterized protein LOC105167549    117   4e-26   
gb|KHN48057.1|  hypothetical protein glysoja_015527                     116   5e-26   Glycine soja [wild soybean]
gb|KJB69765.1|  hypothetical protein B456_011G041100                    116   5e-26   Gossypium raimondii
gb|KJB69763.1|  hypothetical protein B456_011G041100                    116   5e-26   Gossypium raimondii
gb|KHN22963.1|  hypothetical protein glysoja_030633                     116   8e-26   Glycine soja [wild soybean]
ref|XP_006580202.1|  PREDICTED: uncharacterized serine-rich prote...    115   1e-25   Glycine max [soybeans]
ref|XP_010243689.1|  PREDICTED: uncharacterized protein LOC104587...    115   2e-25   Nelumbo nucifera [Indian lotus]
gb|EYU28172.1|  hypothetical protein MIMGU_mgv1a001362mg                114   4e-25   Erythranthe guttata [common monkey flower]
ref|XP_007147529.1|  hypothetical protein PHAVU_006G132200g             114   4e-25   Phaseolus vulgaris [French bean]
ref|XP_010540528.1|  PREDICTED: uncharacterized protein LOC104814266    111   4e-24   Tarenaya hassleriana [spider flower]
ref|XP_010275810.1|  PREDICTED: uncharacterized protein LOC104610...    110   6e-24   Nelumbo nucifera [Indian lotus]
ref|XP_010275801.1|  PREDICTED: uncharacterized protein LOC104610...    110   6e-24   Nelumbo nucifera [Indian lotus]
ref|XP_010549430.1|  PREDICTED: uncharacterized protein LOC104820614    110   7e-24   Tarenaya hassleriana [spider flower]
ref|XP_011460396.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    108   4e-23   Fragaria vesca subsp. vesca
ref|XP_010924304.1|  PREDICTED: signaling mucin HKR1-like               108   4e-23   Elaeis guineensis
ref|XP_010469381.1|  PREDICTED: uncharacterized protein LOC104749...    102   6e-23   
ref|XP_010469383.1|  PREDICTED: uncharacterized protein LOC104749...    102   7e-23   
ref|XP_009395691.1|  PREDICTED: mucin-17-like                           106   2e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009410964.1|  PREDICTED: uncharacterized protein LOC103992...    106   2e-22   
ref|XP_009410965.1|  PREDICTED: uncharacterized protein LOC103992...    106   2e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009410966.1|  PREDICTED: uncharacterized protein LOC103992...    105   2e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009410962.1|  PREDICTED: uncharacterized protein LOC103992...    106   2e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004162612.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    105   3e-22   
ref|XP_004134562.1|  PREDICTED: uncharacterized protein LOC101211388    105   3e-22   Cucumis sativus [cucumbers]
ref|XP_008439673.1|  PREDICTED: probable GPI-anchored adhesin-lik...    105   4e-22   Cucumis melo [Oriental melon]
ref|XP_008439672.1|  PREDICTED: probable GPI-anchored adhesin-lik...    105   4e-22   Cucumis melo [Oriental melon]
gb|KGN49366.1|  hypothetical protein Csa_6G522110                       105   4e-22   Cucumis sativus [cucumbers]
ref|XP_010539204.1|  PREDICTED: putative uncharacterized protein ...    105   4e-22   Tarenaya hassleriana [spider flower]
ref|XP_008797516.1|  PREDICTED: uncharacterized protein LOC103712...    105   4e-22   Phoenix dactylifera
ref|XP_010926244.1|  PREDICTED: uncharacterized protein LOC105048593    104   6e-22   Elaeis guineensis
ref|XP_006827353.1|  hypothetical protein AMTR_s00011p00072820          104   7e-22   Amborella trichopoda
gb|KHN14369.1|  hypothetical protein glysoja_012407                     104   7e-22   Glycine soja [wild soybean]
ref|XP_008364175.1|  PREDICTED: uncharacterized protein LOC103427...    103   2e-21   
ref|XP_008364174.1|  PREDICTED: uncharacterized protein LOC103427...    103   2e-21   
ref|XP_008364176.1|  PREDICTED: uncharacterized protein LOC103427...    103   2e-21   
ref|XP_009396491.1|  PREDICTED: uncharacterized protein LOC103981...    103   3e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009396490.1|  PREDICTED: uncharacterized protein LOC103981...    103   3e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008366008.1|  PREDICTED: protein lingerer-like                   102   3e-21   
ref|XP_004961192.1|  PREDICTED: flocculation protein FLO11-like i...    102   4e-21   Setaria italica
ref|XP_004961191.1|  PREDICTED: flocculation protein FLO11-like i...    102   4e-21   Setaria italica
ref|XP_009353838.1|  PREDICTED: uncharacterized protein LOC103945...    102   5e-21   
ref|XP_009353841.1|  PREDICTED: uncharacterized protein LOC103945...    102   5e-21   
ref|XP_009353839.1|  PREDICTED: uncharacterized protein LOC103945...    102   5e-21   
ref|XP_009353842.1|  PREDICTED: uncharacterized protein LOC103945...    102   5e-21   Pyrus x bretschneideri [bai li]
ref|XP_009353840.1|  PREDICTED: uncharacterized protein LOC103945...    102   5e-21   Pyrus x bretschneideri [bai li]
ref|XP_002440264.1|  hypothetical protein SORBIDRAFT_09g028730          101   7e-21   
ref|XP_010538220.1|  PREDICTED: uncharacterized protein LOC104812...    101   8e-21   Tarenaya hassleriana [spider flower]
ref|XP_010538221.1|  PREDICTED: uncharacterized protein LOC104812...    101   9e-21   Tarenaya hassleriana [spider flower]
ref|XP_008800693.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    100   2e-20   
ref|XP_009115248.1|  PREDICTED: putative uncharacterized protein ...    100   3e-20   
ref|XP_009394232.1|  PREDICTED: uncharacterized protein LOC103979756  99.8    3e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010559258.1|  PREDICTED: uncharacterized protein LOC104827...  99.4    4e-20   Tarenaya hassleriana [spider flower]
ref|XP_010559257.1|  PREDICTED: uncharacterized protein LOC104827...  99.4    4e-20   Tarenaya hassleriana [spider flower]
ref|XP_010559259.1|  PREDICTED: uncharacterized protein LOC104827...  99.4    4e-20   Tarenaya hassleriana [spider flower]
ref|XP_010559260.1|  PREDICTED: uncharacterized protein LOC104827...  99.4    4e-20   Tarenaya hassleriana [spider flower]
dbj|BAJ85689.1|  predicted protein                                    99.0    6e-20   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ92311.1|  predicted protein                                    99.0    6e-20   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008655402.1|  PREDICTED: uncharacterized protein LOC101027...  98.6    9e-20   
ref|XP_009141365.1|  PREDICTED: RNA polymerase II degradation fac...  98.2    1e-19   Brassica rapa
ref|XP_011467573.1|  PREDICTED: uncharacterized protein LOC101307...  98.2    1e-19   Fragaria vesca subsp. vesca
emb|CDY43685.1|  BnaA04g20060D                                        98.2    1e-19   Brassica napus [oilseed rape]
ref|XP_008650021.1|  PREDICTED: cell wall protein AWA1-like           98.2    1e-19   
ref|XP_003567874.1|  PREDICTED: uncharacterized protein LOC100840916  98.2    1e-19   Brachypodium distachyon [annual false brome]
ref|XP_006415582.1|  hypothetical protein EUTSA_v10006794mg           97.8    1e-19   Eutrema salsugineum [saltwater cress]
ref|XP_006415581.1|  hypothetical protein EUTSA_v10006794mg           97.8    1e-19   Eutrema salsugineum [saltwater cress]
ref|XP_006306766.1|  hypothetical protein CARUB_v10008305mg           97.8    2e-19   Capsella rubella
ref|XP_007214618.1|  hypothetical protein PRUPE_ppa001304mg           97.4    2e-19   Prunus persica
ref|XP_006306765.1|  hypothetical protein CARUB_v10008305mg           96.7    3e-19   Capsella rubella
emb|CDY48333.1|  BnaA09g26880D                                        96.7    3e-19   Brassica napus [oilseed rape]
gb|AFW83477.1|  putative DUF1296 domain containing family protein     94.0    4e-19   
ref|XP_004969439.1|  PREDICTED: putative GPI-anchored protein PB1...  96.3    5e-19   Setaria italica
emb|CDX94662.1|  BnaC07g09960D                                        96.3    5e-19   
ref|XP_004969440.1|  PREDICTED: putative GPI-anchored protein PB1...  96.3    5e-19   Setaria italica
ref|XP_009132981.1|  PREDICTED: uncharacterized protein LOC103857526  96.3    5e-19   Brassica rapa
ref|XP_008225366.1|  PREDICTED: dentin sialophosphoprotein isofor...  96.3    6e-19   Prunus mume [ume]
ref|XP_008225365.1|  PREDICTED: dentin sialophosphoprotein isofor...  96.3    6e-19   Prunus mume [ume]
ref|XP_010056861.1|  PREDICTED: uncharacterized protein LOC104444...  96.3    6e-19   Eucalyptus grandis [rose gum]
emb|CDX84653.1|  BnaA03g15770D                                        95.9    6e-19   
ref|XP_010056862.1|  PREDICTED: uncharacterized protein LOC104444...  95.9    6e-19   Eucalyptus grandis [rose gum]
ref|XP_010056860.1|  PREDICTED: uncharacterized protein LOC104444...  95.9    6e-19   Eucalyptus grandis [rose gum]
emb|CDY43334.1|  BnaC03g59060D                                        95.5    8e-19   Brassica napus [oilseed rape]
gb|KDP21205.1|  hypothetical protein JCGZ_21676                       95.5    8e-19   Jatropha curcas
ref|XP_001756751.1|  predicted protein                                87.8    1e-18   
emb|CDX90188.1|  BnaA08g17960D                                        94.4    2e-18   
ref|XP_008342251.1|  PREDICTED: chitinase-like protein PB1E7.04c ...  94.4    2e-18   
ref|XP_008342252.1|  PREDICTED: flocculation protein FLO11-like i...  94.4    2e-18   
ref|XP_009109669.1|  PREDICTED: RNA polymerase II degradation fac...  94.4    2e-18   Brassica rapa
ref|XP_002893558.1|  hypothetical protein ARALYDRAFT_473146           94.4    2e-18   
ref|XP_009109668.1|  PREDICTED: RNA polymerase II degradation fac...  94.4    2e-18   Brassica rapa
ref|XP_007214926.1|  hypothetical protein PRUPE_ppa001246mg           94.4    2e-18   Prunus persica
ref|XP_008229782.1|  PREDICTED: putative GPI-anchored protein PB1...  94.4    2e-18   Prunus mume [ume]
ref|XP_008229781.1|  PREDICTED: cell wall protein AWA1 isoform X1     94.4    3e-18   Prunus mume [ume]
ref|XP_009377414.1|  PREDICTED: uncharacterized protein LOC103966021  94.0    3e-18   Pyrus x bretschneideri [bai li]
ref|XP_010323919.1|  PREDICTED: melanoma-associated antigen C1 is...  94.0    3e-18   Solanum lycopersicum
ref|XP_010323918.1|  PREDICTED: melanoma-associated antigen C1 is...  94.0    3e-18   Solanum lycopersicum
ref|XP_010323920.1|  PREDICTED: melanoma-associated antigen C1 is...  94.0    3e-18   Solanum lycopersicum
ref|XP_010323917.1|  PREDICTED: melanoma-associated antigen C1 is...  94.0    3e-18   Solanum lycopersicum
ref|XP_008229421.1|  PREDICTED: cell wall protein AWA1-like           94.0    3e-18   Prunus mume [ume]
gb|EEC79711.1|  hypothetical protein OsI_21014                        94.0    3e-18   Oryza sativa Indica Group [Indian rice]
ref|NP_001056347.1|  Os05g0566900                                     94.0    3e-18   
ref|XP_011467308.1|  PREDICTED: endochitinase A isoform X1            94.0    3e-18   Fragaria vesca subsp. vesca
emb|CDY15632.1|  BnaA07g08030D                                        94.0    3e-18   Brassica napus [oilseed rape]
ref|XP_009356617.1|  PREDICTED: uncharacterized protein LOC103947...  94.0    3e-18   Pyrus x bretschneideri [bai li]
ref|NP_174230.2|  Kinase-related protein                              94.0    3e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009356619.1|  PREDICTED: uncharacterized protein LOC103947...  94.0    3e-18   Pyrus x bretschneideri [bai li]
ref|XP_011467310.1|  PREDICTED: endochitinase A isoform X3            94.0    3e-18   Fragaria vesca subsp. vesca
ref|XP_011467309.1|  PREDICTED: endochitinase A isoform X2            94.0    3e-18   Fragaria vesca subsp. vesca
ref|XP_009356618.1|  PREDICTED: uncharacterized protein LOC103947...  94.0    3e-18   Pyrus x bretschneideri [bai li]
ref|XP_006357672.1|  PREDICTED: flocculation protein FLO11-like i...  94.0    3e-18   
ref|XP_006357671.1|  PREDICTED: flocculation protein FLO11-like i...  94.0    3e-18   
ref|XP_006357673.1|  PREDICTED: flocculation protein FLO11-like i...  94.0    3e-18   
gb|AFW83478.1|  putative DUF1296 domain containing family protein     93.2    3e-18   
ref|XP_002870069.1|  predicted protein                                93.6    4e-18   Arabidopsis lyrata subsp. lyrata
ref|XP_009102861.1|  PREDICTED: uncharacterized protein LOC103828...  93.6    4e-18   Brassica rapa
ref|XP_009102862.1|  PREDICTED: uncharacterized protein LOC103828...  93.6    4e-18   Brassica rapa
ref|XP_007217053.1|  hypothetical protein PRUPE_ppa001198mg           93.6    4e-18   
gb|KDO50974.1|  hypothetical protein CISIN_1g006896mg                 93.2    4e-18   Citrus sinensis [apfelsine]
ref|XP_006447832.1|  hypothetical protein CICLE_v10014215mg           93.6    4e-18   Citrus clementina [clementine]
ref|XP_006447831.1|  hypothetical protein CICLE_v10014215mg           93.6    4e-18   Citrus clementina [clementine]
ref|XP_008656717.1|  PREDICTED: uncharacterized protein LOC103636139  93.2    5e-18   
emb|CDY61669.1|  BnaC01g40800D                                        93.2    5e-18   Brassica napus [oilseed rape]
ref|XP_009131438.1|  PREDICTED: flocculation protein FLO11            93.2    5e-18   Brassica rapa
emb|CDX78828.1|  BnaA01g08950D                                        92.8    5e-18   
ref|XP_006410569.1|  hypothetical protein EUTSA_v10016218mg           93.2    5e-18   
ref|XP_006410568.1|  hypothetical protein EUTSA_v10016218mg           93.2    6e-18   
ref|XP_006410567.1|  hypothetical protein EUTSA_v10016218mg           93.2    6e-18   Eutrema salsugineum [saltwater cress]
gb|KFK36320.1|  hypothetical protein AALP_AA4G107400                  93.2    6e-18   Arabis alpina [alpine rockcress]
ref|XP_010102151.1|  hypothetical protein L484_021385                 92.8    7e-18   Morus notabilis
ref|NP_174229.2|  uncharacterized protein                             92.8    8e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010478296.1|  PREDICTED: probable serine/threonine-protein...  92.8    8e-18   
ref|XP_008342489.1|  PREDICTED: uncharacterized protein LOC103405294  92.8    8e-18   
gb|AAL58943.1|AF462857_1  At1g29350/F15D2_27                          92.8    8e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008362365.1|  PREDICTED: uncharacterized protein LOC103426056  92.8    8e-18   
ref|XP_002320531.2|  hypothetical protein POPTR_0014s16780g           92.4    1e-17   
ref|XP_011008079.1|  PREDICTED: flocculation protein FLO11            92.0    1e-17   Populus euphratica
ref|NP_001043788.1|  Os01g0663800                                     92.0    1e-17   
ref|XP_007048866.1|  Uncharacterized protein TCM_001879               92.0    1e-17   
ref|XP_006857739.1|  hypothetical protein AMTR_s00061p00187940        92.0    1e-17   Amborella trichopoda
ref|XP_010434569.1|  PREDICTED: probable serine/threonine-protein...  91.7    2e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010434571.1|  PREDICTED: probable serine/threonine-protein...  91.7    2e-17   Camelina sativa [gold-of-pleasure]
ref|XP_009361530.1|  PREDICTED: mucin-12 isoform X2                   91.7    2e-17   
ref|XP_009361529.1|  PREDICTED: uncharacterized protein LOC103951...  91.7    2e-17   Pyrus x bretschneideri [bai li]
ref|XP_010460714.1|  PREDICTED: putative uncharacterized protein ...  91.7    2e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010460715.1|  PREDICTED: putative uncharacterized protein ...  91.7    2e-17   
ref|XP_010449499.1|  PREDICTED: uncharacterized protein LOC104731...  91.3    2e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010449498.1|  PREDICTED: uncharacterized protein LOC104731...  91.3    2e-17   Camelina sativa [gold-of-pleasure]
gb|KDO60962.1|  hypothetical protein CISIN_1g0031901mg                84.0    3e-17   Citrus sinensis [apfelsine]
ref|XP_010439897.1|  PREDICTED: uncharacterized protein LOC104723...  91.3    3e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010439898.1|  PREDICTED: uncharacterized protein LOC104723...  90.9    3e-17   Camelina sativa [gold-of-pleasure]
tpg|DAA58234.1|  TPA: putative DUF1296 domain containing family p...  90.9    3e-17   
ref|XP_008671999.1|  PREDICTED: uncharacterized protein LOC100191...  90.9    3e-17   
ref|XP_010547195.1|  PREDICTED: uncharacterized protein LOC104819...  90.9    3e-17   Tarenaya hassleriana [spider flower]
ref|XP_011007010.1|  PREDICTED: uncharacterized protein LOC105112...  90.9    4e-17   Populus euphratica
ref|XP_011007012.1|  PREDICTED: uncharacterized protein LOC105112...  90.9    4e-17   Populus euphratica
ref|XP_010547194.1|  PREDICTED: uncharacterized protein LOC104819...  90.5    4e-17   Tarenaya hassleriana [spider flower]
ref|XP_010547193.1|  PREDICTED: uncharacterized protein LOC104819...  90.5    4e-17   Tarenaya hassleriana [spider flower]
gb|KDP29958.1|  hypothetical protein JCGZ_18527                       90.5    5e-17   Jatropha curcas
ref|XP_006407810.1|  hypothetical protein EUTSA_v10020055mg           90.1    6e-17   Eutrema salsugineum [saltwater cress]
ref|XP_008380020.1|  PREDICTED: flocculation protein FLO11-like i...  90.1    6e-17   
ref|XP_009407930.1|  PREDICTED: uncharacterized protein LOC103990491  90.1    6e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008380021.1|  PREDICTED: flocculation protein FLO11-like i...  90.1    6e-17   
ref|XP_010456509.1|  PREDICTED: uncharacterized protein LOC104737938  90.1    6e-17   Camelina sativa [gold-of-pleasure]
ref|XP_004502111.1|  PREDICTED: flocculation protein FLO11-like       89.7    7e-17   Cicer arietinum [garbanzo]
ref|XP_009391913.1|  PREDICTED: uncharacterized protein LOC103977...  89.7    9e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009391914.1|  PREDICTED: uncharacterized protein LOC103977...  89.7    9e-17   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK28492.1|  hypothetical protein AALP_AA7G003100                  89.4    1e-16   Arabis alpina [alpine rockcress]
gb|KFK28493.1|  hypothetical protein AALP_AA7G003100                  89.4    1e-16   Arabis alpina [alpine rockcress]
ref|XP_010273948.1|  PREDICTED: uncharacterized protein LOC104609...  89.4    1e-16   Nelumbo nucifera [Indian lotus]
ref|XP_002445374.1|  hypothetical protein SORBIDRAFT_07g013800        82.0    1e-16   
ref|XP_006361347.1|  PREDICTED: dentin sialophosphoprotein-like i...  89.4    1e-16   Solanum tuberosum [potatoes]
ref|XP_006361346.1|  PREDICTED: dentin sialophosphoprotein-like i...  89.4    1e-16   Solanum tuberosum [potatoes]
ref|XP_006361345.1|  PREDICTED: dentin sialophosphoprotein-like i...  89.4    1e-16   Solanum tuberosum [potatoes]
ref|XP_010273947.1|  PREDICTED: uncharacterized protein LOC104609...  89.4    1e-16   Nelumbo nucifera [Indian lotus]
ref|XP_002881327.1|  hypothetical protein ARALYDRAFT_321144           89.0    1e-16   Arabidopsis lyrata subsp. lyrata
ref|XP_010464402.1|  PREDICTED: uncharacterized protein LOC104744...  89.0    1e-16   Camelina sativa [gold-of-pleasure]
ref|NP_193549.5|  uncharacterized protein                             89.0    1e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006296980.1|  hypothetical protein CARUB_v10012975mg           89.0    1e-16   Capsella rubella
ref|XP_009757818.1|  PREDICTED: uncharacterized protein LOC104210...  88.6    2e-16   Nicotiana sylvestris
ref|XP_010486335.1|  PREDICTED: uncharacterized protein LOC104764492  88.6    2e-16   Camelina sativa [gold-of-pleasure]
ref|XP_009757817.1|  PREDICTED: uncharacterized protein LOC104210...  88.6    2e-16   Nicotiana sylvestris
gb|KDP46910.1|  hypothetical protein JCGZ_10401                       89.0    2e-16   Jatropha curcas
ref|XP_009757816.1|  PREDICTED: uncharacterized protein LOC104210...  88.6    2e-16   Nicotiana sylvestris
ref|XP_010413763.1|  PREDICTED: alpha-protein kinase 1-like isofo...  88.6    2e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010413764.1|  PREDICTED: probable serine/threonine-protein...  88.6    2e-16   Camelina sativa [gold-of-pleasure]
gb|KJB42722.1|  hypothetical protein B456_007G165200                  88.6    2e-16   Gossypium raimondii
ref|XP_002301574.2|  hypothetical protein POPTR_0002s22320g           88.6    2e-16   
gb|KJB42721.1|  hypothetical protein B456_007G165200                  88.6    2e-16   Gossypium raimondii
ref|XP_010499452.1|  PREDICTED: RNA polymerase II degradation fac...  88.6    2e-16   
ref|XP_009599554.1|  PREDICTED: uncharacterized protein LOC104095...  88.6    2e-16   Nicotiana tomentosiformis
ref|XP_009599553.1|  PREDICTED: uncharacterized protein LOC104095...  88.6    2e-16   Nicotiana tomentosiformis
gb|KFK38227.1|  hypothetical protein AALP_AA3G085200                  88.6    2e-16   Arabis alpina [alpine rockcress]
ref|XP_009599552.1|  PREDICTED: uncharacterized protein LOC104095...  88.6    2e-16   Nicotiana tomentosiformis
ref|XP_002304144.2|  hypothetical protein POPTR_0003s06200g           88.2    2e-16   
ref|XP_010088349.1|  hypothetical protein L484_004857                 87.8    2e-16   
ref|XP_006437175.1|  hypothetical protein CICLE_v10033869mg           87.8    4e-16   
ref|XP_009765586.1|  PREDICTED: mucin-5AC-like                        86.7    4e-16   Nicotiana sylvestris
ref|XP_006484855.1|  PREDICTED: uncharacterized protein LOC102628...  87.8    4e-16   
ref|XP_006484854.1|  PREDICTED: uncharacterized protein LOC102628...  87.8    4e-16   Citrus sinensis [apfelsine]
emb|CDJ26391.1|  unnamed protein product                              87.4    4e-16   Triticum aestivum [Canadian hard winter wheat]
gb|KEH18456.1|  plant/MDC16-11 protein                                87.8    4e-16   Medicago truncatula
ref|XP_008783017.1|  PREDICTED: uncharacterized protein LOC103702...  87.4    4e-16   Phoenix dactylifera
ref|XP_008783011.1|  PREDICTED: uncharacterized protein LOC103702...  87.4    4e-16   Phoenix dactylifera
ref|XP_008783009.1|  PREDICTED: uncharacterized protein LOC103702...  87.4    4e-16   Phoenix dactylifera
ref|XP_008783015.1|  PREDICTED: uncharacterized protein LOC103702...  87.4    4e-16   Phoenix dactylifera
emb|CDP14411.1|  unnamed protein product                              87.4    4e-16   Coffea canephora [robusta coffee]
ref|XP_008783018.1|  PREDICTED: uncharacterized protein LOC103702...  87.4    4e-16   Phoenix dactylifera
ref|XP_008783014.1|  PREDICTED: uncharacterized protein LOC103702...  87.4    4e-16   Phoenix dactylifera
ref|XP_008783012.1|  PREDICTED: uncharacterized protein LOC103702...  87.4    4e-16   Phoenix dactylifera
ref|XP_008783016.1|  PREDICTED: uncharacterized protein LOC103702...  87.4    4e-16   Phoenix dactylifera
ref|XP_008783013.1|  PREDICTED: uncharacterized protein LOC103702...  87.4    4e-16   Phoenix dactylifera
emb|CAB53656.1|  hypothetical protein                                 87.0    6e-16   Arabidopsis thaliana [mouse-ear cress]
gb|KJB06118.1|  hypothetical protein B456_001G0984002                 87.0    7e-16   Gossypium raimondii
ref|XP_008797740.1|  PREDICTED: uncharacterized protein LOC103712...  87.0    7e-16   Phoenix dactylifera
ref|XP_009610069.1|  PREDICTED: uncharacterized protein LOC104103...  87.0    7e-16   Nicotiana tomentosiformis
gb|KJB06119.1|  hypothetical protein B456_001G0984002                 87.0    7e-16   Gossypium raimondii
ref|XP_009610068.1|  PREDICTED: uncharacterized protein LOC104103...  87.0    7e-16   Nicotiana tomentosiformis
ref|XP_008797741.1|  PREDICTED: uncharacterized protein LOC103712...  87.0    7e-16   Phoenix dactylifera
ref|XP_008797743.1|  PREDICTED: uncharacterized protein LOC103712...  87.0    7e-16   Phoenix dactylifera
ref|XP_008797742.1|  PREDICTED: uncharacterized protein LOC103712...  87.0    7e-16   Phoenix dactylifera
ref|XP_008797739.1|  PREDICTED: uncharacterized protein LOC103712...  87.0    7e-16   Phoenix dactylifera
ref|XP_009610070.1|  PREDICTED: uncharacterized protein LOC104103...  86.7    7e-16   Nicotiana tomentosiformis
ref|XP_009610071.1|  PREDICTED: uncharacterized protein LOC104103...  86.7    7e-16   
ref|XP_002884662.1|  hypothetical protein ARALYDRAFT_896937           86.7    7e-16   Arabidopsis lyrata subsp. lyrata
ref|XP_007049405.1|  Cell wall protein AWA1 isoform 3                 86.7    8e-16   
gb|AAT44198.1|  unknown protein                                       86.7    8e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006296970.1|  hypothetical protein CARUB_v10012965mg           86.7    8e-16   
ref|XP_007049403.1|  Cell wall protein AWA1 isoform 1                 86.7    8e-16   
ref|XP_010261965.1|  PREDICTED: uncharacterized protein LOC104600...  86.7    9e-16   
ref|XP_010261966.1|  PREDICTED: uncharacterized protein LOC104600...  86.3    9e-16   
ref|XP_010942572.1|  PREDICTED: uncharacterized protein LOC105060...  86.3    1e-15   
ref|XP_010942576.1|  PREDICTED: uncharacterized protein LOC105060...  86.3    1e-15   
ref|XP_010942570.1|  PREDICTED: uncharacterized protein LOC105060...  86.3    1e-15   
ref|XP_010942575.1|  PREDICTED: uncharacterized protein LOC105060...  86.3    1e-15   
ref|XP_010942574.1|  PREDICTED: uncharacterized protein LOC105060...  86.3    1e-15   
ref|XP_010942569.1|  PREDICTED: uncharacterized protein LOC105060...  86.3    1e-15   
ref|XP_010942571.1|  PREDICTED: uncharacterized protein LOC105060...  86.3    1e-15   
ref|XP_004510436.1|  PREDICTED: flocculation protein FLO11-like       86.3    1e-15   
gb|EPS69388.1|  hypothetical protein M569_05379                       81.3    1e-15   
ref|XP_010036126.1|  PREDICTED: uncharacterized protein LOC104425...  85.9    1e-15   
ref|XP_002521347.1|  conserved hypothetical protein                   85.9    1e-15   
ref|XP_010524628.1|  PREDICTED: uncharacterized protein LOC104802632  85.9    1e-15   
ref|XP_010036125.1|  PREDICTED: uncharacterized protein LOC104425...  85.9    1e-15   
ref|XP_008228221.1|  PREDICTED: probable GPI-anchored adhesin-lik...  85.9    2e-15   
ref|XP_008228217.1|  PREDICTED: probable secreted beta-glucosidas...  85.9    2e-15   
ref|XP_008228219.1|  PREDICTED: probable secreted beta-glucosidas...  85.9    2e-15   
ref|XP_010929035.1|  PREDICTED: uncharacterized protein LOC105050...  85.9    2e-15   
ref|XP_006414144.1|  hypothetical protein EUTSA_v10027504mg           85.5    2e-15   
ref|XP_010929038.1|  PREDICTED: uncharacterized protein LOC105050...  85.9    2e-15   
ref|XP_010929036.1|  PREDICTED: uncharacterized protein LOC105050...  85.9    2e-15   
ref|XP_010929039.1|  PREDICTED: uncharacterized protein LOC105050...  85.9    2e-15   
ref|XP_008228216.1|  PREDICTED: probable secreted beta-glucosidas...  85.5    2e-15   
ref|XP_010657492.1|  PREDICTED: uncharacterized protein LOC100245...  85.9    2e-15   
ref|XP_008228218.1|  PREDICTED: probable GPI-anchored adhesin-lik...  85.5    2e-15   
ref|XP_008228220.1|  PREDICTED: probable secreted beta-glucosidas...  85.5    2e-15   
ref|XP_003544279.1|  PREDICTED: cell wall protein AWA1-like           85.5    2e-15   
ref|XP_010657491.1|  PREDICTED: uncharacterized protein LOC100245...  85.5    2e-15   
ref|XP_002267265.1|  PREDICTED: uncharacterized protein LOC100245...  85.5    2e-15   
ref|XP_008462126.1|  PREDICTED: flocculation protein FLO11            85.5    2e-15   
ref|XP_009412058.1|  PREDICTED: uncharacterized protein LOC103993639  85.5    2e-15   
ref|XP_009372373.1|  PREDICTED: uncharacterized protein LOC103961...  85.5    2e-15   
ref|XP_009372374.1|  PREDICTED: uncharacterized protein LOC103961...  85.5    2e-15   
gb|KHG01632.1|  Segment polarity dishevelled DVL-3                    85.5    2e-15   
ref|XP_008391371.1|  PREDICTED: dentin sialophosphoprotein-like i...  85.5    2e-15   
ref|XP_004162890.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  85.1    2e-15   
ref|XP_008391372.1|  PREDICTED: chitinase-like protein PB1E7.04c ...  85.5    2e-15   
ref|XP_010062689.1|  PREDICTED: uncharacterized protein LOC104450...  85.1    2e-15   
ref|XP_004144622.1|  PREDICTED: uncharacterized protein LOC101212400  85.1    2e-15   
ref|XP_008338694.1|  PREDICTED: dentin sialophosphoprotein-like i...  85.1    2e-15   
ref|XP_010062690.1|  PREDICTED: uncharacterized protein LOC104450...  85.1    2e-15   
ref|XP_010252823.1|  PREDICTED: uncharacterized protein LOC104594...  85.1    2e-15   
gb|KJB75412.1|  hypothetical protein B456_012G040900                  85.1    3e-15   
ref|XP_008338695.1|  PREDICTED: dentin sialophosphoprotein-like i...  85.1    3e-15   
ref|XP_008338696.1|  PREDICTED: dentin sialophosphoprotein-like i...  85.1    3e-15   
ref|XP_010252821.1|  PREDICTED: uncharacterized protein LOC104594...  85.1    3e-15   
ref|XP_010252822.1|  PREDICTED: uncharacterized protein LOC104594...  85.1    3e-15   
ref|XP_010252820.1|  PREDICTED: uncharacterized protein LOC104594...  85.1    3e-15   
ref|XP_006282355.1|  hypothetical protein CARUB_v10028652mg           84.7    3e-15   
gb|KDP40717.1|  hypothetical protein JCGZ_24716                       84.7    3e-15   
ref|XP_010245042.1|  PREDICTED: RNA polymerase II degradation fac...  84.7    4e-15   
ref|XP_009124224.1|  PREDICTED: uncharacterized protein LOC103849165  84.7    4e-15   
ref|XP_010245043.1|  PREDICTED: uncharacterized protein LOC104588...  84.7    4e-15   
emb|CDY22126.1|  BnaC01g39750D                                        84.3    4e-15   
ref|XP_010245041.1|  PREDICTED: uncharacterized protein LOC104588...  84.7    4e-15   
ref|XP_010245040.1|  PREDICTED: uncharacterized protein LOC104588...  84.7    4e-15   
gb|KHN46209.1|  hypothetical protein glysoja_039933                   84.3    4e-15   
ref|XP_006575395.1|  PREDICTED: cell wall protein AWA1-like           84.3    5e-15   
ref|XP_010087685.1|  hypothetical protein L484_013447                 84.3    5e-15   
ref|NP_199450.1|  uncharacterized protein                             84.0    5e-15   
ref|XP_010942880.1|  PREDICTED: uncharacterized protein LOC105060...  84.3    5e-15   
ref|XP_006849609.1|  hypothetical protein AMTR_s00024p00205340        79.7    5e-15   
ref|XP_010942881.1|  PREDICTED: uncharacterized protein LOC105060...  84.3    5e-15   
gb|EPS69701.1|  hypothetical protein M569_05071                       79.0    5e-15   
emb|CDY61561.1|  BnaCnng37960D                                        77.0    6e-15   
ref|XP_010314323.1|  PREDICTED: uncharacterized protein LOC101258...  84.0    6e-15   
ref|XP_004252392.1|  PREDICTED: uncharacterized protein LOC101258...  84.0    6e-15   
ref|XP_010314322.1|  PREDICTED: uncharacterized protein LOC101258...  84.0    6e-15   
ref|XP_009589263.1|  PREDICTED: protein PRRC2B-like isoform X5        84.0    6e-15   
ref|XP_009589261.1|  PREDICTED: protein PRRC2B-like isoform X3        84.0    6e-15   
ref|XP_009589260.1|  PREDICTED: uncharacterized protein LOC104086...  84.0    6e-15   
ref|XP_009589259.1|  PREDICTED: protein PRRC2B-like isoform X1        84.0    6e-15   
ref|XP_009782967.1|  PREDICTED: uncharacterized protein LOC104231...  84.0    6e-15   
ref|XP_009589264.1|  PREDICTED: protein PRRC2B-like isoform X6        84.0    6e-15   
ref|XP_009782966.1|  PREDICTED: uncharacterized protein LOC104231...  84.0    6e-15   
ref|XP_009782965.1|  PREDICTED: uncharacterized protein LOC104231...  84.0    7e-15   
ref|XP_009589262.1|  PREDICTED: uncharacterized protein LOC104086...  84.0    7e-15   
ref|XP_006353098.1|  PREDICTED: putative GPI-anchored protein PB1...  84.0    7e-15   
ref|XP_009782968.1|  PREDICTED: uncharacterized protein LOC104231...  84.0    7e-15   
ref|XP_006353099.1|  PREDICTED: putative GPI-anchored protein PB1...  84.0    7e-15   
ref|XP_009391448.1|  PREDICTED: uncharacterized protein LOC103977608  83.6    8e-15   
gb|KHN39644.1|  hypothetical protein glysoja_020722                   83.6    8e-15   
ref|XP_006598817.1|  PREDICTED: putative uncharacterized protein ...  83.6    8e-15   
ref|XP_010917133.1|  PREDICTED: uncharacterized protein LOC105041...  83.6    8e-15   
ref|XP_011100583.1|  PREDICTED: uncharacterized protein LOC105178745  83.6    9e-15   
ref|XP_010917132.1|  PREDICTED: uncharacterized protein LOC105041...  83.6    9e-15   
emb|CBI35892.3|  unnamed protein product                              83.6    9e-15   
ref|XP_010654469.1|  PREDICTED: uncharacterized protein LOC100248...  83.6    9e-15   
ref|XP_010644609.1|  PREDICTED: RNA polymerase II degradation fac...  83.6    9e-15   
ref|XP_010654470.1|  PREDICTED: uncharacterized protein LOC100248...  83.6    1e-14   
ref|XP_010654468.1|  PREDICTED: uncharacterized protein LOC100248...  83.6    1e-14   
ref|XP_003528451.1|  PREDICTED: dentin sialophosphoprotein-like i...  83.6    1e-14   
ref|XP_010644610.1|  PREDICTED: RNA polymerase II degradation fac...  83.2    1e-14   
ref|XP_004961107.1|  PREDICTED: uncharacterized protein LOC101764...  83.2    1e-14   
ref|XP_010551966.1|  PREDICTED: uncharacterized protein LOC104822439  83.2    1e-14   
ref|XP_004961106.1|  PREDICTED: uncharacterized protein LOC101764...  83.2    1e-14   
gb|AFW61910.1|  putative DUF1296 domain containing family protein     83.2    1e-14   
gb|AFW61911.1|  putative DUF1296 domain containing family protein     83.2    1e-14   
ref|XP_010644611.1|  PREDICTED: RNA polymerase II degradation fac...  83.2    1e-14   
ref|XP_010654471.1|  PREDICTED: uncharacterized protein LOC100248...  83.2    1e-14   
ref|XP_008678497.1|  PREDICTED: uncharacterized protein LOC103653...  83.2    1e-14   
ref|XP_008678495.1|  PREDICTED: probable GPI-anchored adhesin-lik...  83.2    1e-14   
ref|XP_008678496.1|  PREDICTED: uncharacterized protein LOC103653...  83.2    1e-14   
ref|XP_006583149.1|  PREDICTED: dentin sialophosphoprotein-like i...  83.2    1e-14   
ref|XP_008678498.1|  PREDICTED: probable GPI-anchored adhesin-lik...  83.2    1e-14   
ref|XP_006583148.1|  PREDICTED: dentin sialophosphoprotein-like i...  83.2    1e-14   
ref|XP_008678494.1|  PREDICTED: probable GPI-anchored adhesin-lik...  83.2    1e-14   
ref|XP_008464007.1|  PREDICTED: uncharacterized protein LOC103501...  83.2    1e-14   
ref|NP_187423.2|  uncharacterized protein                             83.2    1e-14   
ref|XP_008464006.1|  PREDICTED: uncharacterized protein LOC103501...  83.2    1e-14   
ref|XP_004141213.1|  PREDICTED: uncharacterized protein LOC101203238  82.8    1e-14   
ref|XP_004163891.1|  PREDICTED: uncharacterized protein LOC101226902  83.2    1e-14   
gb|KGN59790.1|  hypothetical protein Csa_3G846060                     82.8    1e-14   
ref|XP_010666705.1|  PREDICTED: uncharacterized protein LOC104883...  82.8    1e-14   
ref|XP_009339824.1|  PREDICTED: uncharacterized protein LOC103932...  82.8    1e-14   
ref|XP_010666704.1|  PREDICTED: uncharacterized protein LOC104883...  82.8    1e-14   
ref|XP_010936970.1|  PREDICTED: uncharacterized protein LOC105056...  82.8    1e-14   
ref|XP_009339833.1|  PREDICTED: uncharacterized protein LOC103932...  82.8    1e-14   
ref|XP_009339841.1|  PREDICTED: uncharacterized protein LOC103932...  82.8    1e-14   
ref|XP_004303676.1|  PREDICTED: uncharacterized protein LOC101293...  82.8    2e-14   
ref|XP_011467415.1|  PREDICTED: uncharacterized protein LOC101293...  82.8    2e-14   
ref|XP_010936968.1|  PREDICTED: uncharacterized protein LOC105056...  82.8    2e-14   
ref|XP_004490553.1|  PREDICTED: flocculation protein FLO11-like       82.8    2e-14   
ref|XP_011072651.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  82.8    2e-14   
ref|XP_006660473.1|  PREDICTED: flocculation protein FLO11-like       82.4    2e-14   
ref|XP_002967632.1|  hypothetical protein SELMODRAFT_440086           82.4    2e-14   
ref|XP_007135474.1|  hypothetical protein PHAVU_010G132600g           82.4    2e-14   
ref|XP_010465278.1|  PREDICTED: uncharacterized protein LOC104745...  82.4    2e-14   
ref|XP_010465277.1|  PREDICTED: uncharacterized protein LOC104745...  82.4    2e-14   
ref|XP_010465276.1|  PREDICTED: uncharacterized protein LOC104745...  82.4    2e-14   
ref|XP_010501523.1|  PREDICTED: uncharacterized protein LOC104778...  82.0    2e-14   
ref|XP_002964401.1|  hypothetical protein SELMODRAFT_438753           82.0    2e-14   
ref|XP_010501517.1|  PREDICTED: uncharacterized protein LOC104778...  82.0    2e-14   
ref|XP_010501500.1|  PREDICTED: uncharacterized protein LOC104778...  82.0    3e-14   
ref|XP_010501510.1|  PREDICTED: uncharacterized protein LOC104778...  82.0    3e-14   
ref|XP_010501505.1|  PREDICTED: uncharacterized protein LOC104778...  82.0    3e-14   
ref|XP_010487182.1|  PREDICTED: uncharacterized protein LOC104765...  82.0    3e-14   
gb|AGT17314.1|  Protein of unknown function DUF1296                   82.0    3e-14   
ref|XP_010487183.1|  PREDICTED: uncharacterized protein LOC104765...  82.0    3e-14   
ref|XP_008784271.1|  PREDICTED: uncharacterized protein LOC103703...  81.6    4e-14   
gb|EYU21338.1|  hypothetical protein MIMGU_mgv1a001286mg              81.6    4e-14   
gb|EEE65290.1|  hypothetical protein OsJ_20522                        81.3    4e-14   
gb|EEC80202.1|  hypothetical protein OsI_22088                        81.3    4e-14   
ref|NP_001057094.1|  Os06g0206100                                     81.3    4e-14   
ref|XP_010685331.1|  PREDICTED: uncharacterized protein LOC104899...  81.3    5e-14   
ref|XP_010685332.1|  PREDICTED: uncharacterized protein LOC104899...  81.3    5e-14   
ref|XP_010685333.1|  PREDICTED: uncharacterized protein LOC104899...  80.9    6e-14   
ref|NP_001056433.1|  Os05g0581800                                     80.9    6e-14   
gb|KHN41482.1|  hypothetical protein glysoja_036276                   74.7    6e-14   
ref|XP_004973209.1|  PREDICTED: flocculation protein FLO11-like       80.9    7e-14   
ref|XP_002885002.1|  hypothetical protein ARALYDRAFT_478805           80.5    7e-14   
ref|NP_001141689.1|  uncharacterized protein LOC100273818             80.5    8e-14   
ref|XP_008647566.1|  PREDICTED: uncharacterized protein LOC100273...  80.5    8e-14   
ref|XP_011026250.1|  PREDICTED: uncharacterized protein LOC105126...  80.5    8e-14   
ref|XP_011026252.1|  PREDICTED: uncharacterized protein LOC105126...  80.5    8e-14   
ref|XP_010321076.1|  PREDICTED: uncharacterized protein LOC101250...  80.5    9e-14   
ref|XP_011026251.1|  PREDICTED: uncharacterized protein LOC105126...  80.5    9e-14   
ref|XP_010321075.1|  PREDICTED: uncharacterized protein LOC101250...  80.5    9e-14   
ref|XP_006656745.1|  PREDICTED: uncharacterized protein LOC102709938  80.5    1e-13   
ref|XP_010534929.1|  PREDICTED: uncharacterized protein LOC104810...  80.1    1e-13   
emb|CDX97535.1|  BnaA05g25440D                                        80.1    1e-13   
ref|XP_002863403.1|  hypothetical protein ARALYDRAFT_356363           80.1    1e-13   
dbj|BAJ94362.1|  predicted protein                                    79.7    2e-13   
ref|XP_003569505.1|  PREDICTED: uncharacterized protein LOC100846...  79.3    2e-13   
ref|XP_010232108.1|  PREDICTED: uncharacterized protein LOC100846...  79.3    2e-13   
ref|XP_010932459.1|  PREDICTED: RNA polymerase II degradation fac...  79.3    2e-13   
gb|AAG51735.1|AC068667_14  unknown protein; 25451-20507               79.0    3e-13   
ref|NP_001078149.1|  kinase-related protein                           78.6    3e-13   
ref|NP_188015.2|  kinase-related protein                              78.6    3e-13   
dbj|BAB02329.1|  unnamed protein product                              78.6    4e-13   
ref|XP_008229801.1|  PREDICTED: uncharacterized protein LOC103329149  77.4    4e-13   
ref|XP_007024587.1|  Uncharacterized protein isoform 4                78.2    5e-13   
ref|XP_007024585.1|  Uncharacterized protein isoform 2                78.2    5e-13   
ref|XP_004516933.1|  PREDICTED: serine-rich adhesin for platelets...  78.2    5e-13   
ref|XP_007024589.1|  Uncharacterized protein isoform 6                78.2    5e-13   
ref|XP_007024588.1|  Uncharacterized protein isoform 5                78.2    5e-13   
gb|AES98495.2|  MLP3.11 protein                                       78.2    6e-13   
gb|ACG43075.1|  hypothetical protein                                  72.0    6e-13   
ref|XP_007024584.1|  Uncharacterized protein isoform 1                77.8    6e-13   
ref|XP_008654854.1|  PREDICTED: uncharacterized protein LOC100280...  77.8    6e-13   
ref|XP_008654853.1|  PREDICTED: uncharacterized protein LOC100280...  77.8    6e-13   
ref|XP_003615537.1|  hypothetical protein MTR_5g069290                77.8    7e-13   
gb|AAG51729.1|AC068667_8  unknown protein; 16040-11188                77.8    7e-13   
gb|AFW81250.1|  putative DUF1296 domain containing family protein     77.8    7e-13   
ref|XP_006465941.1|  PREDICTED: dentin sialophosphoprotein-like       77.8    7e-13   
ref|XP_008654852.1|  PREDICTED: uncharacterized protein LOC100280...  77.8    7e-13   
ref|XP_008654851.1|  PREDICTED: uncharacterized protein LOC100280...  77.4    7e-13   
gb|AFW81248.1|  putative DUF1296 domain containing family protein     77.4    7e-13   
ref|XP_006426627.1|  hypothetical protein CICLE_v10024871mg           77.8    7e-13   
ref|NP_001146586.1|  uncharacterized protein LOC100280182             77.4    8e-13   
gb|KDO65081.1|  hypothetical protein CISIN_1g040475mg                 77.4    8e-13   
ref|XP_006426626.1|  hypothetical protein CICLE_v10024871mg           77.4    8e-13   
ref|XP_010676081.1|  PREDICTED: uncharacterized protein LOC104891...  77.0    8e-13   
emb|CAN73914.1|  hypothetical protein VITISV_035233                   77.4    8e-13   
gb|AFW81251.1|  putative DUF1296 domain containing family protein     77.4    9e-13   
emb|CDY35953.1|  BnaA05g29970D                                        77.4    9e-13   
ref|XP_009147044.1|  PREDICTED: uncharacterized protein LOC103870...  77.0    1e-12   
emb|CDY28028.1|  BnaC05g44300D                                        77.0    1e-12   
ref|XP_009147045.1|  PREDICTED: uncharacterized protein LOC103870...  77.0    1e-12   
ref|XP_009146425.1|  PREDICTED: uncharacterized protein LOC103870...  77.0    1e-12   
ref|XP_009146424.1|  PREDICTED: uncharacterized protein LOC103870...  77.0    1e-12   
ref|XP_009146423.1|  PREDICTED: uncharacterized protein LOC103870...  77.0    1e-12   
ref|XP_009146426.1|  PREDICTED: uncharacterized protein LOC103870...  77.0    1e-12   
ref|XP_010676080.1|  PREDICTED: uncharacterized protein LOC104891...  76.6    1e-12   
ref|XP_002300878.1|  hypothetical protein POPTR_0002s06020g           76.6    2e-12   
ref|XP_008797669.1|  PREDICTED: uncharacterized protein LOC103712...  76.6    2e-12   
emb|CDY33258.1|  BnaC01g37310D                                        76.3    2e-12   
ref|XP_009117292.1|  PREDICTED: uncharacterized protein LOC103842...  76.3    2e-12   
emb|CDY39087.1|  BnaA01g29690D                                        76.3    2e-12   
ref|XP_009117284.1|  PREDICTED: uncharacterized protein LOC103842...  76.3    2e-12   
ref|XP_009108639.1|  PREDICTED: uncharacterized protein LOC103834315  73.2    2e-12   
ref|XP_011085417.1|  PREDICTED: uncharacterized protein LOC105167...  75.9    2e-12   
ref|XP_011085415.1|  PREDICTED: uncharacterized protein LOC105167...  75.9    3e-12   
emb|CDY65326.1|  BnaCnng46620D                                        75.9    3e-12   
ref|XP_011085416.1|  PREDICTED: uncharacterized protein LOC105167...  75.9    3e-12   
gb|EMT03241.1|  hypothetical protein F775_28234                       75.9    3e-12   
gb|AES70123.2|  DUF1296 family protein                                75.5    3e-12   
ref|XP_003599872.1|  hypothetical protein MTR_3g048270                75.5    3e-12   



>ref|XP_009614041.1| PREDICTED: uncharacterized protein LOC104107048 isoform X2 [Nicotiana 
tomentosiformis]
Length=839

 Score =   147 bits (371),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 99/161 (61%), Positives = 116/161 (72%), Gaps = 11/161 (7%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  387
            V  IP+GSRK+V+SLKEIV N PE EIYA LKECNMDPNEAVNRLL+QD FHEVKSKR+K
Sbjct  12   VQAIPAGSRKVVQSLKEIV-NCPEPEIYAMLKECNMDPNEAVNRLLTQDTFHEVKSKREK  70

Query  388  RKENKDTTEsrprgasssrggkgsadr--YAGRGGSESLHGKSTYAY-XENG-YTN--TK  549
            RKE+KDTTESRPRG+ S+ G         Y GRGGSE    K T  Y  ENG YT+  T 
Sbjct  71   RKESKDTTESRPRGSVSNSGRGSRGGAEWYVGRGGSEPT--KPTPGYKKENGSYTSYLTS  128

Query  550  STRTAGSTTNRWLPTISDAAGTENQK--LVDGVSAATQHSS  666
            +   +GS  +R + TISDAA  E++K   VDGVS+ +QHSS
Sbjct  129  TPEVSGSNVSRRVATISDAAANESKKPAAVDGVSSVSQHSS  169



>ref|XP_010317412.1| PREDICTED: uncharacterized protein LOC101266097 isoform X2 [Solanum 
lycopersicum]
Length=822

 Score =   143 bits (361),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 110/161 (68%), Gaps = 9/161 (6%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  387
            V  IP GSRK+V+SLKEIV N PE+EIYA LKECNMDPNEAVNRLL+QDPFHEVKSKR+K
Sbjct  18   VQSIPPGSRKMVQSLKEIV-NCPEAEIYAMLKECNMDPNEAVNRLLTQDPFHEVKSKREK  76

Query  388  RKENKDTTEsrp--rgasssrggkgsadrYAGRGGSESLHGKSTYAYXENGYTNTKSTR-  558
            RKE KD TESR     ++ SRG +   DRY GRGGSES      Y       TN  S+  
Sbjct  77   RKEIKDPTESRSWITSSTPSRGSRAGGDRYVGRGGSESTKPAPAYRKESGSQTNNFSSTP  136

Query  559  -TAGSTTNRWLPTISDAAGTENQKL----VDGVSAATQHSS  666
              AG  T+R    ISDAAG ++++L    VDG SAA+Q SS
Sbjct  137  LIAGGNTDRRPTAISDAAGNDSKRLAPAAVDGHSAASQPSS  177



>ref|XP_004234052.1| PREDICTED: uncharacterized protein LOC101266097 isoform X1 [Solanum 
lycopersicum]
Length=843

 Score =   143 bits (360),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 110/161 (68%), Gaps = 9/161 (6%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  387
            V  IP GSRK+V+SLKEIV N PE+EIYA LKECNMDPNEAVNRLL+QDPFHEVKSKR+K
Sbjct  18   VQSIPPGSRKMVQSLKEIV-NCPEAEIYAMLKECNMDPNEAVNRLLTQDPFHEVKSKREK  76

Query  388  RKENKDTTEsrp--rgasssrggkgsadrYAGRGGSESLHGKSTYAYXENGYTNTKSTR-  558
            RKE KD TESR     ++ SRG +   DRY GRGGSES      Y       TN  S+  
Sbjct  77   RKEIKDPTESRSWITSSTPSRGSRAGGDRYVGRGGSESTKPAPAYRKESGSQTNNFSSTP  136

Query  559  -TAGSTTNRWLPTISDAAGTENQKL----VDGVSAATQHSS  666
              AG  T+R    ISDAAG ++++L    VDG SAA+Q SS
Sbjct  137  LIAGGNTDRRPTAISDAAGNDSKRLAPAAVDGHSAASQPSS  177



>ref|XP_009785957.1| PREDICTED: uncharacterized protein LOC104234138 isoform X2 [Nicotiana 
sylvestris]
Length=841

 Score =   142 bits (359),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 102/163 (63%), Positives = 117/163 (72%), Gaps = 13/163 (8%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  387
            V  IP+GSRK+V+SLKEIV N PE EIYA LKECNMDPNEAVNRLL+QD FHEVKSKR+K
Sbjct  12   VQAIPAGSRKVVQSLKEIV-NCPEPEIYAMLKECNMDPNEAVNRLLTQDTFHEVKSKREK  70

Query  388  RKENKDTTEsrp--rgasssrggkgsadrYAGRGGSESLHGKSTYAY-XENG-YT-NTKS  552
            RKE+KDTTESRP     +S RG +G A+RY GRGGSE    K T  Y  ENG YT N  S
Sbjct  71   RKESKDTTESRPRGSVNNSGRGSRGGAERYVGRGGSEPT--KPTPGYKKENGSYTSNLAS  128

Query  553  TR-TAGSTTNRWLPTISDAAGTENQK----LVDGVSAATQHSS  666
            T   +GS  +R   TISDAA  E ++     VDGVS+ +QHSS
Sbjct  129  TPGVSGSNISRRAATISDAAANETKRPASAAVDGVSSVSQHSS  171



>ref|XP_009614040.1| PREDICTED: uncharacterized protein LOC104107048 isoform X1 [Nicotiana 
tomentosiformis]
Length=841

 Score =   142 bits (359),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 99/163 (61%), Positives = 116/163 (71%), Gaps = 13/163 (8%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  387
            V  IP+GSRK+V+SLKEIV N PE EIYA LKECNMDPNEAVNRLL+QD FHEVKSKR+K
Sbjct  12   VQAIPAGSRKVVQSLKEIV-NCPEPEIYAMLKECNMDPNEAVNRLLTQDTFHEVKSKREK  70

Query  388  RKE--NKDTTEsrprgasssrggkgsadr--YAGRGGSESLHGKSTYAY-XENG-YTN--  543
            RKE  +KDTTESRPRG+ S+ G         Y GRGGSE    K T  Y  ENG YT+  
Sbjct  71   RKEVQSKDTTESRPRGSVSNSGRGSRGGAEWYVGRGGSEPT--KPTPGYKKENGSYTSYL  128

Query  544  TKSTRTAGSTTNRWLPTISDAAGTENQK--LVDGVSAATQHSS  666
            T +   +GS  +R + TISDAA  E++K   VDGVS+ +QHSS
Sbjct  129  TSTPEVSGSNVSRRVATISDAAANESKKPAAVDGVSSVSQHSS  171



>ref|XP_009618326.1| PREDICTED: uncharacterized protein LOC104110515 isoform X1 [Nicotiana 
tomentosiformis]
Length=852

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 106/160 (66%), Gaps = 8/160 (5%)
 Frame = +1

Query  211  AMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKR  390
            ++IP GS+K+V+SLKEIV    E+EIYA LK+CNMDPNEAVN+LLSQD FHEVKSKR+KR
Sbjct  21   SIIPGGSKKMVQSLKEIVNFCTEAEIYAVLKDCNMDPNEAVNKLLSQDTFHEVKSKREKR  80

Query  391  KENKDTTEsrprgasssrggkgsadr--YAGRGGSESLHGKSTYAYXENGYTNTKSTR--  558
            KENKDTTESR   +SS+           Y GRGGSES      Y      +TN  S+   
Sbjct  81   KENKDTTESRSWVSSSTSSRGSRTGAERYVGRGGSESTKPAPAYRKESGSHTNNFSSTPG  140

Query  559  TAGSTTNRWLPTISDAAGTENQKL----VDGVSAATQHSS  666
              GS  +R    +SDAAG E++KL    VDG SAA+Q SS
Sbjct  141  VVGSNIDRRPTAVSDAAGNESKKLTPAAVDGHSAASQLSS  180



>ref|XP_009618328.1| PREDICTED: uncharacterized protein LOC104110515 isoform X2 [Nicotiana 
tomentosiformis]
Length=845

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 106/160 (66%), Gaps = 8/160 (5%)
 Frame = +1

Query  211  AMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKR  390
            ++IP GS+K+V+SLKEIV    E+EIYA LK+CNMDPNEAVN+LLSQD FHEVKSKR+KR
Sbjct  21   SIIPGGSKKMVQSLKEIVNFCTEAEIYAVLKDCNMDPNEAVNKLLSQDTFHEVKSKREKR  80

Query  391  KENKDTTEsrprgasssrggkgsadr--YAGRGGSESLHGKSTYAYXENGYTNTKSTR--  558
            KENKDTTESR   +SS+           Y GRGGSES      Y      +TN  S+   
Sbjct  81   KENKDTTESRSWVSSSTSSRGSRTGAERYVGRGGSESTKPAPAYRKESGSHTNNFSSTPG  140

Query  559  TAGSTTNRWLPTISDAAGTENQKL----VDGVSAATQHSS  666
              GS  +R    +SDAAG E++KL    VDG SAA+Q SS
Sbjct  141  VVGSNIDRRPTAVSDAAGNESKKLTPAAVDGHSAASQLSS  180



>ref|XP_006356118.1| PREDICTED: cell wall protein AWA1-like [Solanum tuberosum]
Length=845

 Score =   139 bits (349),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 109/161 (68%), Gaps = 9/161 (6%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  387
            V  IP GSRK+V+SLKEIV N PE+EIYA LKECNMDPNEAVNRLL+QDPFHEVKSKR+K
Sbjct  18   VQSIPPGSRKMVQSLKEIV-NCPEAEIYAMLKECNMDPNEAVNRLLTQDPFHEVKSKREK  76

Query  388  RKENKDTTEsrp--rgasssrggkgsadrYAGRGGSESLHGKSTYAYXENGYTNTKSTR-  558
            RKE KD TESR     ++ SRG +   +RY GRGGSES      Y       TN  S+  
Sbjct  77   RKEIKDPTESRSWITSSTPSRGSRAGGERYVGRGGSESTKPTPAYRKESGSQTNNFSSTP  136

Query  559  -TAGSTTNRWLPTISDAAGTENQKL----VDGVSAATQHSS  666
              AGS T+R    IS A G ++++L    VDG SAA+Q SS
Sbjct  137  LIAGSNTDRRPTAISYATGNDSKRLAPAAVDGHSAASQPSS  177



>ref|XP_009785950.1| PREDICTED: uncharacterized protein LOC104234138 isoform X1 [Nicotiana 
sylvestris]
Length=843

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 102/165 (62%), Positives = 117/165 (71%), Gaps = 15/165 (9%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  387
            V  IP+GSRK+V+SLKEIV N PE EIYA LKECNMDPNEAVNRLL+QD FHEVKSKR+K
Sbjct  12   VQAIPAGSRKVVQSLKEIV-NCPEPEIYAMLKECNMDPNEAVNRLLTQDTFHEVKSKREK  70

Query  388  RKE--NKDTTEsrp--rgasssrggkgsadrYAGRGGSESLHGKSTYAY-XENG-YT-NT  546
            RKE  +KDTTESRP     +S RG +G A+RY GRGGSE    K T  Y  ENG YT N 
Sbjct  71   RKEVQSKDTTESRPRGSVNNSGRGSRGGAERYVGRGGSEPT--KPTPGYKKENGSYTSNL  128

Query  547  KSTR-TAGSTTNRWLPTISDAAGTENQK----LVDGVSAATQHSS  666
             ST   +GS  +R   TISDAA  E ++     VDGVS+ +QHSS
Sbjct  129  ASTPGVSGSNISRRAATISDAAANETKRPASAAVDGVSSVSQHSS  173



>ref|XP_009790935.1| PREDICTED: uncharacterized protein LOC104238306 [Nicotiana sylvestris]
Length=852

 Score =   137 bits (344),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 87/160 (54%), Positives = 104/160 (65%), Gaps = 8/160 (5%)
 Frame = +1

Query  211  AMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKR  390
            ++IP GS+K+V+SLKEIV    E+EIYA LK+CNMDPNEAVN+LLSQD FHEVKSKR+KR
Sbjct  21   SIIPGGSKKMVQSLKEIVNFCTEAEIYAVLKDCNMDPNEAVNKLLSQDTFHEVKSKREKR  80

Query  391  KENKDTTEsrprgasssrggkgsadr--YAGRGGSESLHGKSTYAYXENGYTNTKSTRTA  564
            KENKDTTESR   +SS+           Y GR GSES      Y      +TN  S+   
Sbjct  81   KENKDTTESRSWVSSSTSSRGSRTGAERYVGRTGSESTKPAPAYRKESGSHTNNFSSTPG  140

Query  565  --GSTTNRWLPTISDAAGTENQKL----VDGVSAATQHSS  666
              GS  +R    +SDAAG E +KL    VDG SAA+Q SS
Sbjct  141  VLGSNIDRRPTAVSDAAGNERKKLAPAAVDGNSAASQPSS  180



>ref|XP_006355598.1| PREDICTED: signaling mucin HKR1-like [Solanum tuberosum]
Length=836

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 97/162 (60%), Positives = 113/162 (70%), Gaps = 11/162 (7%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  387
            V  IP+GSRK+V+SLKEIV N PE EIYA LKECNMDPNEAVNRLL+QD FHEVKSKR+K
Sbjct  11   VQSIPAGSRKMVQSLKEIV-NCPEPEIYAMLKECNMDPNEAVNRLLTQDTFHEVKSKREK  69

Query  388  RKENKDTTEsrp--rgasssrggkgsadrYAGRGGSESLHGKSTYAYXENGYTNTKSTRT  561
            RKE+KDTTESRP    +SS RG +G A+RY GRGGSES      Y   ENG   +  T T
Sbjct  70   RKESKDTTESRPRGAISSSGRGSRGGAERYVGRGGSESTRPIPGYR-KENGSNTSNLTST  128

Query  562  ---AGSTTNRWLPTISDAAGTENQK----LVDGVSAATQHSS  666
               +GS  +R   TISD A  E++K     VDGVS+  + SS
Sbjct  129  LGVSGSNISRRATTISDIAANESKKSAPTAVDGVSSVCETSS  170



>ref|XP_004232971.1| PREDICTED: uncharacterized protein LOC101252351 [Solanum lycopersicum]
Length=833

 Score =   130 bits (328),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 95/159 (60%), Positives = 112/159 (70%), Gaps = 10/159 (6%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  387
            V  IP+GSRK+V+SLKEIV N PE EIYA LKECNMDPNEAVNRLL+QD FHEVKSKR+K
Sbjct  11   VQSIPAGSRKMVQSLKEIV-NCPEPEIYAMLKECNMDPNEAVNRLLTQDTFHEVKSKREK  69

Query  388  RKENKDTTEsrp--rgasssrggkgsadrYAGRGGS-ESLHGKSTYAYXENGYTNTKSTR  558
            RKE+KDTTESRP    ++S RG +G A+RY GRGGS ES      Y   +NG   +  T 
Sbjct  70   RKESKDTTESRPRGAISNSGRGSRGGAERYVGRGGSAESTKLIPGYR-KDNGSKTSNLTS  128

Query  559  TAG-STTNRWLPTISDAAGTENQK----LVDGVSAATQH  660
            T G S  +R   TISD A  E++K     VDGVS+ +QH
Sbjct  129  TLGVSGISRRATTISDIAANESKKSAPAAVDGVSSVSQH  167



>ref|XP_011096498.1| PREDICTED: uncharacterized protein LOC105175670 isoform X2 [Sesamum 
indicum]
Length=842

 Score =   128 bits (322),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 89/166 (54%), Positives = 112/166 (67%), Gaps = 15/166 (9%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  387
            V  IP+GSRK+V+SLKEIV N  E+EIYA LK+CNMDPNEAVNRLLSQDPFHEVKSKR+K
Sbjct  15   VQAIPAGSRKMVQSLKEIV-NCSEAEIYATLKDCNMDPNEAVNRLLSQDPFHEVKSKREK  73

Query  388  RKENKDTTEsrprgasssrg--gkgsadrYAGRGG-------SESLHGKSTYAYXENGYT  540
            +KE KDTTE+R R A+++    GK  ADRY GRGG       S SL G+S+Y   ENG T
Sbjct  74   KKEGKDTTETRSRSANNNSSRGGKIGADRYHGRGGSTPYSSESASLPGRSSYK-KENGST  132

Query  541  NTKSTRTAGSTTNRWLPTISDAAGTENQ----KLVDGVSAATQHSS  666
               S  ++G+  +R     SD A +EN+     + D + +  Q +S
Sbjct  133  PNASYLSSGNNRSRGPAGPSDGASSENKVSSLSMADAMPSGVQPTS  178



>ref|XP_011096496.1| PREDICTED: uncharacterized protein LOC105175670 isoform X1 [Sesamum 
indicum]
Length=843

 Score =   128 bits (322),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 89/166 (54%), Positives = 112/166 (67%), Gaps = 15/166 (9%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  387
            V  IP+GSRK+V+SLKEIV N  E+EIYA LK+CNMDPNEAVNRLLSQDPFHEVKSKR+K
Sbjct  15   VQAIPAGSRKMVQSLKEIV-NCSEAEIYATLKDCNMDPNEAVNRLLSQDPFHEVKSKREK  73

Query  388  RKENKDTTEsrprgasssrg--gkgsadrYAGRGG-------SESLHGKSTYAYXENGYT  540
            +KE KDTTE+R R A+++    GK  ADRY GRGG       S SL G+S+Y   ENG T
Sbjct  74   KKEGKDTTETRSRSANNNSSRGGKIGADRYHGRGGSTPYSSESASLPGRSSYK-KENGST  132

Query  541  NTKSTRTAGSTTNRWLPTISDAAGTENQ----KLVDGVSAATQHSS  666
               S  ++G+  +R     SD A +EN+     + D + +  Q +S
Sbjct  133  PNASYLSSGNNRSRGPAGPSDGASSENKVSSLSMADAMPSGVQPTS  178



>gb|KJB57295.1| hypothetical protein B456_009G157400 [Gossypium raimondii]
 gb|KJB57300.1| hypothetical protein B456_009G157400 [Gossypium raimondii]
Length=869

 Score =   128 bits (321),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 113/171 (66%), Gaps = 25/171 (15%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  387
            ++ IP+GSRK+V+SLKEIV N PE EIYA LKECNMDPNEAVNRLLSQDPFHEVKSKRDK
Sbjct  20   ISGIPAGSRKMVQSLKEIV-NCPEPEIYAMLKECNMDPNEAVNRLLSQDPFHEVKSKRDK  78

Query  388  RKENKDTTEsrp--rgasssrggkgsadrYAGRGGSE--------SLHGKS-------TY  516
            +KE+KDT +SR        SRGG+  +DRY GRGGS           HGK        T+
Sbjct  79   KKESKDTVDSRSRGANNLGSRGGRSGSDRYMGRGGSSYYSSNESGPFHGKPAQKRENGTH  138

Query  517  AYXENGYTNTKSTRTAGSTTNRWLPTISDA--AG--TENQKLVDGVSAATQ  657
            AY     +++ ++   G+  NR  P+ S+A  AG  T    LVDG+S+++Q
Sbjct  139  AYAG---SSSSASGVQGNNMNRRPPSHSEAGIAGHKTTTAGLVDGISSSSQ  186



>gb|KHG18569.1| Protein translocase subunit SecA [Gossypium arboreum]
Length=851

 Score =   127 bits (320),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 89/173 (51%), Positives = 113/173 (65%), Gaps = 25/173 (14%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  387
            ++ IP+GSRK+V+SLKEIV N PE EIYA LKECNMDPNEAVNRLLSQDPFHEVKSKRDK
Sbjct  20   ISGIPAGSRKMVQSLKEIV-NCPEPEIYAMLKECNMDPNEAVNRLLSQDPFHEVKSKRDK  78

Query  388  RKENKDTTEsrp--rgasssrggkgsadrYAGRGGSES--------LHGKS-------TY  516
            +KE+KDT +SR        SRGG+  +DRY GRGGS +         HGK        T+
Sbjct  79   KKESKDTVDSRSRGANNLGSRGGRSGSDRYMGRGGSSNYSSNESGPFHGKPAQKRENGTH  138

Query  517  AYXENGYTNTKSTRTAGSTTNRWLPTISDAA----GTENQKLVDGVSAATQHS  663
            AY     +++ ++   G+  N  LP+ S+A      T    LVDG+S+++Q S
Sbjct  139  AYAG---SSSSASGVQGNNMNWRLPSHSEAVISGHKTTTAGLVDGISSSSQPS  188



>gb|KDO78063.1| hypothetical protein CISIN_1g0026402mg [Citrus sinensis]
Length=567

 Score =   125 bits (315),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 101/162 (62%), Gaps = 29/162 (18%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  387
            ++ IP+GSRKIV+SLKEIV N PESEIYA LKECNMDPNEAVNRLLSQDPFHEVKSKRDK
Sbjct  17   ISSIPAGSRKIVQSLKEIV-NCPESEIYAMLKECNMDPNEAVNRLLSQDPFHEVKSKRDK  75

Query  388  RKENKDTTEsrprgasssrggkgsadrYAGRGGSESLHGKSTYAY---------------  522
            RKE+KDTT+SR RGAS++           GRGG++    +S  AY               
Sbjct  76   RKESKDTTDSRSRGASNTSNR-------GGRGGTDRYGVRSGAAYFTSNESGTLQSKPAY  128

Query  523  -XEN---GYTNTKSTR--TAGSTTNRWLPTISDAAGTENQKL  630
              EN   GY  + S+      +  N+  P  SD   TEN+ L
Sbjct  129  KKENGTHGYAGSSSSAAGVVANNMNQRPPFYSDDMPTENKTL  170



>gb|KDO78065.1| hypothetical protein CISIN_1g0026402mg, partial [Citrus sinensis]
 gb|KDO78066.1| hypothetical protein CISIN_1g0026402mg, partial [Citrus sinensis]
 gb|KDO78067.1| hypothetical protein CISIN_1g0026402mg, partial [Citrus sinensis]
Length=565

 Score =   125 bits (314),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 97/139 (70%), Gaps = 11/139 (8%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  387
            ++ IP+GSRKIV+SLKEIV N PESEIYA LKECNMDPNEAVNRLLSQDPFHEVKSKRDK
Sbjct  17   ISSIPAGSRKIVQSLKEIV-NCPESEIYAMLKECNMDPNEAVNRLLSQDPFHEVKSKRDK  75

Query  388  RKENKDTTEsrprgasssrggkgsadrYAGRGGSESLHGKSTYAY---XENGYTNTKSTR  558
            RKE+KDTT+SR RGAS++           GRGG++    +S  AY    E+G   +K   
Sbjct  76   RKESKDTTDSRSRGASNTSNR-------GGRGGTDRYGVRSGAAYFTSNESGTLQSKPAY  128

Query  559  TAGSTTNRWLPTISDAAGT  615
               + T+ +  + S AAG 
Sbjct  129  KKENGTHGYAGSSSSAAGV  147



>gb|KDO78068.1| hypothetical protein CISIN_1g0026402mg, partial [Citrus sinensis]
Length=550

 Score =   125 bits (314),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 97/139 (70%), Gaps = 11/139 (8%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  387
            ++ IP+GSRKIV+SLKEIV N PESEIYA LKECNMDPNEAVNRLLSQDPFHEVKSKRDK
Sbjct  17   ISSIPAGSRKIVQSLKEIV-NCPESEIYAMLKECNMDPNEAVNRLLSQDPFHEVKSKRDK  75

Query  388  RKENKDTTEsrprgasssrggkgsadrYAGRGGSESLHGKSTYAY---XENGYTNTKSTR  558
            RKE+KDTT+SR RGAS++           GRGG++    +S  AY    E+G   +K   
Sbjct  76   RKESKDTTDSRSRGASNTSNR-------GGRGGTDRYGVRSGAAYFTSNESGTLQSKPAY  128

Query  559  TAGSTTNRWLPTISDAAGT  615
               + T+ +  + S AAG 
Sbjct  129  KKENGTHGYAGSSSSAAGV  147



>gb|KDO78064.1| hypothetical protein CISIN_1g0026402mg, partial [Citrus sinensis]
Length=593

 Score =   125 bits (314),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 97/139 (70%), Gaps = 11/139 (8%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  387
            ++ IP+GSRKIV+SLKEIV N PESEIYA LKECNMDPNEAVNRLLSQDPFHEVKSKRDK
Sbjct  17   ISSIPAGSRKIVQSLKEIV-NCPESEIYAMLKECNMDPNEAVNRLLSQDPFHEVKSKRDK  75

Query  388  RKENKDTTEsrprgasssrggkgsadrYAGRGGSESLHGKSTYAY---XENGYTNTKSTR  558
            RKE+KDTT+SR RGAS++           GRGG++    +S  AY    E+G   +K   
Sbjct  76   RKESKDTTDSRSRGASNTSNR-------GGRGGTDRYGVRSGAAYFTSNESGTLQSKPAY  128

Query  559  TAGSTTNRWLPTISDAAGT  615
               + T+ +  + S AAG 
Sbjct  129  KKENGTHGYAGSSSSAAGV  147



>ref|XP_011005847.1| PREDICTED: uncharacterized protein LOC105112008 isoform X3 [Populus 
euphratica]
Length=869

 Score =   126 bits (317),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 85/173 (49%), Positives = 105/173 (61%), Gaps = 23/173 (13%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  387
            ++ IP+ SRK+V+SLKEIV N PE EIYA LKECNMDPNEAVNRLLSQDPFHEVKSKR+K
Sbjct  19   ISGIPAASRKMVQSLKEIV-NCPEPEIYAMLKECNMDPNEAVNRLLSQDPFHEVKSKREK  77

Query  388  RKENKDTTEs-rprgasssrggkgsadrYAGRGG-----------SESLHGKSTYAYXEN  531
            +KENKD T+S      + S  G        GRGG           S +LHGK +Y   EN
Sbjct  78   KKENKDPTDSRSRGANNMSNRGGRGGADRNGRGGPGRPAYFSSNESSTLHGKPSYK-KEN  136

Query  532  GY-----TNTKSTRTAGSTTNRWLPTISDAAGTENQKLV----DGVSAATQHS  663
            G       +  ++ T G+  N   P  SD+  TEN+       DGVS+++Q S
Sbjct  137  GANAYAGPSPSASGTVGNNINWQPPYHSDSVATENKMSTVGAGDGVSSSSQPS  189



>ref|XP_011005848.1| PREDICTED: uncharacterized protein LOC105112008 isoform X4 [Populus 
euphratica]
Length=868

 Score =   126 bits (317),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 85/173 (49%), Positives = 105/173 (61%), Gaps = 23/173 (13%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  387
            ++ IP+ SRK+V+SLKEIV N PE EIYA LKECNMDPNEAVNRLLSQDPFHEVKSKR+K
Sbjct  19   ISGIPAASRKMVQSLKEIV-NCPEPEIYAMLKECNMDPNEAVNRLLSQDPFHEVKSKREK  77

Query  388  RKENKDTTEs-rprgasssrggkgsadrYAGRGG-----------SESLHGKSTYAYXEN  531
            +KENKD T+S      + S  G        GRGG           S +LHGK +Y   EN
Sbjct  78   KKENKDPTDSRSRGANNMSNRGGRGGADRNGRGGPGRPAYFSSNESSTLHGKPSYK-KEN  136

Query  532  GY-----TNTKSTRTAGSTTNRWLPTISDAAGTENQKLV----DGVSAATQHS  663
            G       +  ++ T G+  N   P  SD+  TEN+       DGVS+++Q S
Sbjct  137  GANAYAGPSPSASGTVGNNINWQPPYHSDSVATENKMSTVGAGDGVSSSSQPS  189



>ref|XP_006597650.1| PREDICTED: cell wall protein AWA1-like isoform X2 [Glycine max]
Length=800

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 83/168 (49%), Positives = 105/168 (63%), Gaps = 19/168 (11%)
 Frame = +1

Query  211  AMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKR  390
            A IP+ SRK+V+SLKEIV N+P+ EIYA LK+CNMDPNEAV+RLLSQDPFHEVKSKR+K+
Sbjct  19   ATIPASSRKMVQSLKEIVSNFPDHEIYATLKDCNMDPNEAVSRLLSQDPFHEVKSKREKK  78

Query  391  KENKDTTEsrprgasssrggk-----gsadrYAGRGGSES-------LHGKSTYAYXENG  534
            KE KD T+SR RG+ ++            DRY GRGG+         L GK  Y      
Sbjct  79   KEIKDPTDSRSRGSGTNNTSSRGGGRAGTDRYGGRGGANQFGSSDYGLQGKPVYKKENGA  138

Query  535  YTNTKSTRTA----GSTTNRWLPTISDAAGTENQ---KLVDGVSAATQ  657
             T   ST +A    G+ TN  LP+ SD+  TE      + DG S+++Q
Sbjct  139  PTFGGSTSSAPSVLGNNTNTRLPSYSDSVVTEKTYAFGIGDGPSSSSQ  186



>ref|XP_006597649.1| PREDICTED: cell wall protein AWA1-like isoform X1 [Glycine max]
Length=832

 Score =   125 bits (315),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 83/168 (49%), Positives = 105/168 (63%), Gaps = 19/168 (11%)
 Frame = +1

Query  211  AMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKR  390
            A IP+ SRK+V+SLKEIV N+P+ EIYA LK+CNMDPNEAV+RLLSQDPFHEVKSKR+K+
Sbjct  19   ATIPASSRKMVQSLKEIVSNFPDHEIYATLKDCNMDPNEAVSRLLSQDPFHEVKSKREKK  78

Query  391  KENKDTTEsrprgasssrggk-----gsadrYAGRGGSES-------LHGKSTYAYXENG  534
            KE KD T+SR RG+ ++            DRY GRGG+         L GK  Y      
Sbjct  79   KEIKDPTDSRSRGSGTNNTSSRGGGRAGTDRYGGRGGANQFGSSDYGLQGKPVYKKENGA  138

Query  535  YTNTKSTRTA----GSTTNRWLPTISDAAGTENQ---KLVDGVSAATQ  657
             T   ST +A    G+ TN  LP+ SD+  TE      + DG S+++Q
Sbjct  139  PTFGGSTSSAPSVLGNNTNTRLPSYSDSVVTEKTYAFGIGDGPSSSSQ  186



>ref|XP_006467530.1| PREDICTED: uncharacterized protein LOC102630898 isoform X1 [Citrus 
sinensis]
Length=869

 Score =   125 bits (314),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 65/69 (94%), Gaps = 1/69 (1%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  387
            ++ IP+GSRKIV+SLKEIV N PESEIYA LKECNMDPNEAVNRLLSQDPFHEVKSKRDK
Sbjct  17   ISSIPAGSRKIVQSLKEIV-NCPESEIYAMLKECNMDPNEAVNRLLSQDPFHEVKSKRDK  75

Query  388  RKENKDTTE  414
            RKE+KDTT+
Sbjct  76   RKESKDTTD  84



>ref|XP_006467531.1| PREDICTED: uncharacterized protein LOC102630898 isoform X2 [Citrus 
sinensis]
Length=854

 Score =   125 bits (314),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 65/69 (94%), Gaps = 1/69 (1%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  387
            ++ IP+GSRKIV+SLKEIV N PESEIYA LKECNMDPNEAVNRLLSQDPFHEVKSKRDK
Sbjct  17   ISSIPAGSRKIVQSLKEIV-NCPESEIYAMLKECNMDPNEAVNRLLSQDPFHEVKSKRDK  75

Query  388  RKENKDTTE  414
            RKE+KDTT+
Sbjct  76   RKESKDTTD  84



>ref|XP_006449625.1| hypothetical protein CICLE_v10014224mg [Citrus clementina]
 gb|ESR62865.1| hypothetical protein CICLE_v10014224mg [Citrus clementina]
Length=878

 Score =   124 bits (312),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 88/119 (74%), Gaps = 8/119 (7%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  387
            ++ IP+GSRKIV+SLKEIV N PESEIYA LKECNMDPNEAVNRLLSQDPFHEVKSKRDK
Sbjct  17   ISSIPAGSRKIVQSLKEIV-NCPESEIYAMLKECNMDPNEAVNRLLSQDPFHEVKSKRDK  75

Query  388  RKENKDTTEsrprgasssrggkgsadrYAGRGGSESLHGKSTYAYXENGYTNTKSTRTA  564
            RKE KDTT+SR RGAS++           GRGG++    +S  AY  +  + T  ++ A
Sbjct  76   RKEIKDTTDSRSRGASNTSNR-------GGRGGTDRYGVRSGAAYFSSNESGTLQSKPA  127



>ref|XP_006449624.1| hypothetical protein CICLE_v10014224mg [Citrus clementina]
 gb|ESR62864.1| hypothetical protein CICLE_v10014224mg [Citrus clementina]
Length=863

 Score =   124 bits (311),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 88/119 (74%), Gaps = 8/119 (7%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  387
            ++ IP+GSRKIV+SLKEIV N PESEIYA LKECNMDPNEAVNRLLSQDPFHEVKSKRDK
Sbjct  17   ISSIPAGSRKIVQSLKEIV-NCPESEIYAMLKECNMDPNEAVNRLLSQDPFHEVKSKRDK  75

Query  388  RKENKDTTEsrprgasssrggkgsadrYAGRGGSESLHGKSTYAYXENGYTNTKSTRTA  564
            RKE KDTT+SR RGAS++           GRGG++    +S  AY  +  + T  ++ A
Sbjct  76   RKEIKDTTDSRSRGASNTSNR-------GGRGGTDRYGVRSGAAYFSSNESGTLQSKPA  127



>ref|XP_002519742.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42715.1| conserved hypothetical protein [Ricinus communis]
Length=849

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 83/168 (49%), Positives = 100/168 (60%), Gaps = 21/168 (13%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  387
            ++ IP+GSRK+V+SLKEIV N PE EIYA LK+CNMDPNEAVNRLLSQDPFHEVKSKR+K
Sbjct  16   ISGIPAGSRKMVQSLKEIV-NCPEPEIYAMLKDCNMDPNEAVNRLLSQDPFHEVKSKREK  74

Query  388  RKENKDTTEs-rprgasssrggkgsadrYAGRGGSESL--------HGKSTYAYXENGYT  540
            +KE KDTTE       +++           GRGGS           HGK  Y   ENG T
Sbjct  75   KKETKDTTEPRSRVANNATHRAGRVGADRYGRGGSSQFSSNDPGVSHGKPAYK-KENG-T  132

Query  541  N-----TKSTRTAGSTTNRWLPTISDAAGTENQKLV----DGVSAATQ  657
            N     + +   AG+  NR     SD    EN+ L     DGVS ++Q
Sbjct  133  NASAGSSSAPSMAGTNINRRPILNSDLVAAENKLLTVGASDGVSLSSQ  180



>emb|CBI30819.3| unnamed protein product [Vitis vinifera]
Length=799

 Score =   124 bits (310),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 84/169 (50%), Positives = 109/169 (64%), Gaps = 18/169 (11%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  387
            ++ IP+ SRK+V+SL+E+V N  E EIYA LKECNMDPN+AV+RLLS DPFHEVKSK+DK
Sbjct  22   ISTIPAASRKMVQSLREVV-NCSEQEIYAMLKECNMDPNDAVHRLLSLDPFHEVKSKKDK  80

Query  388  RKENKDTTEsrprgasssrg--gkgsadrYAGRGGSESL--------HGKSTYAYXENG-  534
            RKE+KDTTESR R  +S+     +G  DR+AGR  S           HGKS Y   ENG 
Sbjct  81   RKESKDTTESRSRSVNSTSTRGSRGGTDRFAGRSSSNQFSSTDSGTSHGKSAYK-KENGT  139

Query  535  --YTNTKSTRTAGSTTNRWLPTISDAAGTENQKLV---DGVSAATQHSS  666
              YT   +   AG++ N   PT S+   TE    +   DG+++++Q SS
Sbjct  140  NAYTTYPAVGVAGNSMNWRPPTTSETVATEKILTIGTSDGITSSSQPSS  188



>ref|XP_007025176.1| Uncharacterized protein TCM_029557 [Theobroma cacao]
 gb|EOY27798.1| Uncharacterized protein TCM_029557 [Theobroma cacao]
Length=872

 Score =   124 bits (310),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 87/173 (50%), Positives = 112/173 (65%), Gaps = 25/173 (14%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  387
            ++ IP+GSRK+V SLKEIV N PE EIY  LKECNMDPNEAVNRLLSQDPFHEVKSKRDK
Sbjct  23   ISGIPAGSRKMVLSLKEIV-NCPEPEIYVMLKECNMDPNEAVNRLLSQDPFHEVKSKRDK  81

Query  388  RKENKDTTEsrprgasssrgg--kgsadrYAGRGGSESL--------HGKS-------TY  516
            +KE+KDT +SR RGA++      +   DRY GRGGS           HGK+       T+
Sbjct  82   KKESKDTVDSRSRGANNLGNRGGRSGPDRYIGRGGSTHYSAYESGPSHGKAAQKRENGTH  141

Query  517  AYXENGYTNTKSTRTAGSTTNRWLPTISDAAGTENQK----LVDGVSAATQHS  663
            AY     +++ ++   G+  NR  P+ S+A  TE++     L DG+S ++Q S
Sbjct  142  AYAG---SSSSASGMPGNNLNRRPPSHSEAVATEHKMSTVGLGDGISLSSQSS  191



>ref|XP_010655630.1| PREDICTED: protein lingerer-like [Vitis vinifera]
Length=886

 Score =   124 bits (310),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 83/169 (49%), Positives = 107/169 (63%), Gaps = 18/169 (11%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  387
            ++ IP+ SRK+V+SL+E+V N  E EIYA LKECNMDPN+AV+RLLS DPFHEVKSK+DK
Sbjct  37   ISTIPAASRKMVQSLREVV-NCSEQEIYAMLKECNMDPNDAVHRLLSLDPFHEVKSKKDK  95

Query  388  RKENKDTTEsrprgasssrggkgs--adrYAGRGGSESL--------HGKSTYAYXENG-  534
            RKE+KDTTESR R  +S+         DR+AGR  S           HGKS Y   ENG 
Sbjct  96   RKESKDTTESRSRSVNSTSTRGSRGGTDRFAGRSSSNQFSSTDSGTSHGKSAYK-KENGT  154

Query  535  --YTNTKSTRTAGSTTNRWLPTISDAAGTENQKLV---DGVSAATQHSS  666
              YT   +   AG++ N   PT S+   TE    +   DG+++++Q SS
Sbjct  155  NAYTTYPAVGVAGNSMNWRPPTTSETVATEKILTIGTSDGITSSSQPSS  203



>ref|XP_011045308.1| PREDICTED: uncharacterized protein LOC105140253 isoform X1 [Populus 
euphratica]
Length=872

 Score =   123 bits (308),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 85/174 (49%), Positives = 104/174 (60%), Gaps = 25/174 (14%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  387
            ++ IP+ SRK+V+SLKEIV N PE EIYA LKECNMDPNEAVNRLLSQDPFHEVKSKR+K
Sbjct  21   ISGIPAASRKMVQSLKEIV-NCPEPEIYAMLKECNMDPNEAVNRLLSQDPFHEVKSKREK  79

Query  388  RKENKDTTEs-rprgasssrggkgsadrYAGRGG-----------SESLHGKSTYAYXEN  531
            +KENKD+T+S      + S  G        GRGG           S + H K TY   EN
Sbjct  80   KKENKDSTDSRSHGAGNISNRGGRGGADRYGRGGPGRSAYFNSNESSTFHSKPTYK-KEN  138

Query  532  GYTNT------KSTRTAGSTTNRWLPTISDAAGTENQKLV----DGVSAATQHS  663
            G TN        ++  AG+  N   P+ SD+   EN+       DGVS++ Q S
Sbjct  139  G-TNAYVDPVPSASDIAGNNINWQPPSHSDSVAKENKMSAIGAGDGVSSSAQPS  191



>ref|XP_011045309.1| PREDICTED: uncharacterized protein LOC105140253 isoform X2 [Populus 
euphratica]
Length=871

 Score =   123 bits (308),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 85/174 (49%), Positives = 104/174 (60%), Gaps = 25/174 (14%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  387
            ++ IP+ SRK+V+SLKEIV N PE EIYA LKECNMDPNEAVNRLLSQDPFHEVKSKR+K
Sbjct  21   ISGIPAASRKMVQSLKEIV-NCPEPEIYAMLKECNMDPNEAVNRLLSQDPFHEVKSKREK  79

Query  388  RKENKDTTEs-rprgasssrggkgsadrYAGRGG-----------SESLHGKSTYAYXEN  531
            +KENKD+T+S      + S  G        GRGG           S + H K TY   EN
Sbjct  80   KKENKDSTDSRSHGAGNISNRGGRGGADRYGRGGPGRSAYFNSNESSTFHSKPTYK-KEN  138

Query  532  GYTNT------KSTRTAGSTTNRWLPTISDAAGTENQKLV----DGVSAATQHS  663
            G TN        ++  AG+  N   P+ SD+   EN+       DGVS++ Q S
Sbjct  139  G-TNAYVDPVPSASDIAGNNINWQPPSHSDSVAKENKMSAIGAGDGVSSSAQPS  191



>ref|XP_006369885.1| hypothetical protein POPTR_0001s34440g [Populus trichocarpa]
 gb|ERP66454.1| hypothetical protein POPTR_0001s34440g [Populus trichocarpa]
Length=867

 Score =   123 bits (308),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 82/171 (48%), Positives = 103/171 (60%), Gaps = 23/171 (13%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  387
            ++ IP+ SRK+V+SLKEIV + PE EIYA LKECNMDPNEAVNRLLSQDPFHEVKSKR+K
Sbjct  18   ISGIPAASRKMVQSLKEIV-SCPEPEIYAMLKECNMDPNEAVNRLLSQDPFHEVKSKREK  76

Query  388  RKENKDTTEs-rprgasssrggkgsadrYAGRGG-----------SESLHGKSTYAYXEN  531
            +KENKD+T+S      + S  G        GRGG           S +LHGK +Y   EN
Sbjct  77   KKENKDSTDSRSRGANNMSNRGGRGGADRNGRGGPGRPAYFSSNDSSTLHGKPSYK-KEN  135

Query  532  GY-----TNTKSTRTAGSTTNRWLPTISDAAGTENQKLV----DGVSAATQ  657
            G       +  ++  AG+  N   P  SD+   EN+       DGVS++ Q
Sbjct  136  GANAYAGPSPSASSMAGNNINWQPPYHSDSVAIENKMTTVGAGDGVSSSAQ  186



>ref|XP_004504230.1| PREDICTED: serine/threonine-protein kinase pakD-like [Cicer arietinum]
Length=861

 Score =   122 bits (307),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 80/173 (46%), Positives = 102/173 (59%), Gaps = 30/173 (17%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IP+ SRK+V+SLKEIV N P++EIYA LK+CNMDPNEAV+RLLSQDPFHEVKSKR+K+KE
Sbjct  16   IPAASRKMVQSLKEIVNNIPDNEIYATLKDCNMDPNEAVSRLLSQDPFHEVKSKREKKKE  75

Query  397  NKDTTEsrprgasssrgg-----kgsadrYAGRGGSESLH-GKSTYAYX--------ENG  534
             KD TE R RG + +        +   DRY GRGG+ S     S Y +         ENG
Sbjct  76   GKDITEPRSRGTNYNTSSRVGGGRTGTDRYVGRGGASSTQFSNSDYGFPQVKPVYKKENG  135

Query  535  YTNTKSTRTAGSTT-----------NRWLPTISDAAGTENQKLVDGVSAATQH  660
                      G +T           NR LP+ SD+ G     + DG+S+++ H
Sbjct  136  TPAYGGPAPYGGSTSYASSVMENNVNRQLPSYSDSVG-----VSDGLSSSSHH  183



>ref|XP_007159534.1| hypothetical protein PHAVU_002G245500g [Phaseolus vulgaris]
 gb|ESW31528.1| hypothetical protein PHAVU_002G245500g [Phaseolus vulgaris]
Length=847

 Score =   122 bits (306),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 90/168 (54%), Positives = 108/168 (64%), Gaps = 27/168 (16%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IP  SRK+V+SLKEIV N PE EIYA LK+CNMDPNEAV+RLLSQDPFHEVKSKR+K+KE
Sbjct  13   IPPASRKMVQSLKEIVSNIPEHEIYATLKDCNMDPNEAVSRLLSQDPFHEVKSKREKKKE  72

Query  397  NKDTTEsrprgasssrg------gkgsadrYAGRGGSES---------LHGKSTYAYXEN  531
             KDTT+SRPRG S++         + SADRY GRGG+           L GK      EN
Sbjct  73   TKDTTDSRPRGLSNTSSRGSGGGARVSADRYVGRGGATQFSSSGDSGLLQGKPVLK-KEN  131

Query  532  GY-TNTKSTRTAGST----TNRWLPTISDAAGTENQKLVDGVSAATQH  660
            G  T   ST +A S      NR LP+ SD+ G     + DG+S ++QH
Sbjct  132  GTPTYGGSTFSAHSALDNNANRQLPSYSDSVG-----VCDGLS-SSQH  173



>emb|CDP17325.1| unnamed protein product [Coffea canephora]
Length=877

 Score =   122 bits (306),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 98/132 (74%), Gaps = 12/132 (9%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IPSGSRKIV+SLKEIV N PE+EIYA LKECNMDPNEAVN+LLSQDPFHEVKSKR+K+KE
Sbjct  39   IPSGSRKIVQSLKEIV-NCPEAEIYAMLKECNMDPNEAVNKLLSQDPFHEVKSKREKKKE  97

Query  397  NKDTTEs-rprgasssrggkgsadrYAGRGGSE----SLHGKSTYAYXENG---YTNTKS  552
             KDT+ES     +S+S  G+   DRY  RGGS     +LHG+  +   ENG   Y ++ S
Sbjct  98   GKDTSESRPRGTSSTSNRGRIGTDRYPSRGGSSAESGALHGRPAHK-KENGPNAYASSLS  156

Query  553  TRT--AGSTTNR  582
            + +  AG++T+R
Sbjct  157  STSAVAGNSTSR  168



>gb|KHF99174.1| hypothetical protein F383_17166 [Gossypium arboreum]
Length=869

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 85/165 (52%), Positives = 106/165 (64%), Gaps = 19/165 (12%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IP GSRK+V+SLKEIV N PE EIYA LK+CNMDPNEAVNRLLSQDPFHEVKSKRDK+KE
Sbjct  24   IPPGSRKMVQSLKEIV-NCPEPEIYAMLKDCNMDPNEAVNRLLSQDPFHEVKSKRDKKKE  82

Query  397  NKDTTEsrp--rgasssrggkgsadrYAGRGGSESL--------HGKSTYAYXENGYTNT  546
            +KD+ E+R        SRGG+  +DRYAGRGGS           HGK        G+   
Sbjct  83   SKDSVEARSRGANNLGSRGGRSGSDRYAGRGGSSHYSSNESGPSHGKPAQKRENGGHPVA  142

Query  547  KSTRTA----GSTTNRWLPTISDAAGTENQ----KLVDGVSAATQ  657
              + +A    G+  NR   + S+ A +E++     L DGVS+++Q
Sbjct  143  GFSSSASGMRGNNMNRGPQSHSEVAVSEHKISTVGLGDGVSSSSQ  187



>gb|KHF99173.1| hypothetical protein F383_17166 [Gossypium arboreum]
Length=891

 Score =   121 bits (303),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 85/165 (52%), Positives = 106/165 (64%), Gaps = 19/165 (12%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IP GSRK+V+SLKEIV N PE EIYA LK+CNMDPNEAVNRLLSQDPFHEVKSKRDK+KE
Sbjct  24   IPPGSRKMVQSLKEIV-NCPEPEIYAMLKDCNMDPNEAVNRLLSQDPFHEVKSKRDKKKE  82

Query  397  NKDTTEsrp--rgasssrggkgsadrYAGRGGSESL--------HGKSTYAYXENGYTNT  546
            +KD+ E+R        SRGG+  +DRYAGRGGS           HGK        G+   
Sbjct  83   SKDSVEARSRGANNLGSRGGRSGSDRYAGRGGSSHYSSNESGPSHGKPAQKRENGGHPVA  142

Query  547  KSTRTA----GSTTNRWLPTISDAAGTENQ----KLVDGVSAATQ  657
              + +A    G+  NR   + S+ A +E++     L DGVS+++Q
Sbjct  143  GFSSSASGMRGNNMNRGPQSHSEVAVSEHKISTVGLGDGVSSSSQ  187



>ref|XP_011045310.1| PREDICTED: uncharacterized protein LOC105140253 isoform X3 [Populus 
euphratica]
Length=841

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 77/156 (49%), Positives = 97/156 (62%), Gaps = 20/156 (13%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  387
            ++ IP+ SRK+V+SLKEIV N PE EIYA LKECNMDPNEAVNRLLSQDPFHEVKSKR+K
Sbjct  21   ISGIPAASRKMVQSLKEIV-NCPEPEIYAMLKECNMDPNEAVNRLLSQDPFHEVKSKREK  79

Query  388  RKENKDTTEsrprgasssrggkgsadrYAGRGGSESLHGKSTYAYXENGYTNTKSTRTAG  567
            +KENKD+T+SR  GA +            GRGG++         Y   G   +    + G
Sbjct  80   KKENKDSTDSRSHGAGNISNR-------GGRGGADR--------YGRGGPGRSAYFNSNG  124

Query  568  STTNRWLPTISDAAGTENQKLV----DGVSAATQHS  663
            +  N   P+ SD+   EN+       DGVS++ Q S
Sbjct  125  NNINWQPPSHSDSVAKENKMSAIGAGDGVSSSAQPS  160



>gb|KJB69764.1| hypothetical protein B456_011G041100 [Gossypium raimondii]
Length=575

 Score =   117 bits (293),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 81/165 (49%), Positives = 107/165 (65%), Gaps = 19/165 (12%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IP GSRK+V+SLKEIV N PE EIYA LK+CNMDPNEAVNRLLSQDPFHEVKSKRDK+KE
Sbjct  24   IPPGSRKMVQSLKEIV-NCPEPEIYAMLKDCNMDPNEAVNRLLSQDPFHEVKSKRDKKKE  82

Query  397  NKDTTEsrprgasssrgg--kgsadrYAGRGGSESL--------HGKSTYAYXENGYT--  540
            +KD+ ++R RGA++      +  +DRY GRGGS           HGK        G+   
Sbjct  83   SKDSVDARSRGANNLGSRGGRSGSDRYTGRGGSSHYSSNESGPSHGKPAQKRENGGHPVA  142

Query  541  --NTKSTRTAGSTTNRWLPTISDAAGTENQ----KLVDGVSAATQ  657
              ++ ++   G+  NR   + S+ A +E++     L DGVS+++Q
Sbjct  143  GSSSSASGMQGNNMNRRPQSHSEVAVSEHKISTVGLGDGVSSSSQ  187



>ref|XP_004486425.1| PREDICTED: serine-rich adhesin for platelets-like [Cicer arietinum]
Length=831

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/69 (74%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  387
            V  IP  S+KIV+SLKEI+ N+PE EIYA L++CNMDPNE VNRLLSQDPFHEVKSKR+K
Sbjct  13   VTTIPPSSKKIVQSLKEILTNFPEHEIYAMLRDCNMDPNETVNRLLSQDPFHEVKSKREK  72

Query  388  RKENKDTTE  414
            +KENKD T+
Sbjct  73   KKENKDPTD  81



>gb|KJB69767.1| hypothetical protein B456_011G041100 [Gossypium raimondii]
Length=641

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 81/165 (49%), Positives = 107/165 (65%), Gaps = 19/165 (12%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IP GSRK+V+SLKEIV N PE EIYA LK+CNMDPNEAVNRLLSQDPFHEVKSKRDK+KE
Sbjct  24   IPPGSRKMVQSLKEIV-NCPEPEIYAMLKDCNMDPNEAVNRLLSQDPFHEVKSKRDKKKE  82

Query  397  NKDTTEsrprgasssrgg--kgsadrYAGRGGSESL--------HGKSTYAYXENGYT--  540
            +KD+ ++R RGA++      +  +DRY GRGGS           HGK        G+   
Sbjct  83   SKDSVDARSRGANNLGSRGGRSGSDRYTGRGGSSHYSSNESGPSHGKPAQKRENGGHPVA  142

Query  541  --NTKSTRTAGSTTNRWLPTISDAAGTENQ----KLVDGVSAATQ  657
              ++ ++   G+  NR   + S+ A +E++     L DGVS+++Q
Sbjct  143  GSSSSASGMQGNNMNRRPQSHSEVAVSEHKISTVGLGDGVSSSSQ  187



>gb|AFK38455.1| unknown [Medicago truncatula]
Length=443

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IP+ SRK+V+SLKEIV N P++EIYA LK+CNMDPNEAV+RLLSQDPFHEVKSKR+K+KE
Sbjct  18   IPATSRKMVQSLKEIVSNIPDNEIYATLKDCNMDPNEAVSRLLSQDPFHEVKSKREKKKE  77

Query  397  NKDTTE  414
             KDTTE
Sbjct  78   GKDTTE  83



>ref|XP_006377248.1| hypothetical protein POPTR_0011s02850g [Populus trichocarpa]
 gb|ERP55045.1| hypothetical protein POPTR_0011s02850g [Populus trichocarpa]
Length=894

 Score =   117 bits (293),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 63/69 (91%), Gaps = 1/69 (1%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  387
            ++ IP+ SRK+V+SLKEIV N PE EIYA LKECNMDPNEAVNRLLSQDPFHEVKSKR+K
Sbjct  24   ISGIPAASRKMVQSLKEIV-NCPEPEIYAMLKECNMDPNEAVNRLLSQDPFHEVKSKREK  82

Query  388  RKENKDTTE  414
            +KENKD+T+
Sbjct  83   KKENKDSTD  91



>ref|XP_002317304.2| kinase-related family protein [Populus trichocarpa]
 gb|EEE97916.2| kinase-related family protein [Populus trichocarpa]
Length=909

 Score =   117 bits (293),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 63/69 (91%), Gaps = 1/69 (1%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  387
            ++ IP+ SRK+V+SLKEIV N PE EIYA LKECNMDPNEAVNRLLSQDPFHEVKSKR+K
Sbjct  24   ISGIPAASRKMVQSLKEIV-NCPEPEIYAMLKECNMDPNEAVNRLLSQDPFHEVKSKREK  82

Query  388  RKENKDTTE  414
            +KENKD+T+
Sbjct  83   KKENKDSTD  91



>ref|XP_003534759.1| PREDICTED: cell wall protein AWA1-like isoform X1 [Glycine max]
Length=838

 Score =   117 bits (293),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +1

Query  211  AMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKR  390
            A IP+ SRK+V+SLKEIV N+P+ EIYA LK+CNMDPNEAV+RLLSQDPFHEVKSKR+K+
Sbjct  12   ATIPASSRKMVQSLKEIVSNFPDHEIYATLKDCNMDPNEAVSRLLSQDPFHEVKSKREKK  71

Query  391  KENKDTTE  414
            KE KD TE
Sbjct  72   KEIKDPTE  79



>ref|XP_006586817.1| PREDICTED: cell wall protein AWA1-like isoform X2 [Glycine max]
Length=837

 Score =   117 bits (293),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +1

Query  211  AMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKR  390
            A IP+ SRK+V+SLKEIV N+P+ EIYA LK+CNMDPNEAV+RLLSQDPFHEVKSKR+K+
Sbjct  12   ATIPASSRKMVQSLKEIVSNFPDHEIYATLKDCNMDPNEAVSRLLSQDPFHEVKSKREKK  71

Query  391  KENKDTTE  414
            KE KD TE
Sbjct  72   KEIKDPTE  79



>ref|XP_003629905.1| hypothetical protein MTR_8g088190 [Medicago truncatula]
 gb|AET04381.1| plant/F15D2-27 protein [Medicago truncatula]
Length=865

 Score =   117 bits (293),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IP+ SRK+V+SLKEIV N P++EIYA LK+CNMDPNEAV+RLLSQDPFHEVKSKR+K+KE
Sbjct  18   IPAASRKMVQSLKEIVSNIPDNEIYATLKDCNMDPNEAVSRLLSQDPFHEVKSKREKKKE  77

Query  397  NKDTTE  414
             KDTTE
Sbjct  78   GKDTTE  83



>ref|XP_011005845.1| PREDICTED: uncharacterized protein LOC105112008 isoform X1 [Populus 
euphratica]
Length=875

 Score =   117 bits (293),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 84/179 (47%), Positives = 104/179 (58%), Gaps = 29/179 (16%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQ------DPFHEV  369
            ++ IP+ SRK+V+SLKEIV N PE EIYA LKECNMDPNEAVNRLLSQ       PFHEV
Sbjct  19   ISGIPAASRKMVQSLKEIV-NCPEPEIYAMLKECNMDPNEAVNRLLSQGFFPRNHPFHEV  77

Query  370  KSKRDKRKENKDTTEs-rprgasssrggkgsadrYAGRGG-----------SESLHGKST  513
            KSKR+K+KENKD T+S      + S  G        GRGG           S +LHGK +
Sbjct  78   KSKREKKKENKDPTDSRSRGANNMSNRGGRGGADRNGRGGPGRPAYFSSNESSTLHGKPS  137

Query  514  YAYXENGY-----TNTKSTRTAGSTTNRWLPTISDAAGTENQKLV----DGVSAATQHS  663
            Y   ENG       +  ++ T G+  N   P  SD+  TEN+       DGVS+++Q S
Sbjct  138  YK-KENGANAYAGPSPSASGTVGNNINWQPPYHSDSVATENKMSTVGAGDGVSSSSQPS  195



>ref|XP_011005846.1| PREDICTED: uncharacterized protein LOC105112008 isoform X2 [Populus 
euphratica]
Length=874

 Score =   117 bits (292),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 84/179 (47%), Positives = 104/179 (58%), Gaps = 29/179 (16%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQ------DPFHEV  369
            ++ IP+ SRK+V+SLKEIV N PE EIYA LKECNMDPNEAVNRLLSQ       PFHEV
Sbjct  19   ISGIPAASRKMVQSLKEIV-NCPEPEIYAMLKECNMDPNEAVNRLLSQGFFPRNHPFHEV  77

Query  370  KSKRDKRKENKDTTEs-rprgasssrggkgsadrYAGRGG-----------SESLHGKST  513
            KSKR+K+KENKD T+S      + S  G        GRGG           S +LHGK +
Sbjct  78   KSKREKKKENKDPTDSRSRGANNMSNRGGRGGADRNGRGGPGRPAYFSSNESSTLHGKPS  137

Query  514  YAYXENGY-----TNTKSTRTAGSTTNRWLPTISDAAGTENQKLV----DGVSAATQHS  663
            Y   ENG       +  ++ T G+  N   P  SD+  TEN+       DGVS+++Q S
Sbjct  138  YK-KENGANAYAGPSPSASGTVGNNINWQPPYHSDSVATENKMSTVGAGDGVSSSSQPS  195



>gb|KJB69766.1| hypothetical protein B456_011G041100 [Gossypium raimondii]
Length=707

 Score =   116 bits (291),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 81/165 (49%), Positives = 107/165 (65%), Gaps = 19/165 (12%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IP GSRK+V+SLKEIV N PE EIYA LK+CNMDPNEAVNRLLSQDPFHEVKSKRDK+KE
Sbjct  24   IPPGSRKMVQSLKEIV-NCPEPEIYAMLKDCNMDPNEAVNRLLSQDPFHEVKSKRDKKKE  82

Query  397  NKDTTEsrprgasssrgg--kgsadrYAGRGGSESL--------HGKSTYAYXENGYT--  540
            +KD+ ++R RGA++      +  +DRY GRGGS           HGK        G+   
Sbjct  83   SKDSVDARSRGANNLGSRGGRSGSDRYTGRGGSSHYSSNESGPSHGKPAQKRENGGHPVA  142

Query  541  --NTKSTRTAGSTTNRWLPTISDAAGTENQ----KLVDGVSAATQ  657
              ++ ++   G+  NR   + S+ A +E++     L DGVS+++Q
Sbjct  143  GSSSSASGMQGNNMNRRPQSHSEVAVSEHKISTVGLGDGVSSSSQ  187



>ref|XP_010243690.1| PREDICTED: uncharacterized protein LOC104587685 isoform X2 [Nelumbo 
nucifera]
Length=855

 Score =   117 bits (292),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 103/158 (65%), Gaps = 17/158 (11%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  387
            V  IP+ SRKIV+SLKEIV NYPE EIYA LKECNMDPN+ ++RLLSQDPFHEVKS+R+K
Sbjct  18   VPSIPAASRKIVQSLKEIV-NYPEHEIYAMLKECNMDPNDTIHRLLSQDPFHEVKSRREK  76

Query  388  RKENKDTTEsrprgasssrggkgsadrYAGRGGSESLHGKSTYAYXE--NGYTNTKSTR-  558
            +KE+K+TTESR RG  S+          + RG   SL GK  Y      N + ++ S   
Sbjct  77   KKESKETTESRSRGLGST----------SNRGEPGSLRGKPAYKKENEANAFPSSSSASG  126

Query  559  TAGSTTNR---WLPTISDAAGTENQKLVDGVSAATQHS  663
             AG++T+R    L ++S  +  ++    DG+S+A Q S
Sbjct  127  MAGNSTSRRPTSLSSVSAESKIQSTSTCDGISSALQPS  164



>ref|XP_011085623.1| PREDICTED: uncharacterized protein LOC105167549 [Sesamum indicum]
Length=848

 Score =   117 bits (292),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 84/170 (49%), Positives = 108/170 (64%), Gaps = 19/170 (11%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  387
            V  IP+GS K+V+SLKEIV N  E+EIYA LKECNMDPNEAVNRLLSQDPF EVKSKR+K
Sbjct  25   VQPIPAGSWKVVQSLKEIV-NCSEAEIYATLKECNMDPNEAVNRLLSQDPFREVKSKREK  83

Query  388  RKENKDTTEsrprgasssrg--------gkgsadrYAGRGGSES-LHGKSTYAYXENGYT  540
            +KE KD ++SR RGA++S           + S   ++    SES LHGKS Y   ENG T
Sbjct  84   KKEGKDNSDSRSRGANNSSNRGGKSGADRRPSRSTFSPYSSSESPLHGKSAYK-KENGST  142

Query  541  NTKSTRTA----GSTTNRWLPTISDAAGTENQKLV----DGVSAATQHSS  666
            +  S  +A    G+  +R  P +SD A  E++  +    DG+ +  Q +S
Sbjct  143  HASSLSSAPGMTGNNRSRGPPGLSDGASAESKGFLLETSDGMPSVVQPAS  192



>gb|KHN48057.1| hypothetical protein glysoja_015527 [Glycine soja]
Length=817

 Score =   116 bits (291),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 77/153 (50%), Positives = 101/153 (66%), Gaps = 21/153 (14%)
 Frame = +1

Query  238  IVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKENKDTTEs  417
            +V+SL+EIV N PE EIYA LK+CNMDPNEAV+RLLSQDPFHEVKSKR+K+KE KDTT++
Sbjct  1    MVQSLREIVSNIPEHEIYATLKDCNMDPNEAVSRLLSQDPFHEVKSKREKKKEGKDTTDT  60

Query  418  rprgasssrg-----gkgsadrYAGRGGSESLHGKSTY-------AYXENGYTNTKSTRT  561
            R RG S++        +  +DRY GRG S  L GK  +       AY   GYT   S+ +
Sbjct  61   RSRGISNASSRGGGGARVGSDRYVGRGDSGLLQGKPVFKKENGTPAY--GGYTAPASS-S  117

Query  562  AGSTTNRWLPTISDAAGTENQKLVDGVSAATQH  660
              +  NR LP+ SD+      ++ DG+S ++QH
Sbjct  118  LDNNVNRQLPSYSDSV-----RVCDGLS-SSQH  144



>gb|KJB69765.1| hypothetical protein B456_011G041100 [Gossypium raimondii]
Length=867

 Score =   116 bits (291),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 81/165 (49%), Positives = 107/165 (65%), Gaps = 19/165 (12%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IP GSRK+V+SLKEIV N PE EIYA LK+CNMDPNEAVNRLLSQDPFHEVKSKRDK+KE
Sbjct  24   IPPGSRKMVQSLKEIV-NCPEPEIYAMLKDCNMDPNEAVNRLLSQDPFHEVKSKRDKKKE  82

Query  397  NKDTTEsrprgasssrgg--kgsadrYAGRGGSESL--------HGKSTYAYXENGYT--  540
            +KD+ ++R RGA++      +  +DRY GRGGS           HGK        G+   
Sbjct  83   SKDSVDARSRGANNLGSRGGRSGSDRYTGRGGSSHYSSNESGPSHGKPAQKRENGGHPVA  142

Query  541  --NTKSTRTAGSTTNRWLPTISDAAGTENQ----KLVDGVSAATQ  657
              ++ ++   G+  NR   + S+ A +E++     L DGVS+++Q
Sbjct  143  GSSSSASGMQGNNMNRRPQSHSEVAVSEHKISTVGLGDGVSSSSQ  187



>gb|KJB69763.1| hypothetical protein B456_011G041100 [Gossypium raimondii]
Length=869

 Score =   116 bits (291),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 81/165 (49%), Positives = 107/165 (65%), Gaps = 19/165 (12%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IP GSRK+V+SLKEIV N PE EIYA LK+CNMDPNEAVNRLLSQDPFHEVKSKRDK+KE
Sbjct  24   IPPGSRKMVQSLKEIV-NCPEPEIYAMLKDCNMDPNEAVNRLLSQDPFHEVKSKRDKKKE  82

Query  397  NKDTTEsrprgasssrgg--kgsadrYAGRGGSESL--------HGKSTYAYXENGYT--  540
            +KD+ ++R RGA++      +  +DRY GRGGS           HGK        G+   
Sbjct  83   SKDSVDARSRGANNLGSRGGRSGSDRYTGRGGSSHYSSNESGPSHGKPAQKRENGGHPVA  142

Query  541  --NTKSTRTAGSTTNRWLPTISDAAGTENQ----KLVDGVSAATQ  657
              ++ ++   G+  NR   + S+ A +E++     L DGVS+++Q
Sbjct  143  GSSSSASGMQGNNMNRRPQSHSEVAVSEHKISTVGLGDGVSSSSQ  187



>gb|KHN22963.1| hypothetical protein glysoja_030633 [Glycine soja]
Length=980

 Score =   116 bits (290),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +1

Query  211  AMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKR  390
            A IP+ SRK+V+SLKEIV N+P+ EIYA LK+CNMDPNEAV+RLLSQDPFHEVKSKR+K+
Sbjct  12   ATIPASSRKMVQSLKEIVSNFPDHEIYATLKDCNMDPNEAVSRLLSQDPFHEVKSKREKK  71

Query  391  KENKDTTE  414
            KE KD TE
Sbjct  72   KEIKDPTE  79



>ref|XP_006580202.1| PREDICTED: uncharacterized serine-rich protein C215.13-like [Glycine 
max]
Length=845

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 80/165 (48%), Positives = 101/165 (61%), Gaps = 28/165 (17%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IP  SRK+V+SLKEIV N PE EIYA LK+CNMDPNEAV+RLLSQD FHEVKSKR+K+KE
Sbjct  13   IPPASRKMVQSLKEIVSNIPEHEIYATLKDCNMDPNEAVSRLLSQDTFHEVKSKREKKKE  72

Query  397  NKDTTEsrprgasssrg----gkgsadrYAGRGGSES---------LHGKS-------TY  516
             KDTT+SR R  S++       + SADRY GRGG+           L GK        T 
Sbjct  73   GKDTTDSRSRVVSNTSSRGGGARVSADRYVGRGGATQFSSGGDSGLLQGKPVLKKENGTP  132

Query  517  AYXENGYTNTKSTRTAGSTTNRWLPTISDAAGTENQKLVDGVSAA  651
            AY   G     ++    +  NR LP+ SD+      ++ DG+S++
Sbjct  133  AY---GGLTAPASSALDNNVNRQLPSYSDSV-----RVCDGLSSS  169



>ref|XP_010243689.1| PREDICTED: uncharacterized protein LOC104587685 isoform X1 [Nelumbo 
nucifera]
Length=875

 Score =   115 bits (288),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 62/69 (90%), Gaps = 1/69 (1%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  387
            V  IP+ SRKIV+SLKEIV NYPE EIYA LKECNMDPN+ ++RLLSQDPFHEVKS+R+K
Sbjct  18   VPSIPAASRKIVQSLKEIV-NYPEHEIYAMLKECNMDPNDTIHRLLSQDPFHEVKSRREK  76

Query  388  RKENKDTTE  414
            +KE+K+TTE
Sbjct  77   KKESKETTE  85



>gb|EYU28172.1| hypothetical protein MIMGU_mgv1a001362mg [Erythranthe guttata]
Length=833

 Score =   114 bits (284),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 62/69 (90%), Gaps = 1/69 (1%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  387
            V +IP+GSRK+V+SLKEIV    E+EIYAALK+CNMDPNEAVNRLL QDPFHEVKSKR+K
Sbjct  15   VQLIPAGSRKMVQSLKEIV-GCSEAEIYAALKDCNMDPNEAVNRLLCQDPFHEVKSKREK  73

Query  388  RKENKDTTE  414
            +KE KDTTE
Sbjct  74   KKEGKDTTE  82



>ref|XP_007147529.1| hypothetical protein PHAVU_006G132200g [Phaseolus vulgaris]
 gb|ESW19523.1| hypothetical protein PHAVU_006G132200g [Phaseolus vulgaris]
Length=843

 Score =   114 bits (284),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = +1

Query  211  AMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKR  390
            A IP+ SRK+V+SLKEIV N+P+ EIYA LK+CNMDPNEAV+RLLSQDPFHEVKSKR+K+
Sbjct  19   ATIPASSRKMVQSLKEIVSNFPDHEIYATLKDCNMDPNEAVSRLLSQDPFHEVKSKREKK  78

Query  391  KENKDTTE  414
            KE KD  +
Sbjct  79   KEIKDPID  86



>ref|XP_010540528.1| PREDICTED: uncharacterized protein LOC104814266 [Tarenaya hassleriana]
Length=832

 Score =   111 bits (277),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 85/161 (53%), Positives = 105/161 (65%), Gaps = 19/161 (12%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  387
            ++ IPSGSRK+V+SLKEIV N PE+EIYA LKECNMDPNEAVNRLLSQDPFHEVKSK+DK
Sbjct  21   ISDIPSGSRKMVQSLKEIV-NCPEAEIYAMLKECNMDPNEAVNRLLSQDPFHEVKSKKDK  79

Query  388  RKENKDTTEsrp--rgasssrggkgsadrYAGRGG--------SESLHGKSTYAYXEN--  531
            +KENKDTT+ +      + +RG +  +DRYAGRGG        S +  GKST    +   
Sbjct  80   KKENKDTTDYKSRGANNTYNRGARSGSDRYAGRGGATNFSSYESGNFQGKSTSKREDGTE  139

Query  532  GYTNTKSTRTAGSTTNRWLPTISDAAGTENQ----KLVDGV  642
            GY  T  T  A     R+ P+ SD    EN+     + DG+
Sbjct  140  GYVGT--TSAASGVMGRYQPSHSDFVAMENKMSSVHVADGI  178



>ref|XP_010275810.1| PREDICTED: uncharacterized protein LOC104610735 isoform X2 [Nelumbo 
nucifera]
Length=889

 Score =   110 bits (276),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 59/69 (86%), Gaps = 1/69 (1%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  387
            V  IP+ SRK+V+SLKEIV NYPE EIYA LKECNMDPN+ V+RLLSQDPFHEVKSKR+K
Sbjct  17   VPSIPAASRKMVQSLKEIV-NYPEHEIYAMLKECNMDPNDTVHRLLSQDPFHEVKSKREK  75

Query  388  RKENKDTTE  414
            +KE K T E
Sbjct  76   KKEIKVTAE  84



>ref|XP_010275801.1| PREDICTED: uncharacterized protein LOC104610735 isoform X1 [Nelumbo 
nucifera]
Length=907

 Score =   110 bits (276),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 59/69 (86%), Gaps = 1/69 (1%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  387
            V  IP+ SRK+V+SLKEIV NYPE EIYA LKECNMDPN+ V+RLLSQDPFHEVKSKR+K
Sbjct  17   VPSIPAASRKMVQSLKEIV-NYPEHEIYAMLKECNMDPNDTVHRLLSQDPFHEVKSKREK  75

Query  388  RKENKDTTE  414
            +KE K T E
Sbjct  76   KKEIKVTAE  84



>ref|XP_010549430.1| PREDICTED: uncharacterized protein LOC104820614 [Tarenaya hassleriana]
Length=826

 Score =   110 bits (275),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 107/162 (66%), Gaps = 21/162 (13%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  387
            V+ IPSGSRK+V+SLKEIV N+PE+EIYA LKECNMDPNEA+NRLLSQDPFHEVKSK+DK
Sbjct  21   VSNIPSGSRKMVQSLKEIV-NFPEAEIYAMLKECNMDPNEAINRLLSQDPFHEVKSKKDK  79

Query  388  RKENKDTTEsrprgasssrggkgs--adrYAGRGG--------SESLHGKSTYAYXEN--  531
            +KENKDTT+SR RGA+++        +DRYAGRGG        S +  GKST    EN  
Sbjct  80   KKENKDTTDSRARGANNTYNRGVRGGSDRYAGRGGATHFSSNESRNFQGKSTNK-KENVT  138

Query  532  -GYTNTKSTRTAGSTTNRWLPTISDAAGTENQ----KLVDGV  642
             GY     T +A     R  P  SD    EN+     L DG+
Sbjct  139  QGY--AWPTSSASGVEGRHQPLHSDFVAMENKMLSVSLTDGI  178



>ref|XP_011460396.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101310004 
[Fragaria vesca subsp. vesca]
Length=841

 Score =   108 bits (270),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 101/149 (68%), Gaps = 14/149 (9%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IP GSRKIV+SLKEIV N  E EIYA LKECNMDPNEAVNRLL+QDPFHEVKSKR+K+KE
Sbjct  20   IPGGSRKIVQSLKEIVNNCTEQEIYAMLKECNMDPNEAVNRLLAQDPFHEVKSKREKKKE  79

Query  397  NKDTTEsrprgasssrggkgsadrYAGRGGSE--------SLHGKSTYAYXENG---YTN  543
            +K+ T+SR RGA+ S  G    DRYA RGGS         SLHG+  Y   ENG   Y  
Sbjct  80   SKEPTDSRSRGANFSNYGGRGGDRYASRGGSNHFGTNESGSLHGRPAYR-KENGTPAYAG  138

Query  544  TKSTR--TAGSTTNRWLPTISDAAGTENQ  624
            + ST   T G  ++R  PT SD+   EN+
Sbjct  139  SSSTAAGTTGYNSSRRPPTYSDSVAAENK  167



>ref|XP_010924304.1| PREDICTED: signaling mucin HKR1-like [Elaeis guineensis]
Length=887

 Score =   108 bits (269),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 59/66 (89%), Gaps = 1/66 (2%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IP+ SRK+V+S+KEIV N PESEIY+ LKECNMDPNEAV+RLLSQD FHEV+SKRDK+KE
Sbjct  20   IPAMSRKLVQSVKEIV-NCPESEIYSMLKECNMDPNEAVHRLLSQDTFHEVRSKRDKKKE  78

Query  397  NKDTTE  414
             KDT E
Sbjct  79   TKDTPE  84



>ref|XP_010469381.1| PREDICTED: uncharacterized protein LOC104749443 isoform X1 [Camelina 
sativa]
 ref|XP_010469382.1| PREDICTED: uncharacterized protein LOC104749443 isoform X2 [Camelina 
sativa]
Length=195

 Score =   102 bits (254),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 82/119 (69%), Gaps = 11/119 (9%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  387
            ++ IPSGS+K+V+SLKEIV N P++EIYA LK+CNMDPNEAV RLLSQDPFHEV SK++K
Sbjct  26   ISDIPSGSKKMVQSLKEIV-NCPDAEIYAVLKDCNMDPNEAVTRLLSQDPFHEVTSKQEK  84

Query  388  RKENKDTTEsrprgasssrggkgsadrYAGRGGSESLHGKS---TYAYXENGYTNTKST  555
            +K+ +D  +SR RG +++            RGGS+   G+S    +   E+G    K+T
Sbjct  85   KKQIRDIQDSRSRGYNNNYNR-------GSRGGSDRYTGRSGATPFTSSESGSVQVKTT  136



>ref|XP_010469383.1| PREDICTED: uncharacterized protein LOC104749443 isoform X3 [Camelina 
sativa]
Length=189

 Score =   102 bits (253),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 82/119 (69%), Gaps = 11/119 (9%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  387
            ++ IPSGS+K+V+SLKEIV N P++EIYA LK+CNMDPNEAV RLLSQDPFHEV SK++K
Sbjct  26   ISDIPSGSKKMVQSLKEIV-NCPDAEIYAVLKDCNMDPNEAVTRLLSQDPFHEVTSKQEK  84

Query  388  RKENKDTTEsrprgasssrggkgsadrYAGRGGSESLHGKS---TYAYXENGYTNTKST  555
            +K+ +D  +SR RG +++            RGGS+   G+S    +   E+G    K+T
Sbjct  85   KKQIRDIQDSRSRGYNNNYNR-------GSRGGSDRYTGRSGATPFTSSESGSVQVKTT  136



>ref|XP_009395691.1| PREDICTED: mucin-17-like [Musa acuminata subsp. malaccensis]
Length=910

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 59/68 (87%), Gaps = 1/68 (1%)
 Frame = +1

Query  211  AMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKR  390
            A IPSGSRK+V+SLKEIV N PE EIYA L+EC+MDPNEA++RLLSQD FHEVKSKRDK+
Sbjct  22   APIPSGSRKLVQSLKEIV-NCPEPEIYAMLRECDMDPNEAIHRLLSQDTFHEVKSKRDKK  80

Query  391  KENKDTTE  414
            KE ++  E
Sbjct  81   KEIREPPE  88



>ref|XP_009410964.1| PREDICTED: uncharacterized protein LOC103992822 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=878

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 60/68 (88%), Gaps = 1/68 (1%)
 Frame = +1

Query  211  AMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKR  390
            A IP+GSRK+V+SLKEIV N PE+EIY+ L+ECNMDPNEAV+RLLSQD FHEVKSKRDK+
Sbjct  15   APIPTGSRKLVQSLKEIV-NCPEAEIYSMLRECNMDPNEAVHRLLSQDTFHEVKSKRDKK  73

Query  391  KENKDTTE  414
            KE ++  E
Sbjct  74   KEIREPPE  81



>ref|XP_009410965.1| PREDICTED: uncharacterized protein LOC103992822 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=872

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 60/68 (88%), Gaps = 1/68 (1%)
 Frame = +1

Query  211  AMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKR  390
            A IP+GSRK+V+SLKEIV N PE+EIY+ L+ECNMDPNEAV+RLLSQD FHEVKSKRDK+
Sbjct  15   APIPTGSRKLVQSLKEIV-NCPEAEIYSMLRECNMDPNEAVHRLLSQDTFHEVKSKRDKK  73

Query  391  KENKDTTE  414
            KE ++  E
Sbjct  74   KEIREPPE  81



>ref|XP_009410966.1| PREDICTED: uncharacterized protein LOC103992822 isoform X4 [Musa 
acuminata subsp. malaccensis]
Length=830

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 60/68 (88%), Gaps = 1/68 (1%)
 Frame = +1

Query  211  AMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKR  390
            A IP+GSRK+V+SLKEIV N PE+EIY+ L+ECNMDPNEAV+RLLSQD FHEVKSKRDK+
Sbjct  15   APIPTGSRKLVQSLKEIV-NCPEAEIYSMLRECNMDPNEAVHRLLSQDTFHEVKSKRDKK  73

Query  391  KENKDTTE  414
            KE ++  E
Sbjct  74   KEIREPPE  81



>ref|XP_009410962.1| PREDICTED: uncharacterized protein LOC103992822 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=883

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 60/68 (88%), Gaps = 1/68 (1%)
 Frame = +1

Query  211  AMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKR  390
            A IP+GSRK+V+SLKEIV N PE+EIY+ L+ECNMDPNEAV+RLLSQD FHEVKSKRDK+
Sbjct  15   APIPTGSRKLVQSLKEIV-NCPEAEIYSMLRECNMDPNEAVHRLLSQDTFHEVKSKRDKK  73

Query  391  KENKDTTE  414
            KE ++  E
Sbjct  74   KEIREPPE  81



>ref|XP_004162612.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101224560 
[Cucumis sativus]
Length=844

 Score =   105 bits (262),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IP   RK+V+SLKEIV N  + EIYA L+ECNMDP+EAVNRLL+QDPFHEVKSKR+K+KE
Sbjct  17   IPPEWRKMVQSLKEIVNNCTDQEIYATLRECNMDPDEAVNRLLTQDPFHEVKSKREKKKE  76

Query  397  NKDTTE  414
            NKD  +
Sbjct  77   NKDPID  82



>ref|XP_004134562.1| PREDICTED: uncharacterized protein LOC101211388 [Cucumis sativus]
Length=845

 Score =   105 bits (262),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IP   RK+V+SLKEIV N  + EIYA L+ECNMDP+EAVNRLL+QDPFHEVKSKR+K+KE
Sbjct  17   IPPEWRKMVQSLKEIVNNCTDQEIYATLRECNMDPDEAVNRLLTQDPFHEVKSKREKKKE  76

Query  397  NKDTTE  414
            NKD  +
Sbjct  77   NKDPID  82



>ref|XP_008439673.1| PREDICTED: probable GPI-anchored adhesin-like protein PGA55 isoform 
X2 [Cucumis melo]
Length=846

 Score =   105 bits (262),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IP   RK+V+SLKEIV N  + EIYA L+ECNMDP+EAVNRLL+QDPFHEVKSKR+K+KE
Sbjct  18   IPPEWRKMVQSLKEIVNNCTDQEIYATLRECNMDPDEAVNRLLTQDPFHEVKSKREKKKE  77

Query  397  NKDTTE  414
            NKD  +
Sbjct  78   NKDPID  83



>ref|XP_008439672.1| PREDICTED: probable GPI-anchored adhesin-like protein PGA55 isoform 
X1 [Cucumis melo]
Length=847

 Score =   105 bits (262),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IP   RK+V+SLKEIV N  + EIYA L+ECNMDP+EAVNRLL+QDPFHEVKSKR+K+KE
Sbjct  18   IPPEWRKMVQSLKEIVNNCTDQEIYATLRECNMDPDEAVNRLLTQDPFHEVKSKREKKKE  77

Query  397  NKDTTE  414
            NKD  +
Sbjct  78   NKDPID  83



>gb|KGN49366.1| hypothetical protein Csa_6G522110 [Cucumis sativus]
Length=905

 Score =   105 bits (262),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IP   RK+V+SLKEIV N  + EIYA L+ECNMDP+EAVNRLL+QDPFHEVKSKR+K+KE
Sbjct  76   IPPEWRKMVQSLKEIVNNCTDQEIYATLRECNMDPDEAVNRLLTQDPFHEVKSKREKKKE  135

Query  397  NKDTTE  414
            NKD  +
Sbjct  136  NKDPID  141



>ref|XP_010539204.1| PREDICTED: putative uncharacterized protein DDB_G0277255 [Tarenaya 
hassleriana]
Length=790

 Score =   105 bits (261),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 81/163 (50%), Positives = 95/163 (58%), Gaps = 15/163 (9%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            +P+ SRK+V SLKE+V N  E EIYA L EC+MDP+ AVNRLLSQD FHEVKSKRDK+KE
Sbjct  19   VPAASRKVVRSLKEVV-NCSEEEIYATLVECDMDPDAAVNRLLSQDSFHEVKSKRDKKKE  77

Query  397  NKDTTEsrprgasssrgg--kgsadrYAGRG----------GSESLHGKSTYAYXENGYT  540
             KDTTESR RGA S      + + D YAGRG          GS  + GK      ENG  
Sbjct  78   TKDTTESRSRGAGSFLNRGGRSNGDNYAGRGGGQKFISNESGSVQVQGKPPNK-RENGTN  136

Query  541  N-TKSTRTAGSTTNRWLPTISDAAGTENQKLVDGVSAATQHSS  666
            N    + +  S   R   + SD  GTEN  L  G   A + SS
Sbjct  137  NHVAGSSSTSSVIGRQPLSNSDPKGTENTSLPVGTCDAVRSSS  179



>ref|XP_008797516.1| PREDICTED: uncharacterized protein LOC103712704 isoform X1 [Phoenix 
dactylifera]
Length=893

 Score =   105 bits (262),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 81/168 (48%), Positives = 99/168 (59%), Gaps = 19/168 (11%)
 Frame = +1

Query  214  MIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRK  393
            +IP+ SRK+V+S+KEIV N P+ EIY+ LKECNMDPNEAV+RLLSQD FHEVKSKRDK+K
Sbjct  17   LIPAMSRKLVQSVKEIV-NCPDPEIYSMLKECNMDPNEAVHRLLSQDTFHEVKSKRDKKK  75

Query  394  ENKDTTEsrprgasssrggkgsadrYAGRGGSESLHGKSTYAY-------XENGYTNTKS  552
            E K+T ESR R  ++S  G       AGR  S         A         ENG  +  +
Sbjct  76   EIKETPESRSRAVNNSGRGARGGTDRAGRNSSIQSSSSDYGAARGKPANKKENGTPSVPT  135

Query  553  TRTAGSTT-----NRWLPTI-SDAAGTENQK----LVDGVSAATQHSS  666
            +   GS T     NR  PTI SD+A  EN      L DG+   +Q SS
Sbjct  136  SSILGSGTVASNPNRR-PTIPSDSASMENTMQATGLSDGIPTPSQTSS  182



>ref|XP_010926244.1| PREDICTED: uncharacterized protein LOC105048593 [Elaeis guineensis]
Length=886

 Score =   104 bits (260),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 59/66 (89%), Gaps = 1/66 (2%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IPS SRK+V+++KEIV N P+SEIY+ LKECNMDPNEAV+RLLSQD FHEVKSKRDK+KE
Sbjct  18   IPSMSRKLVQTVKEIV-NCPDSEIYSMLKECNMDPNEAVHRLLSQDTFHEVKSKRDKKKE  76

Query  397  NKDTTE  414
             K+T E
Sbjct  77   IKETPE  82



>ref|XP_006827353.1| hypothetical protein AMTR_s00011p00072820 [Amborella trichopoda]
 gb|ERM94590.1| hypothetical protein AMTR_s00011p00072820 [Amborella trichopoda]
Length=904

 Score =   104 bits (260),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 49/69 (71%), Positives = 58/69 (84%), Gaps = 1/69 (1%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  387
            +  IPS +RKIV+SLKEIV N P++EIYA L+ECNMDPN+ V RLLSQD FHEVKSKR+K
Sbjct  15   IPAIPSSARKIVQSLKEIV-NCPDNEIYAMLRECNMDPNDTVQRLLSQDTFHEVKSKREK  73

Query  388  RKENKDTTE  414
            +KE KDT E
Sbjct  74   KKEIKDTAE  82



>gb|KHN14369.1| hypothetical protein glysoja_012407 [Glycine soja]
Length=831

 Score =   104 bits (260),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 76/167 (46%), Positives = 98/167 (59%), Gaps = 18/167 (11%)
 Frame = +1

Query  211  AMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKR  390
            A IP+ SRK+V+SLKEIV N+P+ EIYA LK+CNMDPNEAV+RLLSQDPFHEVKSKR+K+
Sbjct  12   ATIPASSRKMVQSLKEIVSNFPDHEIYATLKDCNMDPNEAVSRLLSQDPFHEVKSKREKK  71

Query  391  KENKDTTEsrprgasssrgg----kgsadrYAGRGGSE-------SLHGKSTYAYXENGY  537
            K    T        +++       +   DRY GRGG+         L GK  Y       
Sbjct  72   KIKDPTDSRSRGSGTNNTSSRGGGRAGTDRYGGRGGANQFGSSDYGLQGKPVYKKENGAP  131

Query  538  TNTKSTRTA----GSTTNRWLPTISDAAGTENQ---KLVDGVSAATQ  657
            T   ST +A    G+ TN  LP+ SD+  TE      + DG S+++Q
Sbjct  132  TFGGSTSSAPSVLGNNTNTRLPSYSDSVVTEKTYAFGIGDGPSSSSQ  178



>ref|XP_008364175.1| PREDICTED: uncharacterized protein LOC103427870 isoform X2 [Malus 
domestica]
Length=857

 Score =   103 bits (257),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 85/169 (50%), Positives = 110/169 (65%), Gaps = 18/169 (11%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  387
            ++ IP+GSRK+V+SLKEIV N  E EIYA LK+CNMDPNEAVNRLL+QDPFHEVKSKR+K
Sbjct  19   ISGIPAGSRKMVQSLKEIVNNCTEQEIYAMLKDCNMDPNEAVNRLLAQDPFHEVKSKREK  78

Query  388  RKENKDTTEs-rprgasssrggkgsadrYAGRGGSESL--------HGKSTYAYXENG--  534
            +KE+K+ T+S     +++S  G    DRY+ RGGS           HGKS Y   ENG  
Sbjct  79   KKESKEPTDSRSRGASNASSYGARGGDRYSARGGSNHFSSNDSGFSHGKSAYK-KENGTH  137

Query  535  -YTNTKSTRTAGSTTNRWLPTISDAAGTENQKLV----DGVSAATQHSS  666
             Y  + S   AG+ T R   + SD+ G+EN+       DG+S+ +Q SS
Sbjct  138  AYPGSASG-MAGNHTGRRPTSYSDSVGSENKMPTLSTDDGISSFSQPSS  185



>ref|XP_008364174.1| PREDICTED: uncharacterized protein LOC103427870 isoform X1 [Malus 
domestica]
Length=857

 Score =   103 bits (257),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 85/169 (50%), Positives = 110/169 (65%), Gaps = 18/169 (11%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  387
            ++ IP+GSRK+V+SLKEIV N  E EIYA LK+CNMDPNEAVNRLL+QDPFHEVKSKR+K
Sbjct  19   ISGIPAGSRKMVQSLKEIVNNCTEQEIYAMLKDCNMDPNEAVNRLLAQDPFHEVKSKREK  78

Query  388  RKENKDTTEs-rprgasssrggkgsadrYAGRGGSESL--------HGKSTYAYXENG--  534
            +KE+K+ T+S     +++S  G    DRY+ RGGS           HGKS Y   ENG  
Sbjct  79   KKESKEPTDSRSRGASNASSYGARGGDRYSARGGSNHFSSNDSGFSHGKSAYK-KENGTH  137

Query  535  -YTNTKSTRTAGSTTNRWLPTISDAAGTENQKLV----DGVSAATQHSS  666
             Y  + S   AG+ T R   + SD+ G+EN+       DG+S+ +Q SS
Sbjct  138  AYPGSASG-MAGNHTGRRPTSYSDSVGSENKMPTLSTDDGISSFSQPSS  185



>ref|XP_008364176.1| PREDICTED: uncharacterized protein LOC103427870 isoform X3 [Malus 
domestica]
Length=856

 Score =   103 bits (257),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 85/169 (50%), Positives = 110/169 (65%), Gaps = 18/169 (11%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  387
            ++ IP+GSRK+V+SLKEIV N  E EIYA LK+CNMDPNEAVNRLL+QDPFHEVKSKR+K
Sbjct  19   ISGIPAGSRKMVQSLKEIVNNCTEQEIYAMLKDCNMDPNEAVNRLLAQDPFHEVKSKREK  78

Query  388  RKENKDTTEs-rprgasssrggkgsadrYAGRGGSESL--------HGKSTYAYXENG--  534
            +KE+K+ T+S     +++S  G    DRY+ RGGS           HGKS Y   ENG  
Sbjct  79   KKESKEPTDSRSRGASNASSYGARGGDRYSARGGSNHFSSNDSGFSHGKSAYK-KENGTH  137

Query  535  -YTNTKSTRTAGSTTNRWLPTISDAAGTENQKLV----DGVSAATQHSS  666
             Y  + S   AG+ T R   + SD+ G+EN+       DG+S+ +Q SS
Sbjct  138  AYPGSASG-MAGNHTGRRPTSYSDSVGSENKMPTLSTDDGISSFSQPSS  185



>ref|XP_009396491.1| PREDICTED: uncharacterized protein LOC103981474 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=885

 Score =   103 bits (256),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/69 (71%), Positives = 59/69 (86%), Gaps = 1/69 (1%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  387
             A IP+GSRK+V+SLKEIV N  E+EIYA L+ECNMDPNEAV+RLLSQD FHEV+SKRDK
Sbjct  20   AAPIPAGSRKLVQSLKEIV-NCSETEIYAMLRECNMDPNEAVHRLLSQDAFHEVRSKRDK  78

Query  388  RKENKDTTE  414
            +KE ++  E
Sbjct  79   KKEIREPPE  87



>ref|XP_009396490.1| PREDICTED: uncharacterized protein LOC103981474 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=886

 Score =   103 bits (256),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/69 (71%), Positives = 59/69 (86%), Gaps = 1/69 (1%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  387
             A IP+GSRK+V+SLKEIV N  E+EIYA L+ECNMDPNEAV+RLLSQD FHEV+SKRDK
Sbjct  20   AAPIPAGSRKLVQSLKEIV-NCSETEIYAMLRECNMDPNEAVHRLLSQDAFHEVRSKRDK  78

Query  388  RKENKDTTE  414
            +KE ++  E
Sbjct  79   KKEIREPPE  87



>ref|XP_008366008.1| PREDICTED: protein lingerer-like [Malus domestica]
Length=856

 Score =   102 bits (255),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 81/169 (48%), Positives = 107/169 (63%), Gaps = 18/169 (11%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  387
            ++ IP+GSRK+V+SLKEIV N  E EIYA LK+CNMDPNEAVNRLL+QDPFHEV+SKR+K
Sbjct  19   ISGIPAGSRKMVQSLKEIVNNCTEQEIYAMLKDCNMDPNEAVNRLLAQDPFHEVRSKREK  78

Query  388  RKENKDTTEs-rprgasssrggkgsadrYAGRGGSESL--------HGKSTYAYXENG--  534
            +KE+K+ T+S      ++S  G    DRY+ RGGS           HGK  Y   ENG  
Sbjct  79   KKESKEPTDSRSRGANNTSSYGARGGDRYSARGGSNHYSSNDSGFSHGKPAYK-KENGTH  137

Query  535  -YTNTKSTRTAGSTTNRWLPTISDAAGTENQKLV----DGVSAATQHSS  666
             Y  + S   AG  T R   + SD+ G+EN+       DG+ +++Q S+
Sbjct  138  AYPGSASV-MAGHNTGRRPTSYSDSVGSENKIPALSTDDGILSSSQPSA  185



>ref|XP_004961192.1| PREDICTED: flocculation protein FLO11-like isoform X2 [Setaria 
italica]
Length=846

 Score =   102 bits (254),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 58/66 (88%), Gaps = 1/66 (2%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            +P+GSRK+V+SLKEIV N PE+EIYAAL+EC MDP+EAV+RLLSQD F EVKSKRDK+KE
Sbjct  15   VPAGSRKLVQSLKEIV-NRPEAEIYAALRECGMDPDEAVSRLLSQDTFQEVKSKRDKKKE  73

Query  397  NKDTTE  414
             K+  E
Sbjct  74   IKEVPE  79



>ref|XP_004961191.1| PREDICTED: flocculation protein FLO11-like isoform X1 [Setaria 
italica]
Length=847

 Score =   102 bits (254),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 58/66 (88%), Gaps = 1/66 (2%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            +P+GSRK+V+SLKEIV N PE+EIYAAL+EC MDP+EAV+RLLSQD F EVKSKRDK+KE
Sbjct  15   VPAGSRKLVQSLKEIV-NRPEAEIYAALRECGMDPDEAVSRLLSQDTFQEVKSKRDKKKE  73

Query  397  NKDTTE  414
             K+  E
Sbjct  74   IKEVPE  79



>ref|XP_009353838.1| PREDICTED: uncharacterized protein LOC103945058 isoform X1 [Pyrus 
x bretschneideri]
Length=857

 Score =   102 bits (253),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 104/168 (62%), Gaps = 16/168 (10%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  387
            ++ IP+GSRK+V+SLKEIV N  E EIYA LK+CNMDPNEAVNRLL+QDPFHEV+SKR+K
Sbjct  19   ISGIPAGSRKMVQSLKEIVNNCTEQEIYAMLKDCNMDPNEAVNRLLAQDPFHEVRSKREK  78

Query  388  RKENKDTTEs-rprgasssrggkgsadrYAGRGGSESL--------HGKSTYAYXENGYT  540
            +KE K+ T+S      ++S  G    DRY+ RGGS           HGK  Y   ENG  
Sbjct  79   KKEGKEPTDSRSRGANNTSSYGARGGDRYSARGGSNHYSSNDSGFSHGKPAYK-KENGTH  137

Query  541  NTKSTRTA--GSTTNRWLPTISDAAGTENQKLV----DGVSAATQHSS  666
                + +   G  T R   + SD+ G+EN+       DG+ +++Q S+
Sbjct  138  AIPGSASGMVGHNTGRRPTSYSDSVGSENKIPTLSTDDGILSSSQPSA  185



>ref|XP_009353841.1| PREDICTED: uncharacterized protein LOC103945058 isoform X4 [Pyrus 
x bretschneideri]
 ref|XP_009360834.1| PREDICTED: uncharacterized protein LOC103951238 isoform X3 [Pyrus 
x bretschneideri]
Length=856

 Score =   102 bits (253),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 104/168 (62%), Gaps = 16/168 (10%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  387
            ++ IP+GSRK+V+SLKEIV N  E EIYA LK+CNMDPNEAVNRLL+QDPFHEV+SKR+K
Sbjct  19   ISGIPAGSRKMVQSLKEIVNNCTEQEIYAMLKDCNMDPNEAVNRLLAQDPFHEVRSKREK  78

Query  388  RKENKDTTEs-rprgasssrggkgsadrYAGRGGSESL--------HGKSTYAYXENGYT  540
            +KE K+ T+S      ++S  G    DRY+ RGGS           HGK  Y   ENG  
Sbjct  79   KKEGKEPTDSRSRGANNTSSYGARGGDRYSARGGSNHYSSNDSGFSHGKPAYK-KENGTH  137

Query  541  NTKSTRTA--GSTTNRWLPTISDAAGTENQKLV----DGVSAATQHSS  666
                + +   G  T R   + SD+ G+EN+       DG+ +++Q S+
Sbjct  138  AIPGSASGMVGHNTGRRPTSYSDSVGSENKIPTLSTDDGILSSSQPSA  185



>ref|XP_009353839.1| PREDICTED: uncharacterized protein LOC103945058 isoform X2 [Pyrus 
x bretschneideri]
 ref|XP_009360832.1| PREDICTED: uncharacterized protein LOC103951238 isoform X1 [Pyrus 
x bretschneideri]
Length=856

 Score =   102 bits (253),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 104/168 (62%), Gaps = 16/168 (10%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  387
            ++ IP+GSRK+V+SLKEIV N  E EIYA LK+CNMDPNEAVNRLL+QDPFHEV+SKR+K
Sbjct  19   ISGIPAGSRKMVQSLKEIVNNCTEQEIYAMLKDCNMDPNEAVNRLLAQDPFHEVRSKREK  78

Query  388  RKENKDTTEs-rprgasssrggkgsadrYAGRGGSESL--------HGKSTYAYXENGYT  540
            +KE K+ T+S      ++S  G    DRY+ RGGS           HGK  Y   ENG  
Sbjct  79   KKEGKEPTDSRSRGANNTSSYGARGGDRYSARGGSNHYSSNDSGFSHGKPAYK-KENGTH  137

Query  541  NTKSTRTA--GSTTNRWLPTISDAAGTENQKLV----DGVSAATQHSS  666
                + +   G  T R   + SD+ G+EN+       DG+ +++Q S+
Sbjct  138  AIPGSASGMVGHNTGRRPTSYSDSVGSENKIPTLSTDDGILSSSQPSA  185



>ref|XP_009353842.1| PREDICTED: uncharacterized protein LOC103945058 isoform X5 [Pyrus 
x bretschneideri]
 ref|XP_009360836.1| PREDICTED: uncharacterized protein LOC103951238 isoform X4 [Pyrus 
x bretschneideri]
Length=855

 Score =   102 bits (253),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 104/168 (62%), Gaps = 16/168 (10%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  387
            ++ IP+GSRK+V+SLKEIV N  E EIYA LK+CNMDPNEAVNRLL+QDPFHEV+SKR+K
Sbjct  19   ISGIPAGSRKMVQSLKEIVNNCTEQEIYAMLKDCNMDPNEAVNRLLAQDPFHEVRSKREK  78

Query  388  RKENKDTTEs-rprgasssrggkgsadrYAGRGGSESL--------HGKSTYAYXENGYT  540
            +KE K+ T+S      ++S  G    DRY+ RGGS           HGK  Y   ENG  
Sbjct  79   KKEGKEPTDSRSRGANNTSSYGARGGDRYSARGGSNHYSSNDSGFSHGKPAYK-KENGTH  137

Query  541  NTKSTRT--AGSTTNRWLPTISDAAGTENQKLV----DGVSAATQHSS  666
                + +   G  T R   + SD+ G+EN+       DG+ +++Q S+
Sbjct  138  AIPGSASGMVGHNTGRRPTSYSDSVGSENKIPTLSTDDGILSSSQPSA  185



>ref|XP_009353840.1| PREDICTED: uncharacterized protein LOC103945058 isoform X3 [Pyrus 
x bretschneideri]
 ref|XP_009360833.1| PREDICTED: uncharacterized protein LOC103951238 isoform X2 [Pyrus 
x bretschneideri]
Length=856

 Score =   102 bits (253),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 104/168 (62%), Gaps = 16/168 (10%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  387
            ++ IP+GSRK+V+SLKEIV N  E EIYA LK+CNMDPNEAVNRLL+QDPFHEV+SKR+K
Sbjct  19   ISGIPAGSRKMVQSLKEIVNNCTEQEIYAMLKDCNMDPNEAVNRLLAQDPFHEVRSKREK  78

Query  388  RKENKDTTEs-rprgasssrggkgsadrYAGRGGSESL--------HGKSTYAYXENGYT  540
            +KE K+ T+S      ++S  G    DRY+ RGGS           HGK  Y   ENG  
Sbjct  79   KKEGKEPTDSRSRGANNTSSYGARGGDRYSARGGSNHYSSNDSGFSHGKPAYK-KENGTH  137

Query  541  NTKSTRT--AGSTTNRWLPTISDAAGTENQKLV----DGVSAATQHSS  666
                + +   G  T R   + SD+ G+EN+       DG+ +++Q S+
Sbjct  138  AIPGSASGMVGHNTGRRPTSYSDSVGSENKIPTLSTDDGILSSSQPSA  185



>ref|XP_002440264.1| hypothetical protein SORBIDRAFT_09g028730 [Sorghum bicolor]
 gb|EES18694.1| hypothetical protein SORBIDRAFT_09g028730 [Sorghum bicolor]
Length=856

 Score =   101 bits (252),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 57/66 (86%), Gaps = 1/66 (2%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            +P GSRK+V+SLKEIV N PE+EIYAAL+EC MDP+EAV+RLLSQD F EVKSKRDK+KE
Sbjct  15   VPPGSRKLVQSLKEIV-NRPEAEIYAALRECGMDPDEAVSRLLSQDTFQEVKSKRDKKKE  73

Query  397  NKDTTE  414
             K+  E
Sbjct  74   IKEVPE  79



>ref|XP_010538220.1| PREDICTED: uncharacterized protein LOC104812645 isoform X1 [Tarenaya 
hassleriana]
Length=818

 Score =   101 bits (251),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 57/69 (83%), Positives = 65/69 (94%), Gaps = 1/69 (1%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  387
            ++ IPSGSRKIV+SLKEIV N PE+EIYA LKECNMDPNEAVNR+LSQDPFHEVKSK+DK
Sbjct  22   ISDIPSGSRKIVQSLKEIV-NCPEAEIYAMLKECNMDPNEAVNRILSQDPFHEVKSKKDK  80

Query  388  RKENKDTTE  414
            +KENKDTT+
Sbjct  81   KKENKDTTD  89



>ref|XP_010538221.1| PREDICTED: uncharacterized protein LOC104812645 isoform X2 [Tarenaya 
hassleriana]
Length=817

 Score =   101 bits (251),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 57/69 (83%), Positives = 65/69 (94%), Gaps = 1/69 (1%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  387
            ++ IPSGSRKIV+SLKEIV N PE+EIYA LKECNMDPNEAVNR+LSQDPFHEVKSK+DK
Sbjct  22   ISDIPSGSRKIVQSLKEIV-NCPEAEIYAMLKECNMDPNEAVNRILSQDPFHEVKSKKDK  80

Query  388  RKENKDTTE  414
            +KENKDTT+
Sbjct  81   KKENKDTTD  89



>ref|XP_008800693.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103714980 
[Phoenix dactylifera]
Length=885

 Score =   100 bits (250),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 57/66 (86%), Gaps = 1/66 (2%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IP+ SRK+V+ +KEIV N PESEIY+ L+ECNMDPNEAV+RLLSQD FHEVKSKRDK+KE
Sbjct  22   IPAMSRKLVQCVKEIV-NCPESEIYSMLRECNMDPNEAVHRLLSQDTFHEVKSKRDKKKE  80

Query  397  NKDTTE  414
             K+  E
Sbjct  81   IKEPPE  86



>ref|XP_009115248.1| PREDICTED: putative uncharacterized protein DDB_G0271606 [Brassica 
rapa]
Length=859

 Score =   100 bits (248),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 95/142 (67%), Gaps = 11/142 (8%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IPSGSRKIV+SLKE+V N PE+EIYA LKECNMDPNEAV+RLLSQDPFHEVKSK++K+KE
Sbjct  25   IPSGSRKIVQSLKEVV-NSPEAEIYAMLKECNMDPNEAVHRLLSQDPFHEVKSKKEKKKE  83

Query  397  NKDTTEsrprgasssrggkgsadrYAGRGGSESLHGKSTYAY---XENGYTNTKSTRTAG  567
             +D  +SRPRGA++            GRGGS+   G+S   +    ++G    KST    
Sbjct  84   TRDIPDSRPRGANNRYNS-------GGRGGSDRYAGRSASTHLSSADSGNFQGKSTSKKE  136

Query  568  STTNRWLPTISDAAGTENQKLV  633
            S T  +  + S A+G  N +L 
Sbjct  137  SGTQGYTSSWSSASGVPNHQLT  158



>ref|XP_009394232.1| PREDICTED: uncharacterized protein LOC103979756 [Musa acuminata 
subsp. malaccensis]
Length=884

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 59/68 (87%), Gaps = 1/68 (1%)
 Frame = +1

Query  211  AMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKR  390
            A IP+GSRK+V+SL+EI+ + PE EIYA L+ECNMDPNEAV+RLL+QD FHEVKSKR+K+
Sbjct  12   APIPTGSRKLVQSLREIL-HCPEPEIYAMLRECNMDPNEAVHRLLAQDTFHEVKSKREKK  70

Query  391  KENKDTTE  414
            KE ++  E
Sbjct  71   KEIREPPE  78



>ref|XP_010559258.1| PREDICTED: uncharacterized protein LOC104827729 isoform X2 [Tarenaya 
hassleriana]
Length=795

 Score = 99.4 bits (246),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 92/166 (55%), Gaps = 17/166 (10%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            +P+ +R +V+ LKE+V N  + EIYA L EC+MDP+EAV+RLLSQD FHEVKSKRDK+KE
Sbjct  20   VPAMARNVVQGLKEVV-NCSDQEIYAMLVECDMDPDEAVSRLLSQDTFHEVKSKRDKKKE  78

Query  397  NKDTTEsrprgasssrg----gkgsadrYAGRGGSESLHGK---STYAYXENGYTNTKST  555
             KDTT+S+ R   S            D YAGRGG    +        A   N   N    
Sbjct  79   TKDTTDSQSRRTGSILNRGGCRSAGGDNYAGRGGGHKFNSNEPGGLLAKPANKRENRTRN  138

Query  556  RTAGSTTNR---W--LPTISDAAGTENQKLV----DGVSAATQHSS  666
              AGS++     W   P  SD  GTEN  L     D V +++Q SS
Sbjct  139  HVAGSSSTSGVAWSQHPFSSDPKGTENTSLSTGSGDAVPSSSQASS  184



>ref|XP_010559257.1| PREDICTED: uncharacterized protein LOC104827729 isoform X1 [Tarenaya 
hassleriana]
Length=796

 Score = 99.4 bits (246),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 92/166 (55%), Gaps = 17/166 (10%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            +P+ +R +V+ LKE+V N  + EIYA L EC+MDP+EAV+RLLSQD FHEVKSKRDK+KE
Sbjct  20   VPAMARNVVQGLKEVV-NCSDQEIYAMLVECDMDPDEAVSRLLSQDTFHEVKSKRDKKKE  78

Query  397  NKDTTEsrprgasssrg----gkgsadrYAGRGGSESLHGK---STYAYXENGYTNTKST  555
             KDTT+S+ R   S            D YAGRGG    +        A   N   N    
Sbjct  79   TKDTTDSQSRRTGSILNRGGCRSAGGDNYAGRGGGHKFNSNEPGGLLAKPANKRENRTRN  138

Query  556  RTAGSTTNR---W--LPTISDAAGTENQKLV----DGVSAATQHSS  666
              AGS++     W   P  SD  GTEN  L     D V +++Q SS
Sbjct  139  HVAGSSSTSGVAWSQHPFSSDPKGTENTSLSTGSGDAVPSSSQASS  184



>ref|XP_010559259.1| PREDICTED: uncharacterized protein LOC104827729 isoform X3 [Tarenaya 
hassleriana]
Length=794

 Score = 99.4 bits (246),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 92/166 (55%), Gaps = 17/166 (10%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            +P+ +R +V+ LKE+V N  + EIYA L EC+MDP+EAV+RLLSQD FHEVKSKRDK+KE
Sbjct  20   VPAMARNVVQGLKEVV-NCSDQEIYAMLVECDMDPDEAVSRLLSQDTFHEVKSKRDKKKE  78

Query  397  NKDTTEsrprgasssrg----gkgsadrYAGRGGSESLHGK---STYAYXENGYTNTKST  555
             KDTT+S+ R   S            D YAGRGG    +        A   N   N    
Sbjct  79   TKDTTDSQSRRTGSILNRGGCRSAGGDNYAGRGGGHKFNSNEPGGLLAKPANKRENRTRN  138

Query  556  RTAGSTTNR---W--LPTISDAAGTENQKLV----DGVSAATQHSS  666
              AGS++     W   P  SD  GTEN  L     D V +++Q SS
Sbjct  139  HVAGSSSTSGVAWSQHPFSSDPKGTENTSLSTGSGDAVPSSSQASS  184



>ref|XP_010559260.1| PREDICTED: uncharacterized protein LOC104827729 isoform X4 [Tarenaya 
hassleriana]
Length=793

 Score = 99.4 bits (246),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 92/166 (55%), Gaps = 17/166 (10%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            +P+ +R +V+ LKE+V N  + EIYA L EC+MDP+EAV+RLLSQD FHEVKSKRDK+KE
Sbjct  20   VPAMARNVVQGLKEVV-NCSDQEIYAMLVECDMDPDEAVSRLLSQDTFHEVKSKRDKKKE  78

Query  397  NKDTTEsrprgasssrg----gkgsadrYAGRGGSESLHGK---STYAYXENGYTNTKST  555
             KDTT+S+ R   S            D YAGRGG    +        A   N   N    
Sbjct  79   TKDTTDSQSRRTGSILNRGGCRSAGGDNYAGRGGGHKFNSNEPGGLLAKPANKRENRTRN  138

Query  556  RTAGSTTNR---W--LPTISDAAGTENQKLV----DGVSAATQHSS  666
              AGS++     W   P  SD  GTEN  L     D V +++Q SS
Sbjct  139  HVAGSSSTSGVAWSQHPFSSDPKGTENTSLSTGSGDAVPSSSQASS  184



>dbj|BAJ85689.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=869

 Score = 99.0 bits (245),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 57/66 (86%), Gaps = 1/66 (2%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            +P  S+K+V+SLKEIV N PE+EIYAAL+EC MDP+EAV+RLLSQD F EVKSKRDK+KE
Sbjct  19   VPQASKKLVQSLKEIV-NRPEAEIYAALRECAMDPDEAVSRLLSQDTFQEVKSKRDKKKE  77

Query  397  NKDTTE  414
             K+T E
Sbjct  78   VKETPE  83



>dbj|BAJ92311.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93207.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=869

 Score = 99.0 bits (245),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 57/66 (86%), Gaps = 1/66 (2%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            +P  S+K+V+SLKEIV N PE+EIYAAL+EC MDP+EAV+RLLSQD F EVKSKRDK+KE
Sbjct  19   VPQASKKLVQSLKEIV-NRPEAEIYAALRECAMDPDEAVSRLLSQDTFQEVKSKRDKKKE  77

Query  397  NKDTTE  414
             K+T E
Sbjct  78   VKETPE  83



>ref|XP_008655402.1| PREDICTED: uncharacterized protein LOC101027201 isoform X1 [Zea 
mays]
 gb|AFW81159.1| putative DUF1296 domain containing family protein [Zea mays]
Length=856

 Score = 98.6 bits (244),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 57/66 (86%), Gaps = 1/66 (2%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            +P+GSRK+V+ LKEIV N PE+EIY+AL+EC MDP+EAV+RLLSQD F EVKSKRDK+KE
Sbjct  15   VPAGSRKLVQCLKEIV-NRPEAEIYSALRECGMDPDEAVSRLLSQDTFQEVKSKRDKKKE  73

Query  397  NKDTTE  414
             K+  E
Sbjct  74   IKEVPE  79



>ref|XP_009141365.1| PREDICTED: RNA polymerase II degradation factor 1-like [Brassica 
rapa]
Length=819

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 61/66 (92%), Gaps = 1/66 (2%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  387
            V+ IP+GSRK+V+SLKEIV N PE+EIYA LK+CNMDPNEAVNRLLSQDPFHEVKSK+DK
Sbjct  18   VSDIPTGSRKMVQSLKEIV-NCPEAEIYAVLKDCNMDPNEAVNRLLSQDPFHEVKSKKDK  76

Query  388  RKENKD  405
            +KE +D
Sbjct  77   KKEVRD  82



>ref|XP_011467573.1| PREDICTED: uncharacterized protein LOC101307606 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=803

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 56/68 (82%), Gaps = 1/68 (1%)
 Frame = +1

Query  211  AMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKR  390
            A    G++K+++SLKE+V N PE+EIYA LKECNMDPN+AV RLLS D FHEVKSKR++R
Sbjct  12   AQFLPGTKKMIQSLKEVV-NCPEAEIYAVLKECNMDPNDAVQRLLSLDTFHEVKSKRERR  70

Query  391  KENKDTTE  414
            KE KDT E
Sbjct  71   KEMKDTQE  78



>emb|CDY43685.1| BnaA04g20060D [Brassica napus]
Length=830

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 62/69 (90%), Gaps = 1/69 (1%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  387
            V+ IP+GSRK+V+SLKEIV N PE+EIYA LK+CNMDPNEAVNRLLSQDPFHEVKSK+DK
Sbjct  17   VSDIPTGSRKMVQSLKEIV-NCPEAEIYAVLKDCNMDPNEAVNRLLSQDPFHEVKSKKDK  75

Query  388  RKENKDTTE  414
            +KE +D  +
Sbjct  76   KKEVRDIQD  84



>ref|XP_008650021.1| PREDICTED: cell wall protein AWA1-like [Zea mays]
 gb|AFW79202.1| putative DUF1296 domain containing family protein [Zea mays]
Length=851

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 55/66 (83%), Gaps = 1/66 (2%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            +P GSRK+V+ LKEIV N PE+EIYAAL+EC MDP+E V+RLLSQD F EVKSKRDK+KE
Sbjct  15   VPPGSRKLVQGLKEIV-NRPEAEIYAALRECGMDPDETVSRLLSQDTFQEVKSKRDKKKE  73

Query  397  NKDTTE  414
             K+  E
Sbjct  74   IKEVPE  79



>ref|XP_003567874.1| PREDICTED: uncharacterized protein LOC100840916 [Brachypodium 
distachyon]
Length=859

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 56/66 (85%), Gaps = 1/66 (2%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            +P  SRK+V+ LKEIV N P++EIYAAL+EC MDP+EAV+RLLSQD F EVKSKRDK+KE
Sbjct  19   VPQASRKLVQGLKEIV-NRPDAEIYAALRECGMDPDEAVSRLLSQDTFQEVKSKRDKKKE  77

Query  397  NKDTTE  414
             K+T E
Sbjct  78   VKETPE  83



>ref|XP_006415582.1| hypothetical protein EUTSA_v10006794mg [Eutrema salsugineum]
 gb|ESQ33935.1| hypothetical protein EUTSA_v10006794mg [Eutrema salsugineum]
Length=836

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 98/137 (72%), Gaps = 9/137 (7%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IPSGSRKIV+SLKEIV N PE+EIYA LKECNMDPNEAVNRLLSQDPFHEVKSK++K+KE
Sbjct  24   IPSGSRKIVQSLKEIV-NSPEAEIYAMLKECNMDPNEAVNRLLSQDPFHEVKSKKEKKKE  82

Query  397  NKDTTEsrprgasssrgg--kgsadrYAGRGGSESLHGKSTYAYXENGYTNTKSTRTAGS  570
             +D  +SR RGA+++     +G++DRYAGR G  S H  ST    ++G    KST    S
Sbjct  83   TRDIPDSRLRGANNTYNRGGRGTSDRYAGRSG--STHFSST----DSGNFQGKSTNKKES  136

Query  571  TTNRWLPTISDAAGTEN  621
             T  +  + S A+G  N
Sbjct  137  GTQSYTGSWSSASGVAN  153



>ref|XP_006415581.1| hypothetical protein EUTSA_v10006794mg [Eutrema salsugineum]
 gb|ESQ33934.1| hypothetical protein EUTSA_v10006794mg [Eutrema salsugineum]
Length=838

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 98/137 (72%), Gaps = 9/137 (7%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IPSGSRKIV+SLKEIV N PE+EIYA LKECNMDPNEAVNRLLSQDPFHEVKSK++K+KE
Sbjct  24   IPSGSRKIVQSLKEIV-NSPEAEIYAMLKECNMDPNEAVNRLLSQDPFHEVKSKKEKKKE  82

Query  397  NKDTTEsrprgasssrgg--kgsadrYAGRGGSESLHGKSTYAYXENGYTNTKSTRTAGS  570
             +D  +SR RGA+++     +G++DRYAGR G  S H  ST    ++G    KST    S
Sbjct  83   TRDIPDSRLRGANNTYNRGGRGTSDRYAGRSG--STHFSST----DSGNFQGKSTNKKES  136

Query  571  TTNRWLPTISDAAGTEN  621
             T  +  + S A+G  N
Sbjct  137  GTQSYTGSWSSASGVAN  153



>ref|XP_006306766.1| hypothetical protein CARUB_v10008305mg [Capsella rubella]
 gb|EOA39664.1| hypothetical protein CARUB_v10008305mg [Capsella rubella]
Length=840

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 79/156 (51%), Positives = 97/156 (62%), Gaps = 13/156 (8%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IPSGSRKIV+SLKEIV N PE+EIYA LKECNMDPNEAVNRLLSQDPFHEVKSK++K+KE
Sbjct  26   IPSGSRKIVQSLKEIV-NAPEAEIYAMLKECNMDPNEAVNRLLSQDPFHEVKSKKEKKKE  84

Query  397  NKDTTEsrprgasssrggkgsadrYAGRGGSESLHGK---STYAYXENGYTNTKSTRTAG  567
             +D  + RPRG +S+            RGGS+   G+   + Y   ++G    KST    
Sbjct  85   TRDVPDYRPRGTNSTYNRG------GARGGSDRYAGRGRSTNYISTDSGNFQGKSTNKKE  138

Query  568  STTNRWLPTISDAAGTENQKLV---DGVSAATQHSS  666
            S T  +    S A+G  N       D V+A  + SS
Sbjct  139  SGTQGYTAPWSSASGVANHHQTQNSDSVAAENKSSS  174



>ref|XP_007214618.1| hypothetical protein PRUPE_ppa001304mg [Prunus persica]
 gb|EMJ15817.1| hypothetical protein PRUPE_ppa001304mg [Prunus persica]
Length=859

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 97/148 (66%), Gaps = 14/148 (9%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IP+GSRK+V+SLKEIV N  E EIYA LK+CNMDPNEAVNRLL+QDPFHEVKSKR+K+KE
Sbjct  21   IPAGSRKMVQSLKEIVNNCTEQEIYAMLKDCNMDPNEAVNRLLAQDPFHEVKSKREKKKE  80

Query  397  NKDTTEs-rprgasssrggkgsadrYAGRGGSES--------LHGKSTYAYXENG---YT  540
            NK+ TE       S+S  G    DRYA RGGS          LHGKS Y   ENG   Y 
Sbjct  81   NKEPTEPRSRGANSTSNHGGRGGDRYAARGGSNHFSSNESGFLHGKSAYK-KENGTHAYA  139

Query  541  NTKSTRTAGSTTNRWLPTISDAAGTENQ  624
             + S   AG   +R   + SD+ GTEN+
Sbjct  140  GSAS-GMAGHNMSRRPTSYSDSVGTENK  166



>ref|XP_006306765.1| hypothetical protein CARUB_v10008305mg [Capsella rubella]
 gb|EOA39663.1| hypothetical protein CARUB_v10008305mg [Capsella rubella]
Length=832

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 79/153 (52%), Positives = 95/153 (62%), Gaps = 16/153 (10%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IPSGSRKIV+SLKEIV N PE+EIYA LKECNMDPNEAVNRLLSQDPFHEVKSK++K+KE
Sbjct  26   IPSGSRKIVQSLKEIV-NAPEAEIYAMLKECNMDPNEAVNRLLSQDPFHEVKSKKEKKKE  84

Query  397  NKDTTEsrprgasssrggkgsadrYAGRGGSESLHGKSTYAYXENGYTNTKSTRTAGSTT  576
             +D  + RPRG +S+            RGG+    G   YA  ++G    KST    S T
Sbjct  85   TRDVPDYRPRGTNSTY----------NRGGARG--GSDRYAGRDSGNFQGKSTNKKESGT  132

Query  577  NRWLPTISDAAGTENQKLV---DGVSAATQHSS  666
              +    S A+G  N       D V+A  + SS
Sbjct  133  QGYTAPWSSASGVANHHQTQNSDSVAAENKSSS  165



>emb|CDY48333.1| BnaA09g26880D [Brassica napus]
Length=823

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 94/142 (66%), Gaps = 11/142 (8%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IPSGSRKIV+SLKE+V N PE+EIYA LKECNMDPNEAV+RLLSQDPFHEVKSK++K+KE
Sbjct  24   IPSGSRKIVQSLKEVV-NSPEAEIYAMLKECNMDPNEAVHRLLSQDPFHEVKSKKEKKKE  82

Query  397  NKDTTEsrprgasssrggkgsadrYAGRGGSESLHGKSTYAY---XENGYTNTKSTRTAG  567
             +D  +SRPRGA++             RGGS+   G+S   +    ++G    KST    
Sbjct  83   TRDVPDSRPRGANNRYNSGV-------RGGSDRYAGRSASTHLSSADSGNFQGKSTSKKE  135

Query  568  STTNRWLPTISDAAGTENQKLV  633
            S T  +  + S A+G  N +L 
Sbjct  136  SGTQGYTSSWSSASGVPNHQLT  157



>gb|AFW83477.1| putative DUF1296 domain containing family protein [Zea mays]
Length=355

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 56/66 (85%), Gaps = 1/66 (2%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            +P+ +RK+V+ LKEIV N P++EIYAAL+EC MDP+EAV+RLL QD F EVKSKRDK+KE
Sbjct  20   VPASARKLVQGLKEIV-NRPDAEIYAALRECGMDPDEAVSRLLCQDTFQEVKSKRDKKKE  78

Query  397  NKDTTE  414
             K+T +
Sbjct  79   VKETLD  84



>ref|XP_004969439.1| PREDICTED: putative GPI-anchored protein PB15E9.01c-like isoform 
X1 [Setaria italica]
Length=839

 Score = 96.3 bits (238),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 57/66 (86%), Gaps = 1/66 (2%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            +P+ +RK+V+ LKEIV N P++EIYAAL+EC MDP+EAV+RLL+QD F EVKSKRDK+KE
Sbjct  18   VPASARKLVQGLKEIV-NRPDAEIYAALRECGMDPDEAVSRLLTQDTFQEVKSKRDKKKE  76

Query  397  NKDTTE  414
             K+T E
Sbjct  77   VKETPE  82



>emb|CDX94662.1| BnaC07g09960D [Brassica napus]
Length=805

 Score = 96.3 bits (238),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 45/51 (88%), Positives = 47/51 (92%), Gaps = 1/51 (2%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEV  369
            IPSG RKIVESLKEIV N PE+EIYA LKECNMDPNEAV+RLLSQDPFHEV
Sbjct  20   IPSGCRKIVESLKEIV-NSPEAEIYAMLKECNMDPNEAVHRLLSQDPFHEV  69



>ref|XP_004969440.1| PREDICTED: putative GPI-anchored protein PB15E9.01c-like isoform 
X2 [Setaria italica]
Length=837

 Score = 96.3 bits (238),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 57/66 (86%), Gaps = 1/66 (2%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            +P+ +RK+V+ LKEIV N P++EIYAAL+EC MDP+EAV+RLL+QD F EVKSKRDK+KE
Sbjct  18   VPASARKLVQGLKEIV-NRPDAEIYAALRECGMDPDEAVSRLLTQDTFQEVKSKRDKKKE  76

Query  397  NKDTTE  414
             K+T E
Sbjct  77   VKETPE  82



>ref|XP_009132981.1| PREDICTED: uncharacterized protein LOC103857526 [Brassica rapa]
Length=808

 Score = 96.3 bits (238),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IPSGSRK+V+SLKEIV   PE+EIYA LK+CNMDPNEAVNRLLSQDPFHEVKSK++K+KE
Sbjct  13   IPSGSRKMVQSLKEIVNCCPEAEIYAVLKDCNMDPNEAVNRLLSQDPFHEVKSKKEKKKE  72

Query  397  NKDTTE  414
            N+D  +
Sbjct  73   NRDILD  78



>ref|XP_008225366.1| PREDICTED: dentin sialophosphoprotein isoform X2 [Prunus mume]
Length=860

 Score = 96.3 bits (238),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 81/148 (55%), Positives = 96/148 (65%), Gaps = 14/148 (9%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IP+GSRK+V+SLKEIV N  E EIYA LK+CNMDPNEAVNRLL+QDPFHEVKSKR+K+KE
Sbjct  21   IPAGSRKMVQSLKEIVNNCTEQEIYAMLKDCNMDPNEAVNRLLAQDPFHEVKSKREKKKE  80

Query  397  NKDTTEs-rprgasssrggkgsadrYAGRGGSESL--------HGKSTYAYXENG---YT  540
            NK+ TE       ++S  G    DRYA RGGS           HGKS Y   ENG   Y 
Sbjct  81   NKEPTEPRSRGANNTSNHGGRGGDRYAARGGSNHFSSNESGFSHGKSAYK-KENGTHAYA  139

Query  541  NTKSTRTAGSTTNRWLPTISDAAGTENQ  624
             + S   AG   +R   + SD+ GTEN+
Sbjct  140  GSASG-MAGHNMSRRPTSYSDSVGTENK  166



>ref|XP_008225365.1| PREDICTED: dentin sialophosphoprotein isoform X1 [Prunus mume]
Length=861

 Score = 96.3 bits (238),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 81/148 (55%), Positives = 96/148 (65%), Gaps = 14/148 (9%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IP+GSRK+V+SLKEIV N  E EIYA LK+CNMDPNEAVNRLL+QDPFHEVKSKR+K+KE
Sbjct  21   IPAGSRKMVQSLKEIVNNCTEQEIYAMLKDCNMDPNEAVNRLLAQDPFHEVKSKREKKKE  80

Query  397  NKDTTEs-rprgasssrggkgsadrYAGRGGSESL--------HGKSTYAYXENG---YT  540
            NK+ TE       ++S  G    DRYA RGGS           HGKS Y   ENG   Y 
Sbjct  81   NKEPTEPRSRGANNTSNHGGRGGDRYAARGGSNHFSSNESGFSHGKSAYK-KENGTHAYA  139

Query  541  NTKSTRTAGSTTNRWLPTISDAAGTENQ  624
             + S   AG   +R   + SD+ GTEN+
Sbjct  140  GSASG-MAGHNMSRRPTSYSDSVGTENK  166



>ref|XP_010056861.1| PREDICTED: uncharacterized protein LOC104444809 isoform X2 [Eucalyptus 
grandis]
 gb|KCW73756.1| hypothetical protein EUGRSUZ_E02361 [Eucalyptus grandis]
Length=857

 Score = 96.3 bits (238),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 104/150 (69%), Gaps = 13/150 (9%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  387
            ++ IP+GSRK+V+SLKEIV N  E EIY ALKEC+MDPNEAVNRLL+QDPFHEVKSKR+K
Sbjct  15   ISTIPTGSRKMVQSLKEIV-NCSELEIYTALKECSMDPNEAVNRLLTQDPFHEVKSKREK  73

Query  388  RKENKDTTEsrprgasssrgg--kgsadrYAGRG----GSESLHGKSTYAYXENG-YTNT  546
            +KE+KDTTE RPRG+ S+     +   +RYAGRG     S S  GK      ENG +  T
Sbjct  74   KKESKDTTEVRPRGSISTTTRGGRSGVERYAGRGRAIVPSSSEPGKQQPYKKENGSHVYT  133

Query  547  KSTRTA----GSTTNRWLPTISDAAGTENQ  624
             ST +A    G++ NR +   SDA+  EN+
Sbjct  134  GSTCSAYNMSGNSVNRQI-AHSDASAWENK  162



>emb|CDX84653.1| BnaA03g15770D [Brassica napus]
Length=813

 Score = 95.9 bits (237),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IPSGSRK+V+SLKEIV   PE+EIYA LK+CNMDPNEAVNRLLSQDPFHEVKSK++K+KE
Sbjct  13   IPSGSRKMVQSLKEIVNCCPEAEIYAVLKDCNMDPNEAVNRLLSQDPFHEVKSKKEKKKE  72

Query  397  NKDTTE  414
            N+D  +
Sbjct  73   NRDIPD  78



>ref|XP_010056862.1| PREDICTED: uncharacterized protein LOC104444809 isoform X3 [Eucalyptus 
grandis]
Length=833

 Score = 95.9 bits (237),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 104/150 (69%), Gaps = 13/150 (9%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  387
            ++ IP+GSRK+V+SLKEIV N  E EIY ALKEC+MDPNEAVNRLL+QDPFHEVKSKR+K
Sbjct  15   ISTIPTGSRKMVQSLKEIV-NCSELEIYTALKECSMDPNEAVNRLLTQDPFHEVKSKREK  73

Query  388  RKENKDTTEsrprgasssrgg--kgsadrYAGRG----GSESLHGKSTYAYXENG-YTNT  546
            +KE+KDTTE RPRG+ S+     +   +RYAGRG     S S  GK      ENG +  T
Sbjct  74   KKESKDTTEVRPRGSISTTTRGGRSGVERYAGRGRAIVPSSSEPGKQQPYKKENGSHVYT  133

Query  547  KSTRTA----GSTTNRWLPTISDAAGTENQ  624
             ST +A    G++ NR +   SDA+  EN+
Sbjct  134  GSTCSAYNMSGNSVNRQI-AHSDASAWENK  162



>ref|XP_010056860.1| PREDICTED: uncharacterized protein LOC104444809 isoform X1 [Eucalyptus 
grandis]
 gb|KCW73755.1| hypothetical protein EUGRSUZ_E02361 [Eucalyptus grandis]
Length=859

 Score = 95.9 bits (237),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 104/150 (69%), Gaps = 13/150 (9%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  387
            ++ IP+GSRK+V+SLKEIV N  E EIY ALKEC+MDPNEAVNRLL+QDPFHEVKSKR+K
Sbjct  15   ISTIPTGSRKMVQSLKEIV-NCSELEIYTALKECSMDPNEAVNRLLTQDPFHEVKSKREK  73

Query  388  RKENKDTTEsrprgasssrgg--kgsadrYAGRG----GSESLHGKSTYAYXENG-YTNT  546
            +KE+KDTTE RPRG+ S+     +   +RYAGRG     S S  GK      ENG +  T
Sbjct  74   KKESKDTTEVRPRGSISTTTRGGRSGVERYAGRGRAIVPSSSEPGKQQPYKKENGSHVYT  133

Query  547  KSTRTA----GSTTNRWLPTISDAAGTENQ  624
             ST +A    G++ NR +   SDA+  EN+
Sbjct  134  GSTCSAYNMSGNSVNRQI-AHSDASAWENK  162



>emb|CDY43334.1| BnaC03g59060D [Brassica napus]
Length=822

 Score = 95.5 bits (236),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 89/139 (64%), Gaps = 11/139 (8%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IPSGSRKIV+SLKEIV N PE+EIYA LKECNMDPNEAV+RLLSQDPFHEVKSK++K+KE
Sbjct  22   IPSGSRKIVQSLKEIV-NAPEAEIYAMLKECNMDPNEAVHRLLSQDPFHEVKSKKEKKKE  80

Query  397  NKDTTEs----rprgasssrggkgsadrYAGRGGSESLHGKSTYAYXENGYTNTKSTRTA  564
             +D  +          +    G G +DRYAGR GS  L+        ++G    KST   
Sbjct  81   TRDVPDYRLRGANNTYNRGGRGGGGSDRYAGRSGSAHLNS------TDSGNFQGKSTNKR  134

Query  565  GSTTNRWLPTISDAAGTEN  621
             S T  +  + S A+G  N
Sbjct  135  ESGTQGYTSSWSSASGVAN  153



>gb|KDP21205.1| hypothetical protein JCGZ_21676 [Jatropha curcas]
Length=866

 Score = 95.5 bits (236),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 99/160 (62%), Gaps = 30/160 (19%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  387
            ++ IP+GSRK+V+SLKEIV N PE EIYA LKECNMDPNEAVNRLLSQDPFHEVKSKR+K
Sbjct  21   ISGIPAGSRKMVQSLKEIV-NCPEPEIYAMLKECNMDPNEAVNRLLSQDPFHEVKSKREK  79

Query  388  RKENKDTTEsrprgasssrggkgsadrYAGRGGSESL----------------HGKSTYA  519
            +KENK+TT+ R RGA+++           GRGG++                  HGK  Y 
Sbjct  80   KKENKETTDPRSRGANNTTHR-------GGRGGADRYGRGSSTQPSSNEFGVSHGKPAYK  132

Query  520  YXENG---YTNTKS--TRTAGSTTNRWLPTISDAAGTENQ  624
              ENG   Y    S  +  AGS  NR     SD+  TEN+
Sbjct  133  -KENGTHAYGGGSSYVSSVAGSNVNRRPALHSDSVATENK  171



>ref|XP_001756751.1| predicted protein [Physcomitrella patens]
 gb|EDQ78348.1| predicted protein, partial [Physcomitrella patens]
Length=79

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 50/61 (82%), Gaps = 2/61 (3%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQ-DPFHEVKSKRDKRK  393
            IP+ ++K+V+ LKE+V N  E EIYA LKECNMDPNEA  RLL+Q DPFHEVK KRDK+K
Sbjct  13   IPASTKKVVQDLKEVVGNS-EEEIYAMLKECNMDPNEAAQRLLNQGDPFHEVKRKRDKKK  71

Query  394  E  396
            E
Sbjct  72   E  72



>emb|CDX90188.1| BnaA08g17960D [Brassica napus]
Length=822

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 84/122 (69%), Gaps = 12/122 (10%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IP+GSRKIV+SLKEIV N PE+EIYA LKECNMDPNEAV+RLLSQDPFHEVKSK++K+KE
Sbjct  16   IPTGSRKIVQSLKEIV-NSPEAEIYAMLKECNMDPNEAVHRLLSQDPFHEVKSKKEKKKE  74

Query  397  NKDTTEsrprgasssrggkgsadrYAGRGGSESLHGKSTYAYXENGYTNTKSTRTAGSTT  576
             +D  + R RG  ++           GRGGS+   G+S  A+      +T S    G +T
Sbjct  75   TRDVPDYRLRGGHNTYNR-------GGRGGSDRYAGRSGSAH----LNSTDSGNFQGKST  123

Query  577  NR  582
            N+
Sbjct  124  NK  125



>ref|XP_008342251.1| PREDICTED: chitinase-like protein PB1E7.04c isoform X1 [Malus 
domestica]
Length=866

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IP+G RK ++ +KEI  N+ E EI+A LKECNMDPNE   +LL QDPFHEVK KRDKRKE
Sbjct  10   IPNGVRKTIQDIKEITGNHSEEEIHAMLKECNMDPNETAQKLLLQDPFHEVKRKRDKRKE  69

Query  397  NKDTTE  414
            N +  E
Sbjct  70   NLNNKE  75



>ref|XP_008342252.1| PREDICTED: flocculation protein FLO11-like isoform X2 [Malus 
domestica]
Length=865

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IP+G RK ++ +KEI  N+ E EI+A LKECNMDPNE   +LL QDPFHEVK KRDKRKE
Sbjct  10   IPNGVRKTIQDIKEITGNHSEEEIHAMLKECNMDPNETAQKLLLQDPFHEVKRKRDKRKE  69

Query  397  NKDTTE  414
            N +  E
Sbjct  70   NLNNKE  75



>ref|XP_009109669.1| PREDICTED: RNA polymerase II degradation factor 1-like isoform 
X2 [Brassica rapa]
Length=822

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 71/138 (51%), Positives = 90/138 (65%), Gaps = 11/138 (8%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IP+GSRKIV+SLKEIV N PE+EIYA LKECNMDPNEAV+RLLSQDPFHEVKSK++K+KE
Sbjct  16   IPTGSRKIVQSLKEIV-NSPEAEIYAMLKECNMDPNEAVHRLLSQDPFHEVKSKKEKKKE  74

Query  397  NKDTTEsrprgasssrggkgsadrYAGRGGSESLHGKSTYAY---XENGYTNTKSTRTAG  567
             +D  + R RG  ++           GRGGS+   G+S   +    ++G    KST    
Sbjct  75   TRDVPDYRLRGGHNTYNR-------GGRGGSDRYGGRSGSTHLSSTDSGNFRGKSTNKRE  127

Query  568  STTNRWLPTISDAAGTEN  621
            S T  +  + S A+G  N
Sbjct  128  SGTQGYTSSWSSASGVAN  145



>ref|XP_002893558.1| hypothetical protein ARALYDRAFT_473146 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69817.1| hypothetical protein ARALYDRAFT_473146 [Arabidopsis lyrata subsp. 
lyrata]
Length=841

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 73/138 (53%), Positives = 93/138 (67%), Gaps = 11/138 (8%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IPSGSR IV+SLKEIV N PE+EIYA LKECNMDPNE VNRLLSQDPFHEVKSK++K+KE
Sbjct  25   IPSGSRIIVQSLKEIV-NSPEAEIYAMLKECNMDPNETVNRLLSQDPFHEVKSKKEKKKE  83

Query  397  NKDTTEsrprgasssrggkgsadrYAGRGGSESLHGKS---TYAYXENGYTNTKSTRTAG  567
             +D ++SRPRGA+++            RGGS+   G+S    ++  ++G    KS     
Sbjct  84   TRDISDSRPRGANNTYNR-------GARGGSDRYAGRSGSTHFSSTDSGNFQGKSANKKE  136

Query  568  STTNRWLPTISDAAGTEN  621
            S T  +L + S A+G  N
Sbjct  137  SGTQGYLGSWSSASGVAN  154



>ref|XP_009109668.1| PREDICTED: RNA polymerase II degradation factor 1-like isoform 
X1 [Brassica rapa]
Length=823

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 71/138 (51%), Positives = 90/138 (65%), Gaps = 11/138 (8%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IP+GSRKIV+SLKEIV N PE+EIYA LKECNMDPNEAV+RLLSQDPFHEVKSK++K+KE
Sbjct  16   IPTGSRKIVQSLKEIV-NSPEAEIYAMLKECNMDPNEAVHRLLSQDPFHEVKSKKEKKKE  74

Query  397  NKDTTEsrprgasssrggkgsadrYAGRGGSESLHGKSTYAY---XENGYTNTKSTRTAG  567
             +D  + R RG  ++           GRGGS+   G+S   +    ++G    KST    
Sbjct  75   TRDVPDYRLRGGHNTYNR-------GGRGGSDRYGGRSGSTHLSSTDSGNFRGKSTNKRE  127

Query  568  STTNRWLPTISDAAGTEN  621
            S T  +  + S A+G  N
Sbjct  128  SGTQGYTSSWSSASGVAN  145



>ref|XP_007214926.1| hypothetical protein PRUPE_ppa001246mg [Prunus persica]
 gb|EMJ16125.1| hypothetical protein PRUPE_ppa001246mg [Prunus persica]
Length=873

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IP+  RK ++ +KEI  N+ E EIYA LKECNMDPNE   +LL QDPFHEVK KRDKRKE
Sbjct  10   IPNSVRKTIQDIKEITGNHSEEEIYAMLKECNMDPNETAQKLLFQDPFHEVKRKRDKRKE  69

Query  397  NKDTTE  414
            N +  E
Sbjct  70   NLNNRE  75



>ref|XP_008229782.1| PREDICTED: putative GPI-anchored protein PB15E9.01c isoform X2 
[Prunus mume]
Length=874

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IP+  RK ++ +KEI  N+ E EIYA LKECNMDPNE   +LL QDPFHEVK KRDKRKE
Sbjct  10   IPNSVRKTIQDIKEITGNHSEEEIYAMLKECNMDPNETAQKLLFQDPFHEVKRKRDKRKE  69

Query  397  NKDTTE  414
            N +  E
Sbjct  70   NLNNRE  75



>ref|XP_008229781.1| PREDICTED: cell wall protein AWA1 isoform X1 [Prunus mume]
Length=875

 Score = 94.4 bits (233),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IP+  RK ++ +KEI  N+ E EIYA LKECNMDPNE   +LL QDPFHEVK KRDKRKE
Sbjct  10   IPNSVRKTIQDIKEITGNHSEEEIYAMLKECNMDPNETAQKLLFQDPFHEVKRKRDKRKE  69

Query  397  NKDTTE  414
            N +  E
Sbjct  70   NLNNRE  75



>ref|XP_009377414.1| PREDICTED: uncharacterized protein LOC103966021 [Pyrus x bretschneideri]
Length=822

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 55/69 (80%), Gaps = 1/69 (1%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  387
             A  P  +RKI++SLKEIV N PE EIY+ LKECNMDP++AV RLLS D FHEV+SKR++
Sbjct  13   AAQFPPTTRKIIQSLKEIV-NCPEPEIYSVLKECNMDPSDAVQRLLSLDTFHEVRSKRER  71

Query  388  RKENKDTTE  414
            RKE K+T +
Sbjct  72   RKEIKETQD  80



>ref|XP_010323919.1| PREDICTED: melanoma-associated antigen C1 isoform X3 [Solanum 
lycopersicum]
Length=874

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IPSG RK ++++KEI  N+ E EIYA LKEC+MDPNE   +LLSQD FHEVKSKRD+RKE
Sbjct  15   IPSGMRKTIQNIKEITGNHGEDEIYAMLKECSMDPNETTQKLLSQDTFHEVKSKRDRRKE  74

Query  397  N  399
            N
Sbjct  75   N  75



>ref|XP_010323918.1| PREDICTED: melanoma-associated antigen C1 isoform X2 [Solanum 
lycopersicum]
Length=875

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IPSG RK ++++KEI  N+ E EIYA LKEC+MDPNE   +LLSQD FHEVKSKRD+RKE
Sbjct  15   IPSGMRKTIQNIKEITGNHGEDEIYAMLKECSMDPNETTQKLLSQDTFHEVKSKRDRRKE  74

Query  397  N  399
            N
Sbjct  75   N  75



>ref|XP_010323920.1| PREDICTED: melanoma-associated antigen C1 isoform X4 [Solanum 
lycopersicum]
Length=871

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IPSG RK ++++KEI  N+ E EIYA LKEC+MDPNE   +LLSQD FHEVKSKRD+RKE
Sbjct  15   IPSGMRKTIQNIKEITGNHGEDEIYAMLKECSMDPNETTQKLLSQDTFHEVKSKRDRRKE  74

Query  397  N  399
            N
Sbjct  75   N  75



>ref|XP_010323917.1| PREDICTED: melanoma-associated antigen C1 isoform X1 [Solanum 
lycopersicum]
Length=876

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IPSG RK ++++KEI  N+ E EIYA LKEC+MDPNE   +LLSQD FHEVKSKRD+RKE
Sbjct  15   IPSGMRKTIQNIKEITGNHGEDEIYAMLKECSMDPNETTQKLLSQDTFHEVKSKRDRRKE  74

Query  397  N  399
            N
Sbjct  75   N  75



>ref|XP_008229421.1| PREDICTED: cell wall protein AWA1-like [Prunus mume]
Length=840

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 55/69 (80%), Gaps = 1/69 (1%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  387
             A +  G +K+V+SLKEIV N PE EIY+ LK+CNMDPNEAV RLLS D FHEVKSKR++
Sbjct  10   AAPLSPGGKKMVQSLKEIV-NCPEPEIYSVLKDCNMDPNEAVQRLLSLDTFHEVKSKRER  68

Query  388  RKENKDTTE  414
            RKE K+T +
Sbjct  69   RKEMKETQD  77



>gb|EEC79711.1| hypothetical protein OsI_21014 [Oryza sativa Indica Group]
Length=852

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 54/62 (87%), Gaps = 1/62 (2%)
 Frame = +1

Query  229  SRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKENKDT  408
            SRK+V+SLKEIV N PE+EIYAAL++C MDP+EAV+RLLSQD F EVKSKRDK+KE K+ 
Sbjct  26   SRKLVQSLKEIV-NRPEAEIYAALRDCGMDPDEAVSRLLSQDTFQEVKSKRDKKKEVKEI  84

Query  409  TE  414
             E
Sbjct  85   PE  86



>ref|NP_001056347.1| Os05g0566900 [Oryza sativa Japonica Group]
 gb|AAU10662.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF18261.1| Os05g0566900 [Oryza sativa Japonica Group]
 dbj|BAG89781.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00089.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64717.1| hypothetical protein OsJ_19573 [Oryza sativa Japonica Group]
Length=852

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 54/62 (87%), Gaps = 1/62 (2%)
 Frame = +1

Query  229  SRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKENKDT  408
            SRK+V+SLKEIV N PE+EIYAAL++C MDP+EAV+RLLSQD F EVKSKRDK+KE K+ 
Sbjct  26   SRKLVQSLKEIV-NRPEAEIYAALRDCGMDPDEAVSRLLSQDTFQEVKSKRDKKKEVKEI  84

Query  409  TE  414
             E
Sbjct  85   PE  86



>ref|XP_011467308.1| PREDICTED: endochitinase A isoform X1 [Fragaria vesca subsp. 
vesca]
Length=882

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IP+  RK ++ +KEI  N+ E EIYA LKECNMDPNE   +LL QDPFHEVK KRDKRKE
Sbjct  11   IPTSVRKTIQDIKEITGNHSEEEIYAMLKECNMDPNETAQKLLLQDPFHEVKRKRDKRKE  70

Query  397  N  399
            N
Sbjct  71   N  71



>emb|CDY15632.1| BnaA07g08030D [Brassica napus]
Length=786

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 109/162 (67%), Gaps = 21/162 (13%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IPSG RKIV+SLKEIV N PE+EIYA LKECNMDPNEAV+RLLSQDPFHEVKSK++K+KE
Sbjct  19   IPSGCRKIVQSLKEIV-NSPEAEIYAMLKECNMDPNEAVHRLLSQDPFHEVKSKKEKKKE  77

Query  397  NKDTTEsrprgasssrgg--kgsadrYAGRGGSE--------SLHGKSTYAYXE--NGYT  540
             +D  +SR RGA+++     +G++ RYAGR GS         +  GKST        GYT
Sbjct  78   TRDIPDSRLRGANNAYNRGGRGTSSRYAGRNGSTRFSSSGSGNFQGKSTDKKESGTQGYT  137

Query  541  NTKSTRTAGSTTNRWLPTISDAAGTENQKLV-----DGVSAA  651
            ++ S+  +G  TN    T SD+  TEN KL      DG+S++
Sbjct  138  SSWSS-ASGVATNHQT-TNSDSVVTEN-KLPSAPSGDGISSS  176



>ref|XP_009356617.1| PREDICTED: uncharacterized protein LOC103947437 isoform X1 [Pyrus 
x bretschneideri]
Length=827

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 55/69 (80%), Gaps = 1/69 (1%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  387
             A  P  ++KI++SLKEIV N PE EIY+ LKEC+MDPN+AV RLLS D FHEVKSKR++
Sbjct  13   AAQFPPMTKKIIQSLKEIV-NCPEPEIYSVLKECDMDPNDAVQRLLSLDTFHEVKSKRER  71

Query  388  RKENKDTTE  414
            RKE K+T +
Sbjct  72   RKEIKETQD  80



>ref|NP_174230.2| Kinase-related protein [Arabidopsis thaliana]
 gb|AAL36210.1| unknown protein [Arabidopsis thaliana]
 gb|AAM20314.1| unknown protein [Arabidopsis thaliana]
 gb|AEE31077.1| Kinase-related protein [Arabidopsis thaliana]
Length=831

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 100/159 (63%), Gaps = 15/159 (9%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IPSGSRKIV+SL EIV N PE+EIYA LKECNMDPNE V+RLLSQDPFHEVKSK++K+KE
Sbjct  17   IPSGSRKIVQSLTEIV-NSPEAEIYAMLKECNMDPNETVSRLLSQDPFHEVKSKKEKKKE  75

Query  397  NKDTTEsrprgasssrggkgs--adrYAGRGGSE--------SLHGKSTYAYXENGYTNT  546
             +D ++SRPRGA+++        + RYAGR GS         +  GKST          T
Sbjct  76   TRDISDSRPRGANNTYNRGARGGSARYAGRSGSTHFSSTDSGNFQGKSTNKKESGTQGYT  135

Query  547  KSTRTAGSTTNRWLPTISDAAGTENQ----KLVDGVSAA  651
             S  +A    N +    S+   TEN+     L DG+S++
Sbjct  136  SSWSSASGVANTYQTPHSEPVATENKLPPVTLGDGISSS  174



>ref|XP_009356619.1| PREDICTED: uncharacterized protein LOC103947437 isoform X3 [Pyrus 
x bretschneideri]
Length=804

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 55/69 (80%), Gaps = 1/69 (1%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  387
             A  P  ++KI++SLKEIV N PE EIY+ LKEC+MDPN+AV RLLS D FHEVKSKR++
Sbjct  13   AAQFPPMTKKIIQSLKEIV-NCPEPEIYSVLKECDMDPNDAVQRLLSLDTFHEVKSKRER  71

Query  388  RKENKDTTE  414
            RKE K+T +
Sbjct  72   RKEIKETQD  80



>ref|XP_011467310.1| PREDICTED: endochitinase A isoform X3 [Fragaria vesca subsp. 
vesca]
Length=881

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IP+  RK ++ +KEI  N+ E EIYA LKECNMDPNE   +LL QDPFHEVK KRDKRKE
Sbjct  11   IPTSVRKTIQDIKEITGNHSEEEIYAMLKECNMDPNETAQKLLLQDPFHEVKRKRDKRKE  70

Query  397  N  399
            N
Sbjct  71   N  71



>ref|XP_011467309.1| PREDICTED: endochitinase A isoform X2 [Fragaria vesca subsp. 
vesca]
Length=881

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IP+  RK ++ +KEI  N+ E EIYA LKECNMDPNE   +LL QDPFHEVK KRDKRKE
Sbjct  11   IPTSVRKTIQDIKEITGNHSEEEIYAMLKECNMDPNETAQKLLLQDPFHEVKRKRDKRKE  70

Query  397  N  399
            N
Sbjct  71   N  71



>ref|XP_009356618.1| PREDICTED: uncharacterized protein LOC103947437 isoform X2 [Pyrus 
x bretschneideri]
Length=809

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 55/69 (80%), Gaps = 1/69 (1%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  387
             A  P  ++KI++SLKEIV N PE EIY+ LKEC+MDPN+AV RLLS D FHEVKSKR++
Sbjct  13   AAQFPPMTKKIIQSLKEIV-NCPEPEIYSVLKECDMDPNDAVQRLLSLDTFHEVKSKRER  71

Query  388  RKENKDTTE  414
            RKE K+T +
Sbjct  72   RKEIKETQD  80



>ref|XP_006357672.1| PREDICTED: flocculation protein FLO11-like isoform X2 [Solanum 
tuberosum]
Length=876

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IPSG RK ++++KEI  N+ E EIYA LKEC+MDPNE   +LLSQD FHEVKSKRD+RKE
Sbjct  15   IPSGMRKTIQNIKEITGNHGEDEIYAMLKECSMDPNETTQKLLSQDTFHEVKSKRDRRKE  74

Query  397  N  399
            N
Sbjct  75   N  75



>ref|XP_006357671.1| PREDICTED: flocculation protein FLO11-like isoform X1 [Solanum 
tuberosum]
Length=877

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IPSG RK ++++KEI  N+ E EIYA LKEC+MDPNE   +LLSQD FHEVKSKRD+RKE
Sbjct  15   IPSGMRKTIQNIKEITGNHGEDEIYAMLKECSMDPNETTQKLLSQDTFHEVKSKRDRRKE  74

Query  397  N  399
            N
Sbjct  75   N  75



>ref|XP_006357673.1| PREDICTED: flocculation protein FLO11-like isoform X3 [Solanum 
tuberosum]
Length=875

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IPSG RK ++++KEI  N+ E EIYA LKEC+MDPNE   +LLSQD FHEVKSKRD+RKE
Sbjct  15   IPSGMRKTIQNIKEITGNHGEDEIYAMLKECSMDPNETTQKLLSQDTFHEVKSKRDRRKE  74

Query  397  N  399
            N
Sbjct  75   N  75



>gb|AFW83478.1| putative DUF1296 domain containing family protein, partial [Zea 
mays]
Length=600

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 56/66 (85%), Gaps = 1/66 (2%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            +P+ +RK+V+ LKEIV N P++EIYAAL+EC MDP+EAV+RLL QD F EVKSKRDK+KE
Sbjct  20   VPASARKLVQGLKEIV-NRPDAEIYAALRECGMDPDEAVSRLLCQDTFQEVKSKRDKKKE  78

Query  397  NKDTTE  414
             K+T +
Sbjct  79   VKETLD  84



>ref|XP_002870069.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46328.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=802

 Score = 93.6 bits (231),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 54/66 (82%), Gaps = 1/66 (2%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            +P+ SRK+V+ LKEIV N  E EIYA L EC+MDP+EAVNRLLSQD FHEVKSKR+K+KE
Sbjct  16   VPASSRKVVQGLKEIV-NCSELEIYAMLVECDMDPDEAVNRLLSQDTFHEVKSKREKKKE  74

Query  397  NKDTTE  414
             KD  +
Sbjct  75   TKDPAD  80



>ref|XP_009102861.1| PREDICTED: uncharacterized protein LOC103828968 isoform X1 [Brassica 
rapa]
Length=783

 Score = 93.6 bits (231),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 71/135 (53%), Positives = 87/135 (64%), Gaps = 8/135 (6%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IPSG RKIV+SLKEIV N PE+EIYA LKECNMDPNEAV+RLLSQDPFHEVKSK++K+KE
Sbjct  18   IPSGCRKIVQSLKEIV-NSPEAEIYAMLKECNMDPNEAVHRLLSQDPFHEVKSKKEKKKE  76

Query  397  NKDTTEsrprgasssrggkgsadrYAGRGGSESLHGKSTYAYXENGYTNTKSTRTAGSTT  576
             +D  +SR RG  ++           GRG S+   G S ++   +G    KST    S T
Sbjct  77   TRDIPDSRLRGTYNTYNR-------GGRGASDRYTGSSHFSSTGSGNFQGKSTDKKKSGT  129

Query  577  NRWLPTISDAAGTEN  621
                 + S A+G  N
Sbjct  130  QGHAGSWSSASGVAN  144



>ref|XP_009102862.1| PREDICTED: uncharacterized protein LOC103828968 isoform X2 [Brassica 
rapa]
Length=782

 Score = 93.6 bits (231),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 71/135 (53%), Positives = 87/135 (64%), Gaps = 8/135 (6%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IPSG RKIV+SLKEIV N PE+EIYA LKECNMDPNEAV+RLLSQDPFHEVKSK++K+KE
Sbjct  18   IPSGCRKIVQSLKEIV-NSPEAEIYAMLKECNMDPNEAVHRLLSQDPFHEVKSKKEKKKE  76

Query  397  NKDTTEsrprgasssrggkgsadrYAGRGGSESLHGKSTYAYXENGYTNTKSTRTAGSTT  576
             +D  +SR RG  ++           GRG S+   G S ++   +G    KST    S T
Sbjct  77   TRDIPDSRLRGTYNTYNR-------GGRGASDRYTGSSHFSSTGSGNFQGKSTDKKKSGT  129

Query  577  NRWLPTISDAAGTEN  621
                 + S A+G  N
Sbjct  130  QGHAGSWSSASGVAN  144



>ref|XP_007217053.1| hypothetical protein PRUPE_ppa001198mg [Prunus persica]
 gb|EMJ18252.1| hypothetical protein PRUPE_ppa001198mg [Prunus persica]
Length=883

 Score = 93.6 bits (231),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 55/69 (80%), Gaps = 1/69 (1%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  387
             A +  G +K+V+SLKEIV N PE EIY+ LK+CNMDPNEAV RLLS D FHEVKSKR++
Sbjct  10   AAPLSPGMKKMVQSLKEIV-NCPEPEIYSVLKDCNMDPNEAVQRLLSLDTFHEVKSKRER  68

Query  388  RKENKDTTE  414
            RKE K+T +
Sbjct  69   RKEMKETQD  77



>gb|KDO50974.1| hypothetical protein CISIN_1g006896mg [Citrus sinensis]
Length=627

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IP+  +K+++++KEI  N+ E EIYA LKEC+MDPNE   RLL QDPFHEVK KRDKRKE
Sbjct  18   IPNNMKKMIQNIKEITGNHSEDEIYAMLKECSMDPNETAQRLLFQDPFHEVKRKRDKRKE  77

Query  397  NKDTTE  414
            N +  E
Sbjct  78   NVNNRE  83



>ref|XP_006447832.1| hypothetical protein CICLE_v10014215mg [Citrus clementina]
 ref|XP_006469425.1| PREDICTED: hyphally regulated cell wall protein 3-like isoform 
X2 [Citrus sinensis]
 gb|ESR61072.1| hypothetical protein CICLE_v10014215mg [Citrus clementina]
Length=886

 Score = 93.6 bits (231),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IP+  +K+++++KEI  N+ E EIYA LKEC+MDPNE   RLL QDPFHEVK KRDKRKE
Sbjct  18   IPNNMKKMIQNIKEITGNHSEDEIYAMLKECSMDPNETAQRLLFQDPFHEVKRKRDKRKE  77

Query  397  NKDTTE  414
            N +  E
Sbjct  78   NVNNRE  83



>ref|XP_006447831.1| hypothetical protein CICLE_v10014215mg [Citrus clementina]
 ref|XP_006469424.1| PREDICTED: hyphally regulated cell wall protein 3-like isoform 
X1 [Citrus sinensis]
 gb|ESR61071.1| hypothetical protein CICLE_v10014215mg [Citrus clementina]
Length=887

 Score = 93.6 bits (231),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IP+  +K+++++KEI  N+ E EIYA LKEC+MDPNE   RLL QDPFHEVK KRDKRKE
Sbjct  18   IPNNMKKMIQNIKEITGNHSEDEIYAMLKECSMDPNETAQRLLFQDPFHEVKRKRDKRKE  77

Query  397  NKDTTE  414
            N +  E
Sbjct  78   NVNNRE  83



>ref|XP_008656717.1| PREDICTED: uncharacterized protein LOC103636139 [Zea mays]
 gb|AFW83479.1| putative DUF1296 domain containing family protein [Zea mays]
Length=840

 Score = 93.2 bits (230),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 56/66 (85%), Gaps = 1/66 (2%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            +P+ +RK+V+ LKEIV N P++EIYAAL+EC MDP+EAV+RLL QD F EVKSKRDK+KE
Sbjct  20   VPASARKLVQGLKEIV-NRPDAEIYAALRECGMDPDEAVSRLLCQDTFQEVKSKRDKKKE  78

Query  397  NKDTTE  414
             K+T +
Sbjct  79   VKETLD  84



>emb|CDY61669.1| BnaC01g40800D [Brassica napus]
Length=740

 Score = 93.2 bits (230),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 54/66 (82%), Gaps = 1/66 (2%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            +P+ SRK+VESLKEIV N  + EIYA L +C+MDP+E V+RLLSQD FHEVKSKRDK+KE
Sbjct  18   VPASSRKVVESLKEIV-NCSDLEIYAMLVDCDMDPDETVSRLLSQDTFHEVKSKRDKKKE  76

Query  397  NKDTTE  414
             KD  E
Sbjct  77   TKDPAE  82



>ref|XP_009131438.1| PREDICTED: flocculation protein FLO11 [Brassica rapa]
Length=780

 Score = 93.2 bits (230),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 54/66 (82%), Gaps = 1/66 (2%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            +P+ SRK+VESLKEIV N  + EIYA L +C+MDP+E V+RLLSQD FHEVKSKRDK+KE
Sbjct  19   VPASSRKVVESLKEIV-NCSDLEIYAMLVDCDMDPDETVSRLLSQDTFHEVKSKRDKKKE  77

Query  397  NKDTTE  414
             KD  E
Sbjct  78   TKDPAE  83



>emb|CDX78828.1| BnaA01g08950D [Brassica napus]
Length=698

 Score = 92.8 bits (229),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 54/66 (82%), Gaps = 1/66 (2%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            +P+ SRK+VESLKEIV N  + EIYA L +C+MDP+E V+RLLSQD FHEVKSKRDK+KE
Sbjct  19   VPASSRKVVESLKEIV-NCSDLEIYAMLVDCDMDPDETVSRLLSQDTFHEVKSKRDKKKE  77

Query  397  NKDTTE  414
             KD  E
Sbjct  78   TKDPAE  83



>ref|XP_006410569.1| hypothetical protein EUTSA_v10016218mg [Eutrema salsugineum]
 gb|ESQ52022.1| hypothetical protein EUTSA_v10016218mg [Eutrema salsugineum]
Length=840

 Score = 93.2 bits (230),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 48/52 (92%), Gaps = 1/52 (2%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFH  363
            ++ IPSGSRK+V+SLKEIV N PE+EIYA LK+CNMDPNEAVNRLLSQDPFH
Sbjct  21   ISDIPSGSRKMVQSLKEIV-NCPEAEIYAVLKDCNMDPNEAVNRLLSQDPFH  71



>ref|XP_006410568.1| hypothetical protein EUTSA_v10016218mg [Eutrema salsugineum]
 gb|ESQ52021.1| hypothetical protein EUTSA_v10016218mg [Eutrema salsugineum]
Length=885

 Score = 93.2 bits (230),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 48/52 (92%), Gaps = 1/52 (2%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFH  363
            ++ IPSGSRK+V+SLKEIV N PE+EIYA LK+CNMDPNEAVNRLLSQDPFH
Sbjct  21   ISDIPSGSRKMVQSLKEIV-NCPEAEIYAVLKDCNMDPNEAVNRLLSQDPFH  71



>ref|XP_006410567.1| hypothetical protein EUTSA_v10016218mg [Eutrema salsugineum]
 gb|ESQ52020.1| hypothetical protein EUTSA_v10016218mg [Eutrema salsugineum]
Length=842

 Score = 93.2 bits (230),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 48/52 (92%), Gaps = 1/52 (2%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFH  363
            ++ IPSGSRK+V+SLKEIV N PE+EIYA LK+CNMDPNEAVNRLLSQDPFH
Sbjct  21   ISDIPSGSRKMVQSLKEIV-NCPEAEIYAVLKDCNMDPNEAVNRLLSQDPFH  71



>gb|KFK36320.1| hypothetical protein AALP_AA4G107400 [Arabis alpina]
Length=834

 Score = 93.2 bits (230),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 51/69 (74%), Positives = 62/69 (90%), Gaps = 1/69 (1%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  387
            ++ IPSGSRK+V+SLKEIV N PE+EIYA LK+CNMDPNEAVNRLLSQDPFHEVKSK++K
Sbjct  22   ISDIPSGSRKMVQSLKEIV-NCPEAEIYAVLKDCNMDPNEAVNRLLSQDPFHEVKSKKEK  80

Query  388  RKENKDTTE  414
            +KE +D  +
Sbjct  81   KKETRDIPD  89



>ref|XP_010102151.1| hypothetical protein L484_021385 [Morus notabilis]
 gb|EXB92401.1| hypothetical protein L484_021385 [Morus notabilis]
Length=826

 Score = 92.8 bits (229),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 55/62 (89%), Gaps = 1/62 (2%)
 Frame = +1

Query  229  SRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKENKDT  408
            ++K++++LKEIV + PESEIYA LKECNMDP++AV RLLSQD FHEVKSKR++RKE K+T
Sbjct  19   TKKMIQNLKEIV-DCPESEIYAVLKECNMDPDDAVQRLLSQDTFHEVKSKRERRKEMKET  77

Query  409  TE  414
             E
Sbjct  78   QE  79



>ref|NP_174229.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE31075.1| uncharacterized protein AT1G29350 [Arabidopsis thaliana]
Length=831

 Score = 92.8 bits (229),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 94/137 (69%), Gaps = 9/137 (7%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IPSGSRKIV+SL EIV N PE+EIYA LKECNMDPNE V+RLLSQDPFHEVKSK++K+KE
Sbjct  17   IPSGSRKIVQSLTEIV-NSPEAEIYAMLKECNMDPNETVSRLLSQDPFHEVKSKKEKKKE  75

Query  397  NKDTTEsrprgasssrggkgs--adrYAGRGGSESLHGKSTYAYXENGYTNTKSTRTAGS  570
             +D ++SRPRGA+++        + RYAGR G  S H  ST    ++G    KST    S
Sbjct  76   TRDISDSRPRGANNTYNRGARGGSARYAGRSG--STHFSST----DSGNFQGKSTNKKES  129

Query  571  TTNRWLPTISDAAGTEN  621
             T  +  + S A+G  N
Sbjct  130  GTQGYTSSWSSASGVAN  146



>ref|XP_010478296.1| PREDICTED: probable serine/threonine-protein kinase yakA [Camelina 
sativa]
Length=845

 Score = 92.8 bits (229),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 78/145 (54%), Positives = 96/145 (66%), Gaps = 11/145 (8%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IPSGSR+IV+SLKEIV N PE+EIYA LKECNM+PNEAV RLLSQDPFHEVKSK++K+KE
Sbjct  20   IPSGSREIVKSLKEIV-NAPEAEIYAMLKECNMEPNEAVARLLSQDPFHEVKSKKEKKKE  78

Query  397  NKDTTEsrprgasssrggkgs--adrYAGRGGSE--------SLHGKSTYAYXENGYTNT  546
             +DT +SRPRGA+++        +DRY+GRGGS         +  GKST          T
Sbjct  79   TRDTPDSRPRGANNTYNRGARGGSDRYSGRGGSTHFSSTDSGNFQGKSTNKKESGPQGYT  138

Query  547  KSTRTAGSTTNRWLPTISDAAGTEN  621
             S  +A   T+      SD+  TEN
Sbjct  139  ASWSSASGVTDYHQTQNSDSVATEN  163



>ref|XP_008342489.1| PREDICTED: uncharacterized protein LOC103405294 [Malus domestica]
Length=843

 Score = 92.8 bits (229),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 55/68 (81%), Gaps = 1/68 (1%)
 Frame = +1

Query  211  AMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKR  390
            A  P  +RKI++SLKEIV N PE EIY+ LKEC+MDP++AV RLLS D FHEVKSKR++R
Sbjct  14   AQFPPTTRKIIQSLKEIV-NCPEPEIYSVLKECSMDPSDAVQRLLSLDTFHEVKSKRERR  72

Query  391  KENKDTTE  414
            KE K+T +
Sbjct  73   KEIKETQD  80



>gb|AAL58943.1|AF462857_1 At1g29350/F15D2_27 [Arabidopsis thaliana]
Length=832

 Score = 92.8 bits (229),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 94/137 (69%), Gaps = 9/137 (7%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IPSGSRKIV+SL EIV N PE+EIYA LKECNMDPNE V+RLLSQDPFHEVKSK++K+KE
Sbjct  17   IPSGSRKIVQSLTEIV-NSPEAEIYAMLKECNMDPNETVSRLLSQDPFHEVKSKKEKKKE  75

Query  397  NKDTTEsrprgasssrggkgs--adrYAGRGGSESLHGKSTYAYXENGYTNTKSTRTAGS  570
             +D ++SRPRGA+++        + RYAGR G  S H  ST    ++G    KST    S
Sbjct  76   TRDISDSRPRGANNTYNRGARGGSARYAGRSG--STHFSST----DSGNFQGKSTNKKES  129

Query  571  TTNRWLPTISDAAGTEN  621
             T  +  + S A+G  N
Sbjct  130  GTQGYTSSWSSASGVAN  146



>ref|XP_008362365.1| PREDICTED: uncharacterized protein LOC103426056 [Malus domestica]
Length=843

 Score = 92.8 bits (229),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 55/68 (81%), Gaps = 1/68 (1%)
 Frame = +1

Query  211  AMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKR  390
            A  P  +RKI++SLKEIV N PE EIY+ LKEC+MDP++AV RLLS D FHEVKSKR++R
Sbjct  14   AQFPPTTRKIIQSLKEIV-NCPEPEIYSVLKECSMDPSDAVQRLLSLDTFHEVKSKRERR  72

Query  391  KENKDTTE  414
            KE K+T +
Sbjct  73   KEIKETQD  80



>ref|XP_002320531.2| hypothetical protein POPTR_0014s16780g [Populus trichocarpa]
 gb|EEE98846.2| hypothetical protein POPTR_0014s16780g [Populus trichocarpa]
Length=886

 Score = 92.4 bits (228),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IPS +RK ++++KEI  N+ + EIYA LKEC+MDPNE   +LLSQDPFHEVK KRD++KE
Sbjct  10   IPSNARKTIQNIKEIAGNHSDEEIYAMLKECSMDPNETAQKLLSQDPFHEVKRKRDRKKE  69

Query  397  NKDTTE  414
            N    E
Sbjct  70   NAHNRE  75



>ref|XP_011008079.1| PREDICTED: flocculation protein FLO11 [Populus euphratica]
Length=886

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IPS +RK ++++KEI  N+ + EIYA LKEC+MDPNE   +LLSQDPFHEVK KRD++KE
Sbjct  10   IPSNARKTIQNIKEIAGNHSDEEIYAMLKECSMDPNETAQKLLSQDPFHEVKRKRDRKKE  69

Query  397  NKDTTE  414
            N    E
Sbjct  70   NAHNRE  75



>ref|NP_001043788.1| Os01g0663800 [Oryza sativa Japonica Group]
 dbj|BAD72338.1| TA9 protein-like [Oryza sativa Japonica Group]
 dbj|BAD72381.1| TA9 protein-like [Oryza sativa Japonica Group]
 dbj|BAF05702.1| Os01g0663800 [Oryza sativa Japonica Group]
 gb|EEE55130.1| hypothetical protein OsJ_02914 [Oryza sativa Japonica Group]
Length=851

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 56/67 (84%), Gaps = 2/67 (3%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            +P  +RK+V+ LKEIV N P++EIYAAL++C MDP+EAV+RLLSQD F EVKSKRDK+KE
Sbjct  23   VPGSARKLVQGLKEIV-NRPDAEIYAALRDCGMDPDEAVSRLLSQDTFQEVKSKRDKKKE  81

Query  397  -NKDTTE  414
             NK+  E
Sbjct  82   VNKEALE  88



>ref|XP_007048866.1| Uncharacterized protein TCM_001879 [Theobroma cacao]
 gb|EOX93023.1| Uncharacterized protein TCM_001879 [Theobroma cacao]
Length=873

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 55/67 (82%), Gaps = 1/67 (1%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIV-RNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRK  393
            IP+  +K+V+ LKE+V  N  +SEIYA L++CNMDPNEAV RLLSQD FH+VKS+R++RK
Sbjct  23   IPASVKKVVQDLKEVVGNNCTDSEIYAVLRDCNMDPNEAVQRLLSQDTFHKVKSRRERRK  82

Query  394  ENKDTTE  414
            E K+T E
Sbjct  83   EMKETQE  89



>ref|XP_006857739.1| hypothetical protein AMTR_s00061p00187940 [Amborella trichopoda]
 gb|ERN19206.1| hypothetical protein AMTR_s00061p00187940 [Amborella trichopoda]
Length=909

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +1

Query  211  AMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKR  390
            A IPS  RK+++++KEI  N+ + EIYA LKECNMDPNE   +LL QD FHEV+ KRDKR
Sbjct  11   ASIPSSVRKMIQNIKEIAGNHHDDEIYAMLKECNMDPNETTQKLLLQDTFHEVRRKRDKR  70

Query  391  KENKDTTE  414
            KEN + T+
Sbjct  71   KENLNNTD  78



>ref|XP_010434569.1| PREDICTED: probable serine/threonine-protein kinase yakA isoform 
X1 [Camelina sativa]
 ref|XP_010434570.1| PREDICTED: probable serine/threonine-protein kinase yakA isoform 
X2 [Camelina sativa]
Length=799

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 55/68 (81%), Gaps = 1/68 (1%)
 Frame = +1

Query  211  AMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKR  390
            A +P+ SRK+V+SLKEIV N  E EIYA L EC+MDP+E V+RLLSQD FHEVKSKR+K+
Sbjct  15   AGVPASSRKVVQSLKEIV-NCSELEIYAMLVECDMDPDETVSRLLSQDTFHEVKSKREKK  73

Query  391  KENKDTTE  414
            KE KD  +
Sbjct  74   KETKDPAD  81



>ref|XP_010434571.1| PREDICTED: probable serine/threonine-protein kinase yakA isoform 
X3 [Camelina sativa]
Length=798

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 55/68 (81%), Gaps = 1/68 (1%)
 Frame = +1

Query  211  AMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKR  390
            A +P+ SRK+V+SLKEIV N  E EIYA L EC+MDP+E V+RLLSQD FHEVKSKR+K+
Sbjct  15   AGVPASSRKVVQSLKEIV-NCSELEIYAMLVECDMDPDETVSRLLSQDTFHEVKSKREKK  73

Query  391  KENKDTTE  414
            KE KD  +
Sbjct  74   KETKDPAD  81



>ref|XP_009361530.1| PREDICTED: mucin-12 isoform X2 [Pyrus x bretschneideri]
Length=860

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IP+  RK ++ +KEI  N+ E EI+A LKECNMDPNE   +LL QDPFHEVK KRDKRKE
Sbjct  10   IPNSVRKTIQDIKEITGNHSEEEIHAMLKECNMDPNETAQKLLLQDPFHEVKRKRDKRKE  69

Query  397  NKDTTE  414
            N +  E
Sbjct  70   NLNNKE  75



>ref|XP_009361529.1| PREDICTED: uncharacterized protein LOC103951798 isoform X1 [Pyrus 
x bretschneideri]
Length=861

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IP+  RK ++ +KEI  N+ E EI+A LKECNMDPNE   +LL QDPFHEVK KRDKRKE
Sbjct  10   IPNSVRKTIQDIKEITGNHSEEEIHAMLKECNMDPNETAQKLLLQDPFHEVKRKRDKRKE  69

Query  397  NKDTTE  414
            N +  E
Sbjct  70   NLNNKE  75



>ref|XP_010460714.1| PREDICTED: putative uncharacterized protein DDB_G0271606 isoform 
X1 [Camelina sativa]
Length=843

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 77/145 (53%), Positives = 95/145 (66%), Gaps = 11/145 (8%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IPSGSR+IV+SLKEIV N PE+EIYA LKECNM+PNEAV RLLSQDPFHEVKSK++K+KE
Sbjct  20   IPSGSREIVKSLKEIV-NAPEAEIYAMLKECNMEPNEAVARLLSQDPFHEVKSKKEKKKE  78

Query  397  NKDTTEsrprgasssrggkgs--adrYAGRGGSE--------SLHGKSTYAYXENGYTNT  546
             +DT +SRPRGA+++        +DRY+GRGGS         +  GKST          T
Sbjct  79   TRDTPDSRPRGANNTYNRGARGGSDRYSGRGGSTHFSSTDSGNFQGKSTNKKESGPQGYT  138

Query  547  KSTRTAGSTTNRWLPTISDAAGTEN  621
             S  +A    +      SD+  TEN
Sbjct  139  ASWSSASGVADHHQTQNSDSVATEN  163



>ref|XP_010460715.1| PREDICTED: putative uncharacterized protein DDB_G0271606 isoform 
X2 [Camelina sativa]
Length=842

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 77/145 (53%), Positives = 95/145 (66%), Gaps = 11/145 (8%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IPSGSR+IV+SLKEIV N PE+EIYA LKECNM+PNEAV RLLSQDPFHEVKSK++K+KE
Sbjct  20   IPSGSREIVKSLKEIV-NAPEAEIYAMLKECNMEPNEAVARLLSQDPFHEVKSKKEKKKE  78

Query  397  NKDTTEsrprgasssrggkgs--adrYAGRGGSE--------SLHGKSTYAYXENGYTNT  546
             +DT +SRPRGA+++        +DRY+GRGGS         +  GKST          T
Sbjct  79   TRDTPDSRPRGANNTYNRGARGGSDRYSGRGGSTHFSSTDSGNFQGKSTNKKESGPQGYT  138

Query  547  KSTRTAGSTTNRWLPTISDAAGTEN  621
             S  +A    +      SD+  TEN
Sbjct  139  ASWSSASGVADHHQTQNSDSVATEN  163



>ref|XP_010449499.1| PREDICTED: uncharacterized protein LOC104731723 isoform X2 [Camelina 
sativa]
Length=794

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 54/66 (82%), Gaps = 1/66 (2%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            +P+ SRK+V+SLKEIV N  E EIYA L EC+MDP+E V+RLLSQD FHEVKSKR+K+KE
Sbjct  17   VPASSRKVVQSLKEIV-NCSEVEIYAMLVECDMDPDETVSRLLSQDTFHEVKSKREKKKE  75

Query  397  NKDTTE  414
             KD  +
Sbjct  76   TKDPAD  81



>ref|XP_010449498.1| PREDICTED: uncharacterized protein LOC104731723 isoform X1 [Camelina 
sativa]
Length=795

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 54/66 (82%), Gaps = 1/66 (2%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            +P+ SRK+V+SLKEIV N  E EIYA L EC+MDP+E V+RLLSQD FHEVKSKR+K+KE
Sbjct  17   VPASSRKVVQSLKEIV-NCSEVEIYAMLVECDMDPDETVSRLLSQDTFHEVKSKREKKKE  75

Query  397  NKDTTE  414
             KD  +
Sbjct  76   TKDPAD  81



>gb|KDO60962.1| hypothetical protein CISIN_1g0031901mg, partial [Citrus sinensis]
 gb|KDO60963.1| hypothetical protein CISIN_1g0031901mg, partial [Citrus sinensis]
 gb|KDO60964.1| hypothetical protein CISIN_1g0031901mg, partial [Citrus sinensis]
Length=81

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 50/61 (82%), Gaps = 1/61 (2%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIV-RNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRK  393
            IP+ ++KIV++LKE + +N  +SEIYA L ECNMDPN+A  RLLSQD F EVKSKR++RK
Sbjct  21   IPAAAKKIVQNLKETLNKNCTDSEIYAVLVECNMDPNDAFQRLLSQDAFKEVKSKRERRK  80

Query  394  E  396
            E
Sbjct  81   E  81



>ref|XP_010439897.1| PREDICTED: uncharacterized protein LOC104723267 isoform X1 [Camelina 
sativa]
Length=799

 Score = 91.3 bits (225),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 54/66 (82%), Gaps = 1/66 (2%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            +P+ SRK+V+SLKEIV N  E EIYA L EC+MDP+E V+RLLSQD FHEVKSKR+K+KE
Sbjct  17   VPASSRKVVQSLKEIV-NCSELEIYAMLVECDMDPDETVSRLLSQDTFHEVKSKREKKKE  75

Query  397  NKDTTE  414
             KD  +
Sbjct  76   TKDPAD  81



>ref|XP_010439898.1| PREDICTED: uncharacterized protein LOC104723267 isoform X2 [Camelina 
sativa]
Length=798

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 54/66 (82%), Gaps = 1/66 (2%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            +P+ SRK+V+SLKEIV N  E EIYA L EC+MDP+E V+RLLSQD FHEVKSKR+K+KE
Sbjct  17   VPASSRKVVQSLKEIV-NCSELEIYAMLVECDMDPDETVSRLLSQDTFHEVKSKREKKKE  75

Query  397  NKDTTE  414
             KD  +
Sbjct  76   TKDPAD  81



>tpg|DAA58234.1| TPA: putative DUF1296 domain containing family protein [Zea mays]
Length=821

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 56/91 (62%), Positives = 70/91 (77%), Gaps = 1/91 (1%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            +P+ +RK+V+ LKEIV N P++EIYAAL+ECNMDP+EAV+RLLSQD F EVKSKRD++KE
Sbjct  17   VPASARKLVQGLKEIV-NRPDAEIYAALRECNMDPDEAVSRLLSQDTFQEVKSKRDRKKE  75

Query  397  NKDTTEsrprgasssrggkgsadrYAGRGGS  489
             K+T E R RGAS+S          AGRG S
Sbjct  76   VKETPEPRSRGASNSSRSSRGGVDRAGRGNS  106



>ref|XP_008671999.1| PREDICTED: uncharacterized protein LOC100191159 isoform X1 [Zea 
mays]
 tpg|DAA58235.1| TPA: putative DUF1296 domain containing family protein [Zea mays]
Length=842

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 56/91 (62%), Positives = 70/91 (77%), Gaps = 1/91 (1%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            +P+ +RK+V+ LKEIV N P++EIYAAL+ECNMDP+EAV+RLLSQD F EVKSKRD++KE
Sbjct  17   VPASARKLVQGLKEIV-NRPDAEIYAALRECNMDPDEAVSRLLSQDTFQEVKSKRDRKKE  75

Query  397  NKDTTEsrprgasssrggkgsadrYAGRGGS  489
             K+T E R RGAS+S          AGRG S
Sbjct  76   VKETPEPRSRGASNSSRSSRGGVDRAGRGNS  106



>ref|XP_010547195.1| PREDICTED: uncharacterized protein LOC104819030 isoform X3 [Tarenaya 
hassleriana]
Length=814

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 52/70 (74%), Gaps = 4/70 (6%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVR-NYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRK  393
            IP+ +RK++ S+KEI   NY E EI A L EC+MDP+EA  RLL QDPFHEVK KRDKRK
Sbjct  10   IPASTRKMIHSIKEITAGNYSEDEILAMLHECDMDPDEAAQRLLLQDPFHEVKKKRDKRK  69

Query  394  E---NKDTTE  414
            E   NKD+ E
Sbjct  70   ENLSNKDSAE  79



>ref|XP_011007010.1| PREDICTED: uncharacterized protein LOC105112841 isoform X1 [Populus 
euphratica]
Length=893

 Score = 90.9 bits (224),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IP   RK ++++KEI  N+ + EIYA LKEC+MDPNE   +LLSQDPFHEVK KRD++KE
Sbjct  10   IPGNVRKTIQNIKEITGNHSDEEIYAMLKECSMDPNETAQKLLSQDPFHEVKRKRDRKKE  69

Query  397  NKDTTE  414
            N +  E
Sbjct  70   NMNNRE  75



>ref|XP_011007012.1| PREDICTED: uncharacterized protein LOC105112841 isoform X2 [Populus 
euphratica]
Length=888

 Score = 90.9 bits (224),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IP   RK ++++KEI  N+ + EIYA LKEC+MDPNE   +LLSQDPFHEVK KRD++KE
Sbjct  10   IPGNVRKTIQNIKEITGNHSDEEIYAMLKECSMDPNETAQKLLSQDPFHEVKRKRDRKKE  69

Query  397  NKDTTE  414
            N +  E
Sbjct  70   NMNNRE  75



>ref|XP_010547194.1| PREDICTED: uncharacterized protein LOC104819030 isoform X2 [Tarenaya 
hassleriana]
Length=843

 Score = 90.5 bits (223),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 52/70 (74%), Gaps = 4/70 (6%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVR-NYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRK  393
            IP+ +RK++ S+KEI   NY E EI A L EC+MDP+EA  RLL QDPFHEVK KRDKRK
Sbjct  10   IPASTRKMIHSIKEITAGNYSEDEILAMLHECDMDPDEAAQRLLLQDPFHEVKKKRDKRK  69

Query  394  E---NKDTTE  414
            E   NKD+ E
Sbjct  70   ENLSNKDSAE  79



>ref|XP_010547193.1| PREDICTED: uncharacterized protein LOC104819030 isoform X1 [Tarenaya 
hassleriana]
Length=848

 Score = 90.5 bits (223),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 52/70 (74%), Gaps = 4/70 (6%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVR-NYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRK  393
            IP+ +RK++ S+KEI   NY E EI A L EC+MDP+EA  RLL QDPFHEVK KRDKRK
Sbjct  10   IPASTRKMIHSIKEITAGNYSEDEILAMLHECDMDPDEAAQRLLLQDPFHEVKKKRDKRK  69

Query  394  E---NKDTTE  414
            E   NKD+ E
Sbjct  70   ENLSNKDSAE  79



>gb|KDP29958.1| hypothetical protein JCGZ_18527 [Jatropha curcas]
Length=892

 Score = 90.5 bits (223),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IPS  RK ++++KEI  N+ E EIYA LK+C+MDPNE   +LLSQDPF EVK KRD+RKE
Sbjct  10   IPSNVRKTIQNIKEITGNHSEDEIYAMLKDCSMDPNETAQKLLSQDPFREVKRKRDRRKE  69

Query  397  NKDTTE  414
            N +  E
Sbjct  70   NMNNKE  75



>ref|XP_006407810.1| hypothetical protein EUTSA_v10020055mg [Eutrema salsugineum]
 gb|ESQ49263.1| hypothetical protein EUTSA_v10020055mg [Eutrema salsugineum]
Length=846

 Score = 90.1 bits (222),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 51/70 (73%), Gaps = 4/70 (6%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVR-NYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRK  393
            IP+ +RK ++ +KEI   NY E EI+A L ECNMDP+E   RLL QDPFHEVK KRDKRK
Sbjct  10   IPASTRKTIQDIKEITAGNYSEDEIHAMLHECNMDPDETAQRLLLQDPFHEVKKKRDKRK  69

Query  394  E---NKDTTE  414
            E   NKD+ E
Sbjct  70   ENSSNKDSVE  79



>ref|XP_008380020.1| PREDICTED: flocculation protein FLO11-like isoform X1 [Malus 
domestica]
Length=866

 Score = 90.1 bits (222),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IP+  RK ++ +KEI  N+ E EI+A LKECNMDP+E   +LL QDPFHEVK KRDKRKE
Sbjct  10   IPNSVRKTIQDIKEITGNHSEEEIHAMLKECNMDPDETAQKLLFQDPFHEVKRKRDKRKE  69

Query  397  NKDTTE  414
            N +  E
Sbjct  70   NLNNKE  75



>ref|XP_009407930.1| PREDICTED: uncharacterized protein LOC103990491 [Musa acuminata 
subsp. malaccensis]
Length=895

 Score = 90.1 bits (222),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IP+G R  ++++KEI  N+ + EIYA LKEC MDPNE   +LL QDPFHEVK KRD+RKE
Sbjct  10   IPAGVRPTIQNIKEIAGNHSDEEIYAMLKECGMDPNETAQKLLLQDPFHEVKRKRDRRKE  69

Query  397  N  399
            N
Sbjct  70   N  70



>ref|XP_008380021.1| PREDICTED: flocculation protein FLO11-like isoform X2 [Malus 
domestica]
Length=865

 Score = 90.1 bits (222),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IP+  RK ++ +KEI  N+ E EI+A LKECNMDP+E   +LL QDPFHEVK KRDKRKE
Sbjct  10   IPNSVRKTIQDIKEITGNHSEEEIHAMLKECNMDPDETAQKLLFQDPFHEVKRKRDKRKE  69

Query  397  NKDTTE  414
            N +  E
Sbjct  70   NLNNKE  75



>ref|XP_010456509.1| PREDICTED: uncharacterized protein LOC104737938 [Camelina sativa]
Length=842

 Score = 90.1 bits (222),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 52/70 (74%), Gaps = 4/70 (6%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVR-NYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRK  393
            IP+ +RKI++++KE    NY E EI+A L ECNMDP+E   RLL QDPFHEVK KRDKRK
Sbjct  10   IPASTRKIIQNIKETTAGNYSEDEIHAMLHECNMDPDETAQRLLLQDPFHEVKKKRDKRK  69

Query  394  E---NKDTTE  414
            E   NKD+ E
Sbjct  70   ENINNKDSAE  79



>ref|XP_004502111.1| PREDICTED: flocculation protein FLO11-like [Cicer arietinum]
Length=874

 Score = 89.7 bits (221),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IPSG RK ++++KEI  N+ + EIYA LKEC+MDPNE   +LL QD FHEVK K+DKRKE
Sbjct  10   IPSGVRKTIQNIKEITGNHSDDEIYAMLKECSMDPNETAQKLLFQDTFHEVKRKKDKRKE  69

Query  397  NKDTTE  414
            N +  E
Sbjct  70   NVNNRE  75



>ref|XP_009391913.1| PREDICTED: uncharacterized protein LOC103977959 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=895

 Score = 89.7 bits (221),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IP+G R+ ++++KEI  N+ + EIYA LKEC MDPNE   +LL QDPFHEVK KRDKRKE
Sbjct  10   IPAGVRRTIQNIKEIAGNHSDEEIYAMLKECGMDPNETAQKLLLQDPFHEVKRKRDKRKE  69



>ref|XP_009391914.1| PREDICTED: uncharacterized protein LOC103977959 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=894

 Score = 89.7 bits (221),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IP+G R+ ++++KEI  N+ + EIYA LKEC MDPNE   +LL QDPFHEVK KRDKRKE
Sbjct  10   IPAGVRRTIQNIKEIAGNHSDEEIYAMLKECGMDPNETAQKLLLQDPFHEVKRKRDKRKE  69



>gb|KFK28492.1| hypothetical protein AALP_AA7G003100 [Arabis alpina]
Length=796

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 51/66 (77%), Gaps = 1/66 (2%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IP+ SRK+V  LKEIV N  + EIY  L ECNMDP+E VNRLLSQD FHEVKSKR+K+KE
Sbjct  17   IPASSRKVVMGLKEIV-NCSDLEIYTMLVECNMDPDETVNRLLSQDTFHEVKSKREKKKE  75

Query  397  NKDTTE  414
             KD  +
Sbjct  76   TKDPMD  81



>gb|KFK28493.1| hypothetical protein AALP_AA7G003100 [Arabis alpina]
Length=797

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 51/66 (77%), Gaps = 1/66 (2%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IP+ SRK+V  LKEIV N  + EIY  L ECNMDP+E VNRLLSQD FHEVKSKR+K+KE
Sbjct  17   IPASSRKVVMGLKEIV-NCSDLEIYTMLVECNMDPDETVNRLLSQDTFHEVKSKREKKKE  75

Query  397  NKDTTE  414
             KD  +
Sbjct  76   TKDPMD  81



>ref|XP_010273948.1| PREDICTED: uncharacterized protein LOC104609354 isoform X2 [Nelumbo 
nucifera]
Length=857

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +1

Query  214  MIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRK  393
            ++P+  RK ++S+KEIV N+ E++IY  LKE NMDPNE   +LL+QDPFHEVK +RDKRK
Sbjct  13   ILPARVRKTIQSIKEIVGNHSEADIYVMLKETNMDPNETAQKLLNQDPFHEVKRRRDKRK  72

Query  394  EN  399
            EN
Sbjct  73   EN  74



>ref|XP_002445374.1| hypothetical protein SORBIDRAFT_07g013800 [Sorghum bicolor]
 gb|EES14869.1| hypothetical protein SORBIDRAFT_07g013800 [Sorghum bicolor]
Length=70

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IP+G+R+ V  +KEI   + + E+YA L+ECNMDPNE   RLL +D FHEVK KRDK+KE
Sbjct  9    IPAGARRTVADIKEIAGGHTDEEVYAMLRECNMDPNETAQRLLLEDTFHEVKRKRDKKKE  68



>ref|XP_006361347.1| PREDICTED: dentin sialophosphoprotein-like isoform X3 [Solanum 
tuberosum]
Length=837

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +1

Query  214  MIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRK  393
            ++ +G R+I+ES+KE+V N+ +++IY ALKE NMDPNE   +LL+QDPFHEVK KRD++K
Sbjct  13   VLSAGVREILESIKEVVGNHSDADIYVALKETNMDPNETAQKLLNQDPFHEVKRKRDRKK  72

Query  394  EN  399
            EN
Sbjct  73   EN  74



>ref|XP_006361346.1| PREDICTED: dentin sialophosphoprotein-like isoform X2 [Solanum 
tuberosum]
Length=838

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +1

Query  214  MIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRK  393
            ++ +G R+I+ES+KE+V N+ +++IY ALKE NMDPNE   +LL+QDPFHEVK KRD++K
Sbjct  13   VLSAGVREILESIKEVVGNHSDADIYVALKETNMDPNETAQKLLNQDPFHEVKRKRDRKK  72

Query  394  EN  399
            EN
Sbjct  73   EN  74



>ref|XP_006361345.1| PREDICTED: dentin sialophosphoprotein-like isoform X1 [Solanum 
tuberosum]
Length=839

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +1

Query  214  MIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRK  393
            ++ +G R+I+ES+KE+V N+ +++IY ALKE NMDPNE   +LL+QDPFHEVK KRD++K
Sbjct  13   VLSAGVREILESIKEVVGNHSDADIYVALKETNMDPNETAQKLLNQDPFHEVKRKRDRKK  72

Query  394  EN  399
            EN
Sbjct  73   EN  74



>ref|XP_010273947.1| PREDICTED: uncharacterized protein LOC104609354 isoform X1 [Nelumbo 
nucifera]
Length=873

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +1

Query  214  MIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRK  393
            ++P+  RK ++S+KEIV N+ E++IY  LKE NMDPNE   +LL+QDPFHEVK +RDKRK
Sbjct  13   ILPARVRKTIQSIKEIVGNHSEADIYVMLKETNMDPNETAQKLLNQDPFHEVKRRRDKRK  72

Query  394  EN  399
            EN
Sbjct  73   EN  74



>ref|XP_002881327.1| hypothetical protein ARALYDRAFT_321144 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57586.1| hypothetical protein ARALYDRAFT_321144 [Arabidopsis lyrata subsp. 
lyrata]
Length=865

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 48/52 (92%), Gaps = 1/52 (2%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFH  363
            ++ IPSGS+K+V+SLKEIV N PE+EIYA LK+CNMDPNEAV+RLLSQDPFH
Sbjct  21   ISDIPSGSKKMVQSLKEIV-NCPEAEIYAVLKDCNMDPNEAVSRLLSQDPFH  71



>ref|XP_010464402.1| PREDICTED: uncharacterized protein LOC104744960 isoform X1 [Camelina 
sativa]
 ref|XP_010464403.1| PREDICTED: uncharacterized protein LOC104744960 isoform X2 [Camelina 
sativa]
Length=840

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 67/110 (61%), Gaps = 4/110 (4%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVR-NYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRK  393
            IP+ +RK+++++KE    NY E EI+A L ECNMDP+E   RLL QDPFHEVK KRDKRK
Sbjct  10   IPASTRKMIQNIKETTAGNYSEDEIHAMLHECNMDPDETAQRLLLQDPFHEVKKKRDKRK  69

Query  394  EN---KDTTEsrprgasssrggkgsadrYAGRGGSESLHGKSTYAYXENG  534
            EN   KD+ ES  R   + RG +     ++ R  S  + G       ENG
Sbjct  70   ENINSKDSAESPWRSGGAGRGSRAGRGNFSSRHASHDVAGAKNSFRKENG  119



>ref|NP_193549.5| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE84004.1| uncharacterized protein AT4G18150 [Arabidopsis thaliana]
Length=758

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 52/63 (83%), Gaps = 1/63 (2%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            +P+ SRK+++ LKEIV    E EIYA L EC+M+P+EAVNRLLSQD FHEVKSKR+K+KE
Sbjct  15   VPASSRKVIQDLKEIVECS-ELEIYAMLVECDMNPDEAVNRLLSQDTFHEVKSKREKKKE  73

Query  397  NKD  405
             KD
Sbjct  74   TKD  76



>ref|XP_006296980.1| hypothetical protein CARUB_v10012975mg [Capsella rubella]
 gb|EOA29878.1| hypothetical protein CARUB_v10012975mg [Capsella rubella]
Length=838

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 52/70 (74%), Gaps = 4/70 (6%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVR-NYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRK  393
            IP+ +RK+++++KE    NY E EI+A L ECNMDP+E   RLL QDPFHEVK KRDKRK
Sbjct  10   IPASTRKMIQNIKETTAGNYSEDEIHAMLNECNMDPDETAQRLLLQDPFHEVKKKRDKRK  69

Query  394  E---NKDTTE  414
            E   NKD+ E
Sbjct  70   ENTGNKDSAE  79



>ref|XP_009757818.1| PREDICTED: uncharacterized protein LOC104210585 isoform X3 [Nicotiana 
sylvestris]
Length=832

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +1

Query  214  MIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRK  393
            ++ +G R+I+ES+KE+V N+ +++IY ALKE NMDPNE   +LL+QDPFHEVK +RD++K
Sbjct  15   ILSAGVREILESIKEVVGNHSDADIYVALKETNMDPNETAQKLLNQDPFHEVKRRRDRKK  74

Query  394  EN  399
            EN
Sbjct  75   EN  76



>ref|XP_010486335.1| PREDICTED: uncharacterized protein LOC104764492 [Camelina sativa]
Length=842

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 52/70 (74%), Gaps = 4/70 (6%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVR-NYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRK  393
            IP+ +RK+++++KE    NY E EI+A L ECNMDP+E   RLL QDPFHEVK KRDKRK
Sbjct  10   IPASTRKMIQNIKETTAGNYSEDEIHAMLHECNMDPDETAQRLLLQDPFHEVKKKRDKRK  69

Query  394  E---NKDTTE  414
            E   NKD+ E
Sbjct  70   ENINNKDSAE  79



>ref|XP_009757817.1| PREDICTED: uncharacterized protein LOC104210585 isoform X2 [Nicotiana 
sylvestris]
Length=833

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +1

Query  214  MIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRK  393
            ++ +G R+I+ES+KE+V N+ +++IY ALKE NMDPNE   +LL+QDPFHEVK +RD++K
Sbjct  15   ILSAGVREILESIKEVVGNHSDADIYVALKETNMDPNETAQKLLNQDPFHEVKRRRDRKK  74

Query  394  EN  399
            EN
Sbjct  75   EN  76



>gb|KDP46910.1| hypothetical protein JCGZ_10401 [Jatropha curcas]
Length=883

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 55/67 (82%), Gaps = 1/67 (1%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVR-NYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRK  393
            IP  + K+++S++EI+  N  ++EIY+ LKEC+MDPN+AV RLLSQD FHEVKSKR++RK
Sbjct  20   IPPATEKMIQSIREIIDDNCTDTEIYSVLKECDMDPNDAVQRLLSQDIFHEVKSKRERRK  79

Query  394  ENKDTTE  414
            E K+T E
Sbjct  80   EMKETQE  86



>ref|XP_009757816.1| PREDICTED: uncharacterized protein LOC104210585 isoform X1 [Nicotiana 
sylvestris]
Length=834

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +1

Query  214  MIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRK  393
            ++ +G R+I+ES+KE+V N+ +++IY ALKE NMDPNE   +LL+QDPFHEVK +RD++K
Sbjct  15   ILSAGVREILESIKEVVGNHSDADIYVALKETNMDPNETAQKLLNQDPFHEVKRRRDRKK  74

Query  394  EN  399
            EN
Sbjct  75   EN  76



>ref|XP_010413763.1| PREDICTED: alpha-protein kinase 1-like isoform X1 [Camelina sativa]
Length=864

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 47/52 (90%), Gaps = 1/52 (2%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFH  363
            ++ IPSGS+K+V+SLKEIV N PE+EIYA LK+CNMDPNEAV RLLSQDPFH
Sbjct  27   ISDIPSGSKKMVQSLKEIV-NCPEAEIYAVLKDCNMDPNEAVTRLLSQDPFH  77



>ref|XP_010413764.1| PREDICTED: probable serine/threonine-protein kinase yakA isoform 
X2 [Camelina sativa]
Length=843

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 47/52 (90%), Gaps = 1/52 (2%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFH  363
            ++ IPSGS+K+V+SLKEIV N PE+EIYA LK+CNMDPNEAV RLLSQDPFH
Sbjct  27   ISDIPSGSKKMVQSLKEIV-NCPEAEIYAVLKDCNMDPNEAVTRLLSQDPFH  77



>gb|KJB42722.1| hypothetical protein B456_007G165200 [Gossypium raimondii]
Length=845

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 53/72 (74%), Gaps = 3/72 (4%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  387
            V+ IPS  RK ++++KEI  N+ E EIYA LKEC+MDPNE   RLL QDPF EVK KRD+
Sbjct  8    VSSIPSSVRKTIQNIKEITGNHSEDEIYAMLKECSMDPNETAQRLLLQDPFREVKRKRDR  67

Query  388  RKE---NKDTTE  414
            +KE   NK++ E
Sbjct  68   KKESSNNKESAE  79



>ref|XP_002301574.2| hypothetical protein POPTR_0002s22320g [Populus trichocarpa]
 gb|EEE80847.2| hypothetical protein POPTR_0002s22320g [Populus trichocarpa]
Length=886

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IP   RK ++++KEI  N+ + EIYA LKEC+MDPNE   +LL QDPFHEVK KRD++KE
Sbjct  10   IPGNVRKTIQNIKEITGNHSDEEIYAMLKECSMDPNETAQKLLYQDPFHEVKRKRDRKKE  69

Query  397  NKDTTE  414
            N +  E
Sbjct  70   NMNNRE  75



>gb|KJB42721.1| hypothetical protein B456_007G165200 [Gossypium raimondii]
Length=881

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 53/72 (74%), Gaps = 3/72 (4%)
 Frame = +1

Query  208  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  387
            V+ IPS  RK ++++KEI  N+ E EIYA LKEC+MDPNE   RLL QDPF EVK KRD+
Sbjct  8    VSSIPSSVRKTIQNIKEITGNHSEDEIYAMLKECSMDPNETAQRLLLQDPFREVKRKRDR  67

Query  388  RKE---NKDTTE  414
            +KE   NK++ E
Sbjct  68   KKESSNNKESAE  79



>ref|XP_010499452.1| PREDICTED: RNA polymerase II degradation factor 1-like [Camelina 
sativa]
Length=842

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 76/145 (52%), Positives = 92/145 (63%), Gaps = 11/145 (8%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IPSGSR+IV+SLKEIV N PE+EIYA LKECNM+PNEAV RLLS DPFHEVKSK++K+KE
Sbjct  20   IPSGSREIVKSLKEIV-NAPEAEIYAMLKECNMEPNEAVARLLSSDPFHEVKSKKEKKKE  78

Query  397  NKDTTEsrprgasssrggkgs--adrYAGRGGSESL--------HGKSTYAYXENGYTNT  546
             +DT +SRPRGA++         +DRY+GRGGS            GKST          T
Sbjct  79   TRDTPDSRPRGANNMYNRGARGGSDRYSGRGGSTHFSSTDSGNYQGKSTNKKESGPQGYT  138

Query  547  KSTRTAGSTTNRWLPTISDAAGTEN  621
             S  +A    +      SD+  TEN
Sbjct  139  ASWSSASGVADHHQTQNSDSVATEN  163



>ref|XP_009599554.1| PREDICTED: uncharacterized protein LOC104095192 isoform X3 [Nicotiana 
tomentosiformis]
Length=831

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +1

Query  214  MIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRK  393
            ++ +G R+I+ES+KE+V N+ +++IY ALKE NMDPNE   +LL+QDPFHEVK +RD++K
Sbjct  15   ILSAGVREILESIKEVVGNHSDADIYVALKETNMDPNETAQKLLNQDPFHEVKRRRDRKK  74

Query  394  EN  399
            EN
Sbjct  75   EN  76



>ref|XP_009599553.1| PREDICTED: uncharacterized protein LOC104095192 isoform X2 [Nicotiana 
tomentosiformis]
Length=832

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +1

Query  214  MIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRK  393
            ++ +G R+I+ES+KE+V N+ +++IY ALKE NMDPNE   +LL+QDPFHEVK +RD++K
Sbjct  15   ILSAGVREILESIKEVVGNHSDADIYVALKETNMDPNETAQKLLNQDPFHEVKRRRDRKK  74

Query  394  EN  399
            EN
Sbjct  75   EN  76



>gb|KFK38227.1| hypothetical protein AALP_AA3G085200 [Arabis alpina]
Length=829

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 52/70 (74%), Gaps = 4/70 (6%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVR-NYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRK  393
            IP+ +RK+++++KE    NY E EI A L+ECNMDP+E   RLL QDPFHEVK KRDKRK
Sbjct  10   IPASTRKLIQNIKETTAGNYSEDEIQAMLQECNMDPDETAQRLLLQDPFHEVKKKRDKRK  69

Query  394  E---NKDTTE  414
            E   NKD+ E
Sbjct  70   ENLSNKDSVE  79



>ref|XP_009599552.1| PREDICTED: uncharacterized protein LOC104095192 isoform X1 [Nicotiana 
tomentosiformis]
Length=833

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +1

Query  214  MIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRK  393
            ++ +G R+I+ES+KE+V N+ +++IY ALKE NMDPNE   +LL+QDPFHEVK +RD++K
Sbjct  15   ILSAGVREILESIKEVVGNHSDADIYVALKETNMDPNETAQKLLNQDPFHEVKRRRDRKK  74

Query  394  EN  399
            EN
Sbjct  75   EN  76



>ref|XP_002304144.2| hypothetical protein POPTR_0003s06200g [Populus trichocarpa]
 gb|EEE79123.2| hypothetical protein POPTR_0003s06200g [Populus trichocarpa]
Length=858

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  232  RKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            RKI++S+KEIV N+ +++IY  LKE NMDPNE V +LL+QDPFHEVK KRDK+KE
Sbjct  35   RKIIQSIKEIVGNFSDADIYMVLKETNMDPNETVQKLLNQDPFHEVKRKRDKKKE  89



>ref|XP_010088349.1| hypothetical protein L484_004857 [Morus notabilis]
 gb|EXB34467.1| hypothetical protein L484_004857 [Morus notabilis]
Length=651

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IPS  RK +++LKEI  N+ + EIYA LKEC+MDPNE   +LL QD FHEVK KRD+RKE
Sbjct  10   IPSSVRKTIQNLKEIAGNHSDDEIYAMLKECSMDPNETAQKLLLQDTFHEVKRKRDRRKE  69

Query  397  NKDTTE  414
            N +  E
Sbjct  70   NVNNRE  75



>ref|XP_006437175.1| hypothetical protein CICLE_v10033869mg, partial [Citrus clementina]
 gb|ESR50415.1| hypothetical protein CICLE_v10033869mg, partial [Citrus clementina]
Length=787

 Score = 87.8 bits (216),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 54/67 (81%), Gaps = 1/67 (1%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIV-RNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRK  393
            IP+ ++KIV++LKE + +N  +SEIYA L ECNMDPN+A  RLLSQD F EVKSKR++RK
Sbjct  21   IPAAAKKIVQNLKETLNKNCTDSEIYAVLVECNMDPNDAFQRLLSQDAFKEVKSKRERRK  80

Query  394  ENKDTTE  414
            E K+T E
Sbjct  81   EMKETQE  87



>ref|XP_009765586.1| PREDICTED: mucin-5AC-like [Nicotiana sylvestris]
Length=500

 Score = 86.7 bits (213),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +1

Query  217  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  396
            IPS  RK ++++KEI  N+ E EIYA LKEC+MDPNE   +LL QD FHEVK KRD+R+E
Sbjct  18   IPSSVRKTIQNIKEITGNHSEDEIYAMLKECSMDPNETAQKLLFQDTFHEVKRKRDRRRE  77

Query  397  N  399
            N
Sbjct  78   N  78



Lambda      K        H        a         alpha
   0.306    0.122    0.340    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1050626367960