BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF052I24

Length=661
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011083862.1|  PREDICTED: nucleolar protein 56-like               355   9e-117   Sesamum indicum [beniseed]
gb|EYU23115.1|  hypothetical protein MIMGU_mgv1a004585mg                354   1e-116   Erythranthe guttata [common monkey flower]
gb|EYU23114.1|  hypothetical protein MIMGU_mgv1a004585mg                354   1e-116   Erythranthe guttata [common monkey flower]
ref|XP_010037433.1|  PREDICTED: nucleolar protein 56-like               353   1e-115   Eucalyptus grandis [rose gum]
gb|EYU43055.1|  hypothetical protein MIMGU_mgv1a004561mg                348   2e-114   Erythranthe guttata [common monkey flower]
ref|XP_006344769.1|  PREDICTED: nucleolar protein 56-like               348   6e-114   Solanum tuberosum [potatoes]
ref|XP_009782739.1|  PREDICTED: nucleolar protein 56-like               348   9e-114   Nicotiana sylvestris
ref|XP_009603298.1|  PREDICTED: nucleolar protein 56-like               348   9e-114   Nicotiana tomentosiformis
ref|XP_009767290.1|  PREDICTED: nucleolar protein 56-like               347   1e-113   Nicotiana sylvestris
emb|CBI15634.3|  unnamed protein product                                344   2e-113   Vitis vinifera
ref|XP_009598202.1|  PREDICTED: nucleolar protein 56-like               347   3e-113   Nicotiana tomentosiformis
ref|XP_002283518.1|  PREDICTED: nucleolar protein 56-like               345   1e-112   Vitis vinifera
ref|XP_010102881.1|  hypothetical protein L484_002679                   344   3e-112   Morus notabilis
ref|XP_006477000.1|  PREDICTED: nucleolar protein 56-like isoform X1    343   7e-112   Citrus sinensis [apfelsine]
ref|XP_006477001.1|  PREDICTED: nucleolar protein 56-like isoform X2    343   7e-112   Citrus sinensis [apfelsine]
ref|XP_006440078.1|  hypothetical protein CICLE_v10019526mg             343   8e-112   
ref|XP_006440077.1|  hypothetical protein CICLE_v10019526mg             343   8e-112   Citrus clementina [clementine]
gb|AGU28427.1|  nucleolar protein NOP56-like protein                    332   9e-112   Sinapis alba [bai jie]
ref|XP_004230313.1|  PREDICTED: nucleolar protein 56-like               343   9e-112   Solanum lycopersicum
gb|KDP30943.1|  hypothetical protein JCGZ_11319                         342   1e-111   Jatropha curcas
ref|XP_008239441.1|  PREDICTED: nucleolar protein 56-like               342   2e-111   Prunus mume [ume]
ref|XP_007210566.1|  hypothetical protein PRUPE_ppa003786mg             342   2e-111   Prunus persica
ref|XP_010938674.1|  PREDICTED: nucleolar protein 56-like               342   2e-111   Elaeis guineensis
ref|XP_002318715.1|  nucleolar family protein                           340   5e-111   
ref|XP_008464470.1|  PREDICTED: nucleolar protein 56-like               341   6e-111   Cucumis melo [Oriental melon]
ref|XP_004165830.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar pr...    341   7e-111   
ref|XP_004138057.1|  PREDICTED: nucleolar protein 56-like               341   7e-111   Cucumis sativus [cucumbers]
ref|XP_010250780.1|  PREDICTED: nucleolar protein 56-like               340   1e-110   Nelumbo nucifera [Indian lotus]
ref|XP_010921864.1|  PREDICTED: nucleolar protein 56-like               339   2e-110   Elaeis guineensis
ref|XP_009386842.1|  PREDICTED: nucleolar protein 56-like               339   3e-110   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002511213.1|  nucleolar protein nop56, putative                  339   4e-110   Ricinus communis
ref|XP_011044181.1|  PREDICTED: nucleolar protein 56-like isoform X1    338   4e-110   Populus euphratica
ref|XP_009399980.1|  PREDICTED: nucleolar protein 56-like               338   6e-110   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB40016.1|  hypothetical protein B456_007G042300                    337   9e-110   Gossypium raimondii
gb|KHG15507.1|  Nucleolar 56                                            337   1e-109   Gossypium arboreum [tree cotton]
ref|XP_002322238.2|  nucleolar family protein                           335   2e-109   
ref|XP_011024058.1|  PREDICTED: nucleolar protein 56-like               337   2e-109   Populus euphratica
ref|XP_008796174.1|  PREDICTED: nucleolar protein 56-like isoform X2    337   2e-109   Phoenix dactylifera
ref|XP_008796173.1|  PREDICTED: nucleolar protein 56-like isoform X1    337   3e-109   
ref|XP_006374558.1|  hypothetical protein POPTR_0015s10500g             336   3e-109   Populus trichocarpa [western balsam poplar]
ref|XP_007037933.1|  Nucleolar protein NOP56                            334   2e-108   
ref|XP_010534767.1|  PREDICTED: nucleolar protein 56                    332   2e-108   Tarenaya hassleriana [spider flower]
emb|CDY10510.1|  BnaC03g71040D                                          333   2e-108   Brassica napus [oilseed rape]
ref|XP_008811770.1|  PREDICTED: nucleolar protein 56-like               334   3e-108   Phoenix dactylifera
ref|XP_009106803.1|  PREDICTED: nucleolar protein 56-like               333   3e-108   Brassica rapa
emb|CDY42406.1|  BnaA08g00080D                                          333   3e-108   Brassica napus [oilseed rape]
emb|CDP15007.1|  unnamed protein product                                334   3e-108   Coffea canephora [robusta coffee]
ref|XP_009124126.1|  PREDICTED: nucleolar protein 56-like               332   5e-108   Brassica rapa
ref|XP_006392564.1|  hypothetical protein EUTSA_v10011387mg             332   8e-108   Eutrema salsugineum [saltwater cress]
emb|CDY59117.1|  BnaCnng34340D                                          332   9e-108   Brassica napus [oilseed rape]
ref|NP_176007.1|  nucleolar protein NOP56-like protein                  331   2e-107   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004297546.1|  PREDICTED: nucleolar protein 56-like               332   2e-107   Fragaria vesca subsp. vesca
ref|XP_009359460.1|  PREDICTED: nucleolar protein 56-like               331   3e-107   Pyrus x bretschneideri [bai li]
ref|XP_008392835.1|  PREDICTED: nucleolar protein 56-like               331   3e-107   
dbj|BAH20197.1|  AT1G56110                                              327   3e-107   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008374262.1|  PREDICTED: nucleolar protein 56-like               330   6e-107   Malus domestica [apple tree]
ref|XP_009336572.1|  PREDICTED: nucleolar protein 56-like               330   1e-106   Pyrus x bretschneideri [bai li]
ref|XP_009346504.1|  PREDICTED: nucleolar protein 56-like               330   1e-106   Pyrus x bretschneideri [bai li]
gb|KJB08032.1|  hypothetical protein B456_001G060200                    328   3e-106   Gossypium raimondii
ref|XP_006307187.1|  hypothetical protein CARUB_v10008778mg             328   5e-106   
ref|XP_010543116.1|  PREDICTED: nucleolar protein 56-like               328   5e-106   Tarenaya hassleriana [spider flower]
ref|XP_010501245.1|  PREDICTED: nucleolar protein 56-like               327   6e-106   Camelina sativa [gold-of-pleasure]
gb|KHG28458.1|  Nucleolar 56                                            327   7e-106   Gossypium arboreum [tree cotton]
ref|XP_002894559.1|  hypothetical protein ARALYDRAFT_474678             326   2e-105   Arabidopsis lyrata subsp. lyrata
ref|XP_010462480.1|  PREDICTED: nucleolar protein 56-like               325   3e-105   Camelina sativa [gold-of-pleasure]
ref|XP_010248928.1|  PREDICTED: nucleolar protein 56-like               326   3e-105   Nelumbo nucifera [Indian lotus]
ref|XP_010480175.1|  PREDICTED: nucleolar protein 56-like               325   6e-105   Camelina sativa [gold-of-pleasure]
gb|AFW88375.1|  hypothetical protein ZEAMMB73_553591                    322   4e-104   
ref|XP_010480123.1|  PREDICTED: nucleolar protein 56-like               322   5e-104   Camelina sativa [gold-of-pleasure]
emb|CDY57300.1|  BnaC03g73340D                                          321   6e-104   Brassica napus [oilseed rape]
ref|XP_004984360.1|  PREDICTED: nucleolar protein 56-like               322   1e-103   Setaria italica
ref|XP_008677944.1|  PREDICTED: LOC100283975 isoform X1                 322   1e-103   
ref|XP_007155528.1|  hypothetical protein PHAVU_003G209500g             322   1e-103   Phaseolus vulgaris [French bean]
ref|XP_002465270.1|  hypothetical protein SORBIDRAFT_01g035290          321   2e-103   Sorghum bicolor [broomcorn]
ref|XP_008660149.1|  PREDICTED: nucleolar protein 56-like isoform X1    322   2e-103   Zea mays [maize]
ref|XP_008660150.1|  PREDICTED: nucleolar protein 56-like isoform X2    322   2e-103   Zea mays [maize]
ref|XP_002882791.1|  hypothetical protein ARALYDRAFT_478647             320   2e-103   Arabidopsis lyrata subsp. lyrata
emb|CDX82572.1|  BnaA03g32490D                                          319   4e-103   
ref|XP_009135254.1|  PREDICTED: nucleolar protein 56-like               319   4e-103   Brassica rapa
gb|KHN14092.1|  Nucleolar protein 56                                    320   7e-103   Glycine soja [wild soybean]
ref|XP_003549846.1|  PREDICTED: nucleolar protein 56-like               320   8e-103   Glycine max [soybeans]
gb|KHN44630.1|  Nucleolar protein 56                                    319   1e-102   Glycine soja [wild soybean]
gb|KHN34404.1|  Nucleolar protein 56                                    319   2e-102   Glycine soja [wild soybean]
ref|XP_003525694.1|  PREDICTED: nucleolar protein 56-like isoform 1     319   2e-102   Glycine max [soybeans]
gb|EAY90010.1|  hypothetical protein OsI_11580                          318   5e-102   Oryza sativa Indica Group [Indian rice]
ref|NP_001050122.1|  Os03g0352300                                       318   5e-102   
ref|XP_006845152.1|  hypothetical protein AMTR_s00005p00226680          318   6e-102   Amborella trichopoda
ref|XP_006650085.1|  PREDICTED: nucleolar protein 56-like               317   7e-102   Oryza brachyantha
ref|XP_008351745.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar pr...    317   8e-102   
ref|XP_006407288.1|  hypothetical protein EUTSA_v10020558mg             316   9e-102   Eutrema salsugineum [saltwater cress]
gb|KFK35536.1|  hypothetical protein AALP_AA4G003300                    316   1e-101   Arabis alpina [alpine rockcress]
ref|XP_010499575.1|  PREDICTED: nucleolar protein 56-like               315   2e-101   Camelina sativa [gold-of-pleasure]
ref|XP_010465064.1|  PREDICTED: nucleolar protein 56-like               314   2e-101   Camelina sativa [gold-of-pleasure]
dbj|BAE98741.1|  putative nucleolar protein                             313   3e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003562510.1|  PREDICTED: nucleolar protein 56-like               315   3e-101   Brachypodium distachyon [annual false brome]
ref|XP_004958597.1|  PREDICTED: nucleolar protein 56-like               315   4e-101   Setaria italica
ref|NP_187892.2|  NOP56-like pre RNA processing ribonucleoprotein       313   7e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006395291.1|  hypothetical protein EUTSA_v10004082mg             313   7e-101   Eutrema salsugineum [saltwater cress]
ref|NP_001060541.1|  Os07g0661800                                       306   9e-101   
ref|XP_003563386.1|  PREDICTED: nucleolar protein 56-like               313   4e-100   Brachypodium distachyon [annual false brome]
ref|XP_002461161.1|  hypothetical protein SORBIDRAFT_02g042030          313   4e-100   Sorghum bicolor [broomcorn]
dbj|BAK00100.1|  predicted protein                                      310   3e-99    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS66462.1|  hypothetical protein TRIUR3_03326                       310   5e-99    Triticum urartu
gb|EMT05996.1|  hypothetical protein F775_30288                         310   6e-99    
gb|EEC82626.1|  hypothetical protein OsI_27213                          307   8e-99    Oryza sativa Indica Group [Indian rice]
gb|EPS72848.1|  hypothetical protein M569_01909                         308   8e-99    Genlisea aurea
gb|AFK36574.1|  unknown                                                 309   1e-98    Lotus japonicus
dbj|BAK00655.1|  predicted protein                                      308   3e-98    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001150345.1|  LOC100283975                                       307   5e-98    
ref|XP_003608861.1|  Nucleolar protein                                  303   1e-96    Medicago truncatula
gb|AFK46206.1|  unknown                                                 302   2e-96    Medicago truncatula
gb|ACJ85565.1|  unknown                                                 298   2e-94    Medicago truncatula
gb|EMT17366.1|  hypothetical protein F775_05055                         298   4e-94    
ref|XP_004515826.1|  PREDICTED: nucleolar protein 56-like               295   1e-93    
ref|XP_006297501.1|  hypothetical protein CARUB_v10013523mg             294   2e-93    Capsella rubella
ref|XP_001766920.1|  predicted protein                                  293   2e-93    
gb|KFK38628.1|  hypothetical protein AALP_AA3G138900                    290   4e-92    Arabis alpina [alpine rockcress]
ref|XP_010677900.1|  PREDICTED: nucleolar protein 56-like               289   3e-91    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002964924.1|  hypothetical protein SELMODRAFT_167367             285   6e-90    
ref|XP_001754987.1|  predicted protein                                  284   2e-88    
ref|XP_009129303.1|  PREDICTED: nucleolar protein 56-like               270   1e-84    Brassica rapa
emb|CDY04069.1|  BnaC02g37840D                                          269   2e-84    
dbj|BAK08040.1|  predicted protein                                      257   3e-79    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011401661.1|  Nucleolar protein 56                               256   4e-79    Auxenochlorella protothecoides
ref|XP_003058762.1|  predicted protein                                  252   2e-77    Micromonas pusilla CCMP1545
ref|XP_002953396.1|  hypothetical protein VOLCADRAFT_105910             248   1e-75    Volvox carteri f. nagariensis
ref|XP_007513547.1|  predicted protein                                  246   5e-75    Bathycoccus prasinos
gb|KDD75119.1|  putative snoRNA binding domain-containing protein       250   7e-75    Helicosporidium sp. ATCC 50920
ref|XP_003080617.1|  SAR DNA binding protein, putative (ISS)            239   5e-74    
ref|XP_001697006.1|  nucleolar protein, component of C/D snoRNPs        244   6e-74    Chlamydomonas reinhardtii
ref|XP_001419274.1|  predicted protein                                  242   1e-73    Ostreococcus lucimarinus CCE9901
ref|XP_002502983.1|  predicted protein                                  244   5e-73    Micromonas commoda
emb|CEG01347.1|  NOSIC                                                  239   2e-72    Ostreococcus tauri
ref|XP_005645633.1|  Nop-domain-containing protein                      240   5e-72    Coccomyxa subellipsoidea C-169
ref|XP_010465063.1|  PREDICTED: nucleolar protein 56-like               217   6e-68    
ref|XP_005848173.1|  hypothetical protein CHLNCDRAFT_145563             226   7e-68    Chlorella variabilis
gb|KDO52602.1|  hypothetical protein CISIN_1g0085712mg                  223   4e-66    Citrus sinensis [apfelsine]
gb|KDO52603.1|  hypothetical protein CISIN_1g0085712mg                  223   5e-66    Citrus sinensis [apfelsine]
ref|XP_008616077.1|  hypothetical protein SDRG_11801                    221   2e-65    Saprolegnia diclina VS20
ref|XP_011044182.1|  PREDICTED: nucleolar protein 56-like isoform X2    221   3e-65    Populus euphratica
gb|KDO22655.1|  hypothetical protein SPRG_12284                         220   4e-65    Saprolegnia parasitica CBS 223.65
gb|KDO20999.1|  hypothetical protein SPRG_13895                         220   5e-65    Saprolegnia parasitica CBS 223.65
ref|XP_008892177.1|  hypothetical protein PPTG_02695                    218   8e-64    Phytophthora parasitica INRA-310
ref|XP_002114548.1|  hypothetical protein TRIADDRAFT_28215              216   4e-63    Trichoplax adhaerens
ref|XP_004345107.2|  nucleolar protein 5A                               215   6e-63    Capsaspora owczarzaki ATCC 30864
ref|XP_002999165.1|  nucleolar protein Nop56                            215   8e-63    Phytophthora infestans T30-4
ref|XP_009519011.1|  hypothetical protein PHYSODRAFT_482921             214   2e-62    Phytophthora sojae
emb|CEP08181.1|  hypothetical protein                                   213   3e-62    Parasitella parasitica
gb|EPB88498.1|  hypothetical protein HMPREF1544_04733                   212   5e-62    Mucor circinelloides f. circinelloides 1006PhL
gb|KJE95980.1|  nucleolar protein 5A                                    213   6e-62    Capsaspora owczarzaki ATCC 30864
dbj|GAN01361.1|  nop-domain-containing protein                          210   4e-61    Mucor ambiguus
emb|CBJ48969.1|  conserved unknown protein                              209   5e-61    Ectocarpus siliculosus
gb|KHN43632.1|  Nucleolar protein 56                                    209   6e-61    Glycine soja [wild soybean]
ref|XP_007309335.1|  Nop-domain-containing protein                      210   7e-61    Stereum hirsutum FP-91666 SS1
ref|XP_008879803.1|  hypothetical protein H310_13917                    210   7e-61    Aphanomyces invadans
ref|XP_007341452.1|  Nop-domain-containing protein                      209   1e-60    
ref|XP_009497331.1|  hypothetical protein H696_05198                    209   1e-60    Fonticula alba
emb|CDH49232.1|  nucleolar protein nop56                                209   1e-60    Lichtheimia corymbifera JMRC:FSU:9682
emb|CCI44577.1|  unnamed protein product                                209   1e-60    Albugo candida
gb|KDN52102.1|  Nop-domain-containing protein                           209   2e-60    Tilletiaria anomala UBC 951
emb|CDS07170.1|  hypothetical protein LRAMOSA09693                      208   3e-60    Lichtheimia ramosa
gb|EIE81578.1|  hypothetical protein RO3G_06283                         207   6e-60    Rhizopus delemar RA 99-880
ref|NP_595368.1|  U3 snoRNP protein Nop56 (predicted)                   207   6e-60    Schizosaccharomyces pombe
emb|CEG71269.1|  Putative ZYBA0S10-02674g1_1                            207   8e-60    Rhizopus microsporus
emb|CEI88167.1|  Putative Ribosome biosynthesis protein SIK1            207   8e-60    Rhizopus microsporus
emb|CBK24887.2|  unnamed protein product                                206   8e-60    Blastocystis hominis
emb|CEL62497.1|  Nucleolar protein 56 OS=Schizosaccharomyces pomb...    207   9e-60    Rhizoctonia solani AG-1 IB
emb|CBK24248.2|  unnamed protein product                                207   1e-59    Blastocystis hominis
gb|EMS45652.1|  hypothetical protein TRIUR3_03792                       206   1e-59    Triticum urartu
emb|CCA15297.1|  nucleolar protein Nop56 putative                       206   1e-59    Albugo laibachii Nc14
ref|XP_009546043.1|  hypothetical protein HETIRDRAFT_383737             206   2e-59    Heterobasidion irregulare TC 32-1
gb|ELU38997.1|  small nuclear ribonucleoprotein                         208   3e-59    Rhizoctonia solani AG-1 IA
gb|EIE75754.1|  hypothetical protein RO3G_00458                         205   3e-59    Rhizopus delemar RA 99-880
ref|XP_001748935.1|  hypothetical protein                               205   4e-59    Monosiga brevicollis MX1
gb|KEP47080.1|  small nuclear ribonucleoprotein                         206   5e-59    Rhizoctonia solani 123E
gb|KIO20691.1|  hypothetical protein M407DRAFT_81283                    203   9e-59    Tulasnella calospora MUT 4182
gb|EPY54298.1|  U3 snoRNP protein Nop56                                 203   1e-58    Schizosaccharomyces cryophilus OY26
gb|EPX74338.1|  U3 snoRNP protein Nop56                                 203   2e-58    Schizosaccharomyces octosporus yFS286
gb|EUC60229.1|  small nuclear ribonucleoprotein                         204   3e-58    Rhizoctonia solani AG-3 Rhs1AP
gb|KDQ15155.1|  hypothetical protein BOTBODRAFT_145382                  201   5e-58    Botryobasidium botryosum FD-172 SS1
ref|XP_005998724.1|  PREDICTED: nucleolar protein 56                    201   5e-58    
ref|XP_002173583.1|  U3 snoRNP protein Nop56                            202   5e-58    Schizosaccharomyces japonicus yFS275
ref|XP_005706848.1|  box C/D snoRNP component Nop56                     202   6e-58    Galdieria sulphuraria
ref|XP_009056335.1|  hypothetical protein LOTGIDRAFT_119841             201   2e-57    Lottia gigantea
ref|XP_004993595.1|  nucleolar protein 5A                               200   3e-57    Salpingoeca rosetta
ref|XP_001629178.1|  predicted protein                                  201   3e-57    Nematostella vectensis
gb|KIJ55044.1|  hypothetical protein M422DRAFT_152738                   200   4e-57    Sphaerobolus stellatus SS14
ref|XP_011299290.1|  PREDICTED: nucleolar protein 56                    198   2e-56    Fopius arisanus
ref|XP_003726537.1|  PREDICTED: nucleolar protein 56                    198   2e-56    
dbj|GAC95110.1|  hypothetical protein PHSY_002685                       197   5e-56    Pseudozyma hubeiensis SY62
ref|XP_001876795.1|  predicted protein                                  196   5e-56    Laccaria bicolor S238N-H82
gb|KIK37982.1|  hypothetical protein CY34DRAFT_809811                   197   7e-56    Suillus luteus UH-Slu-Lm8-n1
ref|XP_002155156.2|  PREDICTED: nucleolar protein 56-like               197   7e-56    Hydra vulgaris
gb|KDQ62806.1|  hypothetical protein JAAARDRAFT_149920                  197   7e-56    Jaapia argillacea MUCL 33604
ref|XP_320984.4|  AGAP002063-PA                                         196   1e-55    Anopheles gambiae str. PEST
gb|ELT94557.1|  hypothetical protein CAPTEDRAFT_159443                  196   1e-55    Capitella teleta
ref|XP_007270791.1|  Nop-domain-containing protein                      197   1e-55    Fomitiporia mediterranea MF3/22
gb|KIM54809.1|  hypothetical protein SCLCIDRAFT_135991                  196   1e-55    Scleroderma citrinum Foug A
ref|XP_007399862.1|  hypothetical protein PHACADRAFT_128240             196   1e-55    Phanerochaete carnosa HHB-10118-sp
ref|XP_007324081.1|  hypothetical protein SERLADRAFT_358671             196   2e-55    Serpula lacrymans var. lacrymans S7.9
emb|CBQ71505.1|  probable SIK1-involved in pre-rRNA processing          196   2e-55    Sporisorium reilianum SRZ2
gb|AAH97676.1|  XNop56 protein                                          195   3e-55    Xenopus laevis [clawed frog]
emb|CDI56783.1|  probable SIK1-involved in pre-rRNA processing          194   3e-55    Melanopsichium pennsylvanicum 4
ref|XP_001603746.2|  PREDICTED: nucleolar protein 56                    194   3e-55    
gb|AAI06207.1|  XNop56 protein                                          195   3e-55    Xenopus laevis [clawed frog]
ref|XP_004332871.1|  nucleolar protein Nop56, putative                  195   3e-55    Acanthamoeba castellanii str. Neff
ref|NP_001082151.1|  XNop56 protein                                     195   3e-55    Xenopus laevis [clawed frog]
ref|XP_011392585.1|  putative snoRNP complex protein NOP56              195   4e-55    Ustilago maydis 521
emb|CAJ81913.1|  nucleolar protein 5A (56kDa with KKE/D repeat)         194   4e-55    Xenopus tropicalis [western clawed frog]
ref|XP_005828248.1|  hypothetical protein GUITHDRAFT_74893              194   5e-55    Guillardia theta CCMP2712
gb|EST06828.1|  hypothetical protein PSEUBRA_SCAF25g01067               194   7e-55    Kalmanozyma brasiliensis GHG001
ref|XP_001835490.1|  small nuclear ribonucleoprotein                    194   8e-55    Coprinopsis cinerea okayama7#130
gb|KFH65972.1|  hypothetical protein MVEG_08074                         194   8e-55    Mortierella verticillata NRRL 6337
gb|KFH67499.1|  hypothetical protein MVEG_06231                         193   9e-55    Mortierella verticillata NRRL 6337
ref|NP_001184132.1|  NOP56 ribonucleoprotein homolog                    194   9e-55    Xenopus tropicalis [western clawed frog]
gb|EPZ33215.1|  NOSIC domain-containing protein                         197   1e-54    Rozella allomycis CSF55
emb|CCF48798.1|  probable SIK1-involved in pre-rRNA processing          193   1e-54    Ustilago hordei
ref|XP_007768562.1|  Nop-domain-containing protein                      194   1e-54    Coniophora puteana RWD-64-598 SS2
ref|XP_007866915.1|  Nop-domain-containing protein                      194   1e-54    Gloeophyllum trabeum ATCC 11539
gb|KIK08078.1|  hypothetical protein K443DRAFT_672961                   194   1e-54    Laccaria amethystina LaAM-08-1
ref|XP_005518148.1|  PREDICTED: nucleolar protein 56                    194   2e-54    
ref|XP_007855271.1|  small nuclear ribonucleoprotein                    193   2e-54    
gb|KDQ30951.1|  hypothetical protein PLEOSDRAFT_1092385                 193   3e-54    Pleurotus ostreatus PC15
gb|ETS59786.1|  hypothetical protein PaG_06313                          192   3e-54    Moesziomyces aphidis DSM 70725
dbj|GAK67550.1|  nop-domain-containing protein                          192   3e-54    Moesziomyces antarcticus
ref|NP_001026559.1|  nucleolar protein 56                               192   4e-54    Gallus gallus [bantam]
ref|XP_007883174.1|  PREDICTED: nucleolar protein 56                    192   4e-54    Callorhinchus milii [Australian ghost shark]
gb|KFB36904.1|  AGAP002063-PA-like protein                              192   5e-54    Anopheles sinensis
ref|XP_011493522.1|  AAEL017421-PA                                      191   6e-54    Aedes aegypti
emb|CDW83716.1|  UNKNOWN                                                191   7e-54    Stylonychia lemnae
ref|XP_002741552.1|  PREDICTED: nucleolar protein 56                    192   8e-54    Saccoglossus kowalevskii
ref|XP_007656687.1|  PREDICTED: nucleolar protein 56                    191   1e-53    
gb|ETN58694.1|  nucleolar protein Nop56                                 191   1e-53    Anopheles darlingi [American malaria mosquito]
ref|XP_003325018.1|  hypothetical protein PGTG_06555                    191   1e-53    Puccinia graminis f. sp. tritici CRL 75-36-700-3
ref|XP_009908364.1|  PREDICTED: LOW QUALITY PROTEIN: dynactin sub...    197   1e-53    Picoides pubescens
ref|XP_007380122.1|  Nop domain-containing protein                      188   1e-53    Punctularia strigosozonata HHB-11173 SS5
ref|XP_011429137.1|  PREDICTED: nucleolar protein 56-like               184   1e-53    
ref|XP_003494005.1|  PREDICTED: nucleolar protein 56-like               190   2e-53    Bombus impatiens
ref|XP_010566789.1|  PREDICTED: nucleolar protein 56                    191   2e-53    Haliaeetus leucocephalus
gb|EFX71480.1|  nucleolar protein-like protein 5A                       191   2e-53    Daphnia pulex
ref|XP_007882424.1|  hypothetical protein PFL1_06687                    190   2e-53    Anthracocystis flocculosa PF-1
ref|XP_002608922.1|  hypothetical protein BRAFLDRAFT_85513              191   2e-53    Branchiostoma floridae
gb|EJY76011.1|  Nop multi-domain protein                                190   2e-53    Oxytricha trifallax
ref|XP_007408019.1|  hypothetical protein MELLADRAFT_47719              190   3e-53    Melampsora larici-populina 98AG31
gb|KIK14839.1|  hypothetical protein PISMIDRAFT_343722                  190   3e-53    Pisolithus microcarpus 441
gb|KDR23556.1|  Nucleolar protein 56                                    188   3e-53    Zootermopsis nevadensis
ref|XP_006462942.1|  hypothetical protein AGABI2DRAFT_179517            190   3e-53    Agaricus bisporus var. bisporus H97
ref|XP_007496986.1|  PREDICTED: nucleolar protein 56                    190   3e-53    Monodelphis domestica
ref|XP_006958132.1|  Nop-domain-containing protein                      190   3e-53    Wallemia mellicola CBS 633.66
ref|XP_008556069.1|  PREDICTED: nucleolar protein 56                    189   3e-53    Microplitis demolitor
ref|XP_001845079.1|  nucleolar protein Nop56                            189   3e-53    Culex quinquefasciatus
ref|XP_002186383.1|  predicted protein                                  189   4e-53    Phaeodactylum tricornutum CCAP 1055/1
ref|XP_003773512.1|  PREDICTED: nucleolar protein 56                    189   5e-53    Sarcophilus harrisii
ref|XP_006626757.1|  PREDICTED: nucleolar protein 56-like               190   7e-53    
gb|KII86814.1|  hypothetical protein PLICRDRAFT_113593                  189   8e-53    Plicaturopsis crispa FD-325 SS-3
gb|EMS23759.1|  nucleolar protein 56                                    188   9e-53    Rhodotorula toruloides NP11
ref|XP_973514.1|  PREDICTED: nucleolar protein 56                       188   9e-53    Tribolium castaneum [rust-red flour beetle]
gb|EPT05345.1|  hypothetical protein FOMPIDRAFT_1027507                 187   2e-52    Fomitopsis pinicola FP-58527 SS1
ref|XP_003695473.1|  PREDICTED: nucleolar protein 56                    186   2e-52    
ref|XP_003034611.1|  hypothetical protein SCHCODRAFT_84859              187   3e-52    Schizophyllum commune H4-8
ref|XP_011504958.1|  PREDICTED: nucleolar protein 56                    187   3e-52    Ceratosolen solmsi marchali
ref|XP_003393259.1|  PREDICTED: nucleolar protein 56-like               186   4e-52    Bombus terrestris [large earth bumblebee]
ref|XP_003706024.1|  PREDICTED: nucleolar protein 56                    187   4e-52    
emb|CCA74192.1|  probable SIK1-involved in pre-rRNA processing          187   4e-52    Serendipita indica DSM 11827
ref|XP_006616125.1|  PREDICTED: nucleolar protein 56-like               186   5e-52    Apis dorsata [rock honeybee]
ref|XP_010726026.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar pr...    192   5e-52    
emb|CCU98367.1|  unnamed protein product                                186   5e-52    Malassezia sympodialis ATCC 42132
ref|XP_002287003.1|  predicted protein                                  186   6e-52    Thalassiosira pseudonana CCMP1335
emb|CCG80701.1|  Nucleolar protein 56                                   185   1e-51    Taphrina deformans PYCC 5710
gb|KIJ17579.1|  hypothetical protein PAXINDRAFT_129735                  186   1e-51    Paxillus involutus ATCC 200175
ref|XP_008119824.1|  PREDICTED: nucleolar protein 56                    186   1e-51    Anolis carolinensis [Carolina anole]
gb|EDL80178.1|  rCG26515, isoform CRA_b                                 179   1e-51    Rattus norvegicus [brown rat]
ref|XP_008477583.1|  PREDICTED: nucleolar protein 56                    186   1e-51    
ref|XP_002423012.1|  Nucleolar protein Nop56, putative                  184   2e-51    Pediculus humanus corporis [human body lice]
ref|XP_001730988.1|  hypothetical protein MGL_1987                      185   3e-51    Malassezia globosa CBS 7966
ref|XP_011350170.1|  PREDICTED: nucleolar protein 56 isoform X2         182   3e-51    
gb|KIL66800.1|  hypothetical protein M378DRAFT_9857                     185   4e-51    Amanita muscaria Koide BX008
ref|NP_001135966.1|  nucleolar KKE/D repeat protein Nop56               182   6e-51    Acyrthosiphon pisum
ref|XP_011350169.1|  PREDICTED: nucleolar protein 56 isoform X1         182   6e-51    
gb|EAX10586.1|  nucleolar protein 5A (56kDa with KKE/D repeat), i...    182   8e-51    
ref|XP_005089466.1|  PREDICTED: nucleolar protein 56-like               184   9e-51    
ref|XP_011350166.1|  PREDICTED: nucleolar protein 56-like               182   9e-51    
ref|XP_007064740.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar pr...    183   9e-51    
gb|KIJ64577.1|  hypothetical protein HYDPIDRAFT_111940                  183   9e-51    
ref|XP_004933030.1|  PREDICTED: nucleolar protein 56-like               182   9e-51    
gb|KIM40943.1|  hypothetical protein M413DRAFT_445720                   183   1e-50    
gb|EZA47223.1|  Nucleolar protein                                       182   1e-50    
gb|KIY51519.1|  Nop-domain-containing protein                           183   2e-50    
gb|AEE63285.1|  unknown                                                 182   2e-50    
gb|ELK34501.1|  Nucleolar protein 56                                    184   2e-50    
emb|CAA10127.1|  nucleolar protein                                      181   2e-50    
dbj|BAB27647.3|  unnamed protein product                                178   2e-50    
ref|XP_010350076.1|  PREDICTED: nucleolar protein 56 isoform X2         181   3e-50    
ref|XP_002434695.1|  ribosome biogenesis protein - Nop58p/Nop5p, ...    182   3e-50    
gb|KDR83033.1|  hypothetical protein GALMADRAFT_238789                  182   3e-50    
gb|ENN72756.1|  hypothetical protein YQE_10561                          182   3e-50    
gb|ERL90889.1|  hypothetical protein D910_08234                         182   3e-50    
gb|KIY69599.1|  Nop-domain-containing protein                           182   3e-50    
ref|XP_007246079.1|  PREDICTED: nucleolar protein 56-like               182   4e-50    
ref|XP_502927.1|  YALI0D17116p                                          181   4e-50    
ref|XP_005568575.1|  PREDICTED: nucleolar protein 56 isoform X2         180   5e-50    
ref|XP_011065147.1|  PREDICTED: nucleolar protein 56                    181   5e-50    
ref|XP_008972994.1|  PREDICTED: nucleolar protein 56 isoform X2         180   6e-50    
ref|XP_007523137.1|  PREDICTED: nucleolar protein 56                    182   7e-50    
dbj|GAA94153.1|  hypothetical protein E5Q_00801                         181   7e-50    
gb|KJA24140.1|  hypothetical protein HYPSUDRAFT_184465                  181   8e-50    
ref|XP_008254455.1|  PREDICTED: nucleolar protein 56                    181   9e-50    
gb|EAX10584.1|  nucleolar protein 5A (56kDa with KKE/D repeat), i...    182   9e-50    
gb|ERE69819.1|  nucleolar protein 56                                    181   9e-50    
gb|EAX10588.1|  nucleolar protein 5A (56kDa with KKE/D repeat), i...    182   9e-50    
ref|XP_009029570.1|  hypothetical protein HELRODRAFT_157952             179   1e-49    
gb|AAH18421.1|  NOP56 protein                                           179   1e-49    
gb|KDE09204.1|  nucleolar protein 56                                    181   1e-49    
ref|XP_004585734.1|  PREDICTED: nucleolar protein 56                    181   1e-49    
gb|EGI58948.1|  Nucleolar protein 56                                    181   1e-49    
ref|XP_003747562.1|  PREDICTED: nucleolar protein 56                    180   1e-49    
emb|CCL99748.1|  predicted protein                                      180   1e-49    
ref|NP_001231234.1|  nucleolar protein 56                               181   1e-49    
ref|XP_006500125.1|  PREDICTED: nucleolar protein 56 isoform X1         179   1e-49    
ref|XP_011367718.1|  PREDICTED: nucleolar protein 56 isoform X2         179   2e-49    
ref|XP_006984579.1|  PREDICTED: nucleolar protein 56 isoform X2         179   2e-49    
ref|XP_005380816.1|  PREDICTED: nucleolar protein 56 isoform X2         179   2e-49    
gb|KIW66549.1|  hypothetical protein PV04_05873                         179   2e-49    
ref|XP_005320605.1|  PREDICTED: nucleolar protein 56                    181   2e-49    
ref|XP_003941099.1|  PREDICTED: nucleolar protein 56 isoform X1         181   2e-49    
ref|XP_004661489.1|  PREDICTED: nucleolar protein 56                    179   2e-49    
ref|XP_011276785.1|  hypothetical protein BN7_870                       179   3e-49    
dbj|BAE24185.1|  unnamed protein product                                179   3e-49    
ref|XP_003788268.1|  PREDICTED: nucleolar protein 56                    180   3e-49    
ref|XP_010589876.1|  PREDICTED: nucleolar protein 56                    180   3e-49    
ref|XP_002747496.3|  PREDICTED: nucleolar protein 56                    180   3e-49    
ref|NP_957511.1|  nucleolar protein 56                                  179   3e-49    
ref|XP_010609331.1|  PREDICTED: nucleolar protein 56 isoform X2         178   3e-49    
gb|AAH56732.1|  Nop56 protein                                           178   3e-49    
ref|XP_006758084.1|  PREDICTED: nucleolar protein 56 isoform X1         180   3e-49    
ref|XP_007960441.1|  PREDICTED: nucleolar protein 56 isoform X2         179   3e-49    
ref|XP_005634931.1|  PREDICTED: nucleolar protein 56 isoform X2         178   3e-49    
ref|XP_002127982.1|  PREDICTED: nucleolar protein 56-like               179   3e-49    
gb|EMD40224.1|  hypothetical protein CERSUDRAFT_71997                   179   4e-49    
emb|CDF91232.1|  ZYBA0S10-02674g1_1                                     179   4e-49    
ref|XP_007960434.1|  PREDICTED: nucleolar protein 56 isoform X1         180   4e-49    
dbj|BAF85410.1|  unnamed protein product                                180   4e-49    
ref|XP_003273471.1|  PREDICTED: nucleolar protein 56                    180   4e-49    
ref|XP_010377311.1|  PREDICTED: nucleolar protein 56                    179   4e-49    
gb|EAX10587.1|  nucleolar protein 5A (56kDa with KKE/D repeat), i...    179   4e-49    
gb|EAX10589.1|  nucleolar protein 5A (56kDa with KKE/D repeat), i...    180   4e-49    
gb|EHH19861.1|  Nucleolar protein 5A                                    179   5e-49    
ref|NP_001271483.1|  nucleolar protein 56                               179   5e-49    
ref|NP_006383.2|  nucleolar protein 56                                  179   5e-49    
ref|XP_006096440.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar pr...    179   5e-49    
ref|XP_006044940.1|  PREDICTED: nucleolar protein 56                    177   5e-49    
ref|XP_008065374.1|  PREDICTED: nucleolar protein 56                    179   5e-49    
ref|XP_009037754.1|  hypothetical protein AURANDRAFT_59068              178   5e-49    
ref|NP_001231603.1|  nucleolar protein 56                               179   5e-49    
ref|XP_001263499.1|  pre-rRNA processing nucleolar protein Sik1, ...    178   5e-49    
ref|XP_004061753.1|  PREDICTED: nucleolar protein 56                    179   6e-49    
ref|XP_003821337.1|  PREDICTED: nucleolar protein 56 isoform X1         179   6e-49    
emb|CAA72789.1|  hNop56                                                 179   6e-49    
dbj|BAJ21047.1|  NOP56 ribonucleoprotein homolog                        179   6e-49    
ref|XP_004697938.1|  PREDICTED: nucleolar protein 56                    179   6e-49    
gb|EHH65491.1|  Nucleolar protein 5A                                    179   6e-49    
gb|KIP06858.1|  hypothetical protein PHLGIDRAFT_106506                  178   8e-49    
dbj|BAB26511.1|  unnamed protein product                                179   8e-49    
ref|XP_006163996.1|  PREDICTED: nucleolar protein 56                    179   9e-49    
ref|XP_002674213.1|  nucleolar protein 5A                               179   9e-49    
ref|XP_007635385.1|  PREDICTED: nucleolar protein 56                    179   9e-49    
ref|XP_006675663.1|  hypothetical protein BATDEDRAFT_32692              177   9e-49    
ref|XP_008278728.1|  PREDICTED: nucleolar protein 56                    178   1e-48    
ref|XP_005380815.1|  PREDICTED: nucleolar protein 56 isoform X1         179   1e-48    
ref|XP_005604787.1|  PREDICTED: nucleolar protein 56                    179   1e-48    
ref|XP_005161071.2|  PREDICTED: nucleolar protein 56 isoform X1         178   1e-48    
ref|NP_001020903.1|  nucleolar protein 56                               179   1e-48    
ref|XP_004383061.1|  PREDICTED: nucleolar protein 56                    179   1e-48    
ref|XP_005068672.1|  PREDICTED: nucleolar protein 56                    179   1e-48    
ref|NP_077155.2|  nucleolar protein 56                                  178   1e-48    
ref|XP_011367711.1|  PREDICTED: nucleolar protein 56 isoform X1         178   1e-48    
ref|XP_006921729.1|  PREDICTED: nucleolar protein 56                    178   1e-48    
ref|XP_005365683.1|  PREDICTED: nucleolar protein 56                    178   1e-48    
gb|AAH21355.1|  NOP56 ribonucleoprotein homolog (yeast)                 178   1e-48    
ref|XP_008139230.1|  PREDICTED: nucleolar protein 56                    178   1e-48    
gb|ELK04028.1|  Nucleolar protein 56                                    179   1e-48    
dbj|BAE27007.1|  unnamed protein product                                178   1e-48    
gb|ESW98775.1|  Nucleolar protein 56                                    177   2e-48    
gb|KIL00204.1|  hypothetical protein PAXRUDRAFT_821907                  177   2e-48    
ref|XP_006984578.1|  PREDICTED: nucleolar protein 56 isoform X1         178   2e-48    
ref|XP_005815219.1|  PREDICTED: nucleolar protein 56-like               177   2e-48    
ref|XP_002836982.1|  hypothetical protein                               177   2e-48    
ref|XP_003361646.2|  PREDICTED: nucleolar protein 56-like               178   2e-48    
ref|XP_008852723.1|  PREDICTED: nucleolar protein 56                    178   2e-48    
gb|KFV61200.1|  Nucleolar protein 56                                    176   2e-48    
ref|XP_004634291.1|  PREDICTED: nucleolar protein 56                    178   2e-48    
ref|XP_754659.1|  pre-rRNA processing nucleolar protein Sik1            177   2e-48    
ref|XP_007757608.1|  hypothetical protein A1O7_05408                    177   2e-48    
ref|XP_004433887.1|  PREDICTED: nucleolar protein 56 isoform 1          178   2e-48    
gb|KEY81539.1|  pre rRNA processing nucleolar protein Sik1              177   2e-48    
ref|XP_011262960.1|  PREDICTED: nucleolar protein 56                    176   2e-48    
gb|EHB04280.1|  Nucleolar protein 56                                    177   2e-48    
ref|XP_004285382.1|  PREDICTED: nucleolar protein 56                    177   2e-48    
ref|XP_004433888.1|  PREDICTED: nucleolar protein 56 isoform 2          177   2e-48    
ref|XP_004772971.1|  PREDICTED: nucleolar protein 56                    177   2e-48    
ref|XP_007127210.1|  PREDICTED: nucleolar protein 56 isoform X1         177   3e-48    
ref|XP_004318042.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar pr...    177   3e-48    
gb|EFB15471.1|  hypothetical protein PANDA_007374                       177   3e-48    
ref|XP_010609330.1|  PREDICTED: nucleolar protein 56 isoform X1         177   3e-48    
ref|XP_004886763.1|  PREDICTED: nucleolar protein 56                    177   3e-48    
ref|XP_002000695.1|  GI10373                                            176   3e-48    
ref|XP_006732348.1|  PREDICTED: nucleolar protein 56                    177   3e-48    
ref|XP_003476468.2|  PREDICTED: nucleolar protein 56                    177   3e-48    
ref|XP_011222704.1|  PREDICTED: nucleolar protein 56                    177   3e-48    
ref|XP_004687397.1|  PREDICTED: nucleolar protein 56                    177   3e-48    
ref|XP_004398200.1|  PREDICTED: nucleolar protein 56                    177   3e-48    
ref|XP_003983778.1|  PREDICTED: nucleolar protein 56                    177   3e-48    
ref|XP_008505981.1|  PREDICTED: nucleolar protein 56                    177   3e-48    
ref|XP_851724.2|  PREDICTED: nucleolar protein 56 isoform X3            177   3e-48    
ref|XP_007958208.1|  PREDICTED: nucleolar protein 56 isoform X1         177   4e-48    
gb|KIW12183.1|  hypothetical protein PV08_09459                         176   4e-48    
ref|XP_005634930.1|  PREDICTED: nucleolar protein 56 isoform X1         177   4e-48    
ref|XP_008587878.1|  PREDICTED: nucleolar protein 56                    177   4e-48    
gb|KIO05287.1|  hypothetical protein M404DRAFT_9030                     176   4e-48    
ref|NP_001125816.1|  nucleolar protein 56                               177   4e-48    
gb|KIW80861.1|  hypothetical protein Z517_03884                         176   4e-48    
gb|ESZ96794.1|  putative pre-rRNA processing nucleolar protein Sik1     175   4e-48    
ref|XP_007958209.1|  PREDICTED: nucleolar protein 56 isoform X2         177   5e-48    
dbj|BAC37015.1|  unnamed protein product                                177   5e-48    
ref|XP_010986588.1|  PREDICTED: nucleolar protein 56                    177   5e-48    
ref|NP_013298.1|  snoRNP complex protein NOP56                          176   5e-48    
ref|XP_011135314.1|  PREDICTED: nucleolar protein 56-like               175   5e-48    
ref|XP_002073574.1|  GK14188                                            176   5e-48    
ref|XP_010971089.1|  PREDICTED: nucleolar protein 56                    177   5e-48    
ref|XP_007465444.1|  PREDICTED: nucleolar protein 56                    177   5e-48    
gb|ESA02498.1|  hypothetical protein GLOINDRAFT_337356                  177   5e-48    
ref|XP_003442755.1|  PREDICTED: nucleolar protein 56                    176   5e-48    
gb|KIW33112.1|  hypothetical protein PV07_04604                         176   6e-48    
emb|CAY81429.1|  Sik1p                                                  175   6e-48    
gb|KIW39161.1|  hypothetical protein PV06_08962                         175   6e-48    
ref|XP_003139181.1|  nol5a protein                                      176   7e-48    
gb|KIW86856.1|  hypothetical protein Z519_12477                         175   8e-48    
emb|CEP62588.1|  LALA0S05e08966g1_1                                     175   8e-48    
gb|ELR57620.1|  Nucleolar protein 56                                    176   8e-48    
ref|XP_011150468.1|  PREDICTED: nucleolar protein 56-like               174   8e-48    
ref|XP_008723795.1|  hypothetical protein G647_09579                    175   8e-48    
ref|XP_005893993.1|  PREDICTED: nucleolar protein 56                    176   8e-48    
ref|XP_005974822.1|  PREDICTED: nucleolar protein 56                    176   9e-48    
ref|XP_010879154.1|  PREDICTED: nucleolar protein 56                    176   9e-48    
ref|XP_007554336.1|  PREDICTED: nucleolar protein 56                    175   9e-48    
ref|XP_004014434.1|  PREDICTED: nucleolar protein 56                    176   9e-48    
gb|EGA61281.1|  Sik1p                                                   175   9e-48    
ref|XP_010834818.1|  PREDICTED: nucleolar protein 56                    176   1e-47    
ref|XP_009883931.1|  PREDICTED: nucleolar protein 56-like               175   1e-47    
gb|EJT46895.1|  hypothetical protein A1Q1_04365                         175   1e-47    
ref|XP_011104537.1|  sik1p                                              174   1e-47    
gb|KIV87001.1|  hypothetical protein PV11_02574                         175   1e-47    
ref|XP_005918710.1|  PREDICTED: nucleolar protein 56-like               175   1e-47    
ref|XP_003383935.1|  PREDICTED: nucleolar protein 56-like               175   1e-47    
dbj|GAD96817.1|  pre-rRNA processing nucleolar protein Sik1, puta...    174   1e-47    
gb|EJU03375.1|  Nop domain-containing protein                           175   1e-47    
emb|CDH11324.1|  probable Nucleolar protein 56                          174   2e-47    
ref|XP_005239616.1|  PREDICTED: dynactin subunit 1                      179   2e-47    
ref|XP_006683874.1|  Nop-domain-containing protein                      174   2e-47    
emb|CDK24344.1|  unnamed protein product                                174   2e-47    
ref|XP_004611059.1|  PREDICTED: nucleolar protein 56                    175   2e-47    
ref|XP_004545283.1|  PREDICTED: nucleolar protein 56-like               175   2e-47    
ref|XP_001586795.1|  hypothetical protein SS1G_11824                    174   2e-47    
ref|XP_444941.1|  hypothetical protein                                  174   2e-47    
ref|XP_638211.1|  NOP5 family protein                                   174   2e-47    
ref|XP_005731328.1|  PREDICTED: nucleolar protein 56-like               175   2e-47    
ref|XP_002497712.1|  ZYRO0F11792p                                       174   2e-47    
gb|KIX94649.1|  hypothetical protein Z520_09695                         174   2e-47    
gb|KIX02211.1|  hypothetical protein Z518_08150                         174   2e-47    
emb|CCD43379.1|  similar to pre-rRNA processing nucleolar protein...    174   2e-47    
ref|XP_003959896.1|  hypothetical protein KAFR_0L01510                  174   2e-47    
ref|XP_001387632.1|  nucleolar protein involved in pre- rRNA proc...    173   3e-47    
gb|EGA77727.1|  Sik1p                                                   174   3e-47    
ref|XP_004180780.1|  hypothetical protein TBLA_0E02080                  174   3e-47    
dbj|BAO40965.1|  nucleolar protein 56                                   174   3e-47    
emb|CAG01410.1|  unnamed protein product                                174   3e-47    
ref|XP_001994928.1|  GH17505                                            173   3e-47    
ref|XP_010741588.1|  PREDICTED: nucleolar protein 56                    174   3e-47    
ref|XP_003973642.1|  PREDICTED: nucleolar protein 56-like               174   3e-47    
gb|KIK55358.1|  hypothetical protein GYMLUDRAFT_231094                  174   3e-47    
ref|XP_007373328.1|  nucleolar protein                                  173   3e-47    
ref|NP_001028794.1|  nucleolar protein 56                               174   3e-47    
ref|XP_003686216.1|  hypothetical protein TPHA_0F03010                  173   3e-47    
ref|XP_008407701.1|  PREDICTED: nucleolar protein 56                    174   3e-47    
gb|EWC45591.1|  nucleolar protein 56                                    174   3e-47    
ref|XP_005187804.1|  PREDICTED: nucleolar protein 56                    173   4e-47    
gb|EHN01190.1|  Sik1p                                                   173   4e-47    
gb|EGA81687.1|  Sik1p                                                   173   4e-47    
emb|CDQ61956.1|  unnamed protein product                                174   4e-47    
gb|EJT42322.1|  NOP56-like protein                                      173   4e-47    
ref|NP_651040.3|  Nop56                                                 173   4e-47    
ref|XP_002032194.1|  GM23654                                            173   4e-47    
gb|AAN71368.1|  RE33426p                                                173   4e-47    
ref|XP_002098284.1|  GE24041                                            173   4e-47    
ref|XP_002104416.1|  GD18461                                            173   5e-47    
ref|XP_011172969.1|  PREDICTED: nucleolar protein 56                    172   5e-47    
ref|XP_008318633.1|  PREDICTED: nucleolar protein 56                    174   5e-47    
ref|XP_002054381.1|  GJ22835                                            173   5e-47    
ref|XP_001982282.1|  GG12519                                            172   5e-47    
gb|ACO12309.1|  Nucleolar protein 5A                                    173   5e-47    



>ref|XP_011083862.1| PREDICTED: nucleolar protein 56-like [Sesamum indicum]
Length=521

 Score =   355 bits (910),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 169/188 (90%), Positives = 181/188 (96%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MALY+LYESASGYGLF AHG+DEIGQNTEAVR+SV DLNRFGKVVKL AF+P+ESALDAL
Sbjct  1    MALYVLYESASGYGLFLAHGIDEIGQNTEAVRSSVDDLNRFGKVVKLAAFSPYESALDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQCNAVSEGQMTDELRNFLELTLPKVK+ KK KFSLG+AEPKLGSHI+E TKIPCQSNEF
Sbjct  61   NQCNAVSEGQMTDELRNFLELTLPKVKEGKKPKFSLGVAEPKLGSHIYEVTKIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            VLELLRGVRLHF++FIENLK GDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VLELLRGVRLHFDRFIENLKPGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKD+N+F
Sbjct  181  LDKDINSF  188



>gb|EYU23115.1| hypothetical protein MIMGU_mgv1a004585mg [Erythranthe guttata]
Length=518

 Score =   354 bits (909),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 168/188 (89%), Positives = 180/188 (96%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MALY+LYESASGYGLF AHG+DEIGQNTEAVR+SV DLNRFGKVVKL AF P+ESALDAL
Sbjct  1    MALYVLYESASGYGLFLAHGIDEIGQNTEAVRSSVSDLNRFGKVVKLAAFTPYESALDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQCNAVSEGQMTDELRNFLEL+LPKVK+ KK KFSLGLAEPKLGSHIFE TKIPCQSNEF
Sbjct  61   NQCNAVSEGQMTDELRNFLELSLPKVKEGKKPKFSLGLAEPKLGSHIFEVTKIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            +LELLRGVRLHF++FIENLK GDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAI++LDT
Sbjct  121  ILELLRGVRLHFDRFIENLKPGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIYILDT  180

Query  637  LDKDVNTF  660
            LDKDVN+F
Sbjct  181  LDKDVNSF  188



>gb|EYU23114.1| hypothetical protein MIMGU_mgv1a004585mg [Erythranthe guttata]
Length=519

 Score =   354 bits (909),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 168/188 (89%), Positives = 180/188 (96%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MALY+LYESASGYGLF AHG+DEIGQNTEAVR+SV DLNRFGKVVKL AF P+ESALDAL
Sbjct  1    MALYVLYESASGYGLFLAHGIDEIGQNTEAVRSSVSDLNRFGKVVKLAAFTPYESALDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQCNAVSEGQMTDELRNFLEL+LPKVK+ KK KFSLGLAEPKLGSHIFE TKIPCQSNEF
Sbjct  61   NQCNAVSEGQMTDELRNFLELSLPKVKEGKKPKFSLGLAEPKLGSHIFEVTKIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            +LELLRGVRLHF++FIENLK GDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAI++LDT
Sbjct  121  ILELLRGVRLHFDRFIENLKPGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIYILDT  180

Query  637  LDKDVNTF  660
            LDKDVN+F
Sbjct  181  LDKDVNSF  188



>ref|XP_010037433.1| PREDICTED: nucleolar protein 56-like [Eucalyptus grandis]
 gb|KCW49154.1| hypothetical protein EUGRSUZ_K02739 [Eucalyptus grandis]
Length=555

 Score =   353 bits (906),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 169/188 (90%), Positives = 179/188 (95%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MALYLLYESASGY L  AHGLDEIGQNTEAVR+SV DLNRFGKVVKLVAF+PFESALDAL
Sbjct  1    MALYLLYESASGYALLEAHGLDEIGQNTEAVRSSVSDLNRFGKVVKLVAFSPFESALDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQCN+VSEG MTDELRNFLEL LPKVKD KK KFSLGLAEPK+GSHIFEETKIPCQSNEF
Sbjct  61   NQCNSVSEGLMTDELRNFLELNLPKVKDGKKPKFSLGLAEPKIGSHIFEETKIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            VLELLRGVRLHF++FI++LK GDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VLELLRGVRLHFDRFIKDLKQGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKD+N+F
Sbjct  181  LDKDINSF  188



>gb|EYU43055.1| hypothetical protein MIMGU_mgv1a004561mg [Erythranthe guttata]
Length=520

 Score =   348 bits (894),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 166/188 (88%), Positives = 178/188 (95%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MALY+LYESASGYGLF AHG+DEIGQNTEAVR SV DLNRFGKVVK VAF P+ SALDAL
Sbjct  1    MALYVLYESASGYGLFLAHGIDEIGQNTEAVRTSVTDLNRFGKVVKFVAFTPYGSALDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQCNAVSEGQMTDELRNFLE +LPKVK+ KK+KFSLGLAEPKLGSHIFE TKIPCQSNEF
Sbjct  61   NQCNAVSEGQMTDELRNFLENSLPKVKEGKKSKFSLGLAEPKLGSHIFEVTKIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            VLE+LRGVRLHF++FIENLK GDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIF+LDT
Sbjct  121  VLEILRGVRLHFDRFIENLKPGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFILDT  180

Query  637  LDKDVNTF  660
            LDKD+N+F
Sbjct  181  LDKDINSF  188



>ref|XP_006344769.1| PREDICTED: nucleolar protein 56-like [Solanum tuberosum]
Length=553

 Score =   348 bits (894),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 169/188 (90%), Positives = 177/188 (94%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MALYLLYESASGYGLF AHG+DEIGQNTEAVRNS+ DLNRFGKVVKL AFNPFESALDAL
Sbjct  1    MALYLLYESASGYGLFLAHGIDEIGQNTEAVRNSITDLNRFGKVVKLEAFNPFESALDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQCNAVSEGQMT+EL+NFLE +LPKVK+ KKAKFSLGLAEPKLGSHI E TKIPCQSNEF
Sbjct  61   NQCNAVSEGQMTEELQNFLERSLPKVKEGKKAKFSLGLAEPKLGSHIHEVTKIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            VLE+LRGVRLHFEKFIENLK GDLEKAQLGL HSYSRAKVKFNVNRVDNMV QAI LLDT
Sbjct  121  VLEILRGVRLHFEKFIENLKHGDLEKAQLGLSHSYSRAKVKFNVNRVDNMVTQAIVLLDT  180

Query  637  LDKDVNTF  660
            LDKD+NTF
Sbjct  181  LDKDINTF  188



>ref|XP_009782739.1| PREDICTED: nucleolar protein 56-like [Nicotiana sylvestris]
Length=547

 Score =   348 bits (892),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 168/188 (89%), Positives = 176/188 (94%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MALYLLYESASGY LF AHG+DEIGQNTEAVRNS+ DLNRFGKVVK+ AFNPFESALDAL
Sbjct  1    MALYLLYESASGYALFLAHGIDEIGQNTEAVRNSITDLNRFGKVVKIEAFNPFESALDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQCNAVSEGQMT+ELRNFLE +LPKVK+ KKAKFSLGLAEPKLGSHI E TKIPCQSNEF
Sbjct  61   NQCNAVSEGQMTEELRNFLERSLPKVKEGKKAKFSLGLAEPKLGSHIHEVTKIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            +LELLRGVRLHFEKFIENLK GDLEKAQLGL HSYSRAKVKFNVNRVDNMV QAI LLDT
Sbjct  121  ILELLRGVRLHFEKFIENLKPGDLEKAQLGLSHSYSRAKVKFNVNRVDNMVTQAIVLLDT  180

Query  637  LDKDVNTF  660
            LDKD+NTF
Sbjct  181  LDKDINTF  188



>ref|XP_009603298.1| PREDICTED: nucleolar protein 56-like [Nicotiana tomentosiformis]
Length=555

 Score =   348 bits (893),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 169/188 (90%), Positives = 176/188 (94%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MALYLLYESASGY LF AHGLDEIGQNTEAVRNSV DLNRFGK++KL AF+PFESALDAL
Sbjct  1    MALYLLYESASGYALFLAHGLDEIGQNTEAVRNSVTDLNRFGKILKLAAFSPFESALDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQCNAVSEGQMTDELRNFLELTLPKVK+ KK KFSLGLAEPKLGSHI E TK PCQSNEF
Sbjct  61   NQCNAVSEGQMTDELRNFLELTLPKVKEGKKPKFSLGLAEPKLGSHIHEVTKFPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            VLELLRGVRLHF+KFIENLK+GDLEKAQLGL HSYSRAKVKFNVNRVDNMV QAI LLDT
Sbjct  121  VLELLRGVRLHFDKFIENLKSGDLEKAQLGLSHSYSRAKVKFNVNRVDNMVTQAIVLLDT  180

Query  637  LDKDVNTF  660
            LDKD+NTF
Sbjct  181  LDKDINTF  188



>ref|XP_009767290.1| PREDICTED: nucleolar protein 56-like [Nicotiana sylvestris]
Length=554

 Score =   347 bits (891),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 169/188 (90%), Positives = 175/188 (93%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MALYLLYESASGY LF  HGLDEIGQNTEAVRNSV DLNRFGK+VKL AF+PFESALDAL
Sbjct  1    MALYLLYESASGYALFLVHGLDEIGQNTEAVRNSVTDLNRFGKIVKLAAFSPFESALDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQCNAVSEGQMTDELRNFLELTLPKVK+ KK KFSLGLAEPKLGSHI E TK PCQSNEF
Sbjct  61   NQCNAVSEGQMTDELRNFLELTLPKVKEGKKPKFSLGLAEPKLGSHIHEVTKFPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            VLELLRGVRLHF+KFIENLK+GDLEKAQLGL HSYSRAKVKFNVNRVDNMV QAI LLDT
Sbjct  121  VLELLRGVRLHFDKFIENLKSGDLEKAQLGLSHSYSRAKVKFNVNRVDNMVTQAIVLLDT  180

Query  637  LDKDVNTF  660
            LDKD+NTF
Sbjct  181  LDKDINTF  188



>emb|CBI15634.3| unnamed protein product [Vitis vinifera]
Length=470

 Score =   344 bits (883),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 165/188 (88%), Positives = 178/188 (95%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MALYLLYESASGY LF AHGLDEIGQNTEAVR+SV DLNRFGKVVKL AF+PFESALDAL
Sbjct  1    MALYLLYESASGYALFLAHGLDEIGQNTEAVRSSVSDLNRFGKVVKLAAFHPFESALDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQCN+VSEG MTDELR+FLEL LPKVK+ KK KFSLG AEPK+GSHIFE+TKIPCQSNEF
Sbjct  61   NQCNSVSEGLMTDELRSFLELNLPKVKEGKKPKFSLGTAEPKIGSHIFEDTKIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            VLELLRGVRLHF++FI++LK GDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VLELLRGVRLHFDRFIKDLKPGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKD+N+F
Sbjct  181  LDKDINSF  188



>ref|XP_009598202.1| PREDICTED: nucleolar protein 56-like [Nicotiana tomentosiformis]
Length=545

 Score =   347 bits (889),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 167/188 (89%), Positives = 175/188 (93%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            M LYLLYESASGY LF AHG+DEIGQNTEAVRNS+ DLNRFGKVVK+ AFNPFESALDAL
Sbjct  1    MTLYLLYESASGYALFLAHGIDEIGQNTEAVRNSITDLNRFGKVVKIEAFNPFESALDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQCNAVSEGQMT+ELRNFLE +LPKVK+ KKAKFSLGLAEPKLGSHI E TKIPCQSNEF
Sbjct  61   NQCNAVSEGQMTEELRNFLERSLPKVKEGKKAKFSLGLAEPKLGSHIHEVTKIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            +LELLRGVRLHFEKFIENLK GDLEKAQLGL HSYSRAKVKFNVNRVDNMV QAI LLDT
Sbjct  121  ILELLRGVRLHFEKFIENLKPGDLEKAQLGLSHSYSRAKVKFNVNRVDNMVTQAIVLLDT  180

Query  637  LDKDVNTF  660
            LDKD+NTF
Sbjct  181  LDKDINTF  188



>ref|XP_002283518.1| PREDICTED: nucleolar protein 56-like [Vitis vinifera]
Length=558

 Score =   345 bits (885),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 165/188 (88%), Positives = 178/188 (95%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MALYLLYESASGY LF AHGLDEIGQNTEAVR+SV DLNRFGKVVKL AF+PFESALDAL
Sbjct  1    MALYLLYESASGYALFLAHGLDEIGQNTEAVRSSVSDLNRFGKVVKLAAFHPFESALDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQCN+VSEG MTDELR+FLEL LPKVK+ KK KFSLG AEPK+GSHIFE+TKIPCQSNEF
Sbjct  61   NQCNSVSEGLMTDELRSFLELNLPKVKEGKKPKFSLGTAEPKIGSHIFEDTKIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            VLELLRGVRLHF++FI++LK GDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VLELLRGVRLHFDRFIKDLKPGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKD+N+F
Sbjct  181  LDKDINSF  188



>ref|XP_010102881.1| hypothetical protein L484_002679 [Morus notabilis]
 gb|EXB94318.1| hypothetical protein L484_002679 [Morus notabilis]
Length=547

 Score =   344 bits (882),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 166/188 (88%), Positives = 178/188 (95%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MALYLLYESASGY LF+AHGLDEIGQNTEAVRNSV DLNRFGKVV+L AF+PFESALDAL
Sbjct  1    MALYLLYESASGYALFNAHGLDEIGQNTEAVRNSVADLNRFGKVVQLTAFHPFESALDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQCN+VSEG MTDELR+FLEL LPKVK+ KK KFSLGLAEPKLGS++ E TKIPCQSNEF
Sbjct  61   NQCNSVSEGLMTDELRSFLELNLPKVKEGKKPKFSLGLAEPKLGSNVLEATKIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            VLELLRGVRLHF+KFI++LK GDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VLELLRGVRLHFDKFIKDLKTGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKDVN+F
Sbjct  181  LDKDVNSF  188



>ref|XP_006477000.1| PREDICTED: nucleolar protein 56-like isoform X1 [Citrus sinensis]
Length=561

 Score =   343 bits (881),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 161/188 (86%), Positives = 180/188 (96%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MALYLLYE+ASGY LF AHGLD+IGQNTEAVR+S+ D+NRFGKVV+L AF+PFESALDAL
Sbjct  1    MALYLLYETASGYSLFLAHGLDQIGQNTEAVRSSISDMNRFGKVVQLTAFHPFESALDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQCN+VSEG MT+ELRNFLEL LPKVK+ KKAKFSLG++EPK+GSHIFEETKIPCQSNEF
Sbjct  61   NQCNSVSEGLMTNELRNFLELNLPKVKEGKKAKFSLGVSEPKIGSHIFEETKIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            VLELLRGVRLHF++FI++LK GDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VLELLRGVRLHFDRFIKDLKPGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKD+N+F
Sbjct  181  LDKDINSF  188



>ref|XP_006477001.1| PREDICTED: nucleolar protein 56-like isoform X2 [Citrus sinensis]
Length=553

 Score =   343 bits (880),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 161/188 (86%), Positives = 180/188 (96%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MALYLLYE+ASGY LF AHGLD+IGQNTEAVR+S+ D+NRFGKVV+L AF+PFESALDAL
Sbjct  1    MALYLLYETASGYSLFLAHGLDQIGQNTEAVRSSISDMNRFGKVVQLTAFHPFESALDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQCN+VSEG MT+ELRNFLEL LPKVK+ KKAKFSLG++EPK+GSHIFEETKIPCQSNEF
Sbjct  61   NQCNSVSEGLMTNELRNFLELNLPKVKEGKKAKFSLGVSEPKIGSHIFEETKIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            VLELLRGVRLHF++FI++LK GDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VLELLRGVRLHFDRFIKDLKPGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKD+N+F
Sbjct  181  LDKDINSF  188



>ref|XP_006440078.1| hypothetical protein CICLE_v10019526mg [Citrus clementina]
 gb|ESR53318.1| hypothetical protein CICLE_v10019526mg [Citrus clementina]
Length=562

 Score =   343 bits (880),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 161/188 (86%), Positives = 180/188 (96%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MALYLLYE+ASGY LF AHGLD+IGQNTEAVR+S+ D+NRFGKVV+L AF+PFESALDAL
Sbjct  1    MALYLLYETASGYSLFLAHGLDQIGQNTEAVRSSISDMNRFGKVVQLTAFHPFESALDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQCN+VSEG MT+ELRNFLEL LPKVK+ KKAKFSLG++EPK+GSHIFEETKIPCQSNEF
Sbjct  61   NQCNSVSEGLMTNELRNFLELNLPKVKEGKKAKFSLGVSEPKIGSHIFEETKIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            VLELLRGVRLHF++FI++LK GDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VLELLRGVRLHFDRFIKDLKPGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKD+N+F
Sbjct  181  LDKDINSF  188



>ref|XP_006440077.1| hypothetical protein CICLE_v10019526mg [Citrus clementina]
 gb|ESR53317.1| hypothetical protein CICLE_v10019526mg [Citrus clementina]
Length=554

 Score =   343 bits (880),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 161/188 (86%), Positives = 180/188 (96%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MALYLLYE+ASGY LF AHGLD+IGQNTEAVR+S+ D+NRFGKVV+L AF+PFESALDAL
Sbjct  1    MALYLLYETASGYSLFLAHGLDQIGQNTEAVRSSISDMNRFGKVVQLTAFHPFESALDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQCN+VSEG MT+ELRNFLEL LPKVK+ KKAKFSLG++EPK+GSHIFEETKIPCQSNEF
Sbjct  61   NQCNSVSEGLMTNELRNFLELNLPKVKEGKKAKFSLGVSEPKIGSHIFEETKIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            VLELLRGVRLHF++FI++LK GDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VLELLRGVRLHFDRFIKDLKPGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKD+N+F
Sbjct  181  LDKDINSF  188



>gb|AGU28427.1| nucleolar protein NOP56-like protein, partial [Sinapis alba]
Length=232

 Score =   332 bits (850),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 159/188 (85%), Positives = 175/188 (93%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MA+YLLYES+SGYGLF AHGLDEIGQNTEAVR+SV DL+RFG+VV+L AF+PFESALDAL
Sbjct  1    MAMYLLYESSSGYGLFEAHGLDEIGQNTEAVRSSVSDLSRFGRVVQLTAFHPFESALDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQ NAVSEG MTDELR+FLEL LPKVK+ KK KFSLG AEPKLGSHI E TKIPCQSNEF
Sbjct  61   NQVNAVSEGVMTDELRSFLELNLPKVKEGKKPKFSLGTAEPKLGSHILEATKIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            VLELLRGVRLHF++FI++LK GDLEK+QLGL HSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VLELLRGVRLHFDRFIKDLKPGDLEKSQLGLAHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKD+N+F
Sbjct  181  LDKDINSF  188



>ref|XP_004230313.1| PREDICTED: nucleolar protein 56-like [Solanum lycopersicum]
Length=553

 Score =   343 bits (879),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 165/188 (88%), Positives = 176/188 (94%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MALYLLYESASGYGLF AHG+DEIGQNTEAVRNS+ DLNRFGKVVK+ AFNPFESALDAL
Sbjct  1    MALYLLYESASGYGLFLAHGIDEIGQNTEAVRNSIDDLNRFGKVVKIEAFNPFESALDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQCNAVSEGQMT+EL+NFLE +LPKVK+ KKAKFSLGLAEPKLGSHI E TKIPCQSNEF
Sbjct  61   NQCNAVSEGQMTEELQNFLERSLPKVKEGKKAKFSLGLAEPKLGSHIHEVTKIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            VLE+LRGVRLHFEKF++NLK GD EKAQLGL HSYSRAKVKFNVNRVDNMV QAI LLDT
Sbjct  121  VLEILRGVRLHFEKFVKNLKPGDSEKAQLGLSHSYSRAKVKFNVNRVDNMVTQAIVLLDT  180

Query  637  LDKDVNTF  660
            LDKD+NTF
Sbjct  181  LDKDINTF  188



>gb|KDP30943.1| hypothetical protein JCGZ_11319 [Jatropha curcas]
Length=556

 Score =   342 bits (878),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 165/188 (88%), Positives = 179/188 (95%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MALYLLYESASGY LF A+GLDEIGQNTEAVRNSV DLNRFGKVV+L AF PFES+LDAL
Sbjct  1    MALYLLYESASGYSLFLANGLDEIGQNTEAVRNSVADLNRFGKVVQLTAFLPFESSLDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQCN+VSEG MT+ELR+FLEL LPKVK+ KKAKFSLG+AEPKLGSHI+EETKIPCQSNEF
Sbjct  61   NQCNSVSEGLMTEELRSFLELNLPKVKEGKKAKFSLGVAEPKLGSHIYEETKIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            VLELLRGVRLHFE+FI++LK GDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VLELLRGVRLHFERFIKDLKPGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKD+N+F
Sbjct  181  LDKDINSF  188



>ref|XP_008239441.1| PREDICTED: nucleolar protein 56-like [Prunus mume]
Length=552

 Score =   342 bits (878),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 161/188 (86%), Positives = 178/188 (95%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MALYLLYE+ASGY LF AHG+DEIGQNT+AVR+SV DLNRFGKVV+L AF+PFESALDAL
Sbjct  1    MALYLLYEAASGYSLFLAHGIDEIGQNTDAVRSSVSDLNRFGKVVQLTAFHPFESALDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQCN++SEG MTDELRNFLE+ LPKVKD KK KFSLGLAEPK+GSHIFE TKIPCQSN+F
Sbjct  61   NQCNSISEGVMTDELRNFLEINLPKVKDGKKPKFSLGLAEPKIGSHIFEATKIPCQSNDF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            VLEL+RGVRLHF++FI++LK GDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VLELIRGVRLHFDRFIKDLKPGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKDVN+F
Sbjct  181  LDKDVNSF  188



>ref|XP_007210566.1| hypothetical protein PRUPE_ppa003786mg [Prunus persica]
 gb|EMJ11765.1| hypothetical protein PRUPE_ppa003786mg [Prunus persica]
Length=549

 Score =   342 bits (877),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 161/188 (86%), Positives = 178/188 (95%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MALYLLYE+ASGY LF AHG+DEIGQNT+AVR+SV DLNRFGKVV+L AF+PFESALDAL
Sbjct  1    MALYLLYEAASGYSLFLAHGIDEIGQNTDAVRSSVSDLNRFGKVVQLTAFHPFESALDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQCN++SEG MTDELRNFLE+ LPKVKD KK KFSLGLAEPK+GSHIFE TKIPCQSN+F
Sbjct  61   NQCNSISEGVMTDELRNFLEINLPKVKDGKKPKFSLGLAEPKIGSHIFEATKIPCQSNDF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            VLEL+RGVRLHF++FI++LK GDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VLELIRGVRLHFDRFIKDLKPGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKDVN+F
Sbjct  181  LDKDVNSF  188



>ref|XP_010938674.1| PREDICTED: nucleolar protein 56-like [Elaeis guineensis]
Length=559

 Score =   342 bits (877),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 164/188 (87%), Positives = 175/188 (93%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MALYLL+ESASGY LFHA+GLDEIGQNTEAVRNSV DL RFGKVVKLVAF PF SALDAL
Sbjct  1    MALYLLFESASGYSLFHAYGLDEIGQNTEAVRNSVHDLTRFGKVVKLVAFQPFSSALDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQCNA+SEG MTDELRNFLE+ LPK KD KKAKFSLG+AEPK+GS IFE TKIPCQSNEF
Sbjct  61   NQCNAISEGLMTDELRNFLEINLPKPKDGKKAKFSLGVAEPKVGSQIFEVTKIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            VLELLRGVRLHF++FI++LK  DLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VLELLRGVRLHFDRFIKDLKPSDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKD+NTF
Sbjct  181  LDKDINTF  188



>ref|XP_002318715.1| nucleolar family protein [Populus trichocarpa]
 gb|EEE96935.1| nucleolar family protein [Populus trichocarpa]
Length=540

 Score =   340 bits (873),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 164/188 (87%), Positives = 178/188 (95%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MAL+LLYE++SGY LF A+GLDEIGQNTEAVRNSV DLNRFGKVV+L AF+PFESALDAL
Sbjct  1    MALFLLYETSSGYSLFVANGLDEIGQNTEAVRNSVSDLNRFGKVVQLTAFHPFESALDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQCN+VSEG MTDELRNFLEL LPKVK+ KKAKFSLG+AEPK+GSHIFE TKIPCQSNEF
Sbjct  61   NQCNSVSEGIMTDELRNFLELNLPKVKEGKKAKFSLGVAEPKIGSHIFEVTKIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            V ELLRGVRLHFE+FI++LK GDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VHELLRGVRLHFERFIKDLKPGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKDVN+F
Sbjct  181  LDKDVNSF  188



>ref|XP_008464470.1| PREDICTED: nucleolar protein 56-like [Cucumis melo]
Length=552

 Score =   341 bits (874),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 162/187 (87%), Positives = 176/187 (94%), Gaps = 0/187 (0%)
 Frame = +1

Query  100  ALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDALN  279
            + YLLYESASGY LFHAHGLDEIGQNTEAVR+SV DLNRFGKVVKL AF+PFESALDAL 
Sbjct  3    STYLLYESASGYALFHAHGLDEIGQNTEAVRSSVSDLNRFGKVVKLAAFHPFESALDALK  62

Query  280  QCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEFV  459
            QCN+VSEG MTDELR+FLE+ LPK K+ KKAKF LGLAEPK+GS+IFEETKIPCQSNEFV
Sbjct  63   QCNSVSEGLMTDELRSFLEINLPKAKEGKKAKFVLGLAEPKIGSNIFEETKIPCQSNEFV  122

Query  460  LELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDTL  639
            LELLRGVRLHF+KFI++LK GDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDTL
Sbjct  123  LELLRGVRLHFDKFIKDLKQGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDTL  182

Query  640  DKDVNTF  660
            DKD+N+F
Sbjct  183  DKDINSF  189



>ref|XP_004165830.1| PREDICTED: LOW QUALITY PROTEIN: nucleolar protein 56-like [Cucumis 
sativus]
Length=552

 Score =   341 bits (874),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 162/187 (87%), Positives = 176/187 (94%), Gaps = 0/187 (0%)
 Frame = +1

Query  100  ALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDALN  279
            + YLLYESASGY LFHAHGLDEIGQNTEAVR+SV DLNRFGKVVKL AF+PFESALDAL 
Sbjct  3    STYLLYESASGYALFHAHGLDEIGQNTEAVRSSVSDLNRFGKVVKLAAFHPFESALDALK  62

Query  280  QCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEFV  459
            QCN+VSEG MTDELR+FLE+ LPK K+ KKAKF LGLAEPK+GS+IFEETKIPCQSNEFV
Sbjct  63   QCNSVSEGLMTDELRSFLEINLPKAKEGKKAKFVLGLAEPKIGSNIFEETKIPCQSNEFV  122

Query  460  LELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDTL  639
            LELLRGVRLHF+KFI++LK GDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDTL
Sbjct  123  LELLRGVRLHFDKFIKDLKQGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDTL  182

Query  640  DKDVNTF  660
            DKD+N+F
Sbjct  183  DKDINSF  189



>ref|XP_004138057.1| PREDICTED: nucleolar protein 56-like [Cucumis sativus]
 gb|KGN63494.1| hypothetical protein Csa_1G002140 [Cucumis sativus]
Length=552

 Score =   341 bits (874),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 162/187 (87%), Positives = 176/187 (94%), Gaps = 0/187 (0%)
 Frame = +1

Query  100  ALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDALN  279
            + YLLYESASGY LFHAHGLDEIGQNTEAVR+SV DLNRFGKVVKL AF+PFESALDAL 
Sbjct  3    STYLLYESASGYALFHAHGLDEIGQNTEAVRSSVSDLNRFGKVVKLAAFHPFESALDALK  62

Query  280  QCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEFV  459
            QCN+VSEG MTDELR+FLE+ LPK K+ KKAKF LGLAEPK+GS+IFEETKIPCQSNEFV
Sbjct  63   QCNSVSEGLMTDELRSFLEINLPKAKEGKKAKFVLGLAEPKIGSNIFEETKIPCQSNEFV  122

Query  460  LELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDTL  639
            LELLRGVRLHF+KFI++LK GDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDTL
Sbjct  123  LELLRGVRLHFDKFIKDLKQGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDTL  182

Query  640  DKDVNTF  660
            DKD+N+F
Sbjct  183  DKDINSF  189



>ref|XP_010250780.1| PREDICTED: nucleolar protein 56-like [Nelumbo nucifera]
Length=554

 Score =   340 bits (872),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 162/188 (86%), Positives = 177/188 (94%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MALY+LYES+SGY LF AHG+DEIGQNTEAVRNSV DLNRFGKVVKLVAF+PFESALDAL
Sbjct  1    MALYILYESSSGYALFLAHGIDEIGQNTEAVRNSVLDLNRFGKVVKLVAFHPFESALDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQCNA+SEG MTDELRNFLEL LPK+K+ KKAKF LG+AEPK+GSHI E TKIPCQSNEF
Sbjct  61   NQCNAISEGLMTDELRNFLELNLPKIKEGKKAKFKLGVAEPKIGSHISEITKIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            VLELLR VRLHF++FI++LK GDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VLELLRSVRLHFDRFIKDLKPGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKD+N+F
Sbjct  181  LDKDINSF  188



>ref|XP_010921864.1| PREDICTED: nucleolar protein 56-like [Elaeis guineensis]
Length=559

 Score =   339 bits (870),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 163/188 (87%), Positives = 175/188 (93%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MALYLL+ESASGY LFHA+GLDEIGQNTEAVRNSV DL RFGKVVKLVAF PF SALDAL
Sbjct  1    MALYLLFESASGYSLFHAYGLDEIGQNTEAVRNSVLDLTRFGKVVKLVAFQPFSSALDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQCNA+SEG MTDELRNFLE+ LPK K+ KKAKFSLG+AEPK+GS IFE TKIPCQSNEF
Sbjct  61   NQCNAISEGLMTDELRNFLEINLPKPKEGKKAKFSLGVAEPKVGSQIFEVTKIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            VLELLRGVRLHF++FI++LK  DLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VLELLRGVRLHFDRFIKDLKPSDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKD+NTF
Sbjct  181  LDKDINTF  188



>ref|XP_009386842.1| PREDICTED: nucleolar protein 56-like [Musa acuminata subsp. malaccensis]
Length=558

 Score =   339 bits (870),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 163/188 (87%), Positives = 177/188 (94%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MAL+LL+ESASGY LFHA+GLDEIGQNTEAVRNSV DL RFGKVVKLVAF+PF SALDAL
Sbjct  1    MALFLLFESASGYSLFHAYGLDEIGQNTEAVRNSVLDLTRFGKVVKLVAFHPFSSALDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQCNAVSEG MTDELRNFLE+ LPKVK+ KKAKFSLG+AEPK+GS IFE TKIPCQSNEF
Sbjct  61   NQCNAVSEGLMTDELRNFLEMNLPKVKEGKKAKFSLGVAEPKVGSQIFEVTKIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            VLELLRGVRLHF++FI++LK  DLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VLELLRGVRLHFDRFIKDLKPSDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKD+N+F
Sbjct  181  LDKDINSF  188



>ref|XP_002511213.1| nucleolar protein nop56, putative [Ricinus communis]
 gb|EEF51815.1| nucleolar protein nop56, putative [Ricinus communis]
Length=558

 Score =   339 bits (869),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 163/188 (87%), Positives = 178/188 (95%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MALYLLYESASGY LF A+GLDEIGQNTEAVRNSV DLNRFGKVV+L AF PFES+LDAL
Sbjct  1    MALYLLYESASGYSLFLANGLDEIGQNTEAVRNSVADLNRFGKVVQLTAFLPFESSLDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQCN++SEG MTDELR+FLEL LPKVK+ KKAKFSLG++EPKLGSHIFE TKIPCQSNEF
Sbjct  61   NQCNSLSEGLMTDELRSFLELNLPKVKEGKKAKFSLGVSEPKLGSHIFEVTKIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            VLEL+RGVRLHFE+FI++LK GDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VLELIRGVRLHFERFIKDLKPGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKD+N+F
Sbjct  181  LDKDINSF  188



>ref|XP_011044181.1| PREDICTED: nucleolar protein 56-like isoform X1 [Populus euphratica]
Length=547

 Score =   338 bits (868),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 163/188 (87%), Positives = 178/188 (95%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MAL+LLYE++SGY LF A+GLDEIGQNTEAVRNSV DLNRFGKVV+L AF+PFESALDAL
Sbjct  1    MALFLLYETSSGYSLFLANGLDEIGQNTEAVRNSVSDLNRFGKVVQLTAFHPFESALDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQCN+VSEG MTD+LRNFLEL LPKVK+ KKAKFSLG+AEPK+GSHIFE TKIPCQSNEF
Sbjct  61   NQCNSVSEGIMTDDLRNFLELNLPKVKEGKKAKFSLGVAEPKIGSHIFEVTKIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            V ELLRGVRLHFE+FI++LK GDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VNELLRGVRLHFERFIKDLKPGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKDVN+F
Sbjct  181  LDKDVNSF  188



>ref|XP_009399980.1| PREDICTED: nucleolar protein 56-like [Musa acuminata subsp. malaccensis]
Length=556

 Score =   338 bits (868),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 163/188 (87%), Positives = 177/188 (94%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MALYLL+ESASGY LFHA+GLDEIGQNTEAVRNSV DL RFGKVVKLVAF+PF SALDAL
Sbjct  1    MALYLLFESASGYSLFHAYGLDEIGQNTEAVRNSVLDLTRFGKVVKLVAFHPFSSALDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQCNAVSEG MT+ELRNFLE+ LPKVK+ KKAKFSLG+AEPK+GS IFE TKIPCQSNEF
Sbjct  61   NQCNAVSEGLMTEELRNFLEMNLPKVKEGKKAKFSLGVAEPKVGSQIFEVTKIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            VLELLRGVRLHF++FI++LK  DLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VLELLRGVRLHFDRFIKDLKPSDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKD+N+F
Sbjct  181  LDKDINSF  188



>gb|KJB40016.1| hypothetical protein B456_007G042300 [Gossypium raimondii]
Length=534

 Score =   337 bits (864),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 160/188 (85%), Positives = 175/188 (93%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MALYLL+ES+SGY LFHA GLDEIGQNTEAVRNSV DLNRFGKVV+L AF PFESA+D L
Sbjct  1    MALYLLFESSSGYALFHAQGLDEIGQNTEAVRNSVADLNRFGKVVQLTAFQPFESAIDGL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQCN+VSEG MTDELR+FLEL LPKVK+ KK+KFSLG+AEPKLGSHI E TKIPCQS EF
Sbjct  61   NQCNSVSEGLMTDELRSFLELNLPKVKEGKKSKFSLGVAEPKLGSHISETTKIPCQSGEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            VLELLRGVRLHF+KFI++LK+GDLEKAQLGL HSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VLELLRGVRLHFDKFIKDLKSGDLEKAQLGLAHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKD+N+F
Sbjct  181  LDKDINSF  188



>gb|KHG15507.1| Nucleolar 56 [Gossypium arboreum]
Length=534

 Score =   337 bits (863),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 160/188 (85%), Positives = 175/188 (93%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MALYLL+ES+SGY LFHA GLDEIGQNTEAVRNSV DLNRFGKVV+L AF PFESA+D L
Sbjct  1    MALYLLFESSSGYALFHARGLDEIGQNTEAVRNSVADLNRFGKVVQLTAFQPFESAIDGL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQCN+VSEG MTDELR+FLEL LPKVK+ KK+KFSLG+AEPKLGSHI E TKIPCQS EF
Sbjct  61   NQCNSVSEGLMTDELRSFLELNLPKVKEGKKSKFSLGVAEPKLGSHISETTKIPCQSGEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            VLELLRGVRLHF+KFI++LK+GDLEKAQLGL HSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VLELLRGVRLHFDKFIKDLKSGDLEKAQLGLAHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKD+N+F
Sbjct  181  LDKDINSF  188



>ref|XP_002322238.2| nucleolar family protein [Populus trichocarpa]
 gb|EEF06365.2| nucleolar family protein [Populus trichocarpa]
Length=499

 Score =   335 bits (860),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 161/188 (86%), Positives = 177/188 (94%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MALYLLYE++SGY LF A+G+DEIGQNTEAVRNSV DLNRFGKVV+L AF+PFESALDAL
Sbjct  1    MALYLLYETSSGYSLFQANGIDEIGQNTEAVRNSVSDLNRFGKVVQLTAFHPFESALDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQ N+VSEG MTDELRNFLEL LPKVK+ KKAKFSLG+AEPK+GSHIFE TK+PCQSN+F
Sbjct  61   NQINSVSEGIMTDELRNFLELNLPKVKEGKKAKFSLGVAEPKIGSHIFEVTKLPCQSNDF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            V ELLRGVRLHFE+FI++LK GDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VHELLRGVRLHFERFIKDLKPGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKDVN+F
Sbjct  181  LDKDVNSF  188



>ref|XP_011024058.1| PREDICTED: nucleolar protein 56-like [Populus euphratica]
Length=553

 Score =   337 bits (864),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 162/188 (86%), Positives = 176/188 (94%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MALYLLYE++SGY LF A G+DEIGQNTEAVRNSV DLNRFGKVV+L AF+PFESALDAL
Sbjct  1    MALYLLYETSSGYSLFQASGIDEIGQNTEAVRNSVSDLNRFGKVVQLTAFHPFESALDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQ N+VSEG MTDELRNFLEL LPKVK+ KKAKFSLG+AEPK+GSHIFE TKIPCQSN+F
Sbjct  61   NQINSVSEGIMTDELRNFLELNLPKVKEGKKAKFSLGVAEPKIGSHIFEVTKIPCQSNDF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            V ELLRGVRLHFE+FI++LK GDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VHELLRGVRLHFERFIKDLKPGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKDVN+F
Sbjct  181  LDKDVNSF  188



>ref|XP_008796174.1| PREDICTED: nucleolar protein 56-like isoform X2 [Phoenix dactylifera]
Length=559

 Score =   337 bits (864),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 162/188 (86%), Positives = 175/188 (93%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MALYLL+ESASGY LFHA+GLDEIGQNTEAVRNSV DL RFGKVVKLVAF+PF SALDAL
Sbjct  1    MALYLLFESASGYSLFHAYGLDEIGQNTEAVRNSVLDLTRFGKVVKLVAFHPFSSALDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQCNA+SEG MTDELRNFLE+ LPK K+ KK KFSLG+AEPK+GS IFE TKIPCQSNEF
Sbjct  61   NQCNAISEGLMTDELRNFLEINLPKPKEGKKVKFSLGVAEPKVGSQIFEVTKIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            VLELLRGVRLHF++FI++LK  DLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VLELLRGVRLHFDRFIKDLKPSDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKD+NTF
Sbjct  181  LDKDINTF  188



>ref|XP_008796173.1| PREDICTED: nucleolar protein 56-like isoform X1 [Phoenix dactylifera]
Length=577

 Score =   337 bits (865),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 162/188 (86%), Positives = 175/188 (93%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MALYLL+ESASGY LFHA+GLDEIGQNTEAVRNSV DL RFGKVVKLVAF+PF SALDAL
Sbjct  1    MALYLLFESASGYSLFHAYGLDEIGQNTEAVRNSVLDLTRFGKVVKLVAFHPFSSALDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQCNA+SEG MTDELRNFLE+ LPK K+ KK KFSLG+AEPK+GS IFE TKIPCQSNEF
Sbjct  61   NQCNAISEGLMTDELRNFLEINLPKPKEGKKVKFSLGVAEPKVGSQIFEVTKIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            VLELLRGVRLHF++FI++LK  DLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VLELLRGVRLHFDRFIKDLKPSDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKD+NTF
Sbjct  181  LDKDINTF  188



>ref|XP_006374558.1| hypothetical protein POPTR_0015s10500g [Populus trichocarpa]
 gb|ERP52355.1| hypothetical protein POPTR_0015s10500g [Populus trichocarpa]
Length=553

 Score =   336 bits (862),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 161/188 (86%), Positives = 177/188 (94%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MALYLLYE++SGY LF A+G+DEIGQNTEAVRNSV DLNRFGKVV+L AF+PFESALDAL
Sbjct  1    MALYLLYETSSGYSLFQANGIDEIGQNTEAVRNSVSDLNRFGKVVQLTAFHPFESALDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQ N+VSEG MTDELRNFLEL LPKVK+ KKAKFSLG+AEPK+GSHIFE TK+PCQSN+F
Sbjct  61   NQINSVSEGIMTDELRNFLELNLPKVKEGKKAKFSLGVAEPKIGSHIFEVTKLPCQSNDF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            V ELLRGVRLHFE+FI++LK GDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VHELLRGVRLHFERFIKDLKPGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKDVN+F
Sbjct  181  LDKDVNSF  188



>ref|XP_007037933.1| Nucleolar protein NOP56 [Theobroma cacao]
 gb|EOY22434.1| Nucleolar protein NOP56 [Theobroma cacao]
Length=545

 Score =   334 bits (856),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 161/188 (86%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MALYLLYESASGY L  A GLDEIGQNTEAVRNSV DLNRFGKVV+L AF+PFESALDAL
Sbjct  1    MALYLLYESASGYALLQAQGLDEIGQNTEAVRNSVADLNRFGKVVQLTAFHPFESALDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQCN+VSEG MTDELR+FLEL LPKVK+ KK+KFS+G+AEPKLGSHI E TKI CQS EF
Sbjct  61   NQCNSVSEGLMTDELRSFLELNLPKVKEGKKSKFSVGVAEPKLGSHISETTKITCQSGEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            VLELLRGVRLHF+KFI +LK GDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VLELLRGVRLHFDKFIRDLKPGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKD+N+F
Sbjct  181  LDKDINSF  188



>ref|XP_010534767.1| PREDICTED: nucleolar protein 56 [Tarenaya hassleriana]
Length=500

 Score =   332 bits (852),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 159/188 (85%), Positives = 175/188 (93%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            M+LYLLYE++SGY LF AHGLDEIGQNTEAVR+SV DLNRFG+VVKL AF+PFESALDAL
Sbjct  1    MSLYLLYEASSGYALFEAHGLDEIGQNTEAVRSSVSDLNRFGRVVKLTAFHPFESALDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQ NAVSEG MTDELR+FLEL LPKVK+ KK+KFSLGLAEPKLGSH+ E TKIPCQSNEF
Sbjct  61   NQINAVSEGLMTDELRSFLELNLPKVKEGKKSKFSLGLAEPKLGSHVCEATKIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            VLELLRGVR HF++FI++LK GDLEKAQLGL HSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VLELLRGVRQHFDRFIKDLKPGDLEKAQLGLAHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKD+N+F
Sbjct  181  LDKDINSF  188



>emb|CDY10510.1| BnaC03g71040D [Brassica napus]
Length=513

 Score =   333 bits (853),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 158/188 (84%), Positives = 175/188 (93%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MA+YLLYES+SGYGLF AHGLDEIGQNTEAVR+SV DL+RFG+VV+L AF+PFESALDAL
Sbjct  1    MAMYLLYESSSGYGLFEAHGLDEIGQNTEAVRSSVSDLSRFGRVVQLTAFHPFESALDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQ NAVSEG MTDELR+FLEL LPKVK+ KK KFSLG +EPKLGSHI E TKIPCQSNEF
Sbjct  61   NQVNAVSEGVMTDELRSFLELNLPKVKEGKKPKFSLGTSEPKLGSHILEATKIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            VLELLRGVRLHF++FI++LK GDLEK+QLGL HSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VLELLRGVRLHFDRFIKDLKPGDLEKSQLGLAHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKD+N+F
Sbjct  181  LDKDINSF  188



>ref|XP_008811770.1| PREDICTED: nucleolar protein 56-like [Phoenix dactylifera]
Length=559

 Score =   334 bits (857),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 162/188 (86%), Positives = 174/188 (93%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MALYLL+ESASGY LF A+GLDEIGQNTEAVRNSV DL RFGKVVKLVAF+PF SALDAL
Sbjct  1    MALYLLFESASGYSLFQAYGLDEIGQNTEAVRNSVLDLTRFGKVVKLVAFHPFSSALDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQCNA+SEG MTDELRNFLE+ LPK K+ KKAK SLG+AEPK+GS IFE TKIPCQSNEF
Sbjct  61   NQCNAISEGLMTDELRNFLEINLPKPKEGKKAKLSLGVAEPKVGSQIFEVTKIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            VLELLRGVRLHF++FI++LK  DLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VLELLRGVRLHFDRFIKDLKPSDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKDVNTF
Sbjct  181  LDKDVNTF  188



>ref|XP_009106803.1| PREDICTED: nucleolar protein 56-like [Brassica rapa]
Length=519

 Score =   333 bits (853),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 158/188 (84%), Positives = 175/188 (93%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MA+YLLYES+SGYGLF AHGLDEIGQNTEAVR+SV DL+RFG+VV+L AF+PFESALDAL
Sbjct  1    MAMYLLYESSSGYGLFEAHGLDEIGQNTEAVRSSVSDLSRFGRVVQLTAFHPFESALDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQ NAVSEG MTDELR+FLEL LPKVK+ KK KFSLG +EPKLGSHI E TKIPCQSNEF
Sbjct  61   NQVNAVSEGVMTDELRSFLELNLPKVKEGKKPKFSLGTSEPKLGSHILEATKIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            VLELLRGVRLHF++FI++LK GDLEK+QLGL HSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VLELLRGVRLHFDRFIKDLKPGDLEKSQLGLAHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKD+N+F
Sbjct  181  LDKDINSF  188



>emb|CDY42406.1| BnaA08g00080D [Brassica napus]
Length=519

 Score =   333 bits (853),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 158/188 (84%), Positives = 175/188 (93%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MA+YLLYES+SGYGLF AHGLDEIGQNTEAVR+SV DL+RFG+VV+L AF+PFESALDAL
Sbjct  1    MAMYLLYESSSGYGLFEAHGLDEIGQNTEAVRSSVSDLSRFGRVVQLTAFHPFESALDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQ NAVSEG MTDELR+FLEL LPKVK+ KK KFSLG +EPKLGSHI E TKIPCQSNEF
Sbjct  61   NQVNAVSEGVMTDELRSFLELNLPKVKEGKKPKFSLGTSEPKLGSHILEATKIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            VLELLRGVRLHF++FI++LK GDLEK+QLGL HSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VLELLRGVRLHFDRFIKDLKPGDLEKSQLGLAHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKD+N+F
Sbjct  181  LDKDINSF  188



>emb|CDP15007.1| unnamed protein product [Coffea canephora]
Length=560

 Score =   334 bits (856),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 159/188 (85%), Positives = 175/188 (93%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MALYLLYESASGY LF A GLDEIGQNT+AVR+SV D NRFGKVV+L AF+PFESAL+AL
Sbjct  1    MALYLLYESASGYSLFLAGGLDEIGQNTDAVRSSVTDFNRFGKVVQLAAFSPFESALEAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
             QCN++SEGQM DELRNFLE+ LPKVK+ KKAKF LG++EPKLGSHI EETKIPCQSNEF
Sbjct  61   KQCNSISEGQMADELRNFLEINLPKVKEGKKAKFILGVSEPKLGSHIHEETKIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            VLELLRGVRLHF+K+I+NLK GDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VLELLRGVRLHFDKYIKNLKTGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKD+N+F
Sbjct  181  LDKDINSF  188



>ref|XP_009124126.1| PREDICTED: nucleolar protein 56-like [Brassica rapa]
 emb|CDY63487.1| BnaAnng18930D [Brassica napus]
Length=521

 Score =   332 bits (852),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 158/188 (84%), Positives = 175/188 (93%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MA+YLLYES+SGYGLF AHGLDEIGQNTEAVR+SV DL+RFG+VV+L AF+PFESALDAL
Sbjct  1    MAMYLLYESSSGYGLFEAHGLDEIGQNTEAVRSSVSDLSRFGRVVQLTAFHPFESALDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQ NAVSEG MTDELR+FLEL LPKVK+ KK KFSLG +EPKLGSHI E TKIPCQSNEF
Sbjct  61   NQVNAVSEGVMTDELRSFLELNLPKVKEGKKPKFSLGTSEPKLGSHILEATKIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            VLELLRGVRLHF++FI++LK GDLEK+QLGL HSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VLELLRGVRLHFDRFIKDLKPGDLEKSQLGLAHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKD+N+F
Sbjct  181  LDKDINSF  188



>ref|XP_006392564.1| hypothetical protein EUTSA_v10011387mg [Eutrema salsugineum]
 gb|ESQ29850.1| hypothetical protein EUTSA_v10011387mg [Eutrema salsugineum]
Length=526

 Score =   332 bits (851),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 158/188 (84%), Positives = 176/188 (94%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MA +LLYES+SG+GLF AHGLDEIGQNTEAVR+S+ DL+RFG+VV+L AF+PFESALDAL
Sbjct  1    MATFLLYESSSGFGLFEAHGLDEIGQNTEAVRSSISDLSRFGRVVQLTAFHPFESALDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQ NAVSEG MTDELR+FLEL LPKVK+ KKAKFSLGLAEPKLGSHIFE TKIPCQSNEF
Sbjct  61   NQVNAVSEGVMTDELRSFLELNLPKVKEGKKAKFSLGLAEPKLGSHIFEATKIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            VLELLRGVR HF++FI++LK GDLEK+QLGL HSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VLELLRGVRQHFDRFIKDLKPGDLEKSQLGLAHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKD+N+F
Sbjct  181  LDKDINSF  188



>emb|CDY59117.1| BnaCnng34340D [Brassica napus]
Length=515

 Score =   332 bits (850),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 157/188 (84%), Positives = 175/188 (93%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MA+YLLYES+SGYGLF AHGLDEIGQNTEAVR+SV DL+RFG+VV+L AF+PFESALDAL
Sbjct  1    MAMYLLYESSSGYGLFEAHGLDEIGQNTEAVRSSVSDLSRFGRVVQLTAFHPFESALDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQ NAVSEG MTDELR+FLEL LPKV++ KK KFSLG +EPKLGSHI E TKIPCQSNEF
Sbjct  61   NQVNAVSEGVMTDELRSFLELNLPKVREGKKPKFSLGTSEPKLGSHILEATKIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            VLELLRGVRLHF++FI++LK GDLEK+QLGL HSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VLELLRGVRLHFDRFIKDLKPGDLEKSQLGLAHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKD+N+F
Sbjct  181  LDKDINSF  188



>ref|NP_176007.1| nucleolar protein NOP56-like protein [Arabidopsis thaliana]
 gb|AAF02835.1|AC009894_6 nucleolar protein [Arabidopsis thaliana]
 gb|AAG40838.1|AF302492_1 NOP56-like protein [Arabidopsis thaliana]
 gb|AAK62596.1| At1g56110/T6H22_9 [Arabidopsis thaliana]
 gb|AAM26718.1| At1g56110/T6H22_9 [Arabidopsis thaliana]
 gb|AAM64641.1| SAR DNA binding protein, putative [Arabidopsis thaliana]
 gb|AEE33345.1| nucleolar protein NOP56-like protein [Arabidopsis thaliana]
Length=522

 Score =   331 bits (849),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 156/188 (83%), Positives = 174/188 (93%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MA+Y++YES+SGYGLF  HGLDEIGQNTEAVR SV DL+RFG+VV+L AF+PFESALDAL
Sbjct  1    MAMYVIYESSSGYGLFEVHGLDEIGQNTEAVRTSVSDLSRFGRVVQLTAFHPFESALDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQ NAVSEG MTDELR+FLEL LPKVK+ KK KFSLGLAEPKLGSHIFE TKIPCQSNEF
Sbjct  61   NQVNAVSEGVMTDELRSFLELNLPKVKEGKKPKFSLGLAEPKLGSHIFEATKIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            VLELLRGVR HF++FI++LK GDLEK+QLGL HSYSRAKVKFNVNRVDNMVIQAIF+LDT
Sbjct  121  VLELLRGVRQHFDRFIKDLKPGDLEKSQLGLAHSYSRAKVKFNVNRVDNMVIQAIFMLDT  180

Query  637  LDKDVNTF  660
            LDKD+N+F
Sbjct  181  LDKDINSF  188



>ref|XP_004297546.1| PREDICTED: nucleolar protein 56-like [Fragaria vesca subsp. vesca]
Length=545

 Score =   332 bits (850),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 159/188 (85%), Positives = 174/188 (93%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MA+YLLYE+ASGY LF AHGLD+IGQNTEAVR+SV DLNRFGKVV+L AF+PFE ALDAL
Sbjct  1    MAVYLLYEAASGYSLFLAHGLDQIGQNTEAVRSSVTDLNRFGKVVQLAAFHPFEQALDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQCN+VSEG MTDELRNFLEL LPKVK+ KK KFSLG+ EPKLGSHIFE TKIPCQSNEF
Sbjct  61   NQCNSVSEGIMTDELRNFLELNLPKVKEGKKPKFSLGVYEPKLGSHIFEVTKIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            V ELLRGVRLHF++FI++LK GDLEKAQLGL HSYSR+KVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VHELLRGVRLHFDRFIKDLKPGDLEKAQLGLSHSYSRSKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKDVN+F
Sbjct  181  LDKDVNSF  188



>ref|XP_009359460.1| PREDICTED: nucleolar protein 56-like [Pyrus x bretschneideri]
Length=549

 Score =   331 bits (849),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 155/188 (82%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MALYLLYESASGY LF AHG+D+IGQNTEAVR+S+ D+NRFGKVV+L AF+PFESALDAL
Sbjct  1    MALYLLYESASGYSLFLAHGIDQIGQNTEAVRSSISDINRFGKVVQLTAFDPFESALDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQCN+VSEG MTDELR FLE  LP VK+ KK KFSLG++EPK+GSHIFEETKIPCQSNEF
Sbjct  61   NQCNSVSEGVMTDELRKFLEKNLPTVKEGKKPKFSLGVSEPKIGSHIFEETKIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            VLEL+RGVRLHF   +++LK GDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VLELIRGVRLHFTTLLKSLKPGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKD+N+F
Sbjct  181  LDKDINSF  188



>ref|XP_008392835.1| PREDICTED: nucleolar protein 56-like [Malus domestica]
Length=546

 Score =   331 bits (849),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 155/188 (82%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MALYLLYESASGY LF AHG+D+IGQNTEAVR+S+ D+NRFGKVV+L AF+PFESALDAL
Sbjct  1    MALYLLYESASGYSLFLAHGIDQIGQNTEAVRSSISDINRFGKVVQLAAFDPFESALDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQCN+VSEG MTDELR FLE  LP VK+ KK KFSLG++EPK+GSHIFEETKIPCQSNEF
Sbjct  61   NQCNSVSEGVMTDELRKFLEKNLPTVKEGKKPKFSLGVSEPKIGSHIFEETKIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            VLEL+RGVRLHF   +++LK GDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VLELIRGVRLHFTTLLKSLKPGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKD+N+F
Sbjct  181  LDKDINSF  188



>dbj|BAH20197.1| AT1G56110 [Arabidopsis thaliana]
Length=432

 Score =   327 bits (839),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 155/188 (82%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MA+Y++YES+SGYGLF  HGLDEIGQNTEAVR SV DL+RFG+VV+L AF+PFESALDAL
Sbjct  1    MAMYVIYESSSGYGLFEVHGLDEIGQNTEAVRTSVSDLSRFGRVVQLTAFHPFESALDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQ NAVSEG MTDELR+FLEL LPKVK+ KK KFSLGLAEPKLGSHIFE TKIPCQSNEF
Sbjct  61   NQVNAVSEGVMTDELRSFLELNLPKVKEGKKPKFSLGLAEPKLGSHIFEATKIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            VLELLR VR HF++FI++LK GDLEK+QLGL HSYSRAKVKFNVNRVDNMVIQAIF+LDT
Sbjct  121  VLELLRVVRQHFDRFIKDLKPGDLEKSQLGLAHSYSRAKVKFNVNRVDNMVIQAIFMLDT  180

Query  637  LDKDVNTF  660
            LDKD+N+F
Sbjct  181  LDKDINSF  188



>ref|XP_008374262.1| PREDICTED: nucleolar protein 56-like [Malus domestica]
Length=548

 Score =   330 bits (847),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 155/188 (82%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MALYLLYESASGY LF AHG+D+IGQNTEAVR S+ D+NRFGKVV+L AF+PFESALDAL
Sbjct  1    MALYLLYESASGYSLFLAHGIDQIGQNTEAVRGSISDINRFGKVVQLAAFDPFESALDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQCN+VSEG MTDELR FLE  LP+VK+ KK KFSLG++EPK+GSHIFEETKIPCQSNEF
Sbjct  61   NQCNSVSEGVMTDELRKFLEKNLPQVKEGKKPKFSLGVSEPKIGSHIFEETKIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            VLEL+RGVRLHF   +++LK GDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VLELIRGVRLHFVTLLKSLKPGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKD+N+F
Sbjct  181  LDKDINSF  188



>ref|XP_009336572.1| PREDICTED: nucleolar protein 56-like [Pyrus x bretschneideri]
Length=547

 Score =   330 bits (845),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 155/188 (82%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MALYLLYESASGY LF AHG+D+IGQNTEAVR S+ D+NRFGKVV+L AF+PFESALDAL
Sbjct  1    MALYLLYESASGYSLFLAHGIDQIGQNTEAVRGSISDINRFGKVVQLAAFDPFESALDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQCN+VSEG MTDELR FLE  LP+VK+ KK KFSLG++EPK+GSHIFEETKIPCQSNEF
Sbjct  61   NQCNSVSEGVMTDELRKFLEKNLPQVKEGKKPKFSLGVSEPKIGSHIFEETKIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            VLEL+RGVRLHF   +++LK GDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VLELIRGVRLHFVTLLKSLKPGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKD+N+F
Sbjct  181  LDKDINSF  188



>ref|XP_009346504.1| PREDICTED: nucleolar protein 56-like [Pyrus x bretschneideri]
Length=547

 Score =   330 bits (845),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 155/188 (82%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MALYLLYESASGY LF AHG+D+IGQNTEAVR S+ D+NRFGKVV+L AF+PFESALDAL
Sbjct  1    MALYLLYESASGYSLFLAHGIDQIGQNTEAVRGSISDINRFGKVVQLAAFDPFESALDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQCN+VSEG MTDELR FLE  LP+VK+ KK KFSLG++EPK+GSHIFEETKIPCQSNEF
Sbjct  61   NQCNSVSEGVMTDELRKFLEKNLPQVKEGKKPKFSLGVSEPKIGSHIFEETKIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            VLEL+RGVRLHF   +++LK GDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VLELIRGVRLHFVTLLKSLKPGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKD+N+F
Sbjct  181  LDKDINSF  188



>gb|KJB08032.1| hypothetical protein B456_001G060200 [Gossypium raimondii]
Length=533

 Score =   328 bits (841),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 157/188 (84%), Positives = 171/188 (91%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MALY LYES+SGY LF A GLDEIGQNTEAVRNSV DLNRFGKVV+L AF PFESA+D L
Sbjct  1    MALYFLYESSSGYALFQAQGLDEIGQNTEAVRNSVADLNRFGKVVQLTAFQPFESAIDGL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQCN+VSEG MT+ELR+FLEL LPKVK+ KK+KFSLG+AEPKLGSHI E TKI CQS EF
Sbjct  61   NQCNSVSEGLMTNELRSFLELNLPKVKEGKKSKFSLGVAEPKLGSHISETTKITCQSGEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            VLELLRGVRLHF+KFI++LK GDLEKAQLGL HSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VLELLRGVRLHFDKFIKDLKPGDLEKAQLGLAHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKD+N+F
Sbjct  181  LDKDINSF  188



>ref|XP_006307187.1| hypothetical protein CARUB_v10008778mg, partial [Capsella rubella]
 gb|EOA40085.1| hypothetical protein CARUB_v10008778mg, partial [Capsella rubella]
Length=544

 Score =   328 bits (840),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 157/191 (82%), Positives = 173/191 (91%), Gaps = 0/191 (0%)
 Frame = +1

Query  88   PVGMALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESAL  267
            P  MA+Y+ YES+SGY LF  HGLDEIGQNTEAVR SV DL+RFG+VV+L AF+PFESAL
Sbjct  20   PPKMAMYVNYESSSGYALFEVHGLDEIGQNTEAVRTSVSDLSRFGRVVQLTAFHPFESAL  79

Query  268  DALNQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQS  447
            DALNQ NAVSEG MTDELR+FLEL LPKVK+ KK KFSLGLAEPKLGSHIFE TKIPCQS
Sbjct  80   DALNQINAVSEGVMTDELRSFLELNLPKVKEGKKPKFSLGLAEPKLGSHIFEATKIPCQS  139

Query  448  NEFVLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFL  627
            NEFVLELLRGVR HF++FI++LK GDLEK+QLGL HSYSRAKVKFNVNRVDNMVIQAIFL
Sbjct  140  NEFVLELLRGVRQHFDRFIKDLKPGDLEKSQLGLAHSYSRAKVKFNVNRVDNMVIQAIFL  199

Query  628  LDTLDKDVNTF  660
            LDTLDKD+N+F
Sbjct  200  LDTLDKDINSF  210



>ref|XP_010543116.1| PREDICTED: nucleolar protein 56-like [Tarenaya hassleriana]
Length=538

 Score =   328 bits (840),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 158/188 (84%), Positives = 172/188 (91%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            M L LLYES+SGY LF AHGLDEIGQNTEAVR+SV DLNRFG+VVKL AF+PFESALDAL
Sbjct  1    MTLNLLYESSSGYALFEAHGLDEIGQNTEAVRSSVSDLNRFGRVVKLTAFHPFESALDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQ NAVSEG MTDELR+F+EL LPKVK+ KK KFSLG+AEPKLGSHI E TKIPCQSNEF
Sbjct  61   NQINAVSEGLMTDELRSFVELNLPKVKEGKKPKFSLGVAEPKLGSHICEATKIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            VLELLRGVR HF++FI++LK GDLEKAQLGL HSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VLELLRGVRQHFDRFIKDLKPGDLEKAQLGLAHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKD+N+F
Sbjct  181  LDKDINSF  188



>ref|XP_010501245.1| PREDICTED: nucleolar protein 56-like [Camelina sativa]
Length=521

 Score =   327 bits (838),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 155/188 (82%), Positives = 172/188 (91%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MA+Y+ YES+SGY +F  HGLDEIGQNTEAVR SV DL+RFG+VV+L AF+PFESALDAL
Sbjct  1    MAMYVQYESSSGYAIFEVHGLDEIGQNTEAVRTSVSDLSRFGRVVQLTAFHPFESALDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQ NAVSEG MTDELR+FLEL LPKVK+ KK KFSLGLAEPKLGSHIFE TKIPCQSNEF
Sbjct  61   NQINAVSEGVMTDELRSFLELNLPKVKEGKKPKFSLGLAEPKLGSHIFEATKIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            VLELLRGVR HF++FI++LK GDLEK+QLGL HSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VLELLRGVRQHFDRFIKDLKPGDLEKSQLGLAHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKD+N+F
Sbjct  181  LDKDINSF  188



>gb|KHG28458.1| Nucleolar 56 [Gossypium arboreum]
Length=533

 Score =   327 bits (838),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 157/188 (84%), Positives = 170/188 (90%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MALYLLYES+SGY LF A GLDEIGQNTEAVRNSV DLNRFGKVV+L AF PFESA+D L
Sbjct  1    MALYLLYESSSGYALFQAQGLDEIGQNTEAVRNSVADLNRFGKVVQLTAFQPFESAIDGL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQCN+VSEG M DELR+FLEL LPKVK+ KK+KFSLG+AEPKLGSHI E  KI CQS EF
Sbjct  61   NQCNSVSEGLMNDELRSFLELNLPKVKEGKKSKFSLGVAEPKLGSHISETMKITCQSGEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            VLELLRGVRLHF+KFI++LK GDLEKAQLGL HSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VLELLRGVRLHFDKFIKDLKPGDLEKAQLGLAHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKD+N+F
Sbjct  181  LDKDINSF  188



>ref|XP_002894559.1| hypothetical protein ARALYDRAFT_474678 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70818.1| hypothetical protein ARALYDRAFT_474678 [Arabidopsis lyrata subsp. 
lyrata]
Length=522

 Score =   326 bits (835),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 155/188 (82%), Positives = 172/188 (91%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MA+Y+L+ES+SGY L   HGLDEIGQNTEAVR SV DL+RFG+VV+L AF+PFESALDAL
Sbjct  1    MAMYVLHESSSGYALLEVHGLDEIGQNTEAVRTSVSDLSRFGRVVQLTAFHPFESALDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQ NAVSEG MTDELR+FLEL LPKVK+ KK KFSLGLAEPKLGSHIFE TKIPCQSNEF
Sbjct  61   NQVNAVSEGVMTDELRSFLELNLPKVKEGKKPKFSLGLAEPKLGSHIFEATKIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            VLELLRGVR HF++FI++LK GDLEK+QLGL HSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VLELLRGVRQHFDRFIKDLKPGDLEKSQLGLAHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKD+N+F
Sbjct  181  LDKDINSF  188



>ref|XP_010462480.1| PREDICTED: nucleolar protein 56-like [Camelina sativa]
Length=521

 Score =   325 bits (833),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 154/188 (82%), Positives = 171/188 (91%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            M +Y+ YES+SGY +F  HGLDEIGQNTEAVR SV DL+RFG+VV+L AF+PFESALDAL
Sbjct  1    MTMYVQYESSSGYAIFEVHGLDEIGQNTEAVRTSVSDLSRFGRVVQLTAFHPFESALDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQ NAVSEG MTDELR+FLEL LPKVK+ KK KFSLGLAEPKLGSHIFE TKIPCQSNEF
Sbjct  61   NQMNAVSEGVMTDELRSFLELNLPKVKEGKKPKFSLGLAEPKLGSHIFEATKIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            VLELLRGVR HF++FI++LK GDLEK+QLGL HSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VLELLRGVRQHFDRFIKDLKPGDLEKSQLGLAHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKD+N+F
Sbjct  181  LDKDINSF  188



>ref|XP_010248928.1| PREDICTED: nucleolar protein 56-like [Nelumbo nucifera]
Length=564

 Score =   326 bits (836),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 155/188 (82%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MALY L+ES+SGY LF AHG+DEIGQNTEAVR+SV DLNRFGKVVKL AF PFESALDAL
Sbjct  1    MALYALFESSSGYALFLAHGIDEIGQNTEAVRSSVVDLNRFGKVVKLAAFYPFESALDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQCNAVSEG MT+ELRNFLEL LPK+K+ K+ KF LG+AEPK+GSHI E TKIPC SNEF
Sbjct  61   NQCNAVSEGLMTEELRNFLELNLPKIKEGKQVKFKLGVAEPKIGSHISEVTKIPCLSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            VLE+LRGVRLHF++FI++LK GDLEKAQLGLGHSYSRAKVKFNVNRVDNM+IQAIFLLDT
Sbjct  121  VLEILRGVRLHFDRFIKDLKPGDLEKAQLGLGHSYSRAKVKFNVNRVDNMIIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKD+N+F
Sbjct  181  LDKDINSF  188



>ref|XP_010480175.1| PREDICTED: nucleolar protein 56-like [Camelina sativa]
Length=528

 Score =   325 bits (832),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 154/188 (82%), Positives = 171/188 (91%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            M +Y+ YES+SGY +F  HGLDEIGQNTEAVR SV DL+RFG+VV+L AF+PFESALDAL
Sbjct  1    MTMYVQYESSSGYAIFEVHGLDEIGQNTEAVRTSVSDLSRFGRVVQLTAFHPFESALDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQ NAVSEG MTDELR+FLEL LPKVK+ KK KFSLGLAEPKLGSHIFE TKIPCQSNEF
Sbjct  61   NQQNAVSEGVMTDELRSFLELNLPKVKEGKKPKFSLGLAEPKLGSHIFEATKIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            VLELLRGVR HF++FI++LK GDLEK+QLGL HSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VLELLRGVRQHFDRFIKDLKPGDLEKSQLGLAHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKD+N+F
Sbjct  181  LDKDINSF  188



>gb|AFW88375.1| hypothetical protein ZEAMMB73_553591 [Zea mays]
Length=495

 Score =   322 bits (824),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 153/188 (81%), Positives = 170/188 (90%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MALYLL+ESASGYGLFHA+G+DEIGQ+ EAVR+SV DL+RFGK VKL AFNPF SA+DAL
Sbjct  1    MALYLLFESASGYGLFHAYGIDEIGQSVEAVRSSVLDLDRFGKAVKLTAFNPFSSAVDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQCNA+SEG MTDELR+FLEL LPK K+ KKAK+SLG+ EPK+GSHI E T IPCQSNEF
Sbjct  61   NQCNAISEGIMTDELRSFLELNLPKPKEGKKAKYSLGVVEPKVGSHISEVTGIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            V ELLRGVRLHF++FI  LK  DLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VQELLRGVRLHFDRFINELKDSDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKD+N+F
Sbjct  181  LDKDINSF  188



>ref|XP_010480123.1| PREDICTED: nucleolar protein 56-like [Camelina sativa]
 ref|XP_010480124.1| PREDICTED: nucleolar protein 56-like [Camelina sativa]
Length=528

 Score =   322 bits (826),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 152/188 (81%), Positives = 170/188 (90%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MA+YL YES+SGY +F  HGLDEIGQNTEAVR SV DL+RFG+VV+L AF+PFESA DAL
Sbjct  1    MAMYLQYESSSGYAIFEVHGLDEIGQNTEAVRTSVSDLSRFGRVVQLTAFHPFESARDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQ NA++E  MTDELR+FLEL LPKVK+ KK KFSLGLAEPKLGSHIFE TKIPCQSNEF
Sbjct  61   NQTNAITESVMTDELRSFLELNLPKVKEGKKPKFSLGLAEPKLGSHIFEATKIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            VLELLRGVR HF++FI++LK GDLEK+QLGL HSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VLELLRGVRQHFDRFIKDLKPGDLEKSQLGLAHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKD+N+F
Sbjct  181  LDKDINSF  188



>emb|CDY57300.1| BnaC03g73340D [Brassica napus]
Length=505

 Score =   321 bits (823),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 153/188 (81%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            M++YLLYES+SGYGLF AHGLDEIGQNTEAVR+SV DL+RFG+VV+L AF+P ESALDAL
Sbjct  1    MSMYLLYESSSGYGLFEAHGLDEIGQNTEAVRSSVSDLSRFGRVVQLTAFHPSESALDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQ NAVSEG M+DELR+FLEL LPKVK+ KK KFSLG++EPK+GS IFE TKIPCQSNEF
Sbjct  61   NQINAVSEGYMSDELRSFLELNLPKVKEGKKPKFSLGVSEPKIGSCIFEATKIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            V ELLRGVR HF++FI++LK GDLEKAQLGL HSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VHELLRGVRQHFDRFIKDLKPGDLEKAQLGLAHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKD+N+F
Sbjct  181  LDKDINSF  188



>ref|XP_004984360.1| PREDICTED: nucleolar protein 56-like [Setaria italica]
Length=552

 Score =   322 bits (825),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 153/188 (81%), Positives = 171/188 (91%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MALYLL+ESASGYGLFHA+G+DEIGQ+ EAVR+SV DL+RFGK VKL AFNPF SA+DAL
Sbjct  1    MALYLLFESASGYGLFHAYGIDEIGQSVEAVRSSVLDLDRFGKAVKLTAFNPFSSAVDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQCNA+SEG MTDELR+FLEL LPK K+ KKAK+SLG+ EPK+GSHI E T IPCQSNEF
Sbjct  61   NQCNAISEGIMTDELRSFLELNLPKPKEGKKAKYSLGVVEPKVGSHIAEVTGIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            V ELLRGVRLHF++FI+ LK  DLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VQELLRGVRLHFDRFIKELKESDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKD+N+F
Sbjct  181  LDKDINSF  188



>ref|XP_008677944.1| PREDICTED: LOC100283975 isoform X1 [Zea mays]
 gb|ACR36205.1| unknown [Zea mays]
 tpg|DAA45393.1| TPA: nucleolar protein Nop56 [Zea mays]
Length=545

 Score =   322 bits (824),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 153/188 (81%), Positives = 170/188 (90%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MALYLL+ESASGYGLFHA+G+DEIGQ+ EAVR+SV DL+RFGK VKL AFNPF SA+DAL
Sbjct  1    MALYLLFESASGYGLFHAYGIDEIGQSVEAVRSSVLDLDRFGKAVKLTAFNPFSSAVDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQCNA+SEG MTDELR+FLEL LPK K+ KKAK+SLG+ EPK+GSHI E T IPCQSNEF
Sbjct  61   NQCNAISEGIMTDELRSFLELNLPKPKEGKKAKYSLGVVEPKVGSHISEVTGIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            V ELLRGVRLHF++FI  LK  DLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VQELLRGVRLHFDRFINELKDSDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKD+N+F
Sbjct  181  LDKDINSF  188



>ref|XP_007155528.1| hypothetical protein PHAVU_003G209500g [Phaseolus vulgaris]
 gb|ESW27522.1| hypothetical protein PHAVU_003G209500g [Phaseolus vulgaris]
Length=553

 Score =   322 bits (825),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 155/188 (82%), Positives = 169/188 (90%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MAL+LLYESASGY LF AHGLDEIGQNTEAVRNSV DLNRFGKVVKL +FNPF SALDAL
Sbjct  1    MALFLLYESASGYALFEAHGLDEIGQNTEAVRNSVSDLNRFGKVVKLRSFNPFTSALDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
             QCNAVSEG +TDELR  LE  LPKVK+ KKAKFS+G+++PK+GS I E +KIPCQSNEF
Sbjct  61   KQCNAVSEGILTDELRTVLETNLPKVKEGKKAKFSVGVSDPKIGSQISEVSKIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            V ELLRGVRLHF  F+ +LK+GDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VSELLRGVRLHFNTFVGDLKSGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKDVN+F
Sbjct  181  LDKDVNSF  188



>ref|XP_002465270.1| hypothetical protein SORBIDRAFT_01g035290 [Sorghum bicolor]
 gb|EER92268.1| hypothetical protein SORBIDRAFT_01g035290 [Sorghum bicolor]
Length=550

 Score =   321 bits (823),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 153/188 (81%), Positives = 170/188 (90%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MALYLL+ESASGYGLFHA+G+DEIGQ+ EAVR+SV DL+RFGK VKL AFNPF SA+DAL
Sbjct  1    MALYLLFESASGYGLFHAYGIDEIGQSVEAVRSSVLDLDRFGKAVKLTAFNPFSSAVDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQCNA+SEG MTDELR+FLEL LPK K+ KKAK+SLG+ EPK+GSHI E T IPCQSNEF
Sbjct  61   NQCNAISEGIMTDELRSFLELNLPKPKEGKKAKYSLGVVEPKVGSHISEVTGIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            V ELLRGVRLHF++FI  LK  DLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VQELLRGVRLHFDRFINELKDSDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKD+N+F
Sbjct  181  LDKDINSF  188



>ref|XP_008660149.1| PREDICTED: nucleolar protein 56-like isoform X1 [Zea mays]
 gb|AFW88376.1| hypothetical protein ZEAMMB73_553591 [Zea mays]
Length=569

 Score =   322 bits (825),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 153/188 (81%), Positives = 170/188 (90%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MALYLL+ESASGYGLFHA+G+DEIGQ+ EAVR+SV DL+RFGK VKL AFNPF SA+DAL
Sbjct  1    MALYLLFESASGYGLFHAYGIDEIGQSVEAVRSSVLDLDRFGKAVKLTAFNPFSSAVDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQCNA+SEG MTDELR+FLEL LPK K+ KKAK+SLG+ EPK+GSHI E T IPCQSNEF
Sbjct  61   NQCNAISEGIMTDELRSFLELNLPKPKEGKKAKYSLGVVEPKVGSHISEVTGIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            V ELLRGVRLHF++FI  LK  DLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VQELLRGVRLHFDRFINELKDSDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKD+N+F
Sbjct  181  LDKDINSF  188



>ref|XP_008660150.1| PREDICTED: nucleolar protein 56-like isoform X2 [Zea mays]
 gb|AFW88374.1| hypothetical protein ZEAMMB73_553591 [Zea mays]
Length=566

 Score =   322 bits (824),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 153/188 (81%), Positives = 170/188 (90%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MALYLL+ESASGYGLFHA+G+DEIGQ+ EAVR+SV DL+RFGK VKL AFNPF SA+DAL
Sbjct  1    MALYLLFESASGYGLFHAYGIDEIGQSVEAVRSSVLDLDRFGKAVKLTAFNPFSSAVDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQCNA+SEG MTDELR+FLEL LPK K+ KKAK+SLG+ EPK+GSHI E T IPCQSNEF
Sbjct  61   NQCNAISEGIMTDELRSFLELNLPKPKEGKKAKYSLGVVEPKVGSHISEVTGIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            V ELLRGVRLHF++FI  LK  DLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VQELLRGVRLHFDRFINELKDSDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKD+N+F
Sbjct  181  LDKDINSF  188



>ref|XP_002882791.1| hypothetical protein ARALYDRAFT_478647 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59050.1| hypothetical protein ARALYDRAFT_478647 [Arabidopsis lyrata subsp. 
lyrata]
Length=499

 Score =   320 bits (819),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 152/188 (81%), Positives = 172/188 (91%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MA+YLLYES+SGYGLF  HGLDEIGQNTEAVR+SV DL+RFG+VV+L AF+P +SALDAL
Sbjct  1    MAMYLLYESSSGYGLFEVHGLDEIGQNTEAVRSSVSDLSRFGRVVQLTAFHPSQSALDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQ NAVSEG M+DELR+FLEL LPKVK+ KK KFSLG++EPK+GS IFE TKIPCQSNEF
Sbjct  61   NQINAVSEGYMSDELRSFLELNLPKVKEGKKPKFSLGVSEPKIGSCIFEATKIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            V ELLRGVR HF++FI++LK GDLEKAQLGL HSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VHELLRGVRQHFDRFIKDLKPGDLEKAQLGLAHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKD+N+F
Sbjct  181  LDKDINSF  188



>emb|CDX82572.1| BnaA03g32490D [Brassica napus]
Length=505

 Score =   319 bits (818),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 152/188 (81%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            M++YLLYES+SGYGLF AHGLDEIGQNTEAVR+SV DL+RFG+VV+L AF+P +SALDAL
Sbjct  1    MSMYLLYESSSGYGLFEAHGLDEIGQNTEAVRSSVSDLSRFGRVVQLTAFHPSKSALDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQ NAVSEG M+DELR+FLEL LPKVK+ KK KFSLG++EPK+GS IFE TKIPCQSNEF
Sbjct  61   NQINAVSEGYMSDELRSFLELNLPKVKEGKKPKFSLGVSEPKIGSCIFEATKIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            V ELLRGVR HF++FI++LK GDLEKAQLGL HSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VHELLRGVRQHFDRFIKDLKPGDLEKAQLGLAHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKD+N+F
Sbjct  181  LDKDINSF  188



>ref|XP_009135254.1| PREDICTED: nucleolar protein 56-like [Brassica rapa]
Length=505

 Score =   319 bits (818),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 152/188 (81%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            M++YLLYES+SGYGLF AHGLDEIGQNTEAVR+SV DL+RFG+VV+L AF+P +SALDAL
Sbjct  1    MSMYLLYESSSGYGLFEAHGLDEIGQNTEAVRSSVSDLSRFGRVVQLTAFHPSKSALDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQ NAVSEG M+DELR+FLEL LPKVK+ KK KFSLG++EPK+GS IFE TKIPCQSNEF
Sbjct  61   NQINAVSEGYMSDELRSFLELNLPKVKEGKKPKFSLGVSEPKIGSCIFEATKIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            V ELLRGVR HF++FI++LK GDLEKAQLGL HSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VHELLRGVRQHFDRFIKDLKPGDLEKAQLGLAHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKD+N+F
Sbjct  181  LDKDINSF  188



>gb|KHN14092.1| Nucleolar protein 56 [Glycine soja]
Length=549

 Score =   320 bits (820),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 154/188 (82%), Positives = 168/188 (89%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MAL+LLYESASGY LF  HGLDEIGQNTEAVRNSV DLNRFGKVVKL +FNPF SALDAL
Sbjct  1    MALFLLYESASGYTLFEVHGLDEIGQNTEAVRNSVSDLNRFGKVVKLRSFNPFTSALDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
             QCNAVSEG +TDELR  LE  LPKVK+ KK+KFSLG+++PK+GS I E TKIPCQSNEF
Sbjct  61   KQCNAVSEGILTDELRTVLETNLPKVKEGKKSKFSLGVSDPKIGSQISEVTKIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            V ELLRGVR HF+ F+ +LK+GDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VSELLRGVRFHFDTFVGDLKSGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKDVN+F
Sbjct  181  LDKDVNSF  188



>ref|XP_003549846.1| PREDICTED: nucleolar protein 56-like [Glycine max]
Length=549

 Score =   320 bits (819),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 154/188 (82%), Positives = 168/188 (89%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MAL+LLYESASGY LF  HGLDEIGQNTEAVRNSV DLNRFGKVVKL +FNPF SALDAL
Sbjct  1    MALFLLYESASGYTLFEVHGLDEIGQNTEAVRNSVSDLNRFGKVVKLRSFNPFTSALDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
             QCNAVSEG +TDELR  LE  LPKVK+ KK+KFSLG+++PK+GS I E TKIPCQSNEF
Sbjct  61   KQCNAVSEGILTDELRTVLETNLPKVKEGKKSKFSLGVSDPKIGSQISEVTKIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            V ELLRGVR HF+ F+ +LK+GDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VSELLRGVRFHFDTFVGDLKSGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKDVN+F
Sbjct  181  LDKDVNSF  188



>gb|KHN44630.1| Nucleolar protein 56 [Glycine soja]
Length=552

 Score =   319 bits (818),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 152/188 (81%), Positives = 168/188 (89%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MAL+LLYESASGY L  AHGLDEIG  TEAVRNSV DLNRFGKVVKL +FNPF SALDAL
Sbjct  1    MALFLLYESASGYALLEAHGLDEIGHTTEAVRNSVSDLNRFGKVVKLRSFNPFTSALDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
             QCNAVSEG +TDELR  LE  LPKVK+ KK+KFSLG+++PK+GS I E TKIPCQSNEF
Sbjct  61   KQCNAVSEGLLTDELRTVLETNLPKVKEGKKSKFSLGVSDPKIGSQISELTKIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            V ELLRGVRLHF++F+ +LK+GDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VAELLRGVRLHFDRFVSDLKSGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKD+N+F
Sbjct  181  LDKDINSF  188



>gb|KHN34404.1| Nucleolar protein 56 [Glycine soja]
Length=550

 Score =   319 bits (817),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 153/188 (81%), Positives = 168/188 (89%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MAL+LLYESASGY LF  HGLDEIGQNTEAVRNSV DLNRFGKVVKL +FNPF SALDAL
Sbjct  1    MALFLLYESASGYTLFEVHGLDEIGQNTEAVRNSVSDLNRFGKVVKLRSFNPFTSALDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
             QCNAVSEG +TDELR  LE  LPKVK+ KK+KFSLG+++PK+GS I E TKIPCQSNEF
Sbjct  61   KQCNAVSEGILTDELRTVLETNLPKVKEGKKSKFSLGVSDPKIGSQISEVTKIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            V ELLRGVR HF+ F+ +LK+GDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VSELLRGVRFHFDTFVGDLKSGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKD+N+F
Sbjct  181  LDKDINSF  188



>ref|XP_003525694.1| PREDICTED: nucleolar protein 56-like isoform 1 [Glycine max]
Length=550

 Score =   319 bits (817),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 152/188 (81%), Positives = 168/188 (89%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MAL+LLYESASGY LF  HG+DEIGQNTEAVRNSV DLNRFGKVVKL +FNPF SALDAL
Sbjct  1    MALFLLYESASGYSLFEVHGVDEIGQNTEAVRNSVSDLNRFGKVVKLRSFNPFTSALDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
             QCNAVSEG +TDELR  LE  LPKVK+ KK+KFSLG+++PK+GS I E TKIPCQSNEF
Sbjct  61   KQCNAVSEGILTDELRTVLETNLPKVKEGKKSKFSLGVSDPKIGSQISEVTKIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            V ELLRGVR HF+ F+ +LK+GDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VSELLRGVRFHFDTFVGDLKSGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKD+N+F
Sbjct  181  LDKDINSF  188



>gb|EAY90010.1| hypothetical protein OsI_11580 [Oryza sativa Indica Group]
Length=552

 Score =   318 bits (814),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 151/188 (80%), Positives = 168/188 (89%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MALYLL+ESASGYGLFHA+G+DEIGQ+ +AVR SV DL+RFGK VKL AF PF SA+DAL
Sbjct  1    MALYLLFESASGYGLFHAYGIDEIGQSVDAVRASVVDLDRFGKAVKLAAFTPFSSAVDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQCNA+SEG MTDELR+FLEL LPK K+ KKAK+SLG+ EPK+GSHI E T IPCQSNEF
Sbjct  61   NQCNAISEGIMTDELRSFLELNLPKPKEGKKAKYSLGVVEPKVGSHISEVTGIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            V ELLRGVRLHF++FI  LK  DLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VQELLRGVRLHFDRFISELKKSDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKD+N+F
Sbjct  181  LDKDINSF  188



>ref|NP_001050122.1| Os03g0352300 [Oryza sativa Japonica Group]
 gb|ABF95947.1| Nucleolar protein Nop56, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF12036.1| Os03g0352300 [Oryza sativa Japonica Group]
 gb|EAZ26922.1| hypothetical protein OsJ_10851 [Oryza sativa Japonica Group]
Length=552

 Score =   318 bits (814),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 151/188 (80%), Positives = 168/188 (89%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MALYLL+ESASGYGLFHA+G+DEIGQ+ +AVR SV DL+RFGK VKL AF PF SA+DAL
Sbjct  1    MALYLLFESASGYGLFHAYGIDEIGQSVDAVRASVVDLDRFGKAVKLAAFTPFSSAVDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQCNA+SEG MTDELR+FLEL LPK K+ KKAK+SLG+ EPK+GSHI E T IPCQSNEF
Sbjct  61   NQCNAISEGIMTDELRSFLELNLPKPKEGKKAKYSLGVVEPKVGSHISEVTGIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            V ELLRGVRLHF++FI  LK  DLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VQELLRGVRLHFDRFISELKKSDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKD+N+F
Sbjct  181  LDKDINSF  188



>ref|XP_006845152.1| hypothetical protein AMTR_s00005p00226680 [Amborella trichopoda]
 gb|ERN06827.1| hypothetical protein AMTR_s00005p00226680 [Amborella trichopoda]
Length=556

 Score =   318 bits (814),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 151/188 (80%), Positives = 169/188 (90%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MALYLLYESASGY LF AHGLDEIGQ+TE VRNSV DLNRFGKVVKL AF PF SA+DAL
Sbjct  1    MALYLLYESASGYSLFCAHGLDEIGQDTEGVRNSVLDLNRFGKVVKLTAFQPFASAVDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQCNAVSEG++TDELRNFLEL LPKVKD KK KFSLG+++ K+GSHI E T +PC S++F
Sbjct  61   NQCNAVSEGELTDELRNFLELNLPKVKDGKKPKFSLGVSDTKIGSHISEVTGVPCHSSKF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
             LEL+RG+R+HF++FI+ LK  DLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  DLELIRGIRMHFDRFIKELKQSDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKD+NTF
Sbjct  181  LDKDINTF  188



>ref|XP_006650085.1| PREDICTED: nucleolar protein 56-like [Oryza brachyantha]
Length=545

 Score =   317 bits (813),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 151/188 (80%), Positives = 168/188 (89%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MALYLL+ESASGYGLFHA+G+DEIGQ+ +AVR SV DL+RFGK VKL AF PF SA+DAL
Sbjct  1    MALYLLFESASGYGLFHAYGIDEIGQSVDAVRASVVDLDRFGKAVKLAAFTPFSSAVDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQCNA+SEG MTDELR+FLEL LPK K+ KKAK+SLG+ EPK+GSHI E T IPCQSNEF
Sbjct  61   NQCNAISEGIMTDELRSFLELNLPKPKEGKKAKYSLGVVEPKVGSHISEVTGIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            V ELLRGVRLHF++FI  LK  DLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VQELLRGVRLHFDRFISELKKSDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKD+N+F
Sbjct  181  LDKDINSF  188



>ref|XP_008351745.1| PREDICTED: LOW QUALITY PROTEIN: nucleolar protein 56-like [Malus 
domestica]
Length=543

 Score =   317 bits (812),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 152/188 (81%), Positives = 168/188 (89%), Gaps = 3/188 (2%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MALYLLYESASGY LF AHG+D+IGQNTEAVR+S+ D+NRFGKVV+L AF+PFESALDAL
Sbjct  1    MALYLLYESASGYSLFLAHGIDQIGQNTEAVRSSISDINRFGKVVQLAAFDPFESALDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQCN+VSEG MTDELR FLE  LP VK+ KK KFSLG++EPK+GSHIFEETK PCQSNEF
Sbjct  61   NQCNSVSEGVMTDELRKFLEKNLPTVKEGKKPKFSLGVSEPKIGSHIFEETKXPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            VLEL+RGVRLH   F    + GDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VLELIRGVRLHLLLFS---RPGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  177

Query  637  LDKDVNTF  660
            LDKD+N+F
Sbjct  178  LDKDINSF  185



>ref|XP_006407288.1| hypothetical protein EUTSA_v10020558mg [Eutrema salsugineum]
 gb|ESQ48741.1| hypothetical protein EUTSA_v10020558mg [Eutrema salsugineum]
Length=504

 Score =   316 bits (809),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 151/188 (80%), Positives = 170/188 (90%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MA+YLLYES+SGYGLF AHGLDEIGQNTEAVR+SV DL+RFG+VV+L AF P +SALDAL
Sbjct  1    MAMYLLYESSSGYGLFKAHGLDEIGQNTEAVRSSVSDLSRFGRVVQLTAFQPSQSALDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQ NAVSEG M+DELR+FLEL LPKVK+ K  KFSLG++EPK+GS IFE TKIPCQSNEF
Sbjct  61   NQINAVSEGYMSDELRSFLELNLPKVKEGKTPKFSLGVSEPKIGSCIFEATKIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            V ELLRGVR HF++FI++LK GDL KAQLGL HSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VHELLRGVRQHFDRFIKDLKPGDLGKAQLGLAHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKD+N+F
Sbjct  181  LDKDINSF  188



>gb|KFK35536.1| hypothetical protein AALP_AA4G003300 [Arabis alpina]
Length=508

 Score =   316 bits (809),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 151/188 (80%), Positives = 170/188 (90%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MAL LL+E ASG+ L  AHG+DEIGQN EAVR+S+ DL+RFG+VVKL AF+PFESALDAL
Sbjct  1    MALSLLFEHASGFALLEAHGIDEIGQNIEAVRSSITDLSRFGRVVKLTAFHPFESALDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQ NAVSEG MTDELR+ LEL LPKVK+ KK KFSLGLAEPKLGSHIFE TKIPCQSNEF
Sbjct  61   NQINAVSEGVMTDELRSVLELNLPKVKEGKKPKFSLGLAEPKLGSHIFEVTKIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            VLELLRGVR HF++FI++LK GD+EK+QLGL HSYSRAKVKFNVNRVDNMVIQAIFL+DT
Sbjct  121  VLELLRGVRQHFDRFIKDLKPGDIEKSQLGLAHSYSRAKVKFNVNRVDNMVIQAIFLIDT  180

Query  637  LDKDVNTF  660
            LDKD+N+F
Sbjct  181  LDKDINSF  188



>ref|XP_010499575.1| PREDICTED: nucleolar protein 56-like [Camelina sativa]
Length=498

 Score =   315 bits (806),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 150/188 (80%), Positives = 170/188 (90%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MALYLL ES SG+GL+ AHG+DEIGQNTEAVR+SV DL+RFG+VV+L AF PF+SALDAL
Sbjct  1    MALYLLSESPSGFGLWEAHGIDEIGQNTEAVRSSVSDLSRFGRVVQLTAFQPFQSALDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            +Q NAVSEG M+DELR+FLEL LPKVK+ KK KFSLG+AEPK+GS IFE T IPCQSNEF
Sbjct  61   SQANAVSEGYMSDELRSFLELNLPKVKEGKKPKFSLGVAEPKIGSCIFEATNIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            + ELLRGVR HF++FI++LK GDLEKAQLGL HSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  IHELLRGVRQHFDRFIKDLKPGDLEKAQLGLAHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKDVN+F
Sbjct  181  LDKDVNSF  188



>ref|XP_010465064.1| PREDICTED: nucleolar protein 56-like [Camelina sativa]
Length=498

 Score =   314 bits (805),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 150/188 (80%), Positives = 170/188 (90%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MALYLL ESASG+GL+ AHG+DEIGQN EAVR+SV DL+RFG+VV+L AF PF+SALDAL
Sbjct  1    MALYLLSESASGFGLYSAHGIDEIGQNAEAVRSSVSDLSRFGRVVQLTAFQPFQSALDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQ +AVSEG M+DELR+FLEL LPKVK+ KK KFSLG+AEPK+GS IFE T IPCQSNEF
Sbjct  61   NQTSAVSEGYMSDELRSFLELNLPKVKEGKKPKFSLGVAEPKIGSCIFEATNIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            + ELLRGVR HF++FI++LK GDLEKAQLGL HSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  IHELLRGVRQHFDRFIKDLKPGDLEKAQLGLAHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKDVN+F
Sbjct  181  LDKDVNSF  188



>dbj|BAE98741.1| putative nucleolar protein [Arabidopsis thaliana]
Length=465

 Score =   313 bits (802),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 149/188 (79%), Positives = 169/188 (90%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            M +YLL ES SGYGLF  HG DEIGQNTEAVR+SV DL+RFG+VV+L AF+PF+SALDAL
Sbjct  1    MKIYLLSESPSGYGLFEGHGSDEIGQNTEAVRSSVSDLSRFGRVVQLTAFHPFQSALDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQ NAVSEG M+DELR+FLEL LPKVK+ KK KFSLG++EPK+GS IFE TKIPCQSNEF
Sbjct  61   NQINAVSEGYMSDELRSFLELNLPKVKEGKKPKFSLGVSEPKIGSCIFEATKIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            V ELLRGVR HF++FI++LK GDLEKAQLGL HSYSRAKVKFNVNRVDNMVIQAIF+LDT
Sbjct  121  VHELLRGVRQHFDRFIKDLKPGDLEKAQLGLAHSYSRAKVKFNVNRVDNMVIQAIFMLDT  180

Query  637  LDKDVNTF  660
            LDKD+N+F
Sbjct  181  LDKDINSF  188



>ref|XP_003562510.1| PREDICTED: nucleolar protein 56-like [Brachypodium distachyon]
Length=534

 Score =   315 bits (807),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 149/188 (79%), Positives = 167/188 (89%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MAL+LL+ESASGY LFHAHG+DEIGQ+ +AVR+SV D+ RF K VKLV F PF SA+DAL
Sbjct  1    MALHLLFESASGYALFHAHGIDEIGQSVDAVRSSVLDIKRFSKAVKLVGFTPFASAVDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQCNA+SEG MTDELRNFLEL LPKVK+ KKAKFS+G+ EPK+GSHI E T IPCQSNE+
Sbjct  61   NQCNAISEGIMTDELRNFLELNLPKVKEGKKAKFSVGVVEPKVGSHITEATGIPCQSNEY  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            V ELLR VRLHF++FI+ LK  DLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VQELLRAVRLHFDQFIDQLKPADLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKDVN+F
Sbjct  181  LDKDVNSF  188



>ref|XP_004958597.1| PREDICTED: nucleolar protein 56-like [Setaria italica]
Length=548

 Score =   315 bits (808),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 151/188 (80%), Positives = 166/188 (88%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MALYLL+ESAS Y LFHA+G+DEIGQ+ +AVR SV DL RFGK VKL  F+PF SA+DAL
Sbjct  1    MALYLLFESASAYALFHAYGIDEIGQSVDAVRASVLDLQRFGKTVKLAGFSPFSSAVDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQCNA+SEG MTDELRNFLEL LPKVK  KKAK+SLG+ EPK+GSHI E T IPCQSNEF
Sbjct  61   NQCNAISEGIMTDELRNFLELNLPKVKVGKKAKYSLGVMEPKVGSHISEATGIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            V ELLRGVRLHF++FI+ LK  DLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VQELLRGVRLHFDQFIDQLKKSDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKD+NTF
Sbjct  181  LDKDINTF  188



>ref|NP_187892.2| NOP56-like pre RNA processing ribonucleoprotein [Arabidopsis 
thaliana]
 dbj|BAB02430.1| nucleolar protein [Arabidopsis thaliana]
 gb|AEE75254.1| NOP56-like pre RNA processing ribonucleoprotein [Arabidopsis 
thaliana]
Length=499

 Score =   313 bits (802),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 149/188 (79%), Positives = 169/188 (90%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            M +YLL ES SGYGLF  HG DEIGQNTEAVR+SV DL+RFG+VV+L AF+PF+SALDAL
Sbjct  1    MKIYLLSESPSGYGLFEGHGSDEIGQNTEAVRSSVSDLSRFGRVVQLTAFHPFQSALDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQ NAVSEG M+DELR+FLEL LPKVK+ KK KFSLG++EPK+GS IFE TKIPCQSNEF
Sbjct  61   NQINAVSEGYMSDELRSFLELNLPKVKEGKKPKFSLGVSEPKIGSCIFEATKIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            V ELLRGVR HF++FI++LK GDLEKAQLGL HSYSRAKVKFNVNRVDNMVIQAIF+LDT
Sbjct  121  VHELLRGVRQHFDRFIKDLKPGDLEKAQLGLAHSYSRAKVKFNVNRVDNMVIQAIFMLDT  180

Query  637  LDKDVNTF  660
            LDKD+N+F
Sbjct  181  LDKDINSF  188



>ref|XP_006395291.1| hypothetical protein EUTSA_v10004082mg [Eutrema salsugineum]
 gb|ESQ32577.1| hypothetical protein EUTSA_v10004082mg [Eutrema salsugineum]
Length=491

 Score =   313 bits (802),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 151/188 (80%), Positives = 167/188 (89%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            M +YLLYES SGY L  AHGLDEI QNTEAVR SV DL+RFG+VVKL+AF P +SALDAL
Sbjct  1    MVIYLLYESPSGYCLLEAHGLDEIRQNTEAVRASVSDLSRFGRVVKLIAFQPSQSALDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQ NAVSEG MTDELR+FLEL LPKVK+ KK KFSLG++EPK+GS IFE TKIPCQSNEF
Sbjct  61   NQINAVSEGYMTDELRSFLELNLPKVKEGKKPKFSLGVSEPKIGSCIFEATKIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            V ELLRGVR HF++FI++LK GDLEKAQLGL HSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VHELLRGVRQHFDRFIKDLKPGDLEKAQLGLAHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKD+N+F
Sbjct  181  LDKDINSF  188



>ref|NP_001060541.1| Os07g0661800 [Oryza sativa Japonica Group]
 dbj|BAC84317.1| putative nucleolar protein [Oryza sativa Japonica Group]
 dbj|BAF22455.1| Os07g0661800 [Oryza sativa Japonica Group]
Length=313

 Score =   306 bits (785),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 146/188 (78%), Positives = 163/188 (87%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MALYLL+ESASGY LFHAHG+DEIGQ  +A R SV +L RF K VKL  F+PF SA+DAL
Sbjct  1    MALYLLFESASGYALFHAHGVDEIGQGVDAARASVLELQRFSKAVKLAGFSPFSSAVDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQCNA+SEG MTDELR+FLEL LPKVK+ KKAK+S+G+ EPK+GSHI E T IPCQ NEF
Sbjct  61   NQCNAISEGIMTDELRSFLELNLPKVKEGKKAKYSVGVMEPKVGSHISEATGIPCQCNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            V ELLRGVRLHF+ FI+ LK  DLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VQELLRGVRLHFDHFIDQLKPTDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKD+N+F
Sbjct  181  LDKDINSF  188



>ref|XP_003563386.1| PREDICTED: nucleolar protein 56-like [Brachypodium distachyon]
Length=547

 Score =   313 bits (801),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 148/188 (79%), Positives = 165/188 (88%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MALYLL+ESASGY +FHA+G+DEIGQ+ +AVR+SV DL RF K VKL  F PF SA+DAL
Sbjct  1    MALYLLFESASGYAVFHAYGIDEIGQSVDAVRSSVLDLKRFSKTVKLTGFTPFASAVDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQCNA+SEG MTDELRNFLEL LPK K+ KKAK+SLG+ EPK+GSHI E T IPCQSNEF
Sbjct  61   NQCNAISEGIMTDELRNFLELNLPKAKEGKKAKYSLGVMEPKVGSHITEATGIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            V ELLR VRLHF++FI+ LK  DLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VQELLRAVRLHFDQFIDQLKPSDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKDVN+F
Sbjct  181  LDKDVNSF  188



>ref|XP_002461161.1| hypothetical protein SORBIDRAFT_02g042030 [Sorghum bicolor]
 gb|EER97682.1| hypothetical protein SORBIDRAFT_02g042030 [Sorghum bicolor]
Length=565

 Score =   313 bits (802),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 146/188 (78%), Positives = 166/188 (88%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MALYLL+E ASGY LFHA+G+DEIGQ+ +AVR SV DL RFGK ++L  F+PF SA+DA+
Sbjct  1    MALYLLFEVASGYALFHAYGIDEIGQSVDAVRASVLDLQRFGKAIRLTGFSPFSSAMDAI  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQCNA+SEG MTDELRNFLEL LPKVK+ KKAK+SLG+ EPK+GSHI E T IPCQSNEF
Sbjct  61   NQCNAISEGIMTDELRNFLELNLPKVKEGKKAKYSLGVTEPKVGSHITEATGIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            V ELLRGVRLHF++FI+ LK  DLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VQELLRGVRLHFDQFIDQLKKSDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKD+N+ 
Sbjct  181  LDKDINSI  188



>dbj|BAK00100.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=547

 Score =   310 bits (795),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 146/188 (78%), Positives = 166/188 (88%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MALYLL+ESASGY LFHA+G+DEIGQ+ +AVR++V DLNRF K VKL  F PF SA+DAL
Sbjct  1    MALYLLFESASGYALFHAYGIDEIGQSVDAVRSTVLDLNRFSKAVKLAGFTPFLSAVDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQCNA+SEG MTDELRNFLEL LPKVK+ KKAKF +G+ EPK+GSHI E T IPC+SN++
Sbjct  61   NQCNAISEGIMTDELRNFLELNLPKVKEGKKAKFRVGVTEPKVGSHITEATGIPCESNDY  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            + ELLR VRLHF++FIE LK  DLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  IQELLRAVRLHFDQFIEQLKPSDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKDVN+F
Sbjct  181  LDKDVNSF  188



>gb|EMS66462.1| hypothetical protein TRIUR3_03326 [Triticum urartu]
Length=548

 Score =   310 bits (794),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 146/188 (78%), Positives = 165/188 (88%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MALYLL+ESASGY LFHAHG+DEIGQ+ +AVR++V DL RF K VKL  F PF SA+DAL
Sbjct  1    MALYLLFESASGYALFHAHGIDEIGQSVDAVRSTVLDLKRFSKAVKLAGFTPFLSAVDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQCNA+SEG MTDELRNFLEL LPKVK+ KKAKF +G+ EPK+GSHI E T IPC+SN++
Sbjct  61   NQCNAISEGIMTDELRNFLELNLPKVKEGKKAKFRVGVMEPKVGSHITEATGIPCESNDY  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            V ELLR VRLHF++FI+ LK  DLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VQELLRAVRLHFDQFIDQLKPSDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKDVN+F
Sbjct  181  LDKDVNSF  188



>gb|EMT05996.1| hypothetical protein F775_30288 [Aegilops tauschii]
Length=537

 Score =   310 bits (793),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 147/188 (78%), Positives = 165/188 (88%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MALYLL+ESASGY LFHAHG+DEIGQ+ +AVR++V DL R  K VKL  F PF SA+DAL
Sbjct  1    MALYLLFESASGYALFHAHGIDEIGQSVDAVRSTVLDLKRCSKAVKLAGFTPFLSAVDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQCNA+SEG MTDELRNFLEL LPKVK+ KKAKF++G+ EPK+GSHI E T IPCQSN++
Sbjct  61   NQCNAISEGIMTDELRNFLELNLPKVKEGKKAKFTVGVMEPKVGSHITEATGIPCQSNDY  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            V ELLR VRLHF++FIE LK  DLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VQELLRAVRLHFDQFIEQLKPSDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKDVN+F
Sbjct  181  LDKDVNSF  188



>gb|EEC82626.1| hypothetical protein OsI_27213 [Oryza sativa Indica Group]
 gb|EEE67753.1| hypothetical protein OsJ_25460 [Oryza sativa Japonica Group]
Length=481

 Score =   307 bits (787),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 146/188 (78%), Positives = 163/188 (87%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MALYLL+ESASGY LFHAHG+DEIGQ  +A R SV +L RF K VKL  F+PF SA+DAL
Sbjct  1    MALYLLFESASGYALFHAHGVDEIGQGVDAARASVLELQRFSKAVKLAGFSPFSSAVDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQCNA+SEG MTDELR+FLEL LPKVK+ KKAK+S+G+ EPK+GSHI E T IPCQ NEF
Sbjct  61   NQCNAISEGIMTDELRSFLELNLPKVKEGKKAKYSVGVMEPKVGSHISEATGIPCQCNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            V ELLRGVRLHF+ FI+ LK  DLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VQELLRGVRLHFDHFIDQLKPTDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKD+N+F
Sbjct  181  LDKDINSF  188



>gb|EPS72848.1| hypothetical protein M569_01909, partial [Genlisea aurea]
Length=496

 Score =   308 bits (788),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 148/188 (79%), Positives = 166/188 (88%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MALY+L+E+ASGY L  A G+DEIGQNTEAVR SV D NRF KVV LVAF+PFESA+DAL
Sbjct  1    MALYVLFEAASGYALLSAKGIDEIGQNTEAVRGSVNDYNRFVKVVHLVAFSPFESAVDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
             QCNAVSEG MT+ELR+FLEL LPKVK+ KK+KFSLG+AEPKLGSHIFE TKIPCQ NE 
Sbjct  61   KQCNAVSEGHMTEELRSFLELNLPKVKELKKSKFSLGVAEPKLGSHIFEVTKIPCQCNEL  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            V E+LRGVRLHF + +++LK GDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLD+
Sbjct  121  VHEILRGVRLHFHQILKSLKPGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDS  180

Query  637  LDKDVNTF  660
             DKD+N F
Sbjct  181  FDKDINLF  188



>gb|AFK36574.1| unknown [Lotus japonicus]
Length=546

 Score =   309 bits (792),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/187 (81%), Positives = 164/187 (88%), Gaps = 0/187 (0%)
 Frame = +1

Query  100  ALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDALN  279
            AL+LLYESA GY LF AHGLDEIGQNTEAVRNSV DLNRFGKVVKL +F+ F SALDAL 
Sbjct  3    ALFLLYESACGYALFEAHGLDEIGQNTEAVRNSVSDLNRFGKVVKLCSFHAFTSALDALK  62

Query  280  QCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEFV  459
            QCNAVSEG +TD LR  LE  LPKVK+ KK KFSLG+++PK+GS I E +KIPCQSNEFV
Sbjct  63   QCNAVSEGILTDGLRAALEKNLPKVKEGKKPKFSLGVSDPKIGSQIAEVSKIPCQSNEFV  122

Query  460  LELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDTL  639
             ELLRGVRLHF KFI +LK GDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDTL
Sbjct  123  SELLRGVRLHFNKFIGDLKTGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDTL  182

Query  640  DKDVNTF  660
            DKDVN+F
Sbjct  183  DKDVNSF  189



>dbj|BAK00655.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=540

 Score =   308 bits (788),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 145/188 (77%), Positives = 165/188 (88%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MALYLL+ESASGY LFHA+G+DEIGQ+ +AVR++V DL RF K VKL  F PF SA+DAL
Sbjct  1    MALYLLFESASGYALFHAYGIDEIGQSVDAVRSTVLDLQRFSKAVKLAGFTPFLSAVDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQCNA+SEG MTDELRNFLEL LPKVK+ KKAKF +G+ EPK+GSHI E T IPC+SN++
Sbjct  61   NQCNAISEGIMTDELRNFLELNLPKVKEGKKAKFRVGVMEPKVGSHITEATGIPCESNDY  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            + ELLR VRLHF++FIE LK  DLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  IQELLRAVRLHFDQFIEQLKPSDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKDVN+F
Sbjct  181  LDKDVNSF  188



>ref|NP_001150345.1| LOC100283975 [Zea mays]
 gb|ACG38753.1| nucleolar protein Nop56 [Zea mays]
Length=544

 Score =   307 bits (787),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 149/188 (79%), Positives = 165/188 (88%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MALYLL+ESASGYGLFHA+G+DEIGQ+ EAVR+SV DL+RFGK VKL AFNPF SA+DAL
Sbjct  1    MALYLLFESASGYGLFHAYGIDEIGQSVEAVRSSVLDLDRFGKAVKLTAFNPFSSAVDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQCNA     MTDELR+FLEL LPK K+ KKAK+SLG+ EPK+GSHI E T IP QSNEF
Sbjct  61   NQCNAYIRRIMTDELRSFLELNLPKPKEGKKAKYSLGVVEPKVGSHISEVTGIPXQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            V ELLRGVRLHF++FI  LK  DLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VQELLRGVRLHFDRFINELKDSDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKD+N+F
Sbjct  181  LDKDINSF  188



>ref|XP_003608861.1| Nucleolar protein [Medicago truncatula]
 gb|ACJ85727.1| unknown [Medicago truncatula]
 gb|AES91058.1| NOP56-like pre RNA processing ribonucleoprotein [Medicago truncatula]
 gb|AFK48590.1| unknown [Medicago truncatula]
Length=524

 Score =   303 bits (776),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 149/188 (79%), Positives = 165/188 (88%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MAL+LL+E+A GY LF AHG+DEIGQNTEAVRNSV DL+RFGKVVKL +FNPF SAL++L
Sbjct  1    MALFLLHETALGYALFEAHGIDEIGQNTEAVRNSVTDLSRFGKVVKLRSFNPFTSALESL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
             Q NAVSEG MTDELR  LE  LPKVK+ KKAKFSLG+AE K+GSHI E TKIP QSNEF
Sbjct  61   EQINAVSEGIMTDELRTVLETNLPKVKEGKKAKFSLGVAESKIGSHIHEATKIPVQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            V EL+RGVR HF+KF+ +LK GDLEKAQLGL HSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VGELIRGVRQHFDKFVGDLKQGDLEKAQLGLCHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKDVN+F
Sbjct  181  LDKDVNSF  188



>gb|AFK46206.1| unknown [Medicago truncatula]
Length=524

 Score =   302 bits (774),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 148/188 (79%), Positives = 165/188 (88%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MAL+LL+E+A GY LF AHG+DEIGQNTEAVRNSV DL+RFGKVVKL +FNPF SAL++L
Sbjct  1    MALFLLHETALGYALFEAHGIDEIGQNTEAVRNSVTDLSRFGKVVKLRSFNPFTSALESL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
             Q NAVSEG MTDELR  LE  LPKVK+ KKAKFSLG+AE K+GSHI E TKIP QSNEF
Sbjct  61   EQINAVSEGIMTDELRTVLETNLPKVKEGKKAKFSLGVAESKIGSHIHEATKIPVQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            V EL+RGVR HF+KF+ +LK GDLEKAQLGL HSYSRAKVKFNVNRVDNMV+QAIFLLDT
Sbjct  121  VGELIRGVRQHFDKFVGDLKQGDLEKAQLGLCHSYSRAKVKFNVNRVDNMVVQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKDVN+F
Sbjct  181  LDKDVNSF  188



>gb|ACJ85565.1| unknown [Medicago truncatula]
Length=524

 Score =   298 bits (762),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 147/188 (78%), Positives = 163/188 (87%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MAL+LL+E+A GY LF AHG+DEIGQNTEAVRNSV DL+RFGKVVKL +FNPF SAL++L
Sbjct  1    MALFLLHETALGYALFEAHGIDEIGQNTEAVRNSVTDLSRFGKVVKLRSFNPFTSALESL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
             Q NAVSEG MTDELR  LE  LPKVK+ KKAKFSLG+AE K+GSHI E TKIP QSNE 
Sbjct  61   EQINAVSEGIMTDELRTVLETNLPKVKEGKKAKFSLGVAESKIGSHIHEATKIPVQSNES  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            V EL+RGVR HF+KF+ +LK GDLEKAQLG  HSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VGELIRGVRQHFDKFVGDLKQGDLEKAQLGPCHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKDVN+F
Sbjct  181  LDKDVNSF  188



>gb|EMT17366.1| hypothetical protein F775_05055 [Aegilops tauschii]
Length=577

 Score =   298 bits (763),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 145/201 (72%), Positives = 164/201 (82%), Gaps = 13/201 (6%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MALYLL+ESASGY LFHAHG+DEIGQ+ +AVR++V DL RF K VKL  F PF SA+DAL
Sbjct  1    MALYLLFESASGYALFHAHGIDEIGQSVDAVRSTVLDLKRFSKAVKLAGFTPFLSAVDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQCNA+SEG MTDELRNFLEL LPKVK+ KKAKF +G+ EPK+GSHI E T IPC+SN++
Sbjct  61   NQCNAISEGIMTDELRNFLELNLPKVKEGKKAKFRVGVMEPKVGSHITEATGIPCESNDY  120

Query  457  VLELLRGVRLHFEKFIENLK-------------AGDLEKAQLGLGHSYSRAKVKFNVNRV  597
            V ELLR VRLH ++FI+ LK               DLEKAQLGLGHSYSRAKVKFNVNRV
Sbjct  121  VQELLRAVRLHLDQFIDQLKRIVQQWEKFNVLVPSDLEKAQLGLGHSYSRAKVKFNVNRV  180

Query  598  DNMVIQAIFLLDTLDKDVNTF  660
            DNMVIQAIFLLDTLDKDVN+F
Sbjct  181  DNMVIQAIFLLDTLDKDVNSF  201



>ref|XP_004515826.1| PREDICTED: nucleolar protein 56-like [Cicer arietinum]
Length=525

 Score =   295 bits (756),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 146/188 (78%), Positives = 160/188 (85%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MAL+LL+E+A+GY LF AHG+DEIGQNTEAVRNSV DLNRFGKVVKL +FNPF SALDAL
Sbjct  1    MALFLLFEAANGYALFEAHGIDEIGQNTEAVRNSVTDLNRFGKVVKLRSFNPFTSALDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
             Q NAV+EG MTDELR  LE  LPKVK+ KK KFSLG+AE KLGS I + TKIPCQ NEF
Sbjct  61   EQVNAVTEGVMTDELRTVLETNLPKVKEGKKPKFSLGVAESKLGSQIHDVTKIPCQCNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            V ELLRGVR HF   + +LK GDL KAQLGL HSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  121  VGELLRGVRQHFVDSVGDLKPGDLIKAQLGLSHSYSRAKVKFNVNRVDNMVIQAIFLLDT  180

Query  637  LDKDVNTF  660
            LDKD+N+F
Sbjct  181  LDKDINSF  188



>ref|XP_006297501.1| hypothetical protein CARUB_v10013523mg [Capsella rubella]
 gb|EOA30399.1| hypothetical protein CARUB_v10013523mg [Capsella rubella]
Length=497

 Score =   294 bits (753),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 140/177 (79%), Positives = 158/177 (89%), Gaps = 0/177 (0%)
 Frame = +1

Query  130  GYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDALNQCNAVSEGQM  309
            GY LF   G+DEIGQNTEAVR+SV DL+RFG+VV+L AF+P +SALDALNQ +A+SEG M
Sbjct  12   GYALFQVQGVDEIGQNTEAVRSSVSDLSRFGRVVQLTAFHPSQSALDALNQISAISEGYM  71

Query  310  TDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEFVLELLRGVRLH  489
            TDELR+FLEL LPKVK+ KK KFSLG+AEPK+GS IFE TKIPCQSNEFV ELLRGVR H
Sbjct  72   TDELRSFLELNLPKVKEGKKPKFSLGVAEPKIGSCIFEATKIPCQSNEFVHELLRGVRQH  131

Query  490  FEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDTLDKDVNTF  660
            F +FI++LK GDLEKAQLGL HSYSRAKVKFNVNRVDNMVIQAIFLLDTLDKD+N+F
Sbjct  132  FHRFIKDLKPGDLEKAQLGLAHSYSRAKVKFNVNRVDNMVIQAIFLLDTLDKDINSF  188



>ref|XP_001766920.1| predicted protein [Physcomitrella patens]
 gb|EDQ68322.1| predicted protein, partial [Physcomitrella patens]
Length=478

 Score =   293 bits (751),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 138/186 (74%), Positives = 159/186 (85%), Gaps = 0/186 (0%)
 Frame = +1

Query  103  LYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDALNQ  282
            LYLLYESASGY LF   GLDEIGQN EA++ S+ DLNRFGKVVKL+AF+PF SA DAL+Q
Sbjct  1    LYLLYESASGYALFETMGLDEIGQNAEAIQESITDLNRFGKVVKLLAFSPFTSAADALDQ  60

Query  283  CNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEFVL  462
            CN+V+EG MT EL+NFLEL LPKVK  KK K +LG+AEPKLGS I E T IPCQSN++V 
Sbjct  61   CNSVTEGIMTAELKNFLELNLPKVKSGKKPKVNLGVAEPKLGSAILESTHIPCQSNDYVN  120

Query  463  ELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDTLD  642
            E LRG+R HF +FI++LK GD+EKAQLGL HSYSR+KVKFNVNRVDNM+IQ+I LLDTLD
Sbjct  121  EFLRGIRFHFSRFIKDLKEGDIEKAQLGLAHSYSRSKVKFNVNRVDNMIIQSISLLDTLD  180

Query  643  KDVNTF  660
            KDVNTF
Sbjct  181  KDVNTF  186



>gb|KFK38628.1| hypothetical protein AALP_AA3G138900 [Arabis alpina]
Length=489

 Score =   290 bits (743),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = +1

Query  139  LFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDALNQCNAVSEGQMTDE  318
            +F A+GLDEIGQN EAVR+SV D++RFG+VV+L AF PFESALDALNQ NAVSEG MTDE
Sbjct  1    MFLANGLDEIGQNIEAVRSSVSDMSRFGRVVQLTAFLPFESALDALNQTNAVSEGYMTDE  60

Query  319  LRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEFVLELLRGVRLHFEK  498
            LR+FLEL LPKVK+ KK KFSLG++EPK+GS IFE TKIPCQSNEFV ELLRGVR HF++
Sbjct  61   LRSFLELNLPKVKEGKKPKFSLGVSEPKIGSCIFEATKIPCQSNEFVHELLRGVRQHFDR  120

Query  499  FIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDTLDKDVNTF  660
            FI++LKAGDLEKAQLGL HSYSRAKVKFNVNRVDNMVIQAIFL+D LDKD+NTF
Sbjct  121  FIKDLKAGDLEKAQLGLAHSYSRAKVKFNVNRVDNMVIQAIFLIDKLDKDINTF  174



>ref|XP_010677900.1| PREDICTED: nucleolar protein 56-like [Beta vulgaris subsp. vulgaris]
Length=519

 Score =   289 bits (740),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 144/188 (77%), Positives = 162/188 (86%), Gaps = 3/188 (2%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            M  YLL ESASGYGLF A GLDEIGQN EAVRNSV D+NRFG+VVKL AF PF+SALDAL
Sbjct  1    MKTYLLSESASGYGLFFAEGLDEIGQNIEAVRNSVTDINRFGQVVKLTAFQPFDSALDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQ +A+SEG MTDELR+FLEL+    ++SK  +F LG+A+ KLG+ I EETKI C+SNEF
Sbjct  61   NQASAISEGVMTDELRSFLELSF---QNSKAKEFILGVADSKLGASISEETKIQCRSNEF  117

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
             +ELLRGVRLHFE+FI+ LK GDLEKAQLGL HSYSRAKVKFNVNRVDNMVIQAIFLLDT
Sbjct  118  DMELLRGVRLHFERFIKYLKPGDLEKAQLGLAHSYSRAKVKFNVNRVDNMVIQAIFLLDT  177

Query  637  LDKDVNTF  660
            LDKDVN+F
Sbjct  178  LDKDVNSF  185



>ref|XP_002964924.1| hypothetical protein SELMODRAFT_167367 [Selaginella moellendorffii]
 ref|XP_002986505.1| hypothetical protein SELMODRAFT_124256 [Selaginella moellendorffii]
 gb|EFJ12362.1| hypothetical protein SELMODRAFT_124256 [Selaginella moellendorffii]
 gb|EFJ33762.1| hypothetical protein SELMODRAFT_167367 [Selaginella moellendorffii]
Length=513

 Score =   285 bits (730),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 133/186 (72%), Positives = 153/186 (82%), Gaps = 0/186 (0%)
 Frame = +1

Query  103  LYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDALNQ  282
            LYLLYE+ SGY +F AHGLDEIGQ   AV+ S+KDLNRFG VV+LV F PFESA  AL+Q
Sbjct  12   LYLLYEAPSGYSIFEAHGLDEIGQAAAAVQESIKDLNRFGNVVRLVTFKPFESAASALDQ  71

Query  283  CNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEFVL  462
            CNA+SEG MT EL+ FL   LPKVK  K AKFSLG+AEPKLGS I E   +PCQSNEFV 
Sbjct  72   CNAISEGIMTSELQEFLGSCLPKVKAGKAAKFSLGVAEPKLGSQIQESLGVPCQSNEFVA  131

Query  463  ELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDTLD  642
            E LRG+RLHF +F+ +LK GD+E+AQLGL HSYSRAKVKFNVNR+DNM+IQ+I LLDTLD
Sbjct  132  EFLRGIRLHFSRFVRDLKEGDVERAQLGLSHSYSRAKVKFNVNRIDNMIIQSISLLDTLD  191

Query  643  KDVNTF  660
            KD+NTF
Sbjct  192  KDINTF  197



>ref|XP_001754987.1| predicted protein [Physcomitrella patens]
 gb|EDQ80441.1| predicted protein [Physcomitrella patens]
Length=590

 Score =   284 bits (726),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 141/188 (75%), Positives = 159/188 (85%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            M L+LLYESASGY LF   GLDEIGQN EA++ S+ DLNRFGKVVKL+AF+PF SA DAL
Sbjct  1    MTLHLLYESASGYALFETMGLDEIGQNAEAIQESIMDLNRFGKVVKLLAFSPFTSAADAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
             QCNAV+EG MT EL+NFLEL LPK K  KKAK SLG+AEPKLGS I E T IPCQSN++
Sbjct  61   EQCNAVTEGIMTAELKNFLELNLPKAKAGKKAKVSLGVAEPKLGSAILEATSIPCQSNDY  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            V E LRGVR HF +FI++LK GD+EKAQLGL HSYSR+KVKFNVNRVDNM+IQ+I LLDT
Sbjct  121  VNEFLRGVRFHFSRFIKDLKEGDIEKAQLGLAHSYSRSKVKFNVNRVDNMIIQSISLLDT  180

Query  637  LDKDVNTF  660
            LDKDVNTF
Sbjct  181  LDKDVNTF  188



>ref|XP_009129303.1| PREDICTED: nucleolar protein 56-like [Brassica rapa]
 emb|CDY44398.1| BnaA02g29790D [Brassica napus]
Length=445

 Score =   270 bits (689),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 128/188 (68%), Positives = 158/188 (84%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MA+++LYES+SGY LF  HGL+EIGQN EAV++SV DL RFG+VVKL AF+P+++A DAL
Sbjct  1    MAMFVLYESSSGYALFDVHGLNEIGQNVEAVQSSVSDLARFGQVVKLTAFHPWQTAQDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQ NAVSEG M++ELR+FLEL LPK ++ K+ KFSLG+++PKLGS I E TKIPCQSNEF
Sbjct  61   NQVNAVSEGFMSEELRSFLELNLPKAEEGKETKFSLGVSDPKLGSCISEATKIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            V ELLRGVR HF+ FI + K G LEK Q+GL  SYSRAKVK+NVN+ D+MVIQ I LLDT
Sbjct  121  VQELLRGVRQHFDSFINDFKPGGLEKPQVGLALSYSRAKVKYNVNKEDHMVIQTISLLDT  180

Query  637  LDKDVNTF  660
            LDKD+N++
Sbjct  181  LDKDINSY  188



>emb|CDY04069.1| BnaC02g37840D [Brassica napus]
Length=446

 Score =   269 bits (688),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 130/188 (69%), Positives = 156/188 (83%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MA+++LYES SGY LF  HGLDEIGQN EAV+ SV DL +FG+VVKL AF+P+++A DAL
Sbjct  1    MAMFVLYESFSGYALFDVHGLDEIGQNVEAVQTSVSDLAQFGQVVKLTAFHPWQTAQDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQ NAVSEG M++ELR+FL+L LPKV++  + KFSLG+++PKLGS I E TKIPCQSNEF
Sbjct  61   NQINAVSEGFMSEELRSFLDLNLPKVEEGVEPKFSLGVSDPKLGSCISEATKIPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            V ELLRGVR HF+ FI +LK G  EKAQ GL HSYSRAKVK NVNR D+MVIQ I LLDT
Sbjct  121  VQELLRGVRQHFDSFINDLKPGGFEKAQQGLAHSYSRAKVKHNVNRKDHMVIQTISLLDT  180

Query  637  LDKDVNTF  660
            LDKD+N++
Sbjct  181  LDKDINSY  188



>dbj|BAK08040.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=475

 Score =   257 bits (656),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 122/188 (65%), Positives = 150/188 (80%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            M LYLL+ESASGY LFHA+G+ +IGQ+ +AVR+++ DL RF + +KL  F PF SA+DAL
Sbjct  1    MVLYLLFESASGYALFHAYGIRKIGQSVDAVRSTLLDLKRFRRAIKLDGFTPFMSAVDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            +QCNA+SEG MTD+LRNFLEL LPK    KKA F++G+ EPK+GSHI E T I CQS+++
Sbjct  61   SQCNAISEGIMTDKLRNFLELYLPKEIPGKKATFTVGVMEPKVGSHITEATGITCQSDDY  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            + ELLR VRLHF +  + LK  DLEK+QL LGHSYSR KVK N NRVDNM+ QAIFLLDT
Sbjct  121  IQELLRAVRLHFGQLFDKLKPYDLEKSQLDLGHSYSRVKVKSNANRVDNMMTQAIFLLDT  180

Query  637  LDKDVNTF  660
            LD+DVN F
Sbjct  181  LDRDVNFF  188



>ref|XP_011401661.1| Nucleolar protein 56 [Auxenochlorella protothecoides]
 gb|KFM28625.1| Nucleolar protein 56 [Auxenochlorella protothecoides]
Length=469

 Score =   256 bits (654),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 147/188 (78%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            M  +LL+E+ASGY LF    LDEIG + +AV+ SV DL+RFGK VKL AF PF SA +AL
Sbjct  1    MTQFLLFEAASGYALFEVTALDEIGTSVDAVQASVTDLSRFGKAVKLTAFRPFSSAANAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
             Q NAVSE Q+T++L+NFL  +LPKVK +  AKF LG++EPKLGS I EET +PC+ NEF
Sbjct  61   EQINAVSESQVTEDLKNFLTSSLPKVKKASSAKFKLGVSEPKLGSAIQEETSVPCECNEF  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            V EL+RGVR HF  FI  L+ GD  +AQLGL HSYSRAKVKFNV++ DNM+IQAI LLDT
Sbjct  121  VGELIRGVRAHFTTFIRGLEEGDSARAQLGLAHSYSRAKVKFNVHKSDNMIIQAIALLDT  180

Query  637  LDKDVNTF  660
            LDKDVNTF
Sbjct  181  LDKDVNTF  188



>ref|XP_003058762.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH57217.1| predicted protein [Micromonas pusilla CCMP1545]
Length=486

 Score =   252 bits (644),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/188 (62%), Positives = 146/188 (78%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MA +LLYESASGY LF    +DEIGQ  EAV+ +V D+ RFGKVVKL  F PF SA +AL
Sbjct  1    MATFLLYESASGYALFEGLDMDEIGQTQEAVQETVTDMTRFGKVVKLKGFKPFTSAANAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
             Q N+V+E   +D+L+NFLE+ LPKVKD+KKAKF LG+A+PKLG+ I E T IPC SN+ 
Sbjct  61   EQINSVAESTCSDDLKNFLEMNLPKVKDAKKAKFQLGVADPKLGNSIVEHTSIPCVSNDH  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            + E++RG R HF +F++ LK GD E+AQLGL HS+SR +VKFNVNR DNM+I AI L+D 
Sbjct  121  IGEMIRGCRYHFSRFMKGLKDGDYERAQLGLAHSFSRTRVKFNVNRSDNMIINAIALIDI  180

Query  637  LDKDVNTF  660
            LDKD+NTF
Sbjct  181  LDKDINTF  188



>ref|XP_002953396.1| hypothetical protein VOLCADRAFT_105910 [Volvox carteri f. nagariensis]
 gb|EFJ45369.1| hypothetical protein VOLCADRAFT_105910 [Volvox carteri f. nagariensis]
Length=503

 Score =   248 bits (633),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/188 (63%), Positives = 148/188 (79%), Gaps = 1/188 (1%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MA ++LYESA GYG+F     DEIGQ  + V+ ++ DL RFG++VKLVAF PF SA D+L
Sbjct  1    MATFVLYESAVGYGIFEITEFDEIGQAVDKVQEAISDLARFGRIVKLVAFKPFPSAADSL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
             Q NA+SE Q+TDEL+ FLEL +PKVK+ KKAKF LG+ EPKLGS I E T IPC SN+ 
Sbjct  61   EQINAISEAQLTDELKAFLELNMPKVKEGKKAKFKLGVFEPKLGSVIQETTNIPCISNDV  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            V E++RG+R +  +FI ++   D+++AQLGL HSYSRAKVKFNVN+VDNM+IQAI LLDT
Sbjct  121  VGEVIRGIRANISRFI-SVSDADMKRAQLGLAHSYSRAKVKFNVNKVDNMIIQAIALLDT  179

Query  637  LDKDVNTF  660
            LDKD+NTF
Sbjct  180  LDKDINTF  187



>ref|XP_007513547.1| predicted protein [Bathycoccus prasinos]
 emb|CCO16072.1| predicted protein [Bathycoccus prasinos]
Length=481

 Score =   246 bits (627),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 117/188 (62%), Positives = 144/188 (77%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MA +LLYESASGY LF A  +D +G   ++V  +V +++RFGKV  L +F PF+SA DAL
Sbjct  1    MATFLLYESASGYALFEAKDMDWVGDTPQSVAETVNNMDRFGKVCSLQSFKPFKSAKDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
             Q NA+SEG  TD L NFLE  LP++KD KKAKF+LG+ + KLG+ I +  KIPC  N+ 
Sbjct  61   EQINAISEGVCTDLLHNFLEQNLPRIKDEKKAKFTLGVLDSKLGNSIVDSMKIPCVCNDS  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            + E+ RGVR+HF KFI+ LK GD EKAQLGL HSYSRAKVKFNVNR DNM+IQAI L+DT
Sbjct  121  INEMTRGVRIHFGKFIKGLKEGDYEKAQLGLAHSYSRAKVKFNVNRSDNMIIQAIALIDT  180

Query  637  LDKDVNTF  660
            LDKD+NTF
Sbjct  181  LDKDINTF  188



>gb|KDD75119.1| putative snoRNA binding domain-containing protein, partial [Helicosporidium 
sp. ATCC 50920]
Length=651

 Score =   250 bits (638),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 144/188 (77%), Gaps = 2/188 (1%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            M+ +LL+ESASG+GLF    +DEIG  +EAV+ SV+D+ RFGK VKL AF PF SA +AL
Sbjct  1    MSQFLLFESASGFGLFEVTAIDEIGHTSEAVQQSVQDIARFGKAVKLTAFKPFTSAANAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
             Q NAVSE Q TD+L+NFL   LPKVK  K +K  LG++EPKLGS I E T IPC+ NE 
Sbjct  61   EQINAVSESQATDDLKNFLTTNLPKVK--KSSKLRLGVSEPKLGSAIAEATGIPCECNES  118

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            V ELLRGVR HF  F++ L A D  +AQLGL HSYSRAKVKFNVN+ DNM+IQAI LLDT
Sbjct  119  VGELLRGVRAHFGTFVKGLDAKDAARAQLGLAHSYSRAKVKFNVNKSDNMIIQAIALLDT  178

Query  637  LDKDVNTF  660
            LDKDVNTF
Sbjct  179  LDKDVNTF  186



>ref|XP_003080617.1| SAR DNA binding protein, putative (ISS) [Ostreococcus tauri]
Length=326

 Score =   239 bits (609),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 114/188 (61%), Positives = 143/188 (76%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MA ++L+ESASGYGLF    +D +GQ+ E V+   +D  +FGK+VKL  F PF SA +AL
Sbjct  1    MAQFVLFESASGYGLFETLDVDVVGQSLEKVQEQTQDAGKFGKMVKLHGFKPFTSAANAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
             Q N VSEG  +++L+NFLE  LP+ KDS KAK+ LG+++ KLG+ I E TKIPC  N+ 
Sbjct  61   EQINCVSEGVASEDLQNFLEQNLPRQKDSAKAKYQLGVSDSKLGNSIVESTKIPCVCNDS  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            V E+LRG+R HF KF++  K GD EKAQLGL HSYSRAKVKFNVNR DNM+IQAI L+DT
Sbjct  121  VGEILRGIRQHFTKFVKGFKGGDYEKAQLGLAHSYSRAKVKFNVNRSDNMIIQAIALIDT  180

Query  637  LDKDVNTF  660
            LDKD+NTF
Sbjct  181  LDKDINTF  188



>ref|XP_001697006.1| nucleolar protein, component of C/D snoRNPs [Chlamydomonas reinhardtii]
 gb|EDP00698.1| nucleolar protein, component of C/D snoRNPs [Chlamydomonas reinhardtii]
Length=498

 Score =   244 bits (622),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 117/188 (62%), Positives = 147/188 (78%), Gaps = 1/188 (1%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MA ++L+ESA GYGLF     DEIGQ+ + V+ +V D+ RFG++VKL AF PF SA D+L
Sbjct  1    MATFVLFESAVGYGLFEVAEFDEIGQSLDKVQEAVSDMARFGRIVKLTAFKPFPSAADSL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
             Q NA+SE  +TDEL+NFLE  LPKVK+ KKAK+ LG+ EPKLGS I E T IPC SN+ 
Sbjct  61   EQINAISEANLTDELKNFLEQNLPKVKEGKKAKYKLGVFEPKLGSIIQETTSIPCISNDM  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            V E+LRG+R +  +F+ ++   D+++AQLGL HSYSRAKVKFNVN+VDNM+IQAI LLDT
Sbjct  121  VGEVLRGIRANMARFV-SVAEADMKRAQLGLAHSYSRAKVKFNVNKVDNMIIQAIALLDT  179

Query  637  LDKDVNTF  660
            LDKDVNTF
Sbjct  180  LDKDVNTF  187



>ref|XP_001419274.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO97567.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=471

 Score =   242 bits (617),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/188 (62%), Positives = 145/188 (77%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MA ++L+ES+SGYGLF    LD +GQ  E V+ + +  ++FGKVVKL  F PF SA +AL
Sbjct  1    MAQFVLFESSSGYGLFETLDLDVVGQALEKVQETTQSADKFGKVVKLHGFKPFTSAANAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
             Q N VSEG  +++L+NFLE  LPK+KDSKKAKF LG+A+ KLG+ I E TKIPC  N+ 
Sbjct  61   EQINCVSEGVASEDLQNFLEQNLPKLKDSKKAKFQLGVADSKLGNSIVETTKIPCVCNDH  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            V E++RG+R +F KF++  K GD EKAQLGL HSYSRAKVKFNVNR DNM+IQAI L+DT
Sbjct  121  VGEIIRGIRAYFTKFVKGFKGGDYEKAQLGLAHSYSRAKVKFNVNRSDNMIIQAIALIDT  180

Query  637  LDKDVNTF  660
            LDKD+NTF
Sbjct  181  LDKDINTF  188



>ref|XP_002502983.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO64241.1| predicted protein [Micromonas sp. RCC299]
Length=617

 Score =   244 bits (623),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 115/187 (61%), Positives = 146/187 (78%), Gaps = 0/187 (0%)
 Frame = +1

Query  100  ALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDALN  279
            A ++LYESASGY LF    LDEIGQ +EAV+ ++ D+ RFGKVVKL  F PF SA  AL+
Sbjct  137  AQFILYESASGYALFEGLDLDEIGQTSEAVQATITDMTRFGKVVKLKGFKPFTSAAMALD  196

Query  280  QCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEFV  459
            + N V+E   +D+L+NFLEL LPKVKD+KKAKFSLG+++PKLG+ I E+T IPC  N+ +
Sbjct  197  EINNVAESTCSDDLKNFLELNLPKVKDAKKAKFSLGVSDPKLGNAIVEKTGIPCVCNDKI  256

Query  460  LELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDTL  639
             E++RG R HF +F++ LK GD EKAQLGL HS+SR +VKFNVNR DNM+I AI L+D L
Sbjct  257  GEIMRGCRTHFTRFLKGLKDGDYEKAQLGLAHSFSRTRVKFNVNRSDNMIINAIALVDIL  316

Query  640  DKDVNTF  660
            DKD+NTF
Sbjct  317  DKDINTF  323



>emb|CEG01347.1| NOSIC [Ostreococcus tauri]
Length=473

 Score =   239 bits (609),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/188 (61%), Positives = 143/188 (76%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MA ++L+ESASGYGLF    +D +GQ+ E V+   +D  +FGK+VKL  F PF SA +AL
Sbjct  1    MAQFVLFESASGYGLFETLDVDVVGQSLEKVQEQTQDAGKFGKMVKLHGFKPFTSAANAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
             Q N VSEG  +++L+NFLE  LP+ KDS KAK+ LG+++ KLG+ I E TKIPC  N+ 
Sbjct  61   EQINCVSEGVASEDLQNFLEQNLPRQKDSAKAKYQLGVSDSKLGNSIVESTKIPCVCNDS  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            V E+LRG+R HF KF++  K GD EKAQLGL HSYSRAKVKFNVNR DNM+IQAI L+DT
Sbjct  121  VGEILRGIRQHFTKFVKGFKGGDYEKAQLGLAHSYSRAKVKFNVNRSDNMIIQAIALIDT  180

Query  637  LDKDVNTF  660
            LDKD+NTF
Sbjct  181  LDKDINTF  188



>ref|XP_005645633.1| Nop-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE21089.1| Nop-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=558

 Score =   240 bits (612),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 119/189 (63%), Positives = 149/189 (79%), Gaps = 2/189 (1%)
 Frame = +1

Query  100  ALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDALN  279
            AL++LYE+A+GY LF   GLDE+GQ+ +AV+ S  DL RFGKVVKL +F PF++A  AL+
Sbjct  3    ALFVLYETAAGYSLFEVIGLDELGQSADAVQQSTLDLARFGKVVKLQSFLPFKNAAHALD  62

Query  280  QCNAVSEGQMTDELRNFLELTLPKV--KDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNE  453
            + NA+SE  +TD+L++FLE  LPKV  K SK  KF LG++E KLGS I E TKIPC  NE
Sbjct  63   EINAISEAVLTDDLQSFLETNLPKVSGKPSKDPKFQLGVSEAKLGSEIQEATKIPCVCNE  122

Query  454  FVLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLD  633
            F+ EL+RG+RLH  + ++ L+  DL ++QLGL HSYSRAKVKFNVNRVDNMVIQAI LLD
Sbjct  123  FIGELVRGLRLHAPRLLKGLEEMDLRRSQLGLAHSYSRAKVKFNVNRVDNMVIQAIALLD  182

Query  634  TLDKDVNTF  660
            TLDKD+NTF
Sbjct  183  TLDKDINTF  191



>ref|XP_010465063.1| PREDICTED: nucleolar protein 56-like [Camelina sativa]
Length=148

 Score =   217 bits (552),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 101/139 (73%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MALY+L ES SGYGL+ AHG++EIGQN EAVR+SV DL+RFG+VV+L AF PF+SALDAL
Sbjct  1    MALYILSESPSGYGLYEAHGIEEIGQNAEAVRSSVSDLSRFGRVVQLTAFQPFQSALDAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            NQ NAVSEG M+DELR+FLEL LPKVK+ +K KFSLG+ EPKLGS IFE TK PCQSNEF
Sbjct  61   NQVNAVSEGNMSDELRSFLELNLPKVKEGEKPKFSLGVGEPKLGSCIFEATKTPCQSNEF  120

Query  457  VLELLRGVRLHFEKFIENL  513
            + ELLRGVR HF++FI+++
Sbjct  121  IHELLRGVRQHFDRFIKDI  139



>ref|XP_005848173.1| hypothetical protein CHLNCDRAFT_145563 [Chlorella variabilis]
 gb|EFN56071.1| hypothetical protein CHLNCDRAFT_145563 [Chlorella variabilis]
Length=410

 Score =   226 bits (575),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 117/188 (62%), Positives = 138/188 (73%), Gaps = 2/188 (1%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            M  +LL+ESASGYGLF     DE+G   +AV+ SV D+ RFGK +KL AF PF SA +AL
Sbjct  1    MTTFLLFESASGYGLFELTAADELG-GVDAVQQSVNDIQRFGKSIKLAAFKPFTSAANAL  59

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
             Q NAVSE Q+TD+L+NFL   LP  K  K     LG+AE KLGS I EET +PC+ NE+
Sbjct  60   EQINAVSESQVTDDLKNFLTTNLPAAKKGKAKY-KLGVAEAKLGSAIQEETGVPCECNEY  118

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            V ELLRGVR H   FI+ L+  D+ +AQLGL HSYSRAKVKFNVN+ DNM+IQAI LLDT
Sbjct  119  VGELLRGVRQHIATFIKGLEDRDMARAQLGLAHSYSRAKVKFNVNKADNMIIQAIALLDT  178

Query  637  LDKDVNTF  660
            LDKDVNTF
Sbjct  179  LDKDVNTF  186



>gb|KDO52602.1| hypothetical protein CISIN_1g0085712mg, partial [Citrus sinensis]
Length=484

 Score =   223 bits (567),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = +1

Query  307  MTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEFVLELLRGVRL  486
            MT+ELRNFLEL LPKVK+ KKAKFSLG++EPK+GSHIFEETKIPCQSNEFVLELLRGVRL
Sbjct  2    MTNELRNFLELNLPKVKEGKKAKFSLGVSEPKIGSHIFEETKIPCQSNEFVLELLRGVRL  61

Query  487  HFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDTLDKDVNTF  660
            HF++FI++LK GDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDTLDKD+N+F
Sbjct  62   HFDRFIKDLKPGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDTLDKDINSF  119



>gb|KDO52603.1| hypothetical protein CISIN_1g0085712mg, partial [Citrus sinensis]
Length=492

 Score =   223 bits (568),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = +1

Query  307  MTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEFVLELLRGVRL  486
            MT+ELRNFLEL LPKVK+ KKAKFSLG++EPK+GSHIFEETKIPCQSNEFVLELLRGVRL
Sbjct  2    MTNELRNFLELNLPKVKEGKKAKFSLGVSEPKIGSHIFEETKIPCQSNEFVLELLRGVRL  61

Query  487  HFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDTLDKDVNTF  660
            HF++FI++LK GDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDTLDKD+N+F
Sbjct  62   HFDRFIKDLKPGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDTLDKDINSF  119



>ref|XP_008616077.1| hypothetical protein SDRG_11801 [Saprolegnia diclina VS20]
 gb|EQC30484.1| hypothetical protein SDRG_11801 [Saprolegnia diclina VS20]
Length=485

 Score =   221 bits (564),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 111/185 (60%), Positives = 137/185 (74%), Gaps = 2/185 (1%)
 Frame = +1

Query  106  YLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDALNQC  285
            ++L+ESASGY LF     ++IGQ  + V+  V+DL +FG  VKL AF+PF SA  AL   
Sbjct  5    FVLFESASGYALFEVVEAEQIGQLLDQVQKGVQDLAKFGAAVKLKAFSPFTSAESALENI  64

Query  286  NAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEFVLE  465
            NA+SEG +TD+L+ FLE+ LP    SKKAK++LGL +  L   + +  KIPC +NE  LE
Sbjct  65   NAISEGLVTDDLKAFLEMNLPS--SSKKAKYTLGLTDKGLAQSLTDALKIPCNTNETSLE  122

Query  466  LLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDTLDK  645
            +LRGVRLHF KFI+ L  G+L KAQLGLGHSYSRAKVKFNVNR DNM+IQAI LLD +DK
Sbjct  123  VLRGVRLHFAKFIKELDNGNLAKAQLGLGHSYSRAKVKFNVNRADNMIIQAIALLDQMDK  182

Query  646  DVNTF  660
            DVNTF
Sbjct  183  DVNTF  187



>ref|XP_011044182.1| PREDICTED: nucleolar protein 56-like isoform X2 [Populus euphratica]
Length=503

 Score =   221 bits (563),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 106/120 (88%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = +1

Query  301  GQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEFVLELLRGV  480
            G MTD+LRNFLEL LPKVK+ KKAKFSLG+AEPK+GSHIFE TKIPCQSNEFV ELLRGV
Sbjct  25   GIMTDDLRNFLELNLPKVKEGKKAKFSLGVAEPKIGSHIFEVTKIPCQSNEFVNELLRGV  84

Query  481  RLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDTLDKDVNTF  660
            RLHFE+FI++LK GDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDTLDKDVN+F
Sbjct  85   RLHFERFIKDLKPGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDTLDKDVNSF  144



>gb|KDO22655.1| hypothetical protein SPRG_12284 [Saprolegnia parasitica CBS 223.65]
Length=483

 Score =   220 bits (561),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 110/185 (59%), Positives = 137/185 (74%), Gaps = 2/185 (1%)
 Frame = +1

Query  106  YLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDALNQC  285
            ++L+ESASGY LF     ++IGQ  + V+  V+DL +FG  VKL AF+PF SA  AL   
Sbjct  5    FVLFESASGYALFEVVEAEQIGQLLDQVQKGVQDLAKFGAAVKLKAFSPFTSAESALENI  64

Query  286  NAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEFVLE  465
            N++SEG +TD+L+ FLE+ LP    SKKAK++LGL +  L   + +  KIPC +NE  LE
Sbjct  65   NSISEGLVTDDLKAFLEMNLPT--SSKKAKYTLGLTDKGLAQSLTDALKIPCNTNETSLE  122

Query  466  LLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDTLDK  645
            +LRGVRLHF KFI+ L  G+L KAQLGLGHSYSRAKVKFNVNR DNM+IQAI LLD +DK
Sbjct  123  VLRGVRLHFAKFIKELDNGNLAKAQLGLGHSYSRAKVKFNVNRADNMIIQAIALLDQMDK  182

Query  646  DVNTF  660
            DVNTF
Sbjct  183  DVNTF  187



>gb|KDO20999.1| hypothetical protein SPRG_13895 [Saprolegnia parasitica CBS 223.65]
Length=486

 Score =   220 bits (561),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 110/185 (59%), Positives = 137/185 (74%), Gaps = 2/185 (1%)
 Frame = +1

Query  106  YLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDALNQC  285
            ++L+ESASGY LF     ++IGQ  + V+  V+DL +FG  VKL AF+PF SA  AL   
Sbjct  5    FVLFESASGYALFEVVEAEQIGQLLDQVQKGVQDLAKFGAAVKLKAFSPFTSAESALENI  64

Query  286  NAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEFVLE  465
            N++SEG +TD+L+ FLE+ LP    SKKAK++LGL +  L   + +  KIPC +NE  LE
Sbjct  65   NSISEGLVTDDLKAFLEMNLPT--SSKKAKYTLGLTDKGLAQSLTDALKIPCNTNETSLE  122

Query  466  LLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDTLDK  645
            +LRGVRLHF KFI+ L  G+L KAQLGLGHSYSRAKVKFNVNR DNM+IQAI LLD +DK
Sbjct  123  VLRGVRLHFAKFIKELDNGNLAKAQLGLGHSYSRAKVKFNVNRADNMIIQAIALLDQMDK  182

Query  646  DVNTF  660
            DVNTF
Sbjct  183  DVNTF  187



>ref|XP_008892177.1| hypothetical protein PPTG_02695 [Phytophthora parasitica INRA-310]
 gb|ETI49601.1| hypothetical protein F443_06593 [Phytophthora parasitica P1569]
 gb|ETK89490.1| hypothetical protein L915_06466 [Phytophthora parasitica]
 gb|ETL42893.1| hypothetical protein L916_06411 [Phytophthora parasitica]
 gb|ETL96069.1| hypothetical protein L917_06276 [Phytophthora parasitica]
 gb|ETM49245.1| hypothetical protein L914_06386 [Phytophthora parasitica]
 gb|ETN22961.1| hypothetical protein PPTG_02695 [Phytophthora parasitica INRA-310]
 gb|ETO78317.1| hypothetical protein F444_06665 [Phytophthora parasitica P1976]
 gb|ETP19376.1| hypothetical protein F441_06602 [Phytophthora parasitica CJ01A1]
 gb|ETP47305.1| hypothetical protein F442_06637 [Phytophthora parasitica P10297]
Length=518

 Score =   218 bits (554),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 105/185 (57%), Positives = 137/185 (74%), Gaps = 0/185 (0%)
 Frame = +1

Query  106  YLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDALNQC  285
            ++L+ESASGY +F     +EIG     V+ SV D++ FG++VKL AF PF SA +AL   
Sbjct  6    FVLFESASGYAIFEVVENEEIGGLLAEVQASVADVSSFGRIVKLKAFQPFTSAENALENI  65

Query  286  NAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEFVLE  465
            N VSEG ++++L+NFLE+ LPKVK  KKAKF+LG+ +  L   I +E   PC ++E  LE
Sbjct  66   NNVSEGLLSEDLKNFLEMNLPKVKSGKKAKFALGVQDKGLAQAISDELNAPCNTSETTLE  125

Query  466  LLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDTLDK  645
            ++RGVR+HF  F++ L  G+L KAQLGLGHSYSRAKVKFNVNR DNM+IQAI LLD +DK
Sbjct  126  IVRGVRMHFATFVKELAQGNLAKAQLGLGHSYSRAKVKFNVNRADNMIIQAIALLDQMDK  185

Query  646  DVNTF  660
            D+NTF
Sbjct  186  DINTF  190



>ref|XP_002114548.1| hypothetical protein TRIADDRAFT_28215 [Trichoplax adhaerens]
 gb|EDV22682.1| hypothetical protein TRIADDRAFT_28215, partial [Trichoplax adhaerens]
Length=543

 Score =   216 bits (551),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 109/186 (59%), Positives = 135/186 (73%), Gaps = 2/186 (1%)
 Frame = +1

Query  103  LYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDALNQ  282
            LYLL+E ASGY +F +   +EIG  T  V+ S+ DL RFGK++KLVAF PF S+ +AL  
Sbjct  2    LYLLFEHASGYAIFQSLAQEEIGALTAEVQESILDLGRFGKLIKLVAFTPFRSSSNALEN  61

Query  283  CNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEFVL  462
             N+VSEG   D+L+ FL   +P  K  KK K  LG+++ KL S + E  K+ CQS E VL
Sbjct  62   INSVSEGIAHDDLKAFLLANIPVGK--KKTKVVLGISDSKLASAVQESVKLSCQSGELVL  119

Query  463  ELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDTLD  642
            EL+RG+R+HF KFIE L A    KAQLGLGHSYSRAKVKFNVNRVDNM+IQ+I LLD +D
Sbjct  120  ELIRGIRVHFHKFIEGLSADSAGKAQLGLGHSYSRAKVKFNVNRVDNMIIQSINLLDQMD  179

Query  643  KDVNTF  660
            KD+NTF
Sbjct  180  KDINTF  185



>ref|XP_004345107.2| nucleolar protein 5A [Capsaspora owczarzaki ATCC 30864]
Length=491

 Score =   215 bits (547),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 112/188 (60%), Positives = 136/188 (72%), Gaps = 1/188 (1%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            M L +L+ESASG+ LF A    EI     A++ SV D  RFGKVVK VAF PF+SAL AL
Sbjct  1    MVLLVLFESASGFALFEAVENAEIALTGPAIQQSVTDFARFGKVVKAVAFAPFKSALHAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
               NA+SEG + D L NFLE+ + KV   KK+K  LG+A+ ++ S I +   + C++ + 
Sbjct  61   ENINAISEGILHDYLNNFLEMNVAKV-GGKKSKVQLGVADARIASSITDSLGLQCKTGDV  119

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            V ELLRGVRLHF K  + L+ GD+EKAQLGLGHSYSRAKVKFNVNRVDNM+IQAI LLD 
Sbjct  120  VNELLRGVRLHFTKLTKELREGDVEKAQLGLGHSYSRAKVKFNVNRVDNMIIQAISLLDQ  179

Query  637  LDKDVNTF  660
            LDKDVNTF
Sbjct  180  LDKDVNTF  187



>ref|XP_002999165.1| nucleolar protein Nop56 [Phytophthora infestans T30-4]
 gb|EEY69311.1| nucleolar protein Nop56 [Phytophthora infestans T30-4]
Length=514

 Score =   215 bits (547),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 103/185 (56%), Positives = 137/185 (74%), Gaps = 0/185 (0%)
 Frame = +1

Query  106  YLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDALNQC  285
            ++L+ESASGY +F     +EIG     V+ +V D++ FG++VKL AF PF SA +AL   
Sbjct  6    FVLFESASGYAIFEVVENEEIGGLLSEVQAAVADVSSFGRIVKLKAFQPFTSAENALENI  65

Query  286  NAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEFVLE  465
            N +SEG ++++L+NFLE+ LPKVK  KKAKF+LG+ +  L   I +E   PC ++E  LE
Sbjct  66   NNISEGLLSEDLKNFLEMNLPKVKAGKKAKFALGVQDKGLAQAISDELNAPCNTSETTLE  125

Query  466  LLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDTLDK  645
            ++RGVR+HF  F++ L  G+L KAQLGLGHSYSRAKVKFNVNR DNM+IQAI LLD +DK
Sbjct  126  IVRGVRVHFATFVKELAQGNLAKAQLGLGHSYSRAKVKFNVNRADNMIIQAIALLDQMDK  185

Query  646  DVNTF  660
            D+NTF
Sbjct  186  DINTF  190



>ref|XP_009519011.1| hypothetical protein PHYSODRAFT_482921, partial [Phytophthora 
sojae]
 gb|EGZ23723.1| hypothetical protein PHYSODRAFT_482921 [Phytophthora sojae]
Length=517

 Score =   214 bits (545),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 103/185 (56%), Positives = 136/185 (74%), Gaps = 0/185 (0%)
 Frame = +1

Query  106  YLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDALNQC  285
            ++L+ESASGY +F     +EI      V+ +V D++ FG++VKL AF PF SA +AL   
Sbjct  5    FVLFESASGYAIFEVVENEEIAGLLAEVQAAVADVSSFGRIVKLKAFQPFTSAENALENI  64

Query  286  NAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEFVLE  465
            N VSEG + D+L+NFLE+ LPKVK  KKAKF+LG+ +  L   I ++  +PC ++E  LE
Sbjct  65   NNVSEGLVGDDLKNFLEMNLPKVKAGKKAKFALGVQDKGLAQSISDDLNVPCNTSETTLE  124

Query  466  LLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDTLDK  645
            ++RGVR+HF  F++ L  G+L KAQLGLGHSYSRAKVKFNVNR DNM+IQAI LLD +DK
Sbjct  125  IVRGVRMHFSTFVKELANGNLAKAQLGLGHSYSRAKVKFNVNRADNMIIQAIALLDQMDK  184

Query  646  DVNTF  660
            D+NTF
Sbjct  185  DINTF  189



>emb|CEP08181.1| hypothetical protein [Parasitella parasitica]
Length=493

 Score =   213 bits (542),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 109/188 (58%), Positives = 135/188 (72%), Gaps = 2/188 (1%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MA Y+L+E+ASGY LF     +EIG   E+V+NS+ DL++F K++KL +F PF++A DAL
Sbjct  1    MANYVLFETASGYSLFERLQSEEIGSKLESVQNSIADLSKFSKMLKLKSFAPFKNAADAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
               N VSEG +   L+ FLE+ LPK    KK+K  LG+ E  L   I  E  I C S+E 
Sbjct  61   ENANDVSEGIVNPSLKAFLEMNLPK--SGKKSKVCLGVTEKNLAGAIKSELSIDCASDEM  118

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            V EL+RG+RL  +K +  LKAGDLEKAQLGLGHSYSRAKVKFNVNR DNM+IQAI LLD 
Sbjct  119  VQELIRGIRLWADKLLGQLKAGDLEKAQLGLGHSYSRAKVKFNVNRADNMIIQAIALLDQ  178

Query  637  LDKDVNTF  660
            +DKDVNTF
Sbjct  179  MDKDVNTF  186



>gb|EPB88498.1| hypothetical protein HMPREF1544_04733 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=493

 Score =   212 bits (540),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 108/188 (57%), Positives = 135/188 (72%), Gaps = 2/188 (1%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MA Y+L+E+ASGY LF     +EIG   E+V+NS+ DL++F K++KL +F PF++A DAL
Sbjct  1    MANYVLFETASGYSLFERLQSEEIGSKLESVQNSIADLSKFSKMLKLKSFAPFKNAADAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
               N VSEG +   L+ FLE+ LPK    KK+K  LG+ E  L   I  E  I C S+E 
Sbjct  61   ENANDVSEGIVNPSLKAFLEMNLPK--SDKKSKVCLGVTEKNLAGAIKSELSIDCASDEM  118

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            V EL+RG+RL  +K +  LKAGDLE+AQLGLGHSYSRAKVKFNVNR DNM+IQAI LLD 
Sbjct  119  VQELIRGIRLWADKLLGQLKAGDLERAQLGLGHSYSRAKVKFNVNRADNMIIQAIALLDQ  178

Query  637  LDKDVNTF  660
            +DKDVNTF
Sbjct  179  MDKDVNTF  186



>gb|KJE95980.1| nucleolar protein 5A [Capsaspora owczarzaki ATCC 30864]
Length=502

 Score =   213 bits (541),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 111/186 (60%), Positives = 135/186 (73%), Gaps = 1/186 (1%)
 Frame = +1

Query  103  LYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDALNQ  282
            L +L+ESASG+ LF A    EI     A++ SV D  RFGKVVK VAF PF+SAL AL  
Sbjct  14   LLVLFESASGFALFEAVENAEIALTGPAIQQSVTDFARFGKVVKAVAFAPFKSALHALEN  73

Query  283  CNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEFVL  462
             NA+SEG + D L NFLE+ + KV   KK+K  LG+A+ ++ S I +   + C++ + V 
Sbjct  74   INAISEGILHDYLNNFLEMNVAKV-GGKKSKVQLGVADARIASSITDSLGLQCKTGDVVN  132

Query  463  ELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDTLD  642
            ELLRGVRLHF K  + L+ GD+EKAQLGLGHSYSRAKVKFNVNRVDNM+IQAI LLD LD
Sbjct  133  ELLRGVRLHFTKLTKELREGDVEKAQLGLGHSYSRAKVKFNVNRVDNMIIQAISLLDQLD  192

Query  643  KDVNTF  660
            KDVNTF
Sbjct  193  KDVNTF  198



>dbj|GAN01361.1| nop-domain-containing protein [Mucor ambiguus]
Length=495

 Score =   210 bits (534),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 106/185 (57%), Positives = 133/185 (72%), Gaps = 2/185 (1%)
 Frame = +1

Query  106  YLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDALNQC  285
            Y+L+E+ASGY LF     +EIG   E+V+NS+ DL++F K++KL +F PF++A DAL   
Sbjct  5    YVLFETASGYSLFERLQSEEIGSKLESVQNSIADLSKFSKMLKLKSFAPFKNAADALENA  64

Query  286  NAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEFVLE  465
            N VSEG +   L+ FLE+ LPK    KK+K  LG+ E  L   I  E  I C S+E V E
Sbjct  65   NDVSEGIVNPSLKAFLEMNLPK--SDKKSKVCLGVTEKNLAGAIKSELSIDCASDEMVQE  122

Query  466  LLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDTLDK  645
            L+RG+RL  +K +  LKAGDLE+AQLGLGHSYSRAKVKFNVNR DNM+IQAI LLD +DK
Sbjct  123  LIRGIRLWADKLLGQLKAGDLERAQLGLGHSYSRAKVKFNVNRADNMIIQAIALLDQMDK  182

Query  646  DVNTF  660
            DVNTF
Sbjct  183  DVNTF  187



>emb|CBJ48969.1| conserved unknown protein [Ectocarpus siliculosus]
Length=484

 Score =   209 bits (533),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 103/188 (55%), Positives = 131/188 (70%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            M+ ++LYESASGY L      +E+G   E V+ +V D  RF + VKL  F PF +A +AL
Sbjct  1    MSFFVLYESASGYALLEVMEAEEVGSLLEEVQQAVLDPQRFCRTVKLKGFQPFTTAENAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
               NA+SE  +TD+L+NFLE+ LPKVK SK A F LG  EP L S I +    PC+S+E 
Sbjct  61   ENVNAISEQIVTDDLKNFLEMNLPKVKKSKSASFQLGCIEPGLASAIQDRLGFPCRSDET  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            V E++RG+R+HF +F++ L  G  EKAQLGLGHSYSRAKVK N  R DNM+IQ+I LLD 
Sbjct  121  VKEIIRGIRVHFHRFVKELDGGVGEKAQLGLGHSYSRAKVKMNPARSDNMIIQSICLLDQ  180

Query  637  LDKDVNTF  660
            LDKD+NTF
Sbjct  181  LDKDLNTF  188



>gb|KHN43632.1| Nucleolar protein 56 [Glycine soja]
Length=496

 Score =   209 bits (533),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 109/188 (58%), Positives = 128/188 (68%), Gaps = 22/188 (12%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MAL+LLYESASGY L  AHGLD+IG NTEAV NSV DLNRFG+  +     P        
Sbjct  1    MALFLLYESASGYALLEAHGLDDIGHNTEAVCNSVSDLNRFGQGCQAPLLQPLHL-----  55

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
                     +    L N + LTL          +   +++PK+G  I E  KIPCQSNEF
Sbjct  56   -------RSRRPQTLINLVSLTL----------YIFCVSDPKIGCQISELPKIPCQSNEF  98

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
              ELLRGVRLHF++F+ +LK+ DLEKAQLGLGHSYSRAKVKFNVNR DN+VIQAIFLLDT
Sbjct  99   DSELLRGVRLHFDRFVSDLKSRDLEKAQLGLGHSYSRAKVKFNVNRADNIVIQAIFLLDT  158

Query  637  LDKDVNTF  660
            LDKD+N+F
Sbjct  159  LDKDINSF  166



>ref|XP_007309335.1| Nop-domain-containing protein [Stereum hirsutum FP-91666 SS1]
 gb|EIM81508.1| Nop-domain-containing protein [Stereum hirsutum FP-91666 SS1]
Length=526

 Score =   210 bits (534),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 104/188 (55%), Positives = 137/188 (73%), Gaps = 2/188 (1%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MA ++L+ESASGY +F     D++G  T+AV++S+ DL RFGK+V LV+F PF+SA  AL
Sbjct  1    MASHILFESASGYAIFEVKLKDDVGAMTKAVQDSIADLARFGKMVSLVSFAPFKSAAHAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
               N +SEG + ++L++ LEL L   K SKK+   LG++EP L S I     IPC ++E 
Sbjct  61   ENANDISEGTVNEDLKSLLELNL--SKPSKKSTIVLGVSEPILASSIKAAVNIPCDTSES  118

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
              ELLRG+RLH  K ++ L+A D+ KAQLGLGHSYSR+K+KFNVNR+DNM+IQAI LLD 
Sbjct  119  TAELLRGIRLHAAKLLKGLEANDITKAQLGLGHSYSRSKLKFNVNRIDNMIIQAIALLDQ  178

Query  637  LDKDVNTF  660
            LDKDVN F
Sbjct  179  LDKDVNLF  186



>ref|XP_008879803.1| hypothetical protein H310_13917 [Aphanomyces invadans]
 gb|ETV91535.1| hypothetical protein H310_13917 [Aphanomyces invadans]
Length=517

 Score =   210 bits (534),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 107/188 (57%), Positives = 133/188 (71%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            M  ++L+ESASGY LF     ++I    + V+  V+DL++FG  VKL AF+PF SA  AL
Sbjct  35   MTSFVLFESASGYALFEVVEAEQIAVLLDQVQQGVQDLSKFGAAVKLKAFSPFVSAESAL  94

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
               NA+SEG +TD+L+ FLEL LPK K SK A F+LG+++  L   I +   +   +NE 
Sbjct  95   ENINAISEGLLTDDLQAFLELNLPKAKKSKSAAFTLGVSDKGLAQAITDALHLSVNTNET  154

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
             LE+LRGVRLHF KFI+ L  G   KAQLGLGHSYSRAKVKFNVNR DNM+IQAI LLD 
Sbjct  155  TLEVLRGVRLHFAKFIKELDNGVWSKAQLGLGHSYSRAKVKFNVNRADNMIIQAIALLDQ  214

Query  637  LDKDVNTF  660
            LDKD+NTF
Sbjct  215  LDKDINTF  222



>ref|XP_007341452.1| Nop-domain-containing protein [Auricularia delicata TFB-10046 
SS5]
 gb|EJD50556.1| Nop-domain-containing protein [Auricularia delicata TFB-10046 
SS5]
Length=517

 Score =   209 bits (532),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 107/188 (57%), Positives = 137/188 (73%), Gaps = 2/188 (1%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MA ++L+ESA GY LF     +EIG  T+AV+ S++DL++FGKVV+LV+F PF+SA  AL
Sbjct  1    MATHILFESAGGYALFEVKQHEEIGAKTKAVQESLEDLHKFGKVVQLVSFAPFKSAAHAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
               N VSEG + D L++ LEL L K   +KK+   LG+ +P L + I     + C ++E 
Sbjct  61   ENANDVSEGVLNDHLKSLLELNLSK--GTKKSSPKLGVTDPGLAASIKAGLNVDCDTSER  118

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
             LEL+RGVRLH  K ++ L+ GD+EKAQLGLGHSYSRAKVKFNVNR DNM+IQAI LLD 
Sbjct  119  SLELIRGVRLHAGKLLKGLQEGDVEKAQLGLGHSYSRAKVKFNVNRTDNMIIQAIALLDQ  178

Query  637  LDKDVNTF  660
            LDKDVNTF
Sbjct  179  LDKDVNTF  186



>ref|XP_009497331.1| hypothetical protein H696_05198 [Fonticula alba]
 gb|KCV68277.1| hypothetical protein H696_05198 [Fonticula alba]
Length=496

 Score =   209 bits (531),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 103/188 (55%), Positives = 135/188 (72%), Gaps = 5/188 (3%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            M+L+LL+ESASGY LF     +EIGQ  E+V+ +++DL++ GKV+KL +F PF+SA  AL
Sbjct  1    MSLFLLFESASGYALFERTASEEIGQELESVQTAMQDLSKAGKVLKLKSFAPFQSAAHAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
               N ++EG + D L+NFL   L K K     K  LG+ E +LG  I + T I C  ++ 
Sbjct  61   ENINDITEGIVNDYLKNFLTANLAKSK-----KVKLGVQEARLGGAISDATGISCDVSDV  115

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
              ELLRG+R+HFEK I+  + GDLEKAQLGLGH+YSRAK+KFN+NR DNM+IQAI LLD 
Sbjct  116  TTELLRGIRMHFEKLIKQFREGDLEKAQLGLGHAYSRAKLKFNINRSDNMIIQAISLLDQ  175

Query  637  LDKDVNTF  660
            LDKD+NTF
Sbjct  176  LDKDLNTF  183



>emb|CDH49232.1| nucleolar protein nop56 [Lichtheimia corymbifera JMRC:FSU:9682]
Length=500

 Score =   209 bits (531),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 109/188 (58%), Positives = 132/188 (70%), Gaps = 2/188 (1%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MA Y+L+E+ASGY LF     +EIG   E V+++V DL +FGK+VKL +F PF+SA DAL
Sbjct  1    MANYILFETASGYALFERVQSEEIGAKLEQVQSTVTDLAKFGKMVKLKSFAPFKSAADAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
               N VSEG +   L+ FLE+ LPK    KK K  LG++E  L   I  E  + C ++E 
Sbjct  61   ENANDVSEGIVNPSLKAFLEMNLPKA--GKKNKIQLGVSERNLAGAIKGEIGVECTTDEL  118

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            V EL+RG+RL  EK +  LK GDL KAQLGLGHSYSRAKVKFNVNR DNM+IQAI LLD 
Sbjct  119  VQELIRGIRLWSEKLLSQLKEGDLGKAQLGLGHSYSRAKVKFNVNRSDNMIIQAIALLDQ  178

Query  637  LDKDVNTF  660
            LDKDVNTF
Sbjct  179  LDKDVNTF  186



>emb|CCI44577.1| unnamed protein product [Albugo candida]
Length=507

 Score =   209 bits (531),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 100/184 (54%), Positives = 132/184 (72%), Gaps = 0/184 (0%)
 Frame = +1

Query  109  LLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDALNQCN  288
            +L+ESASGY LF     +E+G     V+ SV DL  FG+++KL AF PF+S  +AL   N
Sbjct  7    VLFESASGYALFQVVEHEEVGVLLNEVQESVTDLASFGRIMKLKAFQPFKSGENALENIN  66

Query  289  AVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEFVLEL  468
            ++SEG + ++L+NFLE+ LP    SKKAKFSLG+ +  L   + +E  +PC SNE   E+
Sbjct  67   SISEGLICEDLKNFLEMNLPSKGKSKKAKFSLGIQDKNLAQSVSDELNVPCNSNETTQEI  126

Query  469  LRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDTLDKD  648
            +RG+R HF K ++ L  G+L KAQLGLGHSYSRAKVKFNVNR DNM+IQ+I LLD +DKD
Sbjct  127  VRGIRYHFCKMVKGLDHGNLSKAQLGLGHSYSRAKVKFNVNRADNMIIQSIALLDQMDKD  186

Query  649  VNTF  660
            +NTF
Sbjct  187  INTF  190



>gb|KDN52102.1| Nop-domain-containing protein [Tilletiaria anomala UBC 951]
Length=546

 Score =   209 bits (532),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 103/185 (56%), Positives = 133/185 (72%), Gaps = 5/185 (3%)
 Frame = +1

Query  106  YLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDALNQC  285
            ++L+ESA+G  +F    ++EIG  T AV+ S+KDLN+FGK+V+LV+F+PF+SA+DAL  C
Sbjct  7    HILFESATGCAIFKCVQVEEIGNKTPAVQESIKDLNKFGKMVQLVSFSPFKSAVDALQTC  66

Query  286  NAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEFVLE  465
              +SEG M D L+  + L L K K        LG++E  L   I  ET I C + E  LE
Sbjct  67   LDISEGVMNDHLKQLITLNLQKSKS-----ILLGVSERGLAGSIMSETGITCDTGERTLE  121

Query  466  LLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDTLDK  645
            L+RG+RLH EK ++ L  GD+ KAQLGLGHSYSR+KVKFNVNR DNM+IQAI L+DTLDK
Sbjct  122  LIRGIRLHSEKLLKGLSEGDMAKAQLGLGHSYSRSKVKFNVNRSDNMIIQAIALVDTLDK  181

Query  646  DVNTF  660
            DVNTF
Sbjct  182  DVNTF  186



>emb|CDS07170.1| hypothetical protein LRAMOSA09693 [Absidia idahoensis var. thermophila]
Length=500

 Score =   208 bits (529),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 109/188 (58%), Positives = 131/188 (70%), Gaps = 2/188 (1%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MA Y+L+E+ASGY LF     +EIG   E V+ +V DL +FGK+VKL +F PF+SA DAL
Sbjct  1    MANYILFETASGYALFERVQSEEIGAKLEQVQATVTDLAKFGKMVKLKSFAPFKSAADAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
               N VSEG +   L+ FLE+ LPK    KK K  LG++E  L   I  E  + C ++E 
Sbjct  61   ENANDVSEGIVNPSLKAFLEMNLPKA--GKKNKIQLGVSERNLAGAIKGEIGVDCTTDEL  118

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            V EL+RG+RL  EK +  LK GDL KAQLGLGHSYSRAKVKFNVNR DNM+IQAI LLD 
Sbjct  119  VQELIRGIRLWSEKLLSQLKEGDLGKAQLGLGHSYSRAKVKFNVNRSDNMIIQAIALLDQ  178

Query  637  LDKDVNTF  660
            LDKDVNTF
Sbjct  179  LDKDVNTF  186



>gb|EIE81578.1| hypothetical protein RO3G_06283 [Rhizopus delemar RA 99-880]
Length=492

 Score =   207 bits (526),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 107/188 (57%), Positives = 131/188 (70%), Gaps = 2/188 (1%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            M  ++L+E+ASGY LF     +EIG   E+V+NS+ DL +F K++KL +F PF++A DAL
Sbjct  1    MVNFVLFETASGYALFERLQSEEIGSKLESVQNSIADLPKFSKMLKLKSFAPFKNAADAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
               N VSEG +   L+ FLE+ LPK    KK K  LG+ E  L   I  E  + C S+E 
Sbjct  61   ENANDVSEGIVNASLKAFLEMNLPK--SGKKNKVVLGVGEKNLAGAIKAELSVECASDEM  118

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            V EL+RG+RL  EK +  LK GDLEKAQLGLGHSYSRAKVKFNVNR DNM+IQAI LLD 
Sbjct  119  VQELVRGIRLWAEKLLSQLKTGDLEKAQLGLGHSYSRAKVKFNVNRADNMIIQAIALLDQ  178

Query  637  LDKDVNTF  660
            LDKDVNTF
Sbjct  179  LDKDVNTF  186



>ref|NP_595368.1| U3 snoRNP protein Nop56 (predicted) [Schizosaccharomyces pombe 
972h-]
 sp|O94514.1|NOP56_SCHPO RecName: Full=Nucleolar protein 56; AltName: Full=Ribosome biosynthesis 
protein sik1 [Schizosaccharomyces pombe 972h-]
 emb|CAA22814.1| U3 snoRNP protein Nop56 (predicted) [Schizosaccharomyces pombe]
Length=497

 Score =   207 bits (526),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 106/189 (56%), Positives = 136/189 (72%), Gaps = 3/189 (2%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MA YLLYESA+GY LF   G D+I   T+ V+ S++D+++FGKVV+L +F PF++A  AL
Sbjct  1    MADYLLYESATGYSLFDVVGADQIAAKTKEVQLSLQDISKFGKVVQLRSFIPFKNAAHAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETK-IPCQSNE  453
               N +SEG + D L+NFLEL LPK   SKK K SLG+ +  L + I  E   I C ++E
Sbjct  61   ENANDISEGVLNDFLKNFLELNLPKA--SKKKKVSLGVQDKNLATSIKSEIDAIECDTSE  118

Query  454  FVLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLD  633
               +LLRG+R H +K ++ L  GD E+AQLGLGHSYSRAKVKFNVNR DNM+IQAI +LD
Sbjct  119  LTQDLLRGIRFHGDKLLKQLSPGDFERAQLGLGHSYSRAKVKFNVNRNDNMIIQAIAILD  178

Query  634  TLDKDVNTF  660
             LDKD+NTF
Sbjct  179  QLDKDINTF  187



>emb|CEG71269.1| Putative ZYBA0S10-02674g1_1 [Rhizopus microsporus]
Length=494

 Score =   207 bits (526),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 107/188 (57%), Positives = 130/188 (69%), Gaps = 2/188 (1%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            M  Y+L+E+ASGY LF     +EIG   E+V+ S+ DL +F K+VKL +F PF++A DAL
Sbjct  1    MVNYVLFETASGYALFERLQSEEIGSKLESVQKSILDLPKFSKMVKLKSFAPFKNAADAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
               N VSEG +   L+ FLE+ LPK    KK K  LG+AE  L   I  E  + C S+E 
Sbjct  61   ENANDVSEGIVNPSLKAFLEINLPKA--GKKNKVVLGVAEKNLAGAIKAEVNVECASDEL  118

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            V EL+RG+R   EK +  LK GDLEKAQLGLGHSYSRAKVKFNVNR DNM+IQAI LLD 
Sbjct  119  VQELVRGIRFWSEKLLSQLKTGDLEKAQLGLGHSYSRAKVKFNVNRADNMIIQAIALLDQ  178

Query  637  LDKDVNTF  660
            LDKD+NTF
Sbjct  179  LDKDINTF  186



>emb|CEI88167.1| Putative Ribosome biosynthesis protein SIK1 [Rhizopus microsporus]
Length=494

 Score =   207 bits (526),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 107/188 (57%), Positives = 130/188 (69%), Gaps = 2/188 (1%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            M  Y+L+E+ASGY LF     +EIG   E+V+ S+ DL +F K+VKL +F PF++A DAL
Sbjct  1    MVNYVLFETASGYALFERLQSEEIGSKLESVQKSILDLPKFSKMVKLKSFAPFKNAADAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
               N VSEG +   L+ FLE+ LPK    KK K  LG+AE  L   I  E  + C S+E 
Sbjct  61   ENANDVSEGIVNPSLKAFLEINLPKA--GKKNKVVLGVAEKNLAGAIKAEVNVECASDEL  118

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            V EL+RG+R   EK +  LK GDLEKAQLGLGHSYSRAKVKFNVNR DNM+IQAI LLD 
Sbjct  119  VQELVRGIRFWSEKLLSQLKTGDLEKAQLGLGHSYSRAKVKFNVNRADNMIIQAIALLDQ  178

Query  637  LDKDVNTF  660
            LDKD+NTF
Sbjct  179  LDKDINTF  186



>emb|CBK24887.2| unnamed protein product [Blastocystis hominis]
Length=492

 Score =   206 bits (525),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 101/189 (53%), Positives = 132/189 (70%), Gaps = 0/189 (0%)
 Frame = +1

Query  94   GMALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDA  273
            G   Y+L+E+ASGY L+     +EI   T+ V+ S+ D + F  +VKL AF PFESA DA
Sbjct  3    GKTTYILFEAASGYSLYEVVEKEEIASLTKQVQESLNDFSNFSNLVKLKAFVPFESAEDA  62

Query  274  LNQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNE  453
            L  CN +SEG +++ L+ FLE+ +P VK  K +  +LG+ + K+G  I EE KIPC +N+
Sbjct  63   LENCNNISEGVLSNTLKLFLEVNIPSVKKLKDSTITLGVIDAKIGQAIQEELKIPCMTND  122

Query  454  FVLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLD  633
             V EL RG+R H+ KF+ +L  G  EKA LGLGHSYSRA VKFNVNR DNM+IQAI LLD
Sbjct  123  VVAELCRGIRQHYSKFVTSLSNGAAEKAMLGLGHSYSRAHVKFNVNREDNMIIQAICLLD  182

Query  634  TLDKDVNTF  660
             +DKD+NTF
Sbjct  183  QIDKDLNTF  191



>emb|CEL62497.1| Nucleolar protein 56 OS=Schizosaccharomyces pombe (strain 972 
/ ATCC 24843) GN=nop56 PE=3 SV=1 [Rhizoctonia solani AG-1 IB]
Length=554

 Score =   207 bits (528),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 108/187 (58%), Positives = 134/187 (72%), Gaps = 2/187 (1%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            M  ++L+ESASGYGLF     + IG  T+ V++S++DL++FGK+V+L +F PF+SA  AL
Sbjct  1    MVTHVLFESASGYGLFSVKQQEVIGSKTKEVQDSIQDLHKFGKMVELKSFMPFKSAAHAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
               N VSEG   D L+N LEL LPK   SKKA   LG++E  L   I     I C ++E 
Sbjct  61   ENINDVSEGVCNDYLKNMLELNLPK--HSKKAPVVLGVSEKNLAGSIVATLSIECDTSEK  118

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
             LEL+RGVRLH EK ++ L+ GD+ KAQLGLGHSYSRAKVKFNVNR DNM+IQAI LLD 
Sbjct  119  SLELIRGVRLHAEKLLKGLETGDVSKAQLGLGHSYSRAKVKFNVNRSDNMIIQAIALLDQ  178

Query  637  LDKDVNT  657
            LDKDVNT
Sbjct  179  LDKDVNT  185



>emb|CBK24248.2| unnamed protein product [Blastocystis hominis]
Length=520

 Score =   207 bits (526),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 101/190 (53%), Positives = 133/190 (70%), Gaps = 0/190 (0%)
 Frame = +1

Query  91   VGMALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALD  270
            +G   Y+L+E+ASGY L+     +EI   T+ V+ S+ D + F  +VKL AF PFESA D
Sbjct  28   MGKTTYILFEAASGYSLYEVVEKEEIASLTKQVQESLSDFSNFSNLVKLKAFVPFESAED  87

Query  271  ALNQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSN  450
            AL  CN +SEG +++ L+ FLE+ +P VK  K +  +LG+ + K+G  I EE KIPC +N
Sbjct  88   ALENCNNISEGVLSNTLKLFLEVNIPSVKKLKDSTITLGVIDAKIGQAIQEELKIPCMTN  147

Query  451  EFVLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLL  630
            + V EL RG+R H+ KF+ +L  G  EKA LGLGHSYSRA VKFNVNR DNM+IQAI LL
Sbjct  148  DVVAELCRGIRQHYSKFVTSLSNGAAEKAMLGLGHSYSRAHVKFNVNREDNMIIQAICLL  207

Query  631  DTLDKDVNTF  660
            D +DKD+NTF
Sbjct  208  DQIDKDLNTF  217



>gb|EMS45652.1| hypothetical protein TRIUR3_03792 [Triticum urartu]
Length=469

 Score =   206 bits (523),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 97/118 (82%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = +1

Query  307  MTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEFVLELLRGVRL  486
            MTDELRNFLEL LPKVK+ KKAKF++G+ EPK+GSHI E T IPCQSN++V ELLR VRL
Sbjct  1    MTDELRNFLELNLPKVKEGKKAKFTVGVMEPKVGSHITEATGIPCQSNDYVQELLRAVRL  60

Query  487  HFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDTLDKDVNTF  660
            HF++FIE LK  DLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDTLDKDVN+F
Sbjct  61   HFDQFIEQLKPSDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDTLDKDVNSF  118



>emb|CCA15297.1| nucleolar protein Nop56 putative [Albugo laibachii Nc14]
Length=507

 Score =   206 bits (525),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/184 (54%), Positives = 131/184 (71%), Gaps = 0/184 (0%)
 Frame = +1

Query  109  LLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDALNQCN  288
            +L+ESASGY LF     +E+G     V+ SV D+  FG+++KL AF PF+S  +AL   N
Sbjct  7    VLFESASGYALFQVIEHEEVGVLLNEVQESVTDVASFGRLMKLKAFQPFKSGENALENIN  66

Query  289  AVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEFVLEL  468
            ++SEG M ++L+NFLE+ LP    SKKAKFSLG+ +  L   + +E  + C SNE   E+
Sbjct  67   SISEGLMCEDLKNFLEMNLPAKGKSKKAKFSLGIQDKNLAQSVSDELSVSCTSNETTHEI  126

Query  469  LRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDTLDKD  648
            +RG+R HF K ++ L  G+L KAQLGLGHSYSRAKVKFNVNR DNM+IQ+I LLD +DKD
Sbjct  127  VRGIRYHFSKMVKGLDHGNLSKAQLGLGHSYSRAKVKFNVNRADNMIIQSIALLDQMDKD  186

Query  649  VNTF  660
            +NTF
Sbjct  187  INTF  190



>ref|XP_009546043.1| hypothetical protein HETIRDRAFT_383737 [Heterobasidion irregulare 
TC 32-1]
 gb|ETW81393.1| hypothetical protein HETIRDRAFT_383737 [Heterobasidion irregulare 
TC 32-1]
Length=534

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 103/188 (55%), Positives = 140/188 (74%), Gaps = 2/188 (1%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MA ++L+ESASGY +F     +E+G  T+AV++S+KDL +FGK+V L++F+PF+SA  AL
Sbjct  1    MATHILFESASGYAIFEVKLKEEVGAMTKAVQDSIKDLAKFGKMVSLMSFSPFKSAGHAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
               N +SEG ++++L++ LEL L K   SKK+K  LG++EP LGS I    +I C ++E 
Sbjct  61   ENANDISEGIVSEDLKSLLELNLSK--PSKKSKVILGVSEPILGSSIKSALQISCDTSES  118

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
              +L+RG+RLH  K +  L+  DL KAQLGLGHSYSRAK+KFNVNR+DNM+IQAI LLD 
Sbjct  119  TADLIRGIRLHASKLLIGLQGDDLTKAQLGLGHSYSRAKLKFNVNRIDNMIIQAIALLDQ  178

Query  637  LDKDVNTF  660
            LDKDVN F
Sbjct  179  LDKDVNLF  186



>gb|ELU38997.1| small nuclear ribonucleoprotein [Rhizoctonia solani AG-1 IA]
Length=655

 Score =   208 bits (530),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 108/190 (57%), Positives = 136/190 (72%), Gaps = 2/190 (1%)
 Frame = +1

Query  88   PVGMALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESAL  267
            P+ M  ++L+ESASGYGLF     + IG  T+ V++S++DL++FGK+V+L +F PF+SA 
Sbjct  223  PLTMVTHILFESASGYGLFTVKQQEVIGAKTKEVQDSIQDLHKFGKMVELKSFMPFKSAA  282

Query  268  DALNQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQS  447
             AL   N VSEG   D L+N LEL LPK   SKK+   LG++E  L   I     I C +
Sbjct  283  HALENINDVSEGVCNDYLKNMLELNLPK--HSKKSPVILGVSEKNLAGSIVSTLSIECDT  340

Query  448  NEFVLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFL  627
            +E  LEL+RGVRLH EK ++ L+ GD+ KAQLGLGHSYSRAKVKFNVNR DNM+IQAI L
Sbjct  341  SEKSLELIRGVRLHAEKLLKGLETGDVSKAQLGLGHSYSRAKVKFNVNRSDNMIIQAIAL  400

Query  628  LDTLDKDVNT  657
            LD LDKDVNT
Sbjct  401  LDQLDKDVNT  410



>gb|EIE75754.1| hypothetical protein RO3G_00458 [Rhizopus delemar RA 99-880]
Length=495

 Score =   205 bits (522),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 105/188 (56%), Positives = 132/188 (70%), Gaps = 2/188 (1%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            M  ++L+E+ASGY LF     +EIG   E+V+NS+ DL +F K++KL +F PF++A DAL
Sbjct  1    MVNFVLFETASGYALFERLQSEEIGSKLESVQNSIADLPKFSKMLKLKSFAPFKNAADAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
               N +SEG +   L+ FLE+ LPK    KK K  LG+ E  L   +  E  + C S+E 
Sbjct  61   ENANDISEGIVNPSLKAFLEMNLPK--SGKKNKVVLGVGEKNLAGAVKAELNVECASDEM  118

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            V EL+RG+RL  EK +  LK+GDLEKAQLGLGHSYSRAKVKFNVNR DNM+IQAI LLD 
Sbjct  119  VQELVRGIRLWAEKLLGQLKSGDLEKAQLGLGHSYSRAKVKFNVNRADNMIIQAIALLDQ  178

Query  637  LDKDVNTF  660
            LDKDVNTF
Sbjct  179  LDKDVNTF  186



>ref|XP_001748935.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ86265.1| predicted protein [Monosiga brevicollis MX1]
Length=504

 Score =   205 bits (521),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 103/186 (55%), Positives = 133/186 (72%), Gaps = 0/186 (0%)
 Frame = +1

Query  103  LYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDALNQ  282
            L +LYE+A GY LF     ++IG   ++V+++V+DL +FGK+ KL A  PF +A DAL  
Sbjct  6    LVVLYEAAIGYALFDVAESEDIGIQLDSVQDAVQDLGKFGKICKLKAIMPFRTAQDALEN  65

Query  283  CNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEFVL  462
             N VSEG M + L++FLE  LPK    KK+K +LG+++ KLG  I EE  I C     V 
Sbjct  66   INMVSEGMMPELLKDFLETHLPKAASVKKSKVTLGVSDYKLGQAIAEEVHIKCDHTGVVP  125

Query  463  ELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDTLD  642
            EL+RG+R+HF K  ++LK   +EKAQLGLGHSYSRAKVKFNV+RVDNM+IQAI LLD LD
Sbjct  126  ELIRGIRMHFSKMHKSLKDTLVEKAQLGLGHSYSRAKVKFNVHRVDNMIIQAISLLDQLD  185

Query  643  KDVNTF  660
            KD+NTF
Sbjct  186  KDINTF  191



>gb|KEP47080.1| small nuclear ribonucleoprotein [Rhizoctonia solani 123E]
Length=549

 Score =   206 bits (523),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 107/187 (57%), Positives = 134/187 (72%), Gaps = 2/187 (1%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            M  ++L+ESASGYGLF     + IG  T+ V++S++DL++FGK+V+L +F PF+SA  AL
Sbjct  1    MVTHVLFESASGYGLFTVKQQEVIGAKTKEVQDSIQDLHKFGKMVELKSFMPFKSAAHAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
               N VSEG   D L+N LEL LPK   SKK+   LG++E  L   I     I C ++E 
Sbjct  61   ENINDVSEGICNDYLKNMLELNLPK--HSKKSPVVLGVSEKNLAGSIVAALSIECDTSEK  118

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
             LEL+RGVRLH EK ++ L+ GD+ KAQLGLGHSYSRAKVKFNVNR DNM+IQAI LLD 
Sbjct  119  SLELIRGVRLHAEKLLKGLETGDVSKAQLGLGHSYSRAKVKFNVNRSDNMIIQAIALLDQ  178

Query  637  LDKDVNT  657
            LDKDVNT
Sbjct  179  LDKDVNT  185



>gb|KIO20691.1| hypothetical protein M407DRAFT_81283 [Tulasnella calospora MUT 
4182]
Length=476

 Score =   203 bits (517),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 102/188 (54%), Positives = 138/188 (73%), Gaps = 2/188 (1%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MA ++L+ESASG  +F+   ++EIG  T+ V+ S++DL++F ++V L +F+PF+SA DAL
Sbjct  1    MATHILFESASGLAVFNVVQVEEIGAKTKEVQESIQDLSKFSRMVSLKSFSPFKSAADAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
               N +SEG + D L+  LEL L     SKK+K  LG+++  L + I  E  I C ++E 
Sbjct  61   QNINDISEGVVNDTLKGLLELNLAST--SKKSKVVLGVSDRFLAAAISSELSISCDNSER  118

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
             LEL+RG+RLH EK ++ L+ GD++KAQLGLGHSYSRAKVKFNVNR DNM+IQAI LLD 
Sbjct  119  SLELIRGIRLHAEKLLKGLQEGDVKKAQLGLGHSYSRAKVKFNVNRSDNMIIQAIALLDQ  178

Query  637  LDKDVNTF  660
            LDKDVNTF
Sbjct  179  LDKDVNTF  186



>gb|EPY54298.1| U3 snoRNP protein Nop56 [Schizosaccharomyces cryophilus OY26]
Length=502

 Score =   203 bits (517),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 106/189 (56%), Positives = 136/189 (72%), Gaps = 3/189 (2%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            M  YLLYESA+GY LF   G +E+   T+ V+ S++DL++FGKVV+L +F PF++A  AL
Sbjct  1    MVDYLLYESATGYSLFDVVGAEEVAGKTKEVQLSLQDLSKFGKVVQLRSFIPFKNAAHAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETK-IPCQSNE  453
               N VSEG M + L++FLEL LPK   SKK K SLG+ +  L S +  E + I C ++E
Sbjct  61   ENANDVSEGVMNEYLKSFLELNLPKA--SKKKKISLGVQDKNLASSVKSEFEGIECDTSE  118

Query  454  FVLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLD  633
               +LLRG+R H +K ++ L  GD E+AQLGLGHSYSRAKVKFNVNR DNM+IQAI +LD
Sbjct  119  LAQDLLRGIRYHGDKMLKQLSPGDFERAQLGLGHSYSRAKVKFNVNRNDNMIIQAIAILD  178

Query  634  TLDKDVNTF  660
             LDKDVNTF
Sbjct  179  QLDKDVNTF  187



>gb|EPX74338.1| U3 snoRNP protein Nop56 [Schizosaccharomyces octosporus yFS286]
Length=503

 Score =   203 bits (517),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 106/189 (56%), Positives = 136/189 (72%), Gaps = 3/189 (2%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            M  YLLYESA+GY LF   G +E+   T+ V+ S++DL++FGKVV+L +F PF++A  AL
Sbjct  1    MVDYLLYESATGYSLFDVVGAEEVAGKTKEVQLSLQDLSKFGKVVQLRSFVPFKNAAHAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETK-IPCQSNE  453
               N VSEG M + L+ FLEL LPK   SKK K SLG+ +  L S I  E + I C +++
Sbjct  61   ENANDVSEGVMNEYLKGFLELNLPKA--SKKKKISLGVQDKNLASSIKGELEGIECDTSD  118

Query  454  FVLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLD  633
               +LLRG+R H +K ++ L AGD E+AQLGLGHSYSRAKVKFNVNR DNM+IQAI +LD
Sbjct  119  LAQDLLRGIRYHGDKMLKQLSAGDFERAQLGLGHSYSRAKVKFNVNRNDNMIIQAIAILD  178

Query  634  TLDKDVNTF  660
             LDKD+NTF
Sbjct  179  QLDKDINTF  187



>gb|EUC60229.1| small nuclear ribonucleoprotein [Rhizoctonia solani AG-3 Rhs1AP]
Length=549

 Score =   204 bits (518),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 106/187 (57%), Positives = 134/187 (72%), Gaps = 2/187 (1%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            M  ++L+ESASGYGLF     + IG  T+ V++S++DL++FGK+V+L +F PF+SA  AL
Sbjct  1    MVTHVLFESASGYGLFTVKQQEVIGAKTKEVQDSIQDLHKFGKMVELKSFMPFKSAAHAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
               N VSEG   + L+N LEL LPK   SKK+   LG++E  L   I     I C ++E 
Sbjct  61   ENINDVSEGICNEYLKNMLELNLPK--HSKKSPVVLGVSEKNLAGSIVAALSIECDTSEK  118

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
             LEL+RGVRLH EK ++ L+ GD+ KAQLGLGHSYSRAKVKFNVNR DNM+IQAI LLD 
Sbjct  119  SLELIRGVRLHAEKLLKGLETGDVSKAQLGLGHSYSRAKVKFNVNRSDNMIIQAIALLDQ  178

Query  637  LDKDVNT  657
            LDKDVNT
Sbjct  179  LDKDVNT  185



>gb|KDQ15155.1| hypothetical protein BOTBODRAFT_145382 [Botryobasidium botryosum 
FD-172 SS1]
Length=475

 Score =   201 bits (512),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 102/188 (54%), Positives = 133/188 (71%), Gaps = 2/188 (1%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            M  + L+ESASGY +F     +EIG  T+ V+ S++DL++FGK+V+L +F PF+SA  AL
Sbjct  1    MLTHALFESASGYAIFEVKQHEEIGAKTKHVQESIQDLHKFGKMVQLKSFAPFKSAAHAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
               N VSEG + D L+  LEL L   K +KK+   LG++E  L   I    +I C ++E 
Sbjct  61   ENANDVSEGVLNDHLKALLELNL--AKSAKKSPIVLGISEKNLAGSISSALEIQCDTSET  118

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
             LE++RG+RLH EK ++ L+ GD+ KAQLGLGHSYSRAKVKFNVNR DNM+IQAI LLD 
Sbjct  119  ALEIIRGIRLHAEKLLKGLQEGDVMKAQLGLGHSYSRAKVKFNVNRSDNMIIQAIALLDQ  178

Query  637  LDKDVNTF  660
            LDKDVNTF
Sbjct  179  LDKDVNTF  186



>ref|XP_005998724.1| PREDICTED: nucleolar protein 56 [Latimeria chalumnae]
Length=473

 Score =   201 bits (512),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 102/191 (53%), Positives = 131/191 (69%), Gaps = 2/191 (1%)
 Frame = +1

Query  88   PVGMALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESAL  267
            P  + L +LYE A+GY LF    ++EIG     V +S+ ++ +F  +VKLVAF+PF+SA 
Sbjct  23   PPMVVLRVLYEHAAGYALFAVKEVEEIGMLLPQVEDSMLNIGKFNTIVKLVAFSPFKSAQ  82

Query  268  DALNQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQS  447
             AL   NAVSEG + ++LR  LE  LP    SKK K  LG+ +PK+G+ I EE   PCQ+
Sbjct  83   SALENINAVSEGILHEDLRLLLETNLPA--PSKKKKSVLGVGDPKIGAAIQEELGFPCQT  140

Query  448  NEFVLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFL  627
               V E++RG+RLHF   ++ L A    KAQLGLGHSYSRAKVKFNVNR DNM+IQ+I L
Sbjct  141  GGVVTEIIRGIRLHFHTLVKGLTAQSASKAQLGLGHSYSRAKVKFNVNRADNMIIQSISL  200

Query  628  LDTLDKDVNTF  660
            LD LDKD+NTF
Sbjct  201  LDQLDKDINTF  211



>ref|XP_002173583.1| U3 snoRNP protein Nop56 [Schizosaccharomyces japonicus yFS275]
 gb|EEB07290.1| U3 snoRNP protein Nop56 [Schizosaccharomyces japonicus yFS275]
Length=495

 Score =   202 bits (513),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 106/189 (56%), Positives = 131/189 (69%), Gaps = 3/189 (2%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            M  YLLYESA+GY LF   G DEI   T+ V+ S++DL++FGKVVKL +F PF++A  AL
Sbjct  1    MVDYLLYESATGYSLFDVLGADEIASKTKEVQKSLQDLSKFGKVVKLRSFIPFKNAAHAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETK-IPCQSNE  453
               N +SEG M D L+NFLE+ LPK   SKK    LG+ +  L   I      + C S+E
Sbjct  61   ENANDISEGVMNDFLKNFLEMNLPKA--SKKNSVKLGVQDKNLAVSIKGGVDGLDCDSSE  118

Query  454  FVLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLD  633
               +LLRGVR H +K ++ L  GD E+AQLGLGHSYSRAKVKFNVNR DNM+IQAI +LD
Sbjct  119  LTQDLLRGVRYHGDKLLKQLSPGDFERAQLGLGHSYSRAKVKFNVNRNDNMIIQAIAILD  178

Query  634  TLDKDVNTF  660
             LDKD+NTF
Sbjct  179  QLDKDINTF  187



>ref|XP_005706848.1| box C/D snoRNP component Nop56 [Galdieria sulphuraria]
 gb|EME30328.1| box C/D snoRNP component Nop56 [Galdieria sulphuraria]
Length=528

 Score =   202 bits (515),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 92/187 (49%), Positives = 137/187 (73%), Gaps = 0/187 (0%)
 Frame = +1

Query  100  ALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDALN  279
            +LY+LYESA+G+ LF+    + I  NTE  ++++ +  RF K+ KL+AF+PF +A  A +
Sbjct  4    SLYILYESAAGFSLFYVENFESIASNTEEFQDALSEFVRFSKLAKLIAFSPFTTAETAFD  63

Query  280  QCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEFV  459
              + +SE ++T  L NFL+  LPKVK+ KK K+ LG+ + KL + I E+ K+P  S+E +
Sbjct  64   NLSKLSEYEITANLSNFLDSNLPKVKEGKKPKYELGVFDHKLAAVIHEQLKLPATSSEKI  123

Query  460  LELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDTL  639
             E++R +RLHFE+F+++L+  D+ KAQLGL H+YSR+KVK+NVNR D MV+Q+I LLD L
Sbjct  124  TEIIRNIRLHFERFVDHLRTSDVIKAQLGLAHAYSRSKVKYNVNRADTMVVQSITLLDQL  183

Query  640  DKDVNTF  660
            DKD+NTF
Sbjct  184  DKDINTF  190



>ref|XP_009056335.1| hypothetical protein LOTGIDRAFT_119841, partial [Lottia gigantea]
 gb|ESO93136.1| hypothetical protein LOTGIDRAFT_119841, partial [Lottia gigantea]
Length=517

 Score =   201 bits (511),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 101/186 (54%), Positives = 131/186 (70%), Gaps = 2/186 (1%)
 Frame = +1

Query  103  LYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDALNQ  282
            LY+L+E ASGYGLF     +E+      V  SV D+++F  VVKLVAF+PF+S  +AL+ 
Sbjct  1    LYVLFEHASGYGLFRVREFEEVSMLLPQVEASVTDVSKFNSVVKLVAFSPFKSGTNALDN  60

Query  283  CNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEFVL  462
             N+VSEG + D+LR F+E  +PK   +KK K  LG+ + ++G+ I E+  + CQ    V 
Sbjct  61   MNSVSEGILHDDLRVFIETNVPK--STKKEKVILGVGDSRIGAAISEDLSVKCQQVGVVQ  118

Query  463  ELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDTLD  642
            ELLRG+R+HF K ++ L      KAQLGLGHSYSRAKVKFNVNRVDNM+IQ+I LLD LD
Sbjct  119  ELLRGIRVHFAKLVKGLTEKSAGKAQLGLGHSYSRAKVKFNVNRVDNMIIQSISLLDQLD  178

Query  643  KDVNTF  660
            KDVNTF
Sbjct  179  KDVNTF  184



>ref|XP_004993595.1| nucleolar protein 5A [Salpingoeca rosetta]
 gb|EGD74033.1| nucleolar protein 5A [Salpingoeca rosetta]
Length=518

 Score =   200 bits (509),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 102/188 (54%), Positives = 131/188 (70%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            M++ +LYESA G+ LF     +EIG +  +V+++V DL++FGKVVK  A  PF SA +AL
Sbjct  1    MSMTVLYESAVGFALFDVVETEEIGISLPSVQDAVNDLSKFGKVVKFKAIQPFRSAQEAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
               NAVSEG++ D L++FLE  + + +  KK+K  LG+A+ KLG  I +     C     
Sbjct  61   ESINAVSEGEVPDLLQDFLETNVLQAQSKKKSKMVLGVADSKLGQSIAQAVGCKCDHTGV  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            V ELLRG+RLHF K    L    L+KAQLGLGHSYSRAKVKFNV+RVDNM+IQAI LLD 
Sbjct  121  VPELLRGIRLHFTKLYPKLSEVGLDKAQLGLGHSYSRAKVKFNVHRVDNMIIQAIALLDQ  180

Query  637  LDKDVNTF  660
            LDKD+NTF
Sbjct  181  LDKDINTF  188



>ref|XP_001629178.1| predicted protein [Nematostella vectensis]
 gb|EDO37115.1| predicted protein [Nematostella vectensis]
Length=538

 Score =   201 bits (510),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 100/188 (53%), Positives = 134/188 (71%), Gaps = 2/188 (1%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            M L++LYE A+GY LF     +E+G     V+ +V DL  FGK+VKLVAF+PF+S  +AL
Sbjct  1    MVLFVLYEHAAGYALFKVIAQEEVGALLPEVQEAVGDLALFGKLVKLVAFSPFKSGTNAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            +  N +SEG + D+L+ F+E  +P  K  KK+K  LG+A+ K+G+ I E   I C S   
Sbjct  61   DNVNCISEGIIHDDLKAFVEANVPTGK--KKSKVLLGVADSKIGAAIQESLNICCDSGGV  118

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            +LE+LRG+R+HF+K I+ L      KAQLGLGHSYSRAKVKFN++RVDNM+IQ+I LLD 
Sbjct  119  ILEVLRGIRMHFDKMIKGLTGAMASKAQLGLGHSYSRAKVKFNIHRVDNMIIQSIALLDQ  178

Query  637  LDKDVNTF  660
            LDKD+NTF
Sbjct  179  LDKDINTF  186



>gb|KIJ55044.1| hypothetical protein M422DRAFT_152738 [Sphaerobolus stellatus 
SS14]
Length=516

 Score =   200 bits (508),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 101/189 (53%), Positives = 134/189 (71%), Gaps = 1/189 (1%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MA ++L+ES+SGY +F     +EIG  T+ V+ S+KDL  FGK+V+LV+F+PF+SA  AL
Sbjct  1    MATHILFESSSGYAIFETKNTEEIGAKTKGVQQSLKDLASFGKMVQLVSFSPFKSAAHAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPK-VKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNE  453
               N VSEG + + L+  LEL L K  K +K A   LG+++P L + I  E  I C ++E
Sbjct  61   ENANDVSEGVVHEHLKALLELNLSKPSKKNKVANVKLGVSDPPLATSIKRELGIECDTSE  120

Query  454  FVLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLD  633
              LEL+RG+RLH  K ++ ++  D+ KAQLGLGHSYSRAKVKFNVNR DNM+IQAI +LD
Sbjct  121  RSLELIRGIRLHASKLLKGMQEEDIAKAQLGLGHSYSRAKVKFNVNRTDNMIIQAIAMLD  180

Query  634  TLDKDVNTF  660
             LDKDVN F
Sbjct  181  QLDKDVNLF  189



>ref|XP_011299290.1| PREDICTED: nucleolar protein 56 [Fopius arisanus]
Length=506

 Score =   198 bits (504),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 98/186 (53%), Positives = 131/186 (70%), Gaps = 2/186 (1%)
 Frame = +1

Query  103  LYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDALNQ  282
            L++LYE A+GY +F     +EIG     V  SV DL+RF  +VKLV F+PF++AL AL  
Sbjct  4    LFILYEHAAGYAVFSVKEFEEIGMLLPQVEASVTDLSRFHAIVKLVGFSPFKTALAALES  63

Query  283  CNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEFVL  462
             N++SEG + ++L+ FL++ +PK    KK+K++LG+++PKLG+ I E   I C     V 
Sbjct  64   INSISEGIVPEDLKLFLDMCIPK--SEKKSKYTLGVSDPKLGASITEALNIKCDHTGAVP  121

Query  463  ELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDTLD  642
            E++RG+R HF   ++ L A     AQLGLGHSYSRAKVKFNVNRVDNM+IQ+I LLD LD
Sbjct  122  EIIRGIRFHFHHLVKGLTAQSSGVAQLGLGHSYSRAKVKFNVNRVDNMIIQSIALLDQLD  181

Query  643  KDVNTF  660
            KDVNTF
Sbjct  182  KDVNTF  187



>ref|XP_003726537.1| PREDICTED: nucleolar protein 56 [Strongylocentrotus purpuratus]
Length=513

 Score =   198 bits (503),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 98/188 (52%), Positives = 131/188 (70%), Gaps = 1/188 (1%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MA+ +LYE ASGYGLF     +E+      V+ SV D  +F  +VKL AF+PF+S ++AL
Sbjct  1    MAMMVLYEHASGYGLFAIKEFEEVSVLHHQVQESVTDFGKFASLVKLQAFSPFKSGINAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
               N++SEG MT++L+ F+E  +P+    KK K +LG+A+ K+G+ I EE  IPCQ+   
Sbjct  61   ENINSISEGVMTEDLKLFMETNMPE-SAKKKKKITLGVADSKIGASIQEELGIPCQTGGV  119

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
              E+ RG+R HF + ++ L A    KAQLGLGHSYSRAKVKFNVNR DNM+IQ+I LLD 
Sbjct  120  FQEIGRGLRYHFHRLVKGLTAQSEAKAQLGLGHSYSRAKVKFNVNRADNMIIQSICLLDQ  179

Query  637  LDKDVNTF  660
            LDKD+NTF
Sbjct  180  LDKDINTF  187



>dbj|GAC95110.1| hypothetical protein PHSY_002685 [Pseudozyma hubeiensis SY62]
Length=519

 Score =   197 bits (501),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 101/185 (55%), Positives = 130/185 (70%), Gaps = 3/185 (2%)
 Frame = +1

Query  106  YLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDALNQC  285
            ++L+ESA+G  +F    ++EIG  T AV+ SV ++N FGK+VKL++F+PF++ALDAL   
Sbjct  7    HILFESATGCAVFEVSAVEEIGSLTRAVQESVNEVNTFGKMVKLLSFSPFKNALDALQAS  66

Query  286  NAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEFVLE  465
              +SEG + D L++ L L L      KK    LG+ +  L S I  E  IPC + E  LE
Sbjct  67   LDISEGVVNDYLKSLLTLNL---SSGKKKSVVLGVQDRNLASSIVGELGIPCDTGETSLE  123

Query  466  LLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDTLDK  645
            L+RGVR H EK ++ +  GDL KAQLGLGHSYSR+KVKFNVNR DNM+IQAI LLDTLDK
Sbjct  124  LIRGVRQHAEKLLKGMADGDLAKAQLGLGHSYSRSKVKFNVNRSDNMIIQAIALLDTLDK  183

Query  646  DVNTF  660
            DVNTF
Sbjct  184  DVNTF  188



>ref|XP_001876795.1| predicted protein [Laccaria bicolor S238N-H82]
 gb|EDR12531.1| predicted protein [Laccaria bicolor S238N-H82]
Length=489

 Score =   196 bits (499),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 100/188 (53%), Positives = 135/188 (72%), Gaps = 2/188 (1%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            M  ++L+ES+SGY +F A   ++IG  + AV+ S+KDL +FGK+V L++F+PF+SA  AL
Sbjct  1    MVTHVLFESSSGYAIFEAKLTEDIGSRSSAVQESIKDLAKFGKMVSLMSFSPFKSAAQAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
               N VSEG M D L+N LEL L K   SKK++ +L +A+  LG  I E       ++E 
Sbjct  61   ENINDVSEGIMNDYLKNLLELNLSKT--SKKSRVTLAVADSLLGKSIKEVLGFNIDTSEK  118

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
              +L+RG+RLH +K ++ L+  DL+KAQLGLGHSYSRAK+KFNVNR+DNM+IQAI LLD 
Sbjct  119  AQDLIRGIRLHADKLLKGLQTDDLKKAQLGLGHSYSRAKLKFNVNRIDNMIIQAIALLDQ  178

Query  637  LDKDVNTF  660
            LDKDVN F
Sbjct  179  LDKDVNLF  186



>gb|KIK37982.1| hypothetical protein CY34DRAFT_809811 [Suillus luteus UH-Slu-Lm8-n1]
Length=541

 Score =   197 bits (501),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 101/188 (54%), Positives = 134/188 (71%), Gaps = 2/188 (1%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MA + L+ESASGY +F     + IG   ++V++S+ DL++FGK+V LV+F+PF++A DAL
Sbjct  1    MATHALFESASGYAIFDVKLHENIGSRVKSVQDSINDLSKFGKMVTLVSFSPFKNAADAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
               N +SEG ++D L++ LEL L K K  K +K  L ++E  L + IFE   I C ++E 
Sbjct  61   ENINDISEGILSDHLKSLLELNLSKPK--KGSKIVLAVSEVGLANSIFENLAIKCDASET  118

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
              E+LRG+R H  K ++ L A DL KAQLGLGHSYSRAK+KFNVNRVDNM+IQAI LLD 
Sbjct  119  SQEILRGIRFHAPKLLKGLDATDLIKAQLGLGHSYSRAKLKFNVNRVDNMIIQAIALLDQ  178

Query  637  LDKDVNTF  660
            LDKDVN F
Sbjct  179  LDKDVNLF  186



>ref|XP_002155156.2| PREDICTED: nucleolar protein 56-like [Hydra vulgaris]
Length=519

 Score =   197 bits (500),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 100/188 (53%), Positives = 134/188 (71%), Gaps = 2/188 (1%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            M LY+L+E A+GY +F     +++G     V+ +V DL RFG++VKLVAF+PF++A +AL
Sbjct  1    MVLYVLFEHAAGYAVFKVISSEDVGALLPEVQEAVLDLERFGRIVKLVAFSPFKTAANAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
               N++SEG + ++L+ FLE  LP  K  KK+K +LG+++ KLG+ I E   I C+    
Sbjct  61   ENINSISEGVVHEDLKTFLENNLPTGK--KKSKVALGISDAKLGAAIQESCNIFCEYGPA  118

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            V E+LRGVR HF KFI+ L A    KAQLGLGHSYSRAKVKFNV+R DNM+IQ I L+D 
Sbjct  119  VSEILRGVRYHFHKFIQGLTAETSGKAQLGLGHSYSRAKVKFNVHRADNMIIQTIALVDQ  178

Query  637  LDKDVNTF  660
            LDKD+NTF
Sbjct  179  LDKDINTF  186



>gb|KDQ62806.1| hypothetical protein JAAARDRAFT_149920 [Jaapia argillacea MUCL 
33604]
Length=541

 Score =   197 bits (501),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 101/188 (54%), Positives = 131/188 (70%), Gaps = 2/188 (1%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MA + L+E +SGY +F     +EIG  TEAV+ S+ D  +F K+V LV+F+PF+SA  AL
Sbjct  1    MATHALFEFSSGYAIFEVKLREEIGARTEAVQASIDDWAKFAKMVSLVSFSPFKSAAHAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
               N VSEG + D L + LEL L K   SK ++  L +++P+L S I E  KI C S++ 
Sbjct  61   ENINDVSEGILNDHLASLLELNLSK--PSKTSQIVLAVSDPQLASSIKESLKIACDSSKS  118

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
              E+LRG+RLH  K ++ L A D+ KAQLGLGHSYSRAK+KFNVNR+DNM+IQAI LLD 
Sbjct  119  AEEILRGIRLHAAKLLKGLSADDITKAQLGLGHSYSRAKLKFNVNRIDNMIIQAIALLDQ  178

Query  637  LDKDVNTF  660
            LDKDVN F
Sbjct  179  LDKDVNLF  186



>ref|XP_320984.4| AGAP002063-PA [Anopheles gambiae str. PEST]
 gb|EAA01114.5| AGAP002063-PA [Anopheles gambiae str. PEST]
Length=516

 Score =   196 bits (498),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 100/188 (53%), Positives = 129/188 (69%), Gaps = 2/188 (1%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MALY+LYE A+GYGLF     +EIG     V  S+ DL+RF  +VKLV F+PF++A+ AL
Sbjct  1    MALYVLYEHAAGYGLFSVKEFEEIGMLLPQVEASILDLSRFNAIVKLVGFHPFKTAVAAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            N  NA+SEG + D+L  FL+ TLPK   SKK + +LG+++ KLG+ I E  ++ C     
Sbjct  61   NNVNAISEGLVPDDLSGFLDTTLPK--SSKKKQVTLGVSDAKLGAAIAEALEVQCSHIGA  118

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            V E+LRG+R HF   ++         AQLGLGHSYSR KVKFNV+R DNM+IQ+I LLD 
Sbjct  119  VPEILRGIRFHFAGMVKGFTDQSAAVAQLGLGHSYSRCKVKFNVHRSDNMIIQSIALLDQ  178

Query  637  LDKDVNTF  660
            LDKDVNTF
Sbjct  179  LDKDVNTF  186



>gb|ELT94557.1| hypothetical protein CAPTEDRAFT_159443 [Capitella teleta]
Length=504

 Score =   196 bits (498),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 100/190 (53%), Positives = 129/190 (68%), Gaps = 2/190 (1%)
 Frame = +1

Query  91   VGMALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALD  270
            V  +LY+L+E ASG+ LF     +EIG     V +SV DL+RF  +V LVAF+PF+S  +
Sbjct  2    VAKSLYVLHEHASGFALFRVKEFEEIGMLLPEVESSVTDLSRFNSIVSLVAFSPFKSGTN  61

Query  271  ALNQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSN  450
            AL+  N++SEG + ++LR FLE   PK   SKK K +LG+ + KLGS I EE    C   
Sbjct  62   ALDNINSISEGILHEDLRVFLESNFPK--SSKKEKSTLGVGDSKLGSAISEEMGFSCLHT  119

Query  451  EFVLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLL  630
              V E++RG+R+HF K ++ L      KAQLGLGHSYSR KVKFNVNRVDNM+IQ+I LL
Sbjct  120  GVVPEIIRGIRMHFHKMVKGLTDLTASKAQLGLGHSYSRCKVKFNVNRVDNMIIQSICLL  179

Query  631  DTLDKDVNTF  660
            D LDKD+N F
Sbjct  180  DQLDKDINIF  189



>ref|XP_007270791.1| Nop-domain-containing protein [Fomitiporia mediterranea MF3/22]
 gb|EJC98906.1| Nop-domain-containing protein [Fomitiporia mediterranea MF3/22]
Length=557

 Score =   197 bits (500),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 99/188 (53%), Positives = 135/188 (72%), Gaps = 2/188 (1%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MA ++L+ESASGY +F     ++IG  T+AV+ S+ D+ +FGK+V L++F+PF++A  AL
Sbjct  1    MATHVLFESASGYAVFEVKQHEDIGAKTKAVQESIGDVAKFGKMVNLLSFSPFKTAAHAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
               N +SEG +++ L++ LEL L K   +KK+   LG++E  LGS I     I C ++E 
Sbjct  61   ENANDISEGILSEHLKSLLELVLSKA--AKKSSVKLGVSEAGLGSSIKAALGIDCDASER  118

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
              EL RG+RLH  K ++ ++A DL KAQLGLGHSYSRAKVKFNVNR+DNM+IQAI LLD 
Sbjct  119  SQELTRGIRLHAPKLLKGMQADDLTKAQLGLGHSYSRAKVKFNVNRMDNMIIQAIALLDQ  178

Query  637  LDKDVNTF  660
            LDKDVN F
Sbjct  179  LDKDVNLF  186



>gb|KIM54809.1| hypothetical protein SCLCIDRAFT_135991 [Scleroderma citrinum 
Foug A]
Length=543

 Score =   196 bits (499),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 101/188 (54%), Positives = 132/188 (70%), Gaps = 2/188 (1%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MA +LL+ESASGY +F     +E+G  T+AV++S+ DL +F K+V L++F+PF+SA DAL
Sbjct  1    MATHLLFESASGYAVFEVKLHEEVGSRTKAVQDSITDLAKFNKMVSLLSFSPFKSAADAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
               N +SEG + D L++ LEL L K K  K +K  LG+A+  L S I E     C +++ 
Sbjct  61   ENINDISEGILNDYLKSLLELNLAKTK--KTSKVKLGVADAALASSISEVMGFKCDASDE  118

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
              EL+RG+R H  K ++ L   DL KAQLGLGHSYSRAK+KFNVNRVDNM+IQAI LLD 
Sbjct  119  TQELIRGIRFHAPKLLKGLDDKDLVKAQLGLGHSYSRAKLKFNVNRVDNMIIQAIALLDQ  178

Query  637  LDKDVNTF  660
            LDKDVN F
Sbjct  179  LDKDVNLF  186



>ref|XP_007399862.1| hypothetical protein PHACADRAFT_128240 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EKM52081.1| hypothetical protein PHACADRAFT_128240 [Phanerochaete carnosa 
HHB-10118-sp]
Length=531

 Score =   196 bits (498),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 99/188 (53%), Positives = 133/188 (71%), Gaps = 2/188 (1%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            M  ++L+ESASGY +F     D +G +T+A+++S+ DL RFGK+V L++F P++SA  AL
Sbjct  1    MVSHVLFESASGYAIFEVKLQDALGSSTKALQDSIDDLARFGKMVNLLSFAPYKSAAHAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
               N +SEG + + L++ LEL L   K +KK+K  LG+ EP L S I       C ++E 
Sbjct  61   ENANDISEGILNEHLQSLLELNL--SKPNKKSKVVLGVWEPTLASSIKSTLSFDCNTDEV  118

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
              +L+RG+RLH  K ++ L+A DL KAQLGLGHSYSRAKVKFNVNR+DNM+IQAI LLD 
Sbjct  119  TKDLIRGIRLHAPKLLKGLQADDLIKAQLGLGHSYSRAKVKFNVNRIDNMIIQAIALLDQ  178

Query  637  LDKDVNTF  660
            LDKDVN F
Sbjct  179  LDKDVNLF  186



>ref|XP_007324081.1| hypothetical protein SERLADRAFT_358671 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EGN94000.1| hypothetical protein SERLA73DRAFT_97405 [Serpula lacrymans var. 
lacrymans S7.3]
 gb|EGO19360.1| hypothetical protein SERLADRAFT_358671 [Serpula lacrymans var. 
lacrymans S7.9]
Length=542

 Score =   196 bits (498),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 101/188 (54%), Positives = 135/188 (72%), Gaps = 2/188 (1%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            M  ++L+ESASGY +F A   + I    +AV++S+KDL++F K+V LV+F+PF+SA +AL
Sbjct  1    MVTHVLFESASGYAIFQAMLFENIAAQHKAVQDSIKDLSKFTKMVSLVSFSPFKSAAEAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
               N VSEG + + L++ LEL L K   SKK+   L ++EP L + I    KI C+ +E 
Sbjct  61   ENINDVSEGLLNEHLQSLLELNLSK--SSKKSPVLLAVSEPALANSINATLKIKCEVSEQ  118

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
             LEL+RG+RLH  K ++ L++ DL KAQLGLGHSYSRAK+KFNVNR DNM+IQAI LLD 
Sbjct  119  GLELIRGIRLHAPKLLKGLESNDLTKAQLGLGHSYSRAKLKFNVNRYDNMIIQAIALLDQ  178

Query  637  LDKDVNTF  660
            LDKDVN F
Sbjct  179  LDKDVNLF  186



>emb|CBQ71505.1| probable SIK1-involved in pre-rRNA processing [Sporisorium reilianum 
SRZ2]
Length=527

 Score =   196 bits (497),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 100/185 (54%), Positives = 129/185 (70%), Gaps = 3/185 (2%)
 Frame = +1

Query  106  YLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDALNQC  285
            ++L+E A+G  +F    ++EIG  T AV+ SV ++N FGK+VKL++F+PF++ALDAL   
Sbjct  7    HILFECATGCAVFEVAAVEEIGSLTRAVQQSVNEVNTFGKMVKLLSFSPFKNALDALQAS  66

Query  286  NAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEFVLE  465
              +SEG + D L++ L L L      KK    LG+ +  L S I  E  IPC + E  LE
Sbjct  67   LDISEGVVNDYLKSLLTLNL---SSGKKKSVVLGVQDRNLASSIVGELGIPCDTGETSLE  123

Query  466  LLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDTLDK  645
            L+RGVR H EK ++ +  GDL KAQLGLGHSYSR+KVKFNVNR DNM+IQAI LLDTLDK
Sbjct  124  LIRGVRQHAEKLLKGMADGDLAKAQLGLGHSYSRSKVKFNVNRSDNMIIQAIALLDTLDK  183

Query  646  DVNTF  660
            DVNTF
Sbjct  184  DVNTF  188



>gb|AAH97676.1| XNop56 protein, partial [Xenopus laevis]
Length=510

 Score =   195 bits (495),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 97/186 (52%), Positives = 132/186 (71%), Gaps = 4/186 (2%)
 Frame = +1

Query  103  LYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDALNQ  282
            L++L+E A+GY LF    ++E+G     V  ++ ++ +F  +VKL AF+PF+SA  AL  
Sbjct  4    LHVLFEHAAGYALFAVKEVEEVGLLIPQVEETLLNVGKFNNIVKLAAFSPFKSAQSALEN  63

Query  283  CNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEFVL  462
             NA+SEG + ++L+  LE  +P    +KK K  LG+A+ K+G+ I EE KIPCQ+   V+
Sbjct  64   VNAISEGVLHEDLKLLLETHMP----AKKKKALLGVADAKIGAAIQEELKIPCQTGGAVV  119

Query  463  ELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDTLD  642
            E+LRG+RLHF   ++ L A    KAQLGLGHSYSRAKVKFNVNRVDNM+IQ+I LLD LD
Sbjct  120  EILRGIRLHFHSLVKGLTAQSASKAQLGLGHSYSRAKVKFNVNRVDNMIIQSISLLDQLD  179

Query  643  KDVNTF  660
            KD+NTF
Sbjct  180  KDINTF  185



>emb|CDI56783.1| probable SIK1-involved in pre-rRNA processing, partial [Melanopsichium 
pennsylvanicum 4]
Length=461

 Score =   194 bits (492),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 99/185 (54%), Positives = 129/185 (70%), Gaps = 3/185 (2%)
 Frame = +1

Query  106  YLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDALNQC  285
            ++L+E A+G  +F    +++IG  T AV+ SV ++N FGK+VKL++F+PF++ALDAL   
Sbjct  7    HILFECATGCAVFEVAAVEQIGSLTRAVQESVNEVNTFGKMVKLLSFSPFKNALDALQAS  66

Query  286  NAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEFVLE  465
              +SEG + D L++ L L L      KK    LG+ +  L S I  E  IPC + E  LE
Sbjct  67   LDISEGVVNDYLKSLLTLNL---SSGKKKSIVLGVQDRNLASSIVGELGIPCDTGETSLE  123

Query  466  LLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDTLDK  645
            L+RGVR H EK ++ +  GDL KAQLGLGHSYSR+KVKFNVNR DNM+IQAI LLDTLDK
Sbjct  124  LIRGVRQHAEKLLKGMADGDLAKAQLGLGHSYSRSKVKFNVNRSDNMIIQAIALLDTLDK  183

Query  646  DVNTF  660
            DVNTF
Sbjct  184  DVNTF  188



>ref|XP_001603746.2| PREDICTED: nucleolar protein 56 [Nasonia vitripennis]
Length=499

 Score =   194 bits (494),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 99/186 (53%), Positives = 127/186 (68%), Gaps = 2/186 (1%)
 Frame = +1

Query  103  LYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDALNQ  282
            L++LYE A+GY LF     +E+G     V  SV DL+RF +VVKLV F+PF++AL AL  
Sbjct  4    LFVLYEHAAGYALFSVKEFEEVGMLLPQVEASVTDLSRFNQVVKLVGFSPFKTALTALEN  63

Query  283  CNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEFVL  462
             N++SEG + ++L+ FL+  +PK   SKK K  LG+ +PKLG+ I E   I C     V 
Sbjct  64   INSISEGVVPEDLQLFLDTNIPKA--SKKEKVVLGIGDPKLGASITEALNIKCDHTGAVP  121

Query  463  ELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDTLD  642
            E++RG+R HF   ++   A     AQLGLGHSYSRAKVKFNVNRVDNM+IQ+I LLD LD
Sbjct  122  EIIRGIRYHFHNLVKGFTAKSSGVAQLGLGHSYSRAKVKFNVNRVDNMIIQSIALLDQLD  181

Query  643  KDVNTF  660
            KDVNTF
Sbjct  182  KDVNTF  187



>gb|AAI06207.1| XNop56 protein [Xenopus laevis]
Length=529

 Score =   195 bits (496),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 97/186 (52%), Positives = 132/186 (71%), Gaps = 4/186 (2%)
 Frame = +1

Query  103  LYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDALNQ  282
            L++L+E A+GY LF    ++E+G     V  ++ ++ +F  +VKL AF+PF+SA  AL  
Sbjct  4    LHVLFEHAAGYALFAVKEVEEVGLLIPQVEETLLNVGKFNNIVKLAAFSPFKSAQSALEN  63

Query  283  CNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEFVL  462
             NA+SEG + ++L+  LE  +P    +KK K  LG+A+ K+G+ I EE KIPCQ+   V+
Sbjct  64   VNAISEGVLHEDLKLLLETHMP----AKKKKALLGVADAKIGAAIQEELKIPCQTGGAVV  119

Query  463  ELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDTLD  642
            E+LRG+RLHF   ++ L A    KAQLGLGHSYSRAKVKFNVNRVDNM+IQ+I LLD LD
Sbjct  120  EILRGIRLHFHSLVKGLTAQSASKAQLGLGHSYSRAKVKFNVNRVDNMIIQSISLLDQLD  179

Query  643  KDVNTF  660
            KD+NTF
Sbjct  180  KDINTF  185



>ref|XP_004332871.1| nucleolar protein Nop56, putative [Acanthamoeba castellanii str. 
Neff]
 gb|ELR10858.1| nucleolar protein Nop56, putative [Acanthamoeba castellanii str. 
Neff]
Length=517

 Score =   195 bits (495),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 102/187 (55%), Positives = 128/187 (68%), Gaps = 1/187 (1%)
 Frame = +1

Query  103  LYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDALNQ  282
            LY+LYESASGY LF     +EI   +  ++ S++D  RF ++VK  +F PF SA  AL  
Sbjct  11   LYVLYESASGYALFERIESEEIADESPELQRSIQDFGRFSRIVKFKSFVPFVSAESALEN  70

Query  283  CNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETK-IPCQSNEFV  459
             NA+SEG + D L+NFLEL LP     K  K  LG+ + KLG  I +  + + C  ++ V
Sbjct  71   VNAISEGLVHDVLKNFLELNLPGGGKKKSKKVELGVTDEKLGGAINDSLEHVACVKSKAV  130

Query  460  LELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDTL  639
             EL RG+RLHF KFI+  K GD EKAQLGLGHSYSR+KVKFNVNR DNM+IQ I LLDTL
Sbjct  131  AELTRGIRLHFAKFIKEFKEGDYEKAQLGLGHSYSRSKVKFNVNRADNMIIQTINLLDTL  190

Query  640  DKDVNTF  660
            +KD+NTF
Sbjct  191  NKDLNTF  197



>ref|NP_001082151.1| XNop56 protein [Xenopus laevis]
 emb|CAC44272.1| XNop56 protein [Xenopus laevis]
Length=532

 Score =   195 bits (496),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 97/186 (52%), Positives = 132/186 (71%), Gaps = 4/186 (2%)
 Frame = +1

Query  103  LYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDALNQ  282
            L++L+E A+GY LF    ++E+G     V  ++ ++ +F  +VKL AF+PF+SA  AL  
Sbjct  4    LHVLFEHAAGYALFAVKEVEEVGLLIPQVEETLLNVGKFNNIVKLAAFSPFKSAQSALEN  63

Query  283  CNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEFVL  462
             NA+SEG + ++L+  LE  +P    +KK K  LG+A+ K+G+ I EE KIPCQ+   V+
Sbjct  64   VNAISEGVLHEDLKLLLETHMP----AKKKKALLGVADAKIGAAIQEELKIPCQTGGAVV  119

Query  463  ELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDTLD  642
            E+LRG+RLHF   ++ L A    KAQLGLGHSYSRAKVKFNVNRVDNM+IQ+I LLD LD
Sbjct  120  EILRGIRLHFHSLVKGLTAQSASKAQLGLGHSYSRAKVKFNVNRVDNMIIQSISLLDQLD  179

Query  643  KDVNTF  660
            KD+NTF
Sbjct  180  KDINTF  185



>ref|XP_011392585.1| putative snoRNP complex protein NOP56 [Ustilago maydis 521]
 gb|KIS65857.1| putative snoRNP complex protein NOP56 [Ustilago maydis 521]
Length=523

 Score =   195 bits (495),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 100/185 (54%), Positives = 129/185 (70%), Gaps = 3/185 (2%)
 Frame = +1

Query  106  YLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDALNQC  285
            ++L+E A+G  +F    ++EIG  T AV+ SV ++N FGK+VKL++F+PF++ALDAL   
Sbjct  7    HILFECATGCAVFEVAAVEEIGSLTRAVQESVNEVNTFGKMVKLLSFSPFKNALDALQAS  66

Query  286  NAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEFVLE  465
              +SEG + D L++ L L L      KK    LG+ +  L S I  E  IPC + E  LE
Sbjct  67   LDISEGVVNDYLKSLLTLNL---SSGKKKSVILGVQDRNLASSIVGELGIPCDTGETSLE  123

Query  466  LLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDTLDK  645
            L+RGVR H EK ++ +  GDL KAQLGLGHSYSR+KVKFNVNR DNM+IQAI LLDTLDK
Sbjct  124  LIRGVRQHAEKLLKGMADGDLAKAQLGLGHSYSRSKVKFNVNRSDNMIIQAIALLDTLDK  183

Query  646  DVNTF  660
            DVNTF
Sbjct  184  DVNTF  188



>emb|CAJ81913.1| nucleolar protein 5A (56kDa with KKE/D repeat) [Xenopus (Silurana) 
tropicalis]
Length=484

 Score =   194 bits (493),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 98/186 (53%), Positives = 130/186 (70%), Gaps = 4/186 (2%)
 Frame = +1

Query  103  LYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDALNQ  282
            L++L+E A+GY LF    ++EIG     V  S+ ++ +F  +VKL AF+PF+SA  AL  
Sbjct  4    LHVLFEHAAGYALFVVKEVEEIGLLIPQVEESLLNVGKFNNIVKLAAFSPFKSAQSALEN  63

Query  283  CNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEFVL  462
             NA+SEG + ++L+  LE  +P    +KK K  LG+ + K+G+ I EE KIPCQ+   V 
Sbjct  64   VNAISEGVLHEDLKLLLETNMP----AKKKKALLGVGDAKIGAAIQEELKIPCQTGGAVA  119

Query  463  ELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDTLD  642
            E+LRG+RLHF   ++ L A    KAQLGLGHSYSRAKVKFNVNRVDNM+IQ+I LLD LD
Sbjct  120  EILRGIRLHFHSLVKGLTAQSASKAQLGLGHSYSRAKVKFNVNRVDNMIIQSISLLDQLD  179

Query  643  KDVNTF  660
            KD+NTF
Sbjct  180  KDINTF  185



>ref|XP_005828248.1| hypothetical protein GUITHDRAFT_74893 [Guillardia theta CCMP2712]
 gb|EKX41268.1| hypothetical protein GUITHDRAFT_74893 [Guillardia theta CCMP2712]
Length=483

 Score =   194 bits (492),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 99/189 (52%), Positives = 132/189 (70%), Gaps = 1/189 (1%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            M+L++LYESASG+ LF     DEIGQ  E +++++ D++R  KV+KL AF PF+SA +AL
Sbjct  1    MSLFVLYESASGFALFEQTESDEIGQFLEEMQDAMADISRMSKVIKLKAFMPFKSAEEAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAK-FSLGLAEPKLGSHIFEETKIPCQSNE  453
               N +SEG + + L+NFLE+ LP      K     LG+ + KL S I +E  I C + +
Sbjct  61   TAANDLSEGILNEYLKNFLEMNLPTGGKKDKKGKVQLGVLDTKLASAISDELGISCTTKD  120

Query  454  FVLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLD  633
             V EL+R VRLHF K+++ L+  DL +A LGL HSYSR+KVKFNVNR DNM+IQ I LLD
Sbjct  121  PVPELIRAVRLHFAKYVKKLEENDLTRASLGLAHSYSRSKVKFNVNRQDNMIIQCICLLD  180

Query  634  TLDKDVNTF  660
            TLDKD+NTF
Sbjct  181  TLDKDINTF  189



>gb|EST06828.1| hypothetical protein PSEUBRA_SCAF25g01067 [Pseudozyma brasiliensis 
GHG001]
Length=541

 Score =   194 bits (494),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 100/185 (54%), Positives = 129/185 (70%), Gaps = 3/185 (2%)
 Frame = +1

Query  106  YLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDALNQC  285
            ++L+E A+G  +F    ++EIG  T AV+ SV ++N FGK+VKL++F+PF++ALDAL   
Sbjct  7    HILFECATGCAVFEVAAVEEIGALTRAVQESVNEVNTFGKMVKLLSFSPFKNALDALQAS  66

Query  286  NAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEFVLE  465
              +SEG + D L++ L L L      KK    LG+ +  L S I  E  IPC + E  LE
Sbjct  67   LDISEGVVNDYLKSLLTLNL---SSGKKKSVVLGVQDRNLASSIVGELGIPCDTGETSLE  123

Query  466  LLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDTLDK  645
            L+RGVR H EK ++ +  GDL KAQLGLGHSYSR+KVKFNVNR DNM+IQAI LLDTLDK
Sbjct  124  LIRGVRQHAEKLLKGMADGDLAKAQLGLGHSYSRSKVKFNVNRSDNMIIQAIALLDTLDK  183

Query  646  DVNTF  660
            DVNTF
Sbjct  184  DVNTF  188



>ref|XP_001835490.1| small nuclear ribonucleoprotein [Coprinopsis cinerea okayama7#130]
 gb|EAU86275.1| small nuclear ribonucleoprotein [Coprinopsis cinerea okayama7#130]
Length=556

 Score =   194 bits (494),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 97/188 (52%), Positives = 136/188 (72%), Gaps = 2/188 (1%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            M  ++L+ESASGY +F     ++IG  +  ++ S++DL +FGK+V+L +F+PF+SA  AL
Sbjct  1    MVSHILFESASGYAIFEVKLSEDIGSKSREMQESIQDLGKFGKMVQLQSFSPFKSAAQAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
               N VSEG + + L+N LEL L K   SKK+K  LG+++P +G  I    +I C ++E 
Sbjct  61   ENINDVSEGVLNEYLQNILELNLSK--PSKKSKILLGVSDPLIGQSIKAALEINCDASEK  118

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
              +L+RG+RLH  K ++ L++ DL+KAQLGLGHSYSRAK+KFNVNR+DNM+IQAI LLD 
Sbjct  119  TQDLIRGIRLHASKLLKGLQSDDLKKAQLGLGHSYSRAKLKFNVNRIDNMIIQAIALLDQ  178

Query  637  LDKDVNTF  660
            LDKDVN F
Sbjct  179  LDKDVNLF  186



>gb|KFH65972.1| hypothetical protein MVEG_08074 [Mortierella verticillata NRRL 
6337]
Length=499

 Score =   194 bits (492),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 104/188 (55%), Positives = 126/188 (67%), Gaps = 2/188 (1%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            M  Y LYES+SGY LF     +EIG     V  +  DL +FGK+VKL +F PF+SA  AL
Sbjct  1    MVNYFLYESSSGYALFERLESEEIGSKLADVAAAASDLTKFGKMVKLKSFAPFKSAAHAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
               N VSEG M D L+ FLE+ LPK    KK+K  LG+ E  L   I E       ++E 
Sbjct  61   ENMNDVSEGIMNDHLKAFLEMNLPK--PGKKSKVVLGVTEKSLAGSIKEGLGYDVDASEI  118

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            VL+L+RGVRL  +K ++ LK GDLE+AQLGLGHSYSR KVKFNV+R DNM+IQAI LLD 
Sbjct  119  VLDLVRGVRLFGDKLLKQLKEGDLERAQLGLGHSYSRGKVKFNVHRSDNMIIQAIALLDQ  178

Query  637  LDKDVNTF  660
            +DKDVNTF
Sbjct  179  MDKDVNTF  186



>gb|KFH67499.1| hypothetical protein MVEG_06231 [Mortierella verticillata NRRL 
6337]
Length=497

 Score =   193 bits (491),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 104/188 (55%), Positives = 126/188 (67%), Gaps = 2/188 (1%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            M  Y LYES+SGY LF     +EIG     V  +  DL +FGK+VKL +F PF+SA  AL
Sbjct  1    MVNYFLYESSSGYALFERLESEEIGSKLADVAAAASDLTKFGKMVKLKSFAPFKSAAHAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
               N VSEG M D L+ FLE+ LPK    KK+K  LG+ E  L   I E       ++E 
Sbjct  61   ENMNDVSEGIMNDHLKAFLEMNLPK--PGKKSKVVLGVTEKSLAGSIKEGLGYDVDASEI  118

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            VL+L+RGVRL  +K ++ LK GDLE+AQLGLGHSYSR KVKFNV+R DNM+IQAI LLD 
Sbjct  119  VLDLVRGVRLFGDKLLKQLKEGDLERAQLGLGHSYSRGKVKFNVHRSDNMIIQAIALLDQ  178

Query  637  LDKDVNTF  660
            +DKDVNTF
Sbjct  179  MDKDVNTF  186



>ref|NP_001184132.1| NOP56 ribonucleoprotein homolog [Xenopus (Silurana) tropicalis]
Length=536

 Score =   194 bits (493),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 98/186 (53%), Positives = 130/186 (70%), Gaps = 4/186 (2%)
 Frame = +1

Query  103  LYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDALNQ  282
            L++L+E A+GY LF    ++EIG     V  S+ ++ +F  +VKL AF+PF+SA  AL  
Sbjct  4    LHVLFEHAAGYALFVVKEVEEIGLLIPQVEESLLNVGKFNNIVKLAAFSPFKSAQSALEN  63

Query  283  CNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEFVL  462
             NA+SEG + ++L+  LE  +P    +KK K  LG+ + K+G+ I EE KIPCQ+   V 
Sbjct  64   VNAISEGVLHEDLKLLLETNMP----AKKKKALLGVGDAKIGAAIQEELKIPCQTGGAVA  119

Query  463  ELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDTLD  642
            E+LRG+RLHF   ++ L A    KAQLGLGHSYSRAKVKFNVNRVDNM+IQ+I LLD LD
Sbjct  120  EILRGIRLHFHSLVKGLTAQSASKAQLGLGHSYSRAKVKFNVNRVDNMIIQSISLLDQLD  179

Query  643  KDVNTF  660
            KD+NTF
Sbjct  180  KDINTF  185



>gb|EPZ33215.1| NOSIC domain-containing protein [Rozella allomycis CSF55]
Length=905

 Score =   197 bits (502),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 100/186 (54%), Positives = 135/186 (73%), Gaps = 2/186 (1%)
 Frame = +1

Query  103  LYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDALNQ  282
            L++L+E+ASGY LF     +EIGQ    V+ S+ DL++FG+++KL +F PF+SA DAL  
Sbjct  427  LFILFETASGYALFERVQSEEIGQELGEVQKSILDLSKFGQMIKLKSFMPFKSAGDALEN  486

Query  283  CNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEFVL  462
             N +SEG + + L+NFLE+ L      KK+K ++G+++  L S I +E +  C  +E VL
Sbjct  487  INDISEGIVGESLKNFLEMNLGNA--GKKSKITIGVSDKALASSIKQELEYNCSFDEVVL  544

Query  463  ELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDTLD  642
            E++RG+R H EK ++  K GDL +AQLGLGHSYSRAKVKFNVNR DNM+IQAI LLD LD
Sbjct  545  EIIRGIRYHGEKMLKQFKQGDLARAQLGLGHSYSRAKVKFNVNRSDNMIIQAISLLDQLD  604

Query  643  KDVNTF  660
            KDVNTF
Sbjct  605  KDVNTF  610



>emb|CCF48798.1| probable SIK1-involved in pre-rRNA processing [Ustilago hordei]
Length=516

 Score =   193 bits (491),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 100/185 (54%), Positives = 129/185 (70%), Gaps = 3/185 (2%)
 Frame = +1

Query  106  YLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDALNQC  285
            ++L+E A+G  +F    ++EIG  T AV+ SV ++N FGK+VKL++F+PF++ALDAL   
Sbjct  7    HILFECATGCAVFEVAAVEEIGSLTRAVQESVNEVNTFGKMVKLLSFSPFKNALDALQAS  66

Query  286  NAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEFVLE  465
              +SEG + D L++ L L L      KK    LG+ +  L S I  E  IPC + E  LE
Sbjct  67   LDISEGVVNDYLKSLLTLNLSL---GKKKSVVLGVQDRNLASSIVGELGIPCDTGETSLE  123

Query  466  LLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDTLDK  645
            L+RGVR H EK ++ +  GDL KAQLGLGHSYSR+KVKFNVNR DNM+IQAI LLDTLDK
Sbjct  124  LIRGVRQHAEKLLKGMADGDLAKAQLGLGHSYSRSKVKFNVNRSDNMIIQAIALLDTLDK  183

Query  646  DVNTF  660
            DVNTF
Sbjct  184  DVNTF  188



>ref|XP_007768562.1| Nop-domain-containing protein [Coniophora puteana RWD-64-598 
SS2]
 gb|EIW81149.1| Nop-domain-containing protein [Coniophora puteana RWD-64-598 
SS2]
Length=539

 Score =   194 bits (492),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 99/188 (53%), Positives = 133/188 (71%), Gaps = 2/188 (1%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            M  + L+ESASGY +F     ++IG NT+A+++S+ DL++F K+V LV+F+PF+SA DAL
Sbjct  1    MVTHALFESASGYAIFKVKLHEDIGTNTQAMQDSIDDLSKFAKMVTLVSFSPFKSAADAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
               N VSEG +T+ LR+ LEL L K +  K +K SL + +  L S+I +   I C ++E 
Sbjct  61   ENINDVSEGLITEHLRSILELNLSKSQ--KASKISLAVFDSGLASNIKDTLNIGCDTSEI  118

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
               ++RG+R H  K +  L+A DL KAQLGLGHSYSRAK+KFNVNRVDNM+IQA  LLD 
Sbjct  119  SQTIIRGIRQHAAKLLTGLEANDLSKAQLGLGHSYSRAKLKFNVNRVDNMIIQASALLDQ  178

Query  637  LDKDVNTF  660
            LDKDVN F
Sbjct  179  LDKDVNLF  186



>ref|XP_007866915.1| Nop-domain-containing protein [Gloeophyllum trabeum ATCC 11539]
 gb|EPQ54640.1| Nop-domain-containing protein [Gloeophyllum trabeum ATCC 11539]
Length=537

 Score =   194 bits (492),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 98/188 (52%), Positives = 136/188 (72%), Gaps = 2/188 (1%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MA ++L+ES+SGY +F     +EIG  T+A+++S+ DL +F K+V L++F+PF+SA  AL
Sbjct  1    MATHVLFESSSGYAIFEVKLKEEIGARTKAIQDSMDDLAKFSKMVSLISFSPFKSAAHAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
               N VSEG +++ L++ LEL L K   +KK+   L +A+P L + I E  KI C ++E 
Sbjct  61   ENANDVSEGLVSEYLQSLLELNLSK--PAKKSGIKLAVADPGLAASIKETCKIDCDTSES  118

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
              EL+RGVRLH  K ++ ++  D+ KAQLGLGHSYSRAK+KFNVNR+DNM+IQAI LLD 
Sbjct  119  SQELIRGVRLHAGKLLKGMQDEDIIKAQLGLGHSYSRAKLKFNVNRIDNMIIQAIALLDQ  178

Query  637  LDKDVNTF  660
            LDKDVN F
Sbjct  179  LDKDVNLF  186



>gb|KIK08078.1| hypothetical protein K443DRAFT_672961 [Laccaria amethystina LaAM-08-1]
Length=536

 Score =   194 bits (492),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 98/188 (52%), Positives = 133/188 (71%), Gaps = 2/188 (1%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            M  ++L+ES+SGY +F A   ++IG  +  V++S+KDL +FGK+V L++F+PF+SA  AL
Sbjct  1    MVTHVLFESSSGYAIFEAKLTEDIGSKSSGVQDSIKDLAKFGKMVSLMSFSPFKSAAQAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
               N +SEG M D L+N LEL L K   SKK+   L +A+  LG  I E       ++E 
Sbjct  61   ENINDISEGIMNDYLKNLLELNLSKT--SKKSPVKLAVADSLLGKSIKEVLGFNIDTSEK  118

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
              +L+RG+RLH +K ++ L+  DL+KAQLGLGHSYSRAK+KFNVNR+DNM+IQAI LLD 
Sbjct  119  AQDLIRGIRLHADKLLKGLQTDDLKKAQLGLGHSYSRAKLKFNVNRIDNMIIQAIALLDQ  178

Query  637  LDKDVNTF  660
            LDKDVN F
Sbjct  179  LDKDVNLF  186



>ref|XP_005518148.1| PREDICTED: nucleolar protein 56 [Pseudopodoces humilis]
Length=591

 Score =   194 bits (494),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 102/201 (51%), Positives = 132/201 (66%), Gaps = 4/201 (2%)
 Frame = +1

Query  58   REAKGEEERDPVGMALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKL  237
            R+ +G+ E     + L++L+E A+GY LF    ++EIG     V  SV  L +F  VVKL
Sbjct  18   RQREGDAEPPVPQVLLHVLFEHAAGYALFAVREVEEIGLLLPQVEESVLTLGKFHNVVKL  77

Query  238  VAFNPFESALDALNQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHI  417
            VAF+PF SA  AL   NAVSEG + ++LR  L+  LP     K+ K  LG+ + K+G+ +
Sbjct  78   VAFSPFRSAQSALENMNAVSEGVLHEDLRLLLDTALP----PKRKKVLLGVGDAKMGAAV  133

Query  418  FEETKIPCQSNEFVLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRV  597
             EE  + CQ+   V EL+RG+RLHF   +  L A    KAQLGLGHSYSRAKVKFNVNRV
Sbjct  134  LEELGVQCQTGGVVAELMRGIRLHFPALVRGLTAQSAAKAQLGLGHSYSRAKVKFNVNRV  193

Query  598  DNMVIQAIFLLDTLDKDVNTF  660
            DNM+IQ+I LLD LDKD+NTF
Sbjct  194  DNMIIQSISLLDQLDKDINTF  214



>ref|XP_007855271.1| small nuclear ribonucleoprotein [Moniliophthora roreri MCA 2997]
 gb|ESK85424.1| small nuclear ribonucleoprotein [Moniliophthora roreri MCA 2997]
Length=532

 Score =   193 bits (490),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 98/188 (52%), Positives = 133/188 (71%), Gaps = 2/188 (1%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            M  + L ES+SGYGLF     ++IG +T+A ++S+KDL++FGK+V L++F PF+SA  AL
Sbjct  1    MITHALLESSSGYGLFQVKLTEDIGAHTQAAQDSIKDLSKFGKMVSLMSFVPFKSAAHAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
               N +SEG + D L+N LEL   K   SKK+   L +++P LG +I +   I C ++E 
Sbjct  61   ENANDISEGIVNDYLKNLLELNFAKA--SKKSLAVLAVSDPILGGNIRDAASIQCDASES  118

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
               ++RG+RLH  K ++ L+  DL KAQLGLGHSYSRAK+KFNVNR+DNM+IQAI LLD 
Sbjct  119  AQNIIRGLRLHAGKLLKGLQDDDLTKAQLGLGHSYSRAKLKFNVNRIDNMIIQAIALLDQ  178

Query  637  LDKDVNTF  660
            LDKDVN F
Sbjct  179  LDKDVNLF  186



>gb|KDQ30951.1| hypothetical protein PLEOSDRAFT_1092385 [Pleurotus ostreatus 
PC15]
Length=554

 Score =   193 bits (491),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 95/185 (51%), Positives = 133/185 (72%), Gaps = 2/185 (1%)
 Frame = +1

Query  106  YLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDALNQC  285
            + L+ESASGY +F     D+I   ++A+++S+KDL++FGK+V L++F+P++SA  AL   
Sbjct  5    HALFESASGYAIFEVKLTDDIALKSKAMQDSLKDLSKFGKIVSLLSFSPYKSAAQALENA  64

Query  286  NAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEFVLE  465
            N +SEG + + L + LEL +PK   SKK    L +++  L S I  E KIPC  ++   E
Sbjct  65   NDISEGIVNEYLHSLLELNIPK--PSKKTTVVLAVSDSALASSIKAELKIPCDVSDEAQE  122

Query  466  LLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDTLDK  645
            ++RG+RLH  K ++ L++ DL KAQLGLGHSYSRAK+KFNVNR+DNM+IQAI LLD LDK
Sbjct  123  IIRGIRLHASKLLKGLQSDDLIKAQLGLGHSYSRAKLKFNVNRIDNMIIQAIALLDQLDK  182

Query  646  DVNTF  660
            DVN F
Sbjct  183  DVNLF  187



>gb|ETS59786.1| hypothetical protein PaG_06313 [Pseudozyma aphidis DSM 70725]
Length=519

 Score =   192 bits (488),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 97/185 (52%), Positives = 130/185 (70%), Gaps = 3/185 (2%)
 Frame = +1

Query  106  YLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDALNQC  285
            ++L+E A+G  +F    ++EIG  + AV+ SV ++N FGK+VKL++F+PF++ALDAL   
Sbjct  7    HILFECATGCAVFEVAAVEEIGSLSRAVQESVNEVNTFGKMVKLLSFSPFKNALDALQAS  66

Query  286  NAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEFVLE  465
              +SEG + D L++ L L L     +KK    LG+ +  L + I  E  IPC + +  LE
Sbjct  67   LDISEGVLNDYLKSLLTLNLAA---AKKKSVVLGVQDRNLATSIVGELGIPCDTGDTALE  123

Query  466  LLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDTLDK  645
            L+RGVR H EK ++ +  GDL KAQLGLGHSYSR+KVKFNVNR DNM+IQAI LLDTLDK
Sbjct  124  LIRGVRQHAEKLLKGMADGDLAKAQLGLGHSYSRSKVKFNVNRSDNMIIQAIALLDTLDK  183

Query  646  DVNTF  660
            DVNTF
Sbjct  184  DVNTF  188



>dbj|GAK67550.1| nop-domain-containing protein [Pseudozyma antarctica]
Length=522

 Score =   192 bits (488),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 97/185 (52%), Positives = 130/185 (70%), Gaps = 3/185 (2%)
 Frame = +1

Query  106  YLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDALNQC  285
            ++L+E A+G  +F    ++EIG  + AV+ SV ++N FGK+VKL++F+PF++ALDAL   
Sbjct  7    HILFECATGCAVFEVAAVEEIGSLSRAVQESVNEVNTFGKMVKLLSFSPFKNALDALQAS  66

Query  286  NAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEFVLE  465
              +SEG + D L++ L L L     +KK    LG+ +  L + I  E  IPC + +  LE
Sbjct  67   LDISEGVLNDYLKSLLTLNLAA---AKKKSVVLGVQDRNLATSIVGELGIPCDTGDTALE  123

Query  466  LLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDTLDK  645
            L+RGVR H EK ++ +  GDL KAQLGLGHSYSR+KVKFNVNR DNM+IQAI LLDTLDK
Sbjct  124  LIRGVRQHAEKLLKGMADGDLAKAQLGLGHSYSRSKVKFNVNRSDNMIIQAIALLDTLDK  183

Query  646  DVNTF  660
            DVNTF
Sbjct  184  DVNTF  188



>ref|NP_001026559.1| nucleolar protein 56 [Gallus gallus]
 emb|CAG31113.1| hypothetical protein RCJMB04_2i9 [Gallus gallus]
Length=535

 Score =   192 bits (489),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 100/186 (54%), Positives = 128/186 (69%), Gaps = 4/186 (2%)
 Frame = +1

Query  103  LYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDALNQ  282
            L++L+E A+GY LF    ++EIG     V  SV  + +F  VVKLVAF+PF+SA  AL  
Sbjct  4    LHVLFEHAAGYALFAVREVEEIGLLLPQVEESVLTVGKFHNVVKLVAFSPFKSAQSALEN  63

Query  283  CNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEFVL  462
             NAVSEG + ++LR  LE ++P    +KK K  LG+ + K+G+ I EE    CQ+   V 
Sbjct  64   MNAVSEGILHEDLRLLLETSMP----AKKKKALLGVGDAKIGAAILEELGYQCQTGGVVA  119

Query  463  ELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDTLD  642
            E+LRG+RLHF   ++ L A    KAQLGLGHSYSRAKVKFNVNRVDNM+IQ+I LLD LD
Sbjct  120  EILRGIRLHFHALVKGLTAQSASKAQLGLGHSYSRAKVKFNVNRVDNMIIQSISLLDQLD  179

Query  643  KDVNTF  660
            KD+NTF
Sbjct  180  KDINTF  185



>ref|XP_007883174.1| PREDICTED: nucleolar protein 56 [Callorhinchus milii]
Length=521

 Score =   192 bits (488),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 100/185 (54%), Positives = 130/185 (70%), Gaps = 2/185 (1%)
 Frame = +1

Query  106  YLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDALNQC  285
            +LL+E ASGY L     ++EI      V   V+ + +F  +VKLVAF+PF+SA  AL+  
Sbjct  5    HLLFEHASGYALLVVKEVEEISMLLPQVEECVQVIGKFNNIVKLVAFSPFKSAQSALDNM  64

Query  286  NAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEFVLE  465
            NAVSEG + ++L+  L+ +LP    SKK K +LG+A+ KLG+ + E+  I CQ+   V+E
Sbjct  65   NAVSEGIVHEDLKLLLDTSLPA--SSKKRKVTLGVADTKLGAALQEDLGIQCQTGGVVVE  122

Query  466  LLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDTLDK  645
            LLRGVRLHF   ++ L A    KAQLGLGHSYSRAKVKFNVNRVDNM+IQ+I LLD LDK
Sbjct  123  LLRGVRLHFHTLVQGLTAVSAAKAQLGLGHSYSRAKVKFNVNRVDNMIIQSISLLDQLDK  182

Query  646  DVNTF  660
            D+NTF
Sbjct  183  DINTF  187



>gb|KFB36904.1| AGAP002063-PA-like protein [Anopheles sinensis]
Length=521

 Score =   192 bits (487),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 99/186 (53%), Positives = 126/186 (68%), Gaps = 3/186 (2%)
 Frame = +1

Query  103  LYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDALNQ  282
            +Y+LYE A+GYGLF     +EIG     V  SV DL+RF  +VKLV F+PF++A+ ALN 
Sbjct  1    MYVLYEHAAGYGLFSVKEFEEIGMLLPQVEASVMDLSRFNAIVKLVGFHPFKTAVAALNN  60

Query  283  CNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEFVL  462
             NA+SEG + D+L  FL+ TLPK   S K K +LG+A+ KLG+ I E  ++ C     V 
Sbjct  61   VNAISEGLLPDDLSTFLDTTLPK---SSKKKVTLGVADAKLGAAISEALEVQCSHIGAVP  117

Query  463  ELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDTLD  642
            E+LRG+R HF   ++         AQLGLGHSYSR KVKFNV+R DNM+IQ+I LLD LD
Sbjct  118  EILRGIRNHFVNMVKGFTDQSAGVAQLGLGHSYSRCKVKFNVHRSDNMIIQSIALLDQLD  177

Query  643  KDVNTF  660
            KDVNTF
Sbjct  178  KDVNTF  183



>ref|XP_011493522.1| AAEL017421-PA [Aedes aegypti]
 gb|EJY57846.1| AAEL017421-PA [Aedes aegypti]
Length=502

 Score =   191 bits (485),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 99/188 (53%), Positives = 126/188 (67%), Gaps = 2/188 (1%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MALY+LYE A+GY +F     +EI      V  SV DL+RF  +VKLV F+PF++A+ AL
Sbjct  1    MALYVLYEHAAGYAVFSVKEFEEISMLLPQVEQSVTDLSRFNSIVKLVGFSPFKTAVAAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
               NA+SEG + D+L  FL+  LPK   SK  KF+LG+A+ KLG+ + E  KI C     
Sbjct  61   ENVNAISEGIVPDDLSVFLDSVLPKA--SKSNKFTLGVADAKLGAALAEALKIQCSHIGA  118

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            V E+LRG+R HF K ++         AQLGLGHSYSR KVKFNV+R DNM+IQ+I LLD 
Sbjct  119  VPEILRGIRHHFPKLVKGFSDKSAGIAQLGLGHSYSRCKVKFNVHRSDNMIIQSIALLDQ  178

Query  637  LDKDVNTF  660
            LDKD+NTF
Sbjct  179  LDKDINTF  186



>emb|CDW83716.1| UNKNOWN [Stylonychia lemnae]
Length=510

 Score =   191 bits (486),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 89/188 (47%), Positives = 125/188 (66%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            M L++LYESASGY LF     DE+G   +A++ S+  L RF K+VKL AF PF++A +AL
Sbjct  1    MQLFILYESASGYALFEKEDFDELGGQMKAIQKSISSLERFSKMVKLAAFQPFQTAEEAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            +   A+++ ++   L+NFL+  LP  K SKK KF LG+AEPK+G  IF E+      NE 
Sbjct  61   DNITAIAQNKVPKTLKNFLQTNLPATKSSKKQKFLLGIAEPKMGQEIFAESGFTAAYNES  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            + ELLRG+R H  K ++ +   D  +AQLGL H YSR +   +VNR D  +IQAI L++T
Sbjct  121  IEELLRGIRTHLPKILKKVSEEDSRRAQLGLAHQYSRQQCAADVNRQDKPIIQAIALIET  180

Query  637  LDKDVNTF  660
            +DK++NTF
Sbjct  181  MDKNINTF  188



>ref|XP_002741552.1| PREDICTED: nucleolar protein 56 [Saccoglossus kowalevskii]
Length=552

 Score =   192 bits (487),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 99/188 (53%), Positives = 128/188 (68%), Gaps = 4/188 (2%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            M L +LYE ASGYGLF    ++EI      V  SV D  +F  +VKL AF PF+SA  AL
Sbjct  1    MRLLVLYEHASGYGLFSVIEMEEISMLQPQVEKSVTDFAKFASIVKLEAFAPFKSAAHAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            +  N VSEG ++D+L+ FLE  +P    +KK K ++G+ + K+G+ I E   + CQ+   
Sbjct  61   DNVNCVSEGIVSDDLKLFLETNIP----AKKKKLTVGVGDAKIGAAITEVFGVKCQAFGV  116

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            V E+LRG+R HF + ++ L A    KAQLGLGHSYSRAKVKFNVNRVDNM+IQ+I LLD 
Sbjct  117  VPEILRGIRYHFHRMVKGLTAVAENKAQLGLGHSYSRAKVKFNVNRVDNMIIQSISLLDQ  176

Query  637  LDKDVNTF  660
            LDKD+NTF
Sbjct  177  LDKDINTF  184



>ref|XP_007656687.1| PREDICTED: nucleolar protein 56 [Ornithorhynchus anatinus]
Length=499

 Score =   191 bits (484),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 100/186 (54%), Positives = 128/186 (69%), Gaps = 4/186 (2%)
 Frame = +1

Query  103  LYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDALNQ  282
            L+LL+E A+GY L     ++EIG     V  SV +L +F  +V+LVAF+PF SA  AL+ 
Sbjct  4    LHLLFEHAAGYALLALKEVEEIGLLLPQVEESVLNLVKFLNLVRLVAFSPFTSAQSALDN  63

Query  283  CNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEFVL  462
             NAVSEG + ++LR  LE  LP    +KK K  LG+ +PK+G+ I EE    CQ+   V 
Sbjct  64   ANAVSEGVVHEDLRLLLETNLP----AKKKKVVLGVGDPKIGAAIQEELGYQCQTGGVVA  119

Query  463  ELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDTLD  642
            E+LRG+RLHF   ++ L A    KAQLGLGHSYSR+KVKFNVNRVDNM+IQAI LLD L+
Sbjct  120  EILRGIRLHFPSLVKGLTAASASKAQLGLGHSYSRSKVKFNVNRVDNMIIQAISLLDQLE  179

Query  643  KDVNTF  660
            KD+NTF
Sbjct  180  KDINTF  185



>gb|ETN58694.1| nucleolar protein Nop56 [Anopheles darlingi]
Length=503

 Score =   191 bits (484),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 98/188 (52%), Positives = 126/188 (67%), Gaps = 2/188 (1%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MAL++LYE A+GY LF     +EIG     V  S+ DL RF  +VKLV F+PF++A+ AL
Sbjct  1    MALHVLYEHAAGYALFGVKEFEEIGMLLPQVEASILDLARFNSIVKLVGFHPFKTAVAAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
            N  NA+SEG + D+L  FL+ TLPK   SKK + +LG+A+ KLG+ I E   + C     
Sbjct  61   NNVNAISEGLLPDDLAAFLDTTLPK--SSKKKQVTLGVADAKLGAAIAEALSVQCSHIGV  118

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            V E+LRG+R HF   ++         AQLGLGHSYSR KVKFNV+R DNM+IQ+I LLD 
Sbjct  119  VPEVLRGIRHHFPSLVKGFTDQSAAVAQLGLGHSYSRCKVKFNVHRSDNMIIQSIALLDQ  178

Query  637  LDKDVNTF  660
            LDKD+NTF
Sbjct  179  LDKDINTF  186



>ref|XP_003325018.1| hypothetical protein PGTG_06555 [Puccinia graminis f. sp. tritici 
CRL 75-36-700-3]
 gb|EFP80599.1| hypothetical protein PGTG_06555 [Puccinia graminis f. sp. tritici 
CRL 75-36-700-3]
Length=555

 Score =   191 bits (486),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 95/188 (51%), Positives = 133/188 (71%), Gaps = 4/188 (2%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MA ++L+ES++GY LF     +EI   T+AV+ ++ +L++FGK+++L +F PF  A  AL
Sbjct  1    MATHVLFESSAGYALFAVKFTEEIAGRTKAVQEAIPNLSKFGKMIELKSFLPFRDAAHAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
               N +SEG M++ L++ LEL +P    +KK+   LG+AE  L   I     I C +++ 
Sbjct  61   ENANDISEGLMSEHLQSLLELHIP----AKKSSIVLGVAERGLAGSIKASLGIECDASDR  116

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
             LEL+RG+RLH EK +  L+ GD++K+QLGLGH+YSRAKVKFNVNR DNM+IQAI LLD 
Sbjct  117  SLELIRGIRLHAEKLLTGLEKGDMDKSQLGLGHAYSRAKVKFNVNRSDNMIIQAIALLDQ  176

Query  637  LDKDVNTF  660
            LDKDVNTF
Sbjct  177  LDKDVNTF  184



>ref|XP_009908364.1| PREDICTED: LOW QUALITY PROTEIN: dynactin subunit 1 [Picoides 
pubescens]
Length=1763

 Score =   197 bits (500),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 100/191 (52%), Positives = 131/191 (69%), Gaps = 4/191 (2%)
 Frame = +1

Query  88    PVGMALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESAL  267
             PV + L++L+E A+GY LF    ++EI      V  SV  + +F  +VKLVAF+PF SA 
Sbjct  1286  PVPVLLHVLFEHAAGYALFAVREVEEISLLLPQVEESVLTIGKFHSLVKLVAFSPFRSAQ  1345

Query  268   DALNQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQS  447
              AL   NA+SEG + ++LR  LE ++P    +KK K  LG+A+PK+G+ I EE    CQ+
Sbjct  1346  SALENINAISEGILHEDLRLLLETSMP----AKKKKALLGVADPKIGAAILEELGYQCQT  1401

Query  448   NEFVLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFL  627
                V E++RG+RLHF   ++ L A    KAQLGLGHSYSRAKVKFNVNRVDNM+IQ+I L
Sbjct  1402  GGVVAEIMRGIRLHFHALVKGLTAQSASKAQLGLGHSYSRAKVKFNVNRVDNMIIQSISL  1461

Query  628   LDTLDKDVNTF  660
             LD LDKD+NTF
Sbjct  1462  LDQLDKDINTF  1472



>ref|XP_007380122.1| Nop domain-containing protein [Punctularia strigosozonata HHB-11173 
SS5]
 gb|EIN12555.1| Nop domain-containing protein [Punctularia strigosozonata HHB-11173 
SS5]
Length=404

 Score =   188 bits (477),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 98/189 (52%), Positives = 129/189 (68%), Gaps = 3/189 (2%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            M  ++L+ESASGY +F A     I   T+ ++ S+ DL +FGK+V L++F+PF++A  AL
Sbjct  1    MVTHVLFESASGYAIFEAKLHASIESRTKDIQESIDDLAKFGKMVSLISFSPFKTAAHAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQ-SNE  453
               N VSEG + D L++ LELTL K   SKK+K  L +++P L + I  E  I C  S  
Sbjct  61   ENANDVSEGIVNDHLKSLLELTLSK--PSKKSKVVLAVSDPALAASIKTELGISCDVSAN  118

Query  454  FVLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLD  633
               EL+RG+RLH  K +  + A DL KAQLGLGHS+SRAK+KFNVNR+DNM+IQAI LLD
Sbjct  119  VAQELIRGIRLHAPKLLTGMAADDLTKAQLGLGHSFSRAKLKFNVNRIDNMIIQAIALLD  178

Query  634  TLDKDVNTF  660
             LDKDVN F
Sbjct  179  QLDKDVNLF  187



>ref|XP_011429137.1| PREDICTED: nucleolar protein 56-like [Crassostrea gigas]
 gb|EKC35060.1| Nucleolar protein 56 [Crassostrea gigas]
Length=268

 Score =   184 bits (467),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 92/187 (49%), Positives = 128/187 (68%), Gaps = 2/187 (1%)
 Frame = +1

Query  100  ALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDALN  279
            +LY+L+E ASGYGLF     +E+      V  S  D+++F  +VKL+AF+PF+S  +AL+
Sbjct  4    SLYVLFEHASGYGLFRVKEFEEVATFIPEVEKSTNDVSKFQSLVKLLAFSPFKSGTNALD  63

Query  280  QCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEFV  459
              N++SEG + D+L+ FLE  +PK    KK K  +G+++ K+G+ I EE  I C     V
Sbjct  64   NMNSISEGLLHDDLQVFLESNVPK--GGKKDKVVVGVSDAKIGAAITEELGIKCSHIGVV  121

Query  460  LELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDTL  639
             E++RG+RLHF   ++ L      KAQLGLGHSYSRAKVKFNVNR DNM+IQ+I L+D L
Sbjct  122  PEVIRGIRLHFPNMVKGLTEVSSAKAQLGLGHSYSRAKVKFNVNRADNMIIQSISLMDQL  181

Query  640  DKDVNTF  660
            DK++NTF
Sbjct  182  DKNINTF  188



>ref|XP_003494005.1| PREDICTED: nucleolar protein 56-like [Bombus impatiens]
Length=493

 Score =   190 bits (482),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 98/186 (53%), Positives = 127/186 (68%), Gaps = 2/186 (1%)
 Frame = +1

Query  103  LYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDALNQ  282
            L++L+E A+GY +F     +E+G     V  SV DL+RF  VVKLVAF+PF++AL AL  
Sbjct  4    LFVLFEHAAGYAIFSVTEFEEVGMLLPQVEASVTDLSRFHSVVKLVAFSPFKTALAALEN  63

Query  283  CNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEFVL  462
             N+VSEG + ++L+ F++  LPK    KK K  LG+A+PKLG+ I E   I C     + 
Sbjct  64   INSVSEGIVPEDLQLFIDSCLPK--SGKKNKIVLGVADPKLGASITEALDIKCDHIGAIP  121

Query  463  ELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDTLD  642
            E++RG+R HF   ++   A     AQLGLGHSYSRAKVKFNVNRVDNM+IQ+I LLD LD
Sbjct  122  EIIRGIRFHFHDLVKGFTAKSSGIAQLGLGHSYSRAKVKFNVNRVDNMIIQSIALLDQLD  181

Query  643  KDVNTF  660
            KDVNTF
Sbjct  182  KDVNTF  187



>ref|XP_010566789.1| PREDICTED: nucleolar protein 56, partial [Haliaeetus leucocephalus]
Length=536

 Score =   191 bits (484),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 100/186 (54%), Positives = 127/186 (68%), Gaps = 4/186 (2%)
 Frame = +1

Query  103  LYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDALNQ  282
            L++L+E A+GY LF    ++EI      V  SV  + +F  VVKLVAF PF+SA  AL  
Sbjct  7    LHVLFEHAAGYALFAVREVEEISLLLPQVEESVLTVGKFHNVVKLVAFAPFKSAQSALEN  66

Query  283  CNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEFVL  462
             NAVSEG + ++LR  LE ++P    +KK K  LG+A+ K+G+ I EE    CQ+   V 
Sbjct  67   INAVSEGILHEDLRLLLETSMP----AKKKKALLGVADAKIGAAILEELGYQCQTGGVVA  122

Query  463  ELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDTLD  642
            E+LRG+RLHF   ++ L A    KAQLGLGHSYSRAKVKFNVNRVDNM+IQ+I LLD LD
Sbjct  123  EILRGIRLHFHALVKGLTAQSASKAQLGLGHSYSRAKVKFNVNRVDNMIIQSISLLDQLD  182

Query  643  KDVNTF  660
            KD+NTF
Sbjct  183  KDINTF  188



>gb|EFX71480.1| nucleolar protein-like protein 5A [Daphnia pulex]
Length=564

 Score =   191 bits (486),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 97/187 (52%), Positives = 128/187 (68%), Gaps = 1/187 (1%)
 Frame = +1

Query  103  LYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDALNQ  282
            +++L+E A+GY LF     +++G     V  SV DL+RF  VVKLVAF PF+SA  AL+ 
Sbjct  4    MFVLFEHAAGYALFRVREFEDVGSFLPQVEQSVTDLSRFNGVVKLVAFAPFKSAAHALDN  63

Query  283  CNAVSEGQMTDELRNFLELTLPKV-KDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEFV  459
             N++SEG ++++L  FLE  LPK  K  KK  F LG++EPKLG+ I E   I CQ    +
Sbjct  64   INSISEGVLSEDLNLFLETNLPKSEKKGKKDSFVLGVSEPKLGASISEILGITCQHAGVI  123

Query  460  LELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDTL  639
             E++RG+R+HF   ++         AQLGLGHSYSRAKVKFNV+RVDNM+IQ+I LLD L
Sbjct  124  PEIVRGIRVHFAHLVKGFTVQTSGVAQLGLGHSYSRAKVKFNVHRVDNMIIQSIALLDQL  183

Query  640  DKDVNTF  660
            DKD+NTF
Sbjct  184  DKDINTF  190



>ref|XP_007882424.1| hypothetical protein PFL1_06687 [Pseudozyma flocculosa PF-1]
 gb|EPQ25820.1| hypothetical protein PFL1_06687 [Pseudozyma flocculosa PF-1]
Length=531

 Score =   190 bits (483),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 98/185 (53%), Positives = 127/185 (69%), Gaps = 2/185 (1%)
 Frame = +1

Query  106  YLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDALNQC  285
            ++L+E A+G  +F    ++EIG  T AV+ SV +   F K+VKLV+F+PF++ALDAL   
Sbjct  7    HVLFECATGCAVFEVVQVEEIGNLTSAVQKSVAEFTTFAKMVKLVSFSPFKNALDALQAS  66

Query  286  NAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEFVLE  465
              +SEG + D L++ L L LP  K  K     LG+A+  L S I  E  IPC + E  +E
Sbjct  67   LDISEGVVNDYLKSLLTLNLPTGKKIKS--VLLGVADRNLASSIVGELGIPCDTGETSIE  124

Query  466  LLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDTLDK  645
            ++RGVR H E+ +  +  GDL KAQLGLGHSYSR+KVKFNVNR DNM+IQAI LLDTLDK
Sbjct  125  IIRGVRQHAERLLRGMAEGDLAKAQLGLGHSYSRSKVKFNVNRSDNMIIQAIALLDTLDK  184

Query  646  DVNTF  660
            DVNTF
Sbjct  185  DVNTF  189



>ref|XP_002608922.1| hypothetical protein BRAFLDRAFT_85513 [Branchiostoma floridae]
 gb|EEN64932.1| hypothetical protein BRAFLDRAFT_85513 [Branchiostoma floridae]
Length=597

 Score =   191 bits (486),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 97/186 (52%), Positives = 126/186 (68%), Gaps = 4/186 (2%)
 Frame = +1

Query  103  LYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDALNQ  282
            L++LYE ASGY LF    ++E+G     V  SVK   +F   VKLVAF+PF+S  +AL+ 
Sbjct  4    LHVLYEHASGYALFRVEEVEEVGMLLPTVEKSVKSYEKFNSTVKLVAFSPFKSGTNALDN  63

Query  283  CNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEFVL  462
            CNA+SEG + D+L+ FLE   P     KK K +LG+ +PK+GS I EE  I     + V 
Sbjct  64   CNAISEGILHDDLKVFLENNFPL----KKKKATLGIGDPKIGSAIQEELGILLTGGDVVQ  119

Query  463  ELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDTLD  642
            E++RG++LHF   ++ L      KAQLGLGHSYSRAKVKFNV+R DNM+IQ+I LLD LD
Sbjct  120  EVIRGIKLHFHLLVKGLTETSASKAQLGLGHSYSRAKVKFNVHRADNMIIQSISLLDQLD  179

Query  643  KDVNTF  660
            KD+NTF
Sbjct  180  KDINTF  185



>gb|EJY76011.1| Nop multi-domain protein [Oxytricha trifallax]
Length=510

 Score =   190 bits (482),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/188 (48%), Positives = 124/188 (66%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            M L++LYESASGY LF     DE+G   +A++ S+  L RF K+VKL AF PF++A +AL
Sbjct  1    MQLFILYESASGYALFEKEDFDELGGQLKAIQKSISSLERFSKMVKLAAFQPFQTAEEAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
                A+++ ++ + L+NFL   LP  K SKK KF LG+AEP +G  +F ET I    NE 
Sbjct  61   ENIQAIAQNKVAETLKNFLITNLPATKSSKKQKFLLGIAEPMMGQQVFAETGITASYNES  120

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
            + ELLRG+R H  K ++ +   D +KAQLGL H YSR     +VNR D  +IQAI L++T
Sbjct  121  IEELLRGIRTHLPKILKKVSEEDTKKAQLGLAHQYSRFMCAADVNRQDKPIIQAIALIET  180

Query  637  LDKDVNTF  660
            +DK++NTF
Sbjct  181  MDKNINTF  188



>ref|XP_007408019.1| hypothetical protein MELLADRAFT_47719 [Melampsora larici-populina 
98AG31]
 gb|EGG08433.1| hypothetical protein MELLADRAFT_47719 [Melampsora larici-populina 
98AG31]
Length=539

 Score =   190 bits (483),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 96/188 (51%), Positives = 132/188 (70%), Gaps = 4/188 (2%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MA ++L+ES++GY LF     ++I   T+AV+ S+ +L++FGK+++L +F PF+ A  AL
Sbjct  1    MATHVLFESSAGYALFAVKFNEQIAGKTKAVQESIPNLSKFGKMIELKSFLPFKDAAHAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
               N +SEG M + L++ LEL +P    SKK+   LG++E  L   I     I C +++ 
Sbjct  61   ENANDISEGIMNEHLQSLLELHIP----SKKSSIVLGVSERGLAGSIKSTLGIECDTSDQ  116

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
             LEL+RG+RLH EK +  L  GDL+K+QLGLGH+YSRAKVKFNVNR DNM+IQAI LLD 
Sbjct  117  SLELIRGIRLHAEKLLTGLTTGDLDKSQLGLGHAYSRAKVKFNVNRSDNMIIQAIALLDQ  176

Query  637  LDKDVNTF  660
            LDKDVNTF
Sbjct  177  LDKDVNTF  184



>gb|KIK14839.1| hypothetical protein PISMIDRAFT_343722 [Pisolithus microcarpus 
441]
Length=528

 Score =   190 bits (482),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 102/188 (54%), Positives = 132/188 (70%), Gaps = 2/188 (1%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            MA +LL+E+ASGY +F     +E+G  T+ V++S+ DL++F K+V L++F+PF SA DAL
Sbjct  1    MATHLLFEAASGYAIFEVKLHEEVGARTKEVQDSISDLSKFNKMVSLLSFSPFRSAADAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
               N +SEG + D L++ LEL L   K  K +K  LGLA+  L S I +   I C ++E 
Sbjct  61   ENINDISEGILNDYLKSLLELNL--AKSKKASKVKLGLADSTLASSISDAMGIKCDASEQ  118

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
              ELLRGVRLH  K ++ L   DL KAQLGLGHSYSRAK+KFNVNR+DNM+IQAI LLD 
Sbjct  119  TQELLRGVRLHAHKLLKGLDDKDLVKAQLGLGHSYSRAKLKFNVNRIDNMIIQAIALLDQ  178

Query  637  LDKDVNTF  660
            LDKDVN F
Sbjct  179  LDKDVNLF  186



>gb|KDR23556.1| Nucleolar protein 56, partial [Zootermopsis nevadensis]
Length=436

 Score =   188 bits (477),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 96/186 (52%), Positives = 127/186 (68%), Gaps = 2/186 (1%)
 Frame = +1

Query  103  LYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDALNQ  282
            L++L+E A+G+ LF  +  +E G     V  SV DL+RF  V+KL+ F+PF++A  AL  
Sbjct  4    LFVLFEHAAGFALFKVNEFEETGMLLPQVEASVTDLSRFNAVIKLIGFSPFKTATSALEN  63

Query  283  CNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEFVL  462
             N++SEG +  +L+ FLE  LPK K+ KK    LG+++PKLG+ I E   I CQ    V 
Sbjct  64   MNSISEGVLPGDLQLFLETHLPKPKEKKKD--ILGVSDPKLGASINEALGIVCQHVGVVP  121

Query  463  ELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDTLD  642
            E++RG+R HF K ++   +     AQLGLGHSYSRAKVKFNVNRVDNM+IQ+I LLD LD
Sbjct  122  EVIRGIRYHFHKLVKGFTSKSSATAQLGLGHSYSRAKVKFNVNRVDNMIIQSIALLDQLD  181

Query  643  KDVNTF  660
            KDVNTF
Sbjct  182  KDVNTF  187



>ref|XP_006462942.1| hypothetical protein AGABI2DRAFT_179517 [Agaricus bisporus var. 
bisporus H97]
 ref|XP_007330258.1| hypothetical protein AGABI1DRAFT_120972 [Agaricus bisporus var. 
burnettii JB137-S8]
 gb|EKM79651.1| hypothetical protein AGABI1DRAFT_120972 [Agaricus bisporus var. 
burnettii JB137-S8]
 gb|EKV46122.1| hypothetical protein AGABI2DRAFT_179517 [Agaricus bisporus var. 
bisporus H97]
Length=550

 Score =   190 bits (483),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 97/188 (52%), Positives = 132/188 (70%), Gaps = 2/188 (1%)
 Frame = +1

Query  97   MALYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDAL  276
            M  ++L+ESASGY +F A   + I   T  ++ S++DL++F K+V L++F PF++A  AL
Sbjct  1    MITHVLFESASGYAIFEAKLAENIALKTPGMQESMRDLSKFSKMVSLMSFTPFKNAAQAL  60

Query  277  NQCNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEF  456
               N VSEG + D L+N LEL L K   SKK+K  L +++  LG+ I +E  I C  +E 
Sbjct  61   ENANDVSEGILNDYLKNLLELNLSK--PSKKSKVLLAVSDANLGTSIKQELNISCDMSEE  118

Query  457  VLELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDT  636
              +L+RG+RLH  K ++ L+A D+ KAQLGLGHSYSRAK+KFNVNR+DNM+IQAI LLD 
Sbjct  119  AQDLIRGIRLHAGKLLKGLQADDITKAQLGLGHSYSRAKLKFNVNRIDNMIIQAIALLDQ  178

Query  637  LDKDVNTF  660
            LDKDVN F
Sbjct  179  LDKDVNLF  186



>ref|XP_007496986.1| PREDICTED: nucleolar protein 56 [Monodelphis domestica]
Length=538

 Score =   190 bits (483),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 98/186 (53%), Positives = 127/186 (68%), Gaps = 4/186 (2%)
 Frame = +1

Query  103  LYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDALNQ  282
            L++L+E A+GY L     ++EI      V   V ++ +F  +V+LVAF+PF+SA  AL  
Sbjct  4    LHVLFEHAAGYALLALKEVEEISLLLPQVEECVLNIGKFHSIVRLVAFSPFKSAHSALEN  63

Query  283  CNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEFVL  462
             NAVSEG + ++LR FLE  +P    +KK K  LG+ +PK+G+ I EE   PCQ+   V 
Sbjct  64   ANAVSEGILHEDLRLFLETNMP----AKKKKALLGVGDPKIGAAIQEELGYPCQTGGVVA  119

Query  463  ELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDTLD  642
            E+LRGVRLHF   ++ L      KAQLGLGHSYSRAKVKFNVNRVDNM+IQ+I LLD LD
Sbjct  120  EILRGVRLHFHSLVKGLTEVSASKAQLGLGHSYSRAKVKFNVNRVDNMIIQSISLLDQLD  179

Query  643  KDVNTF  660
            KD+NTF
Sbjct  180  KDINTF  185



>ref|XP_006958132.1| Nop-domain-containing protein [Wallemia sebi CBS 633.66]
 gb|EIM21830.1| Nop-domain-containing protein [Wallemia sebi CBS 633.66]
Length=544

 Score =   190 bits (483),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 95/185 (51%), Positives = 129/185 (70%), Gaps = 3/185 (2%)
 Frame = +1

Query  106  YLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDALNQC  285
            ++L+ES++GY L   + ++EI   T+AV+  + D + F K+V +V+  PF  A +AL   
Sbjct  5    HILFESSAGYLLLKCNNVEEIASKTKAVQEQINDYHHFSKIVNIVSIYPFADAAEALQNA  64

Query  286  NAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEFVLE  465
            N+VSEG++TD+L++ LE  LPK     K+   LG+++  L + I  E KI    ++  LE
Sbjct  65   NSVSEGELTDQLKSLLEQNLPK---GSKSGVVLGVSDKALATSIKSELKIEGDVSDLSLE  121

Query  466  LLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDTLDK  645
            L+RGVR+H EK IE L  GDL +AQLGLGHSYSRAKVKFNVNR DNM+IQAI L+D LDK
Sbjct  122  LIRGVRIHAEKLIEGLSQGDLLRAQLGLGHSYSRAKVKFNVNRSDNMIIQAIALVDQLDK  181

Query  646  DVNTF  660
            DVNTF
Sbjct  182  DVNTF  186



>ref|XP_008556069.1| PREDICTED: nucleolar protein 56 [Microplitis demolitor]
Length=493

 Score =   189 bits (480),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 96/186 (52%), Positives = 122/186 (66%), Gaps = 3/186 (2%)
 Frame = +1

Query  103  LYLLYESASGYGLFHAHGLDEIGQNTEAVRNSVKDLNRFGKVVKLVAFNPFESALDALNQ  282
            LY+LYE A+GY LF     +E+G     V  SV DL+RF  +VKL+ F PF+SAL AL  
Sbjct  4    LYVLYEHAAGYALFSVSEFEEVGMLLPQVEASVTDLSRFNSIVKLINFTPFKSALTALES  63

Query  283  CNAVSEGQMTDELRNFLELTLPKVKDSKKAKFSLGLAEPKLGSHIFEETKIPCQSNEFVL  462
             NA+SEG + ++L+ FL+  LP    SK    +LG A+ KL + I E   I C     + 
Sbjct  64   INAISEGLLPEDLKLFLDTALPPKISSK---ITLGTADSKLSASITEALSIKCDHTGAIP  120

Query  463  ELLRGVRLHFEKFIENLKAGDLEKAQLGLGHSYSRAKVKFNVNRVDNMVIQAIFLLDTLD  642
            E++RG+R HF + ++ L       AQLGLGHSYSRAKVKFNVNRVDNM+IQ+I LLD LD
Sbjct  121  EIIRGIRYHFPRLVKGLTPQSTAVAQLGLGHSYSRAKVKFNVNRVDNMIIQSIALLDQLD  180

Query  643  KDVNTF  660
            KDVNTF
Sbjct  181  KDVNTF  186



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1023687230320