BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF052I04

Length=662
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009618489.1|  PREDICTED: trafficking protein particle comp...    344   8e-107   Nicotiana tomentosiformis
ref|XP_009778819.1|  PREDICTED: trafficking protein particle comp...    344   8e-107   Nicotiana sylvestris
ref|XP_009618488.1|  PREDICTED: trafficking protein particle comp...    344   9e-107   Nicotiana tomentosiformis
ref|XP_009778818.1|  PREDICTED: trafficking protein particle comp...    344   9e-107   Nicotiana sylvestris
ref|XP_004241792.1|  PREDICTED: trafficking protein particle comp...    344   1e-106   Solanum lycopersicum
ref|XP_006353665.1|  PREDICTED: trafficking protein particle comp...    342   6e-106   Solanum tuberosum [potatoes]
gb|EYU32375.1|  hypothetical protein MIMGU_mgv1a000384mg                330   1e-101   Erythranthe guttata [common monkey flower]
gb|EYU32374.1|  hypothetical protein MIMGU_mgv1a000384mg                330   1e-101   Erythranthe guttata [common monkey flower]
ref|XP_009362334.1|  PREDICTED: uncharacterized protein LOC103952...    304   3e-101   Pyrus x bretschneideri [bai li]
ref|XP_011074995.1|  PREDICTED: trafficking protein particle comp...    327   1e-100   Sesamum indicum [beniseed]
ref|XP_009362333.1|  PREDICTED: trafficking protein particle comp...    304   3e-100   Pyrus x bretschneideri [bai li]
ref|XP_007011772.1|  TRS120 isoform 1                                   325   9e-100   
ref|XP_009122000.1|  PREDICTED: trafficking protein particle comp...    323   7e-99    Brassica rapa
emb|CDX97076.1|  BnaC09g45490D                                          323   7e-99    
emb|CDX69788.1|  BnaA10g21370D                                          322   8e-99    
gb|KFK37733.1|  hypothetical protein AALP_AA3G022200                    321   3e-98    Arabis alpina [alpine rockcress]
ref|XP_010519641.1|  PREDICTED: trafficking protein particle comp...    321   3e-98    Tarenaya hassleriana [spider flower]
ref|XP_006286928.1|  hypothetical protein CARUB_v10000071mg             320   5e-98    Capsella rubella
ref|XP_010453144.1|  PREDICTED: trafficking protein particle comp...    320   6e-98    Camelina sativa [gold-of-pleasure]
ref|XP_010419658.1|  PREDICTED: trafficking protein particle comp...    320   7e-98    Camelina sativa [gold-of-pleasure]
ref|XP_010491797.1|  PREDICTED: trafficking protein particle comp...    320   7e-98    Camelina sativa [gold-of-pleasure]
ref|XP_010048925.1|  PREDICTED: trafficking protein particle comp...    320   7e-98    Eucalyptus grandis [rose gum]
ref|XP_010491799.1|  PREDICTED: trafficking protein particle comp...    320   8e-98    
ref|XP_010048924.1|  PREDICTED: trafficking protein particle comp...    320   9e-98    Eucalyptus grandis [rose gum]
ref|XP_006399603.1|  hypothetical protein EUTSA_v10012483mg             319   1e-97    Eutrema salsugineum [saltwater cress]
ref|NP_196665.1|  protein TRS120                                        318   2e-97    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002871450.1|  hypothetical protein ARALYDRAFT_487936             316   2e-96    
gb|KDO46778.1|  hypothetical protein CISIN_1g045708mg                   315   3e-96    Citrus sinensis [apfelsine]
ref|XP_006483432.1|  PREDICTED: uncharacterized protein LOC102615624    315   4e-96    Citrus sinensis [apfelsine]
ref|XP_006450337.1|  hypothetical protein CICLE_v10007276mg             315   4e-96    
ref|XP_004145518.1|  PREDICTED: uncharacterized protein LOC101217047    315   4e-96    Cucumis sativus [cucumbers]
ref|XP_008219550.1|  PREDICTED: trafficking protein particle comp...    314   1e-95    Prunus mume [ume]
ref|XP_008219549.1|  PREDICTED: trafficking protein particle comp...    314   1e-95    Prunus mume [ume]
ref|XP_008452884.1|  PREDICTED: transport protein particle subuni...    313   2e-95    Cucumis melo [Oriental melon]
ref|XP_010265703.1|  PREDICTED: trafficking protein particle comp...    313   3e-95    Nelumbo nucifera [Indian lotus]
ref|XP_009342628.1|  PREDICTED: LOW QUALITY PROTEIN: trafficking ...    306   5e-95    
ref|XP_009355810.1|  PREDICTED: trafficking protein particle comp...    312   6e-95    Pyrus x bretschneideri [bai li]
emb|CBI21099.3|  unnamed protein product                                310   7e-95    Vitis vinifera
ref|XP_010648709.1|  PREDICTED: trafficking protein particle comp...    311   2e-94    Vitis vinifera
ref|XP_010648710.1|  PREDICTED: trafficking protein particle comp...    311   2e-94    Vitis vinifera
ref|XP_008394132.1|  PREDICTED: trafficking protein particle comp...    310   3e-94    
ref|XP_004290928.1|  PREDICTED: trafficking protein particle comp...    310   3e-94    Fragaria vesca subsp. vesca
ref|XP_011458836.1|  PREDICTED: trafficking protein particle comp...    310   3e-94    Fragaria vesca subsp. vesca
ref|XP_007225443.1|  hypothetical protein PRUPE_ppa000412mg             310   4e-94    Prunus persica
gb|KDP33546.1|  hypothetical protein JCGZ_07117                         308   1e-93    Jatropha curcas
gb|KHG29759.1|  Trafficking particle complex subunit 9                  306   8e-93    Gossypium arboreum [tree cotton]
ref|XP_010244785.1|  PREDICTED: trafficking protein particle comp...    305   1e-92    Nelumbo nucifera [Indian lotus]
ref|XP_010244786.1|  PREDICTED: trafficking protein particle comp...    305   1e-92    Nelumbo nucifera [Indian lotus]
emb|CDP18799.1|  unnamed protein product                                301   4e-91    Coffea canephora [robusta coffee]
ref|XP_010105451.1|  hypothetical protein L484_003461                   300   1e-90    Morus notabilis
gb|KJB07659.1|  hypothetical protein B456_001G035900                    298   5e-90    Gossypium raimondii
ref|XP_002515463.1|  conserved hypothetical protein                     292   7e-88    
ref|XP_010942155.1|  PREDICTED: trafficking protein particle comp...    288   2e-86    
ref|XP_002309653.2|  hypothetical protein POPTR_0006s27580g             288   3e-86    Populus trichocarpa [western balsam poplar]
ref|XP_011036636.1|  PREDICTED: trafficking protein particle comp...    286   6e-86    Populus euphratica
ref|XP_011036637.1|  PREDICTED: trafficking protein particle comp...    286   6e-86    Populus euphratica
ref|XP_006848818.1|  hypothetical protein AMTR_s00026p00150010          286   1e-85    
ref|XP_008784808.1|  PREDICTED: trafficking protein particle comp...    284   5e-85    Phoenix dactylifera
ref|XP_010665754.1|  PREDICTED: trafficking protein particle comp...    283   8e-85    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007161157.1|  hypothetical protein PHAVU_001G047300g             283   1e-84    Phaseolus vulgaris [French bean]
ref|XP_011039615.1|  PREDICTED: trafficking protein particle comp...    283   1e-84    Populus euphratica
gb|KEH39853.1|  transporter TRS120                                      279   3e-83    Medicago truncatula
ref|XP_003550201.1|  PREDICTED: trafficking protein particle comp...    278   5e-83    Glycine max [soybeans]
ref|XP_004498769.1|  PREDICTED: trafficking protein particle comp...    278   5e-83    Cicer arietinum [garbanzo]
ref|XP_006595493.1|  PREDICTED: uncharacterized protein LOC100305...    275   7e-82    Glycine max [soybeans]
ref|XP_009381560.1|  PREDICTED: trafficking protein particle comp...    271   2e-80    Musa acuminata subsp. malaccensis [pisang utan]
emb|CAN82119.1|  hypothetical protein VITISV_024254                     240   2e-76    Vitis vinifera
emb|CAN76628.1|  hypothetical protein VITISV_003544                     233   5e-74    Vitis vinifera
gb|EPS63566.1|  hypothetical protein M569_11217                         237   1e-68    Genlisea aurea
ref|XP_004976134.1|  PREDICTED: trafficking protein particle comp...    237   3e-68    
ref|XP_004976133.1|  PREDICTED: trafficking protein particle comp...    234   4e-67    Setaria italica
tpg|DAA37075.1|  TPA: hypothetical protein ZEAMMB73_993824              233   1e-66    
ref|XP_008669201.1|  PREDICTED: trafficking protein particle comp...    233   1e-66    Zea mays [maize]
ref|XP_002446750.1|  hypothetical protein SORBIDRAFT_06g021740          230   1e-65    
ref|XP_010227185.1|  PREDICTED: LOW QUALITY PROTEIN: trafficking ...    230   2e-65    
emb|CAE01639.1|  OSJNBa0029H02.30                                       226   3e-64    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001053234.1|  Os04g0502200                                       226   5e-64    
gb|EEC77580.1|  hypothetical protein OsI_16530                          225   5e-64    Oryza sativa Indica Group [Indian rice]
ref|XP_001777714.1|  predicted protein                                  223   3e-63    
gb|EMT13211.1|  hypothetical protein F775_03305                         222   1e-62    
ref|XP_001774293.1|  predicted protein                                  215   3e-60    
emb|CAH67557.1|  H0311C03.11                                            213   1e-59    Oryza sativa [red rice]
ref|XP_008347735.1|  PREDICTED: uncharacterized protein LOC103410865    194   2e-58    
ref|XP_008664222.1|  PREDICTED: LOW QUALITY PROTEIN: trafficking ...    195   2e-53    
ref|XP_002965121.1|  hypothetical protein SELMODRAFT_83253              194   8e-53    
ref|XP_002962206.1|  hypothetical protein SELMODRAFT_77626              191   5e-52    
ref|XP_002963095.1|  hypothetical protein SELMODRAFT_165701             187   9e-51    
ref|XP_002980237.1|  hypothetical protein SELMODRAFT_444472             181   3e-48    
ref|XP_005844832.1|  hypothetical protein CHLNCDRAFT_138272             155   4e-39    Chlorella variabilis
ref|XP_002324891.2|  hypothetical protein POPTR_0018s02220g             143   3e-35    
ref|XP_008377455.1|  PREDICTED: cytochrome P450 82A3-like               133   2e-34    
ref|XP_006653574.1|  PREDICTED: trafficking protein particle comp...    141   2e-34    
gb|AFW58777.1|  hypothetical protein ZEAMMB73_746167                    117   8e-30    
ref|XP_011399423.1|  Trafficking protein particle complex subunit 9     122   4e-28    Auxenochlorella protothecoides
gb|EEE61278.1|  hypothetical protein OsJ_15360                          117   3e-26    Oryza sativa Japonica Group [Japonica rice]
gb|KDD72036.1|  hypothetical protein H632_c3968p0                       111   6e-26    Helicosporidium sp. ATCC 50920
ref|XP_643937.1|  hypothetical protein DDB_G0274803                   96.7    5e-19    Dictyostelium discoideum AX4
ref|XP_003290001.1|  hypothetical protein DICPUDRAFT_154468           94.4    3e-18    Dictyostelium purpureum
gb|EMS61444.1|  hypothetical protein TRIUR3_09999                     91.7    2e-17    Triticum urartu
dbj|GAM26879.1|  hypothetical protein SAMD00019534_100540             91.3    3e-17    Acytostelium subglobosum LB1
emb|CEP15600.1|  hypothetical protein                                 91.3    3e-17    Parasitella parasitica
gb|KFH70946.1|  hypothetical protein MVEG_03792                       90.1    7e-17    Mortierella verticillata NRRL 6337
dbj|GAN03919.1|  hypercellular protein                                89.4    1e-16    Mucor ambiguus
gb|EPB91027.1|  hypothetical protein HMPREF1544_02096                 89.4    1e-16    Mucor circinelloides f. circinelloides 1006PhL
gb|ESA21684.1|  hypothetical protein GLOINDRAFT_119508                86.7    1e-15    
ref|XP_002682761.1|  hypothetical protein NAEGRDRAFT_77990            86.3    1e-15    Naegleria gruberi strain NEG-M
gb|EFA80348.1|  histidine kinase DhkG                                 85.9    2e-15    Heterostelium album PN500
ref|XP_006682591.1|  hypothetical protein BATDEDRAFT_28213            84.0    8e-15    Batrachochytrium dendrobatidis JAM81
ref|XP_004361713.1|  histidine kinase                                 83.2    1e-14    Cavenderia fasciculata
gb|KDO21720.1|  hypothetical protein SPRG_13136                       81.6    4e-14    Saprolegnia parasitica CBS 223.65
ref|XP_009530723.1|  hypothetical protein PHYSODRAFT_513497           81.3    6e-14    Phytophthora sojae
ref|XP_008618120.1|  hypothetical protein SDRG_13800                  80.9    7e-14    Saprolegnia diclina VS20
gb|EIE80684.1|  hypothetical protein RO3G_05389                       80.5    1e-13    Rhizopus delemar RA 99-880
gb|ETL89091.1|  hypothetical protein L917_11910                       80.1    1e-13    Phytophthora parasitica
gb|ETK82491.1|  hypothetical protein L915_12150                       80.1    1e-13    Phytophthora parasitica
gb|ETO71095.1|  hypothetical protein F444_12526                       80.1    1e-13    Phytophthora parasitica P1976
gb|ETL35876.1|  hypothetical protein L916_12075                       80.1    1e-13    Phytophthora parasitica
ref|XP_008908759.1|  hypothetical protein PPTG_14018                  80.1    1e-13    Phytophthora parasitica INRA-310
gb|ETI42476.1|  hypothetical protein F443_12424                       80.1    1e-13    Phytophthora parasitica P1569
gb|ETP40315.1|  hypothetical protein F442_12346                       80.1    1e-13    Phytophthora parasitica P10297
emb|CEG81602.1|  hypothetical protein RMATCC62417_15784               79.7    2e-13    Rhizopus microsporus
emb|CEG65590.1|  hypothetical protein RMATCC62417_02344               78.2    5e-13    Rhizopus microsporus
ref|XP_008876428.1|  hypothetical protein H310_11503                  78.2    6e-13    Aphanomyces invadans
emb|CEI98563.1|  hypothetical protein RMCBS344292_12669               77.4    9e-13    Rhizopus microsporus
emb|CEI86846.1|  hypothetical protein RMCBS344292_01273               76.3    2e-12    Rhizopus microsporus
emb|CAN71170.1|  hypothetical protein VITISV_022666                   76.3    2e-12    Vitis vinifera
emb|CEJ01961.1|  hypothetical protein RMCBS344292_15981               75.9    2e-12    Rhizopus microsporus
emb|CDS05824.1|  hypothetical protein LRAMOSA08352                    76.3    2e-12    Lichtheimia ramosa
emb|CEG76765.1|  hypothetical protein RMATCC62417_11620               75.9    3e-12    Rhizopus microsporus
ref|XP_002896003.1|  conserved hypothetical protein                   75.1    5e-12    Phytophthora infestans T30-4
emb|CBN75733.1|  OSJNBa0029H02.30                                     74.3    5e-12    Ectocarpus siliculosus
dbj|GAN09915.1|  hypercellular protein                                74.7    9e-12    Mucor ambiguus
gb|EPB81036.1|  hypothetical protein HMPREF1544_12262                 73.9    1e-11    Mucor circinelloides f. circinelloides 1006PhL
emb|CEP12553.1|  hypothetical protein                                 73.6    2e-11    Parasitella parasitica
ref|XP_002954311.1|  hypothetical protein VOLCADRAFT_106329           67.8    1e-10    Volvox carteri f. nagariensis
ref|XP_005819358.1|  trafficking protein particle complex 9           70.9    1e-10    Guillardia theta CCMP2712
ref|XP_009845683.1|  hypothetical protein H257_18343                  68.9    5e-10    Aphanomyces astaci
gb|EPZ33229.1|  TRAPP II complex, Trs120 domain-containing protein    66.6    2e-09    Rozella allomycis CSF55
ref|XP_007321257.1|  hypothetical protein SERLADRAFT_451500           64.3    2e-08    Serpula lacrymans var. lacrymans S7.9
gb|EMD38404.1|  hypothetical protein CERSUDRAFT_113560                62.0    8e-08    Gelatoporia subvermispora B
ref|XP_004345847.1|  hypothetical protein ACA1_182040                 61.6    9e-08    Acanthamoeba castellanii str. Neff
gb|EMS24343.1|  hypothetical protein RHTO_06347                       59.7    5e-07    Rhodotorula toruloides NP11
emb|CDP20750.1|  unnamed protein product                              55.5    1e-06    Coffea canephora [robusta coffee]
ref|XP_004345072.1|  hypothetical protein CAOG_06323                  58.2    1e-06    Capsaspora owczarzaki ATCC 30864
gb|EGU12099.1|  Transport protein particle complex subunit            58.2    2e-06    Rhodotorula toruloides ATCC 204091
gb|KDR81631.1|  hypothetical protein GALMADRAFT_239700                57.4    2e-06    Galerina marginata CBS 339.88
gb|KII88477.1|  hypothetical protein PLICRDRAFT_110169                56.2    7e-06    Plicaturopsis crispa FD-325 SS-3
gb|EWM27764.1|  TRAPP II complex, Trs120 protein                      53.9    8e-06    Nannochloropsis gaditana
ref|XP_007843830.1|  hypercellular protein                            55.1    2e-05    
gb|KJB65888.1|  hypothetical protein B456_010G117200                  54.7    2e-05    Gossypium raimondii
gb|KJB65886.1|  hypothetical protein B456_010G117200                  54.7    2e-05    Gossypium raimondii
emb|CEG65184.1|  hypothetical protein RMATCC62417_02017               53.9    4e-05    Rhizopus microsporus
gb|KIK57801.1|  hypothetical protein GYMLUDRAFT_45995                 53.1    8e-05    Gymnopus luxurians FD-317 M1
ref|XP_007764740.1|  hypothetical protein CONPUDRAFT_141859           52.4    1e-04    Coniophora puteana RWD-64-598 SS2
gb|KIK47079.1|  hypothetical protein CY34DRAFT_9254                   52.0    2e-04    Suillus luteus UH-Slu-Lm8-n1
ref|NP_001169811.1|  uncharacterized protein LOC100383703             48.9    2e-04    
ref|NP_594102.1|  TRAPP complex subunit Trs120 (predicted)            51.2    3e-04    Schizosaccharomyces pombe
gb|KDQ60798.1|  hypothetical protein JAAARDRAFT_31778                 50.8    4e-04    Jaapia argillacea MUCL 33604



>ref|XP_009618489.1| PREDICTED: trafficking protein particle complex subunit 9 isoform 
X2 [Nicotiana tomentosiformis]
Length=1185

 Score =   344 bits (883),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 161/183 (88%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            MEPDVSIETSCMIRVAVLPIGSI IPLFRDYTSMLVRH+TVSLSSISSFYTEHQKSPF+H
Sbjct  1    MEPDVSIETSCMIRVAVLPIGSITIPLFRDYTSMLVRHYTVSLSSISSFYTEHQKSPFAH  60

Query  294  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  473
            QPWDSGSLRFKFM GGSP SPWEDFQSNRKI AV+GICHCPSSPDL+SV +QF  +CK Y
Sbjct  61   QPWDSGSLRFKFMVGGSPPSPWEDFQSNRKIFAVIGICHCPSSPDLHSVMDQFVTACKSY  120

Query  474  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFEK  653
            SSS+VQRCFAFCPGDSQLED+++KGSN++LFPPADR TQEFHLQTMMQDIAASLLMEFEK
Sbjct  121  SSSVVQRCFAFCPGDSQLEDESFKGSNLILFPPADRQTQEFHLQTMMQDIAASLLMEFEK  180

Query  654  WVL  662
             VL
Sbjct  181  SVL  183



>ref|XP_009778819.1| PREDICTED: trafficking protein particle complex subunit 9 isoform 
X2 [Nicotiana sylvestris]
Length=1185

 Score =   344 bits (883),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 161/183 (88%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            MEPDVSIETSCMIRVAVLPIGSI IPLFRDYTSMLVRH+TVSLSSISSFYTEHQKSPF+H
Sbjct  1    MEPDVSIETSCMIRVAVLPIGSITIPLFRDYTSMLVRHYTVSLSSISSFYTEHQKSPFAH  60

Query  294  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  473
            QPWDSGSLRFKFM GGSP SPWEDFQSNRKI AV+GICHCPSSPDL+SV +QF  +CK Y
Sbjct  61   QPWDSGSLRFKFMVGGSPPSPWEDFQSNRKIFAVIGICHCPSSPDLHSVMDQFVTACKSY  120

Query  474  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFEK  653
            SSS+VQRCFAFCPGDSQLED+++KGSN++LFPPADR TQEFHLQTMMQDIAASLLMEFEK
Sbjct  121  SSSVVQRCFAFCPGDSQLEDESFKGSNLILFPPADRQTQEFHLQTMMQDIAASLLMEFEK  180

Query  654  WVL  662
             VL
Sbjct  181  SVL  183



>ref|XP_009618488.1| PREDICTED: trafficking protein particle complex subunit 9 isoform 
X1 [Nicotiana tomentosiformis]
Length=1188

 Score =   344 bits (883),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 161/183 (88%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            MEPDVSIETSCMIRVAVLPIGSI IPLFRDYTSMLVRH+TVSLSSISSFYTEHQKSPF+H
Sbjct  1    MEPDVSIETSCMIRVAVLPIGSITIPLFRDYTSMLVRHYTVSLSSISSFYTEHQKSPFAH  60

Query  294  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  473
            QPWDSGSLRFKFM GGSP SPWEDFQSNRKI AV+GICHCPSSPDL+SV +QF  +CK Y
Sbjct  61   QPWDSGSLRFKFMVGGSPPSPWEDFQSNRKIFAVIGICHCPSSPDLHSVMDQFVTACKSY  120

Query  474  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFEK  653
            SSS+VQRCFAFCPGDSQLED+++KGSN++LFPPADR TQEFHLQTMMQDIAASLLMEFEK
Sbjct  121  SSSVVQRCFAFCPGDSQLEDESFKGSNLILFPPADRQTQEFHLQTMMQDIAASLLMEFEK  180

Query  654  WVL  662
             VL
Sbjct  181  SVL  183



>ref|XP_009778818.1| PREDICTED: trafficking protein particle complex subunit 9 isoform 
X1 [Nicotiana sylvestris]
Length=1188

 Score =   344 bits (883),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 161/183 (88%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            MEPDVSIETSCMIRVAVLPIGSI IPLFRDYTSMLVRH+TVSLSSISSFYTEHQKSPF+H
Sbjct  1    MEPDVSIETSCMIRVAVLPIGSITIPLFRDYTSMLVRHYTVSLSSISSFYTEHQKSPFAH  60

Query  294  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  473
            QPWDSGSLRFKFM GGSP SPWEDFQSNRKI AV+GICHCPSSPDL+SV +QF  +CK Y
Sbjct  61   QPWDSGSLRFKFMVGGSPPSPWEDFQSNRKIFAVIGICHCPSSPDLHSVMDQFVTACKSY  120

Query  474  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFEK  653
            SSS+VQRCFAFCPGDSQLED+++KGSN++LFPPADR TQEFHLQTMMQDIAASLLMEFEK
Sbjct  121  SSSVVQRCFAFCPGDSQLEDESFKGSNLILFPPADRQTQEFHLQTMMQDIAASLLMEFEK  180

Query  654  WVL  662
             VL
Sbjct  181  SVL  183



>ref|XP_004241792.1| PREDICTED: trafficking protein particle complex subunit 9 isoform 
X1 [Solanum lycopersicum]
Length=1185

 Score =   344 bits (882),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 160/183 (87%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            MEPDVSIETSCMIRVAVLPIGSI IPLFRDYTSMLVRH+TVSLSSISSFYTEHQKSPF+H
Sbjct  1    MEPDVSIETSCMIRVAVLPIGSIAIPLFRDYTSMLVRHYTVSLSSISSFYTEHQKSPFAH  60

Query  294  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  473
            QPWDSGSLRFK+M GGSPASPWEDFQSNRKI AV+GICHCPSSPDL+SV +QF  +CK Y
Sbjct  61   QPWDSGSLRFKYMVGGSPASPWEDFQSNRKIFAVIGICHCPSSPDLHSVMDQFVTACKSY  120

Query  474  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFEK  653
            SSS+VQRCFAFCPGDSQLED+++KGSN++LFPPADR TQEFHLQTMMQDIAASLLM+FEK
Sbjct  121  SSSVVQRCFAFCPGDSQLEDESFKGSNLILFPPADRQTQEFHLQTMMQDIAASLLMKFEK  180

Query  654  WVL  662
             VL
Sbjct  181  SVL  183



>ref|XP_006353665.1| PREDICTED: trafficking protein particle complex subunit 9-like 
[Solanum tuberosum]
Length=1185

 Score =   342 bits (877),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 159/183 (87%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            MEPDVSIETSCMIRVAVLPIGSI IPLFRDYTSMLVRH+TVSLSSISSFYTEHQKSPF+H
Sbjct  1    MEPDVSIETSCMIRVAVLPIGSIAIPLFRDYTSMLVRHYTVSLSSISSFYTEHQKSPFAH  60

Query  294  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  473
            QPWDSGSLRFK+M GGSPASPWEDFQSNRKI AV+GICHCPSSPDL+SV +QF  +CK Y
Sbjct  61   QPWDSGSLRFKYMVGGSPASPWEDFQSNRKIFAVIGICHCPSSPDLHSVMDQFVTACKSY  120

Query  474  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFEK  653
            SSS+V+RCFAFCPGDSQLED+++KGSN++LFPPADR TQEFHLQTMMQDIAASLLM+FEK
Sbjct  121  SSSVVRRCFAFCPGDSQLEDESFKGSNLILFPPADRQTQEFHLQTMMQDIAASLLMKFEK  180

Query  654  WVL  662
             VL
Sbjct  181  SVL  183



>gb|EYU32375.1| hypothetical protein MIMGU_mgv1a000384mg [Erythranthe guttata]
Length=1153

 Score =   330 bits (846),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 154/183 (84%), Positives = 168/183 (92%), Gaps = 0/183 (0%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            MEPD SIETS MIRVAVLPI SIP  LFRDY +ML+RHHTVSL+SISSFYTEHQKSPFS+
Sbjct  1    MEPDASIETSGMIRVAVLPIASIPPLLFRDYAAMLLRHHTVSLNSISSFYTEHQKSPFSN  60

Query  294  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  473
            QPW+SG+LRFKF+ GGSP SPWEDFQSNRK+LAV+GI HCPSSPDL SVA QF  +CKGY
Sbjct  61   QPWESGTLRFKFILGGSPPSPWEDFQSNRKVLAVIGISHCPSSPDLVSVANQFTAACKGY  120

Query  474  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFEK  653
            SSSLVQRCFAFCPGDSQLED++ KGSNI+LFPPADR TQEFHLQTM+QDIAASLLMEFEK
Sbjct  121  SSSLVQRCFAFCPGDSQLEDESVKGSNIILFPPADRQTQEFHLQTMVQDIAASLLMEFEK  180

Query  654  WVL  662
            WVL
Sbjct  181  WVL  183



>gb|EYU32374.1| hypothetical protein MIMGU_mgv1a000384mg [Erythranthe guttata]
Length=1197

 Score =   330 bits (846),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 154/183 (84%), Positives = 168/183 (92%), Gaps = 0/183 (0%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            MEPD SIETS MIRVAVLPI SIP  LFRDY +ML+RHHTVSL+SISSFYTEHQKSPFS+
Sbjct  1    MEPDASIETSGMIRVAVLPIASIPPLLFRDYAAMLLRHHTVSLNSISSFYTEHQKSPFSN  60

Query  294  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  473
            QPW+SG+LRFKF+ GGSP SPWEDFQSNRK+LAV+GI HCPSSPDL SVA QF  +CKGY
Sbjct  61   QPWESGTLRFKFILGGSPPSPWEDFQSNRKVLAVIGISHCPSSPDLVSVANQFTAACKGY  120

Query  474  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFEK  653
            SSSLVQRCFAFCPGDSQLED++ KGSNI+LFPPADR TQEFHLQTM+QDIAASLLMEFEK
Sbjct  121  SSSLVQRCFAFCPGDSQLEDESVKGSNIILFPPADRQTQEFHLQTMVQDIAASLLMEFEK  180

Query  654  WVL  662
            WVL
Sbjct  181  WVL  183



>ref|XP_009362334.1| PREDICTED: uncharacterized protein LOC103952472 isoform X2 [Pyrus 
x bretschneideri]
Length=209

 Score =   304 bits (779),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 143/183 (78%), Positives = 160/183 (87%), Gaps = 0/183 (0%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            MEPDVSIETS MIRVAVLPIG +   L RDY SML+RHHT+ LS+ISSFYTEHQKSPF+H
Sbjct  1    MEPDVSIETSAMIRVAVLPIGHVAPVLLRDYHSMLLRHHTIPLSAISSFYTEHQKSPFAH  60

Query  294  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  473
            QPWDSG+LRFKF+ GG+P SPWEDFQSNRK LAV+GICHCPSSPDL+SV +QF+ +   Y
Sbjct  61   QPWDSGNLRFKFVLGGAPPSPWEDFQSNRKTLAVIGICHCPSSPDLDSVIDQFDSARLAY  120

Query  474  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFEK  653
            SS+LV RCFAFCP DSQLED + KG N++LFPPAD  TQEFHLQTMMQDIAASLLMEFEK
Sbjct  121  SSALVDRCFAFCPADSQLEDGSKKGGNLMLFPPADLATQEFHLQTMMQDIAASLLMEFEK  180

Query  654  WVL  662
            WVL
Sbjct  181  WVL  183



>ref|XP_011074995.1| PREDICTED: trafficking protein particle complex subunit 9 [Sesamum 
indicum]
Length=1196

 Score =   327 bits (839),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 153/183 (84%), Positives = 167/183 (91%), Gaps = 0/183 (0%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            MEPD SIETS MIRVAVLPI  IP  LFRDY +ML+RHHTVSL+SISSFYTEHQKSPF++
Sbjct  1    MEPDASIETSSMIRVAVLPIAGIPPLLFRDYAAMLLRHHTVSLNSISSFYTEHQKSPFAN  60

Query  294  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  473
            QPW+SGSLRFKF+ GGSP SPWEDFQSNRKILAV+GICHCPSSPDL SVA QF  +CK Y
Sbjct  61   QPWESGSLRFKFILGGSPPSPWEDFQSNRKILAVIGICHCPSSPDLRSVANQFAAACKSY  120

Query  474  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFEK  653
            SSSLVQRCFAFCPGDSQLE+++ KGSN+VLFPPADR TQEFHLQTM+QDIAASLLMEFEK
Sbjct  121  SSSLVQRCFAFCPGDSQLEEESNKGSNLVLFPPADRQTQEFHLQTMVQDIAASLLMEFEK  180

Query  654  WVL  662
            WVL
Sbjct  181  WVL  183



>ref|XP_009362333.1| PREDICTED: trafficking protein particle complex subunit 9-like 
isoform X1 [Pyrus x bretschneideri]
Length=282

 Score =   304 bits (779),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 143/183 (78%), Positives = 160/183 (87%), Gaps = 0/183 (0%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            MEPDVSIETS MIRVAVLPIG +   L RDY SML+RHHT+ LS+ISSFYTEHQKSPF+H
Sbjct  1    MEPDVSIETSAMIRVAVLPIGHVAPVLLRDYHSMLLRHHTIPLSAISSFYTEHQKSPFAH  60

Query  294  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  473
            QPWDSG+LRFKF+ GG+P SPWEDFQSNRK LAV+GICHCPSSPDL+SV +QF+ +   Y
Sbjct  61   QPWDSGNLRFKFVLGGAPPSPWEDFQSNRKTLAVIGICHCPSSPDLDSVIDQFDSARLAY  120

Query  474  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFEK  653
            SS+LV RCFAFCP DSQLED + KG N++LFPPAD  TQEFHLQTMMQDIAASLLMEFEK
Sbjct  121  SSALVDRCFAFCPADSQLEDGSKKGGNLMLFPPADLATQEFHLQTMMQDIAASLLMEFEK  180

Query  654  WVL  662
            WVL
Sbjct  181  WVL  183



>ref|XP_007011772.1| TRS120 isoform 1 [Theobroma cacao]
 gb|EOY29391.1| TRS120 isoform 1 [Theobroma cacao]
Length=1201

 Score =   325 bits (834),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 149/183 (81%), Positives = 166/183 (91%), Gaps = 1/183 (1%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            MEPDVSIETSCMIR+AVLPIG +P PL RDY SML+RHH + LS+ISSFYTEHQKSPF+H
Sbjct  1    MEPDVSIETSCMIRIAVLPIGDVPPPLLRDYHSMLLRHHAIPLSTISSFYTEHQKSPFAH  60

Query  294  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  473
            QPWDSGSLRFKF+ GG+P SPWEDFQSNRKILAV+GICHCPSSPDL+ V +QFN +CKGY
Sbjct  61   QPWDSGSLRFKFVLGGAPPSPWEDFQSNRKILAVIGICHCPSSPDLDFVIDQFNAACKGY  120

Query  474  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFEK  653
            +S+LV+RCFAFCPGDSQLE D  K  N+VLFPP+DR TQEFHLQTMMQDIAASLLMEFEK
Sbjct  121  TSALVERCFAFCPGDSQLE-DGKKRENLVLFPPSDRATQEFHLQTMMQDIAASLLMEFEK  179

Query  654  WVL  662
            WVL
Sbjct  180  WVL  182



>ref|XP_009122000.1| PREDICTED: trafficking protein particle complex subunit 9 [Brassica 
rapa]
Length=1183

 Score =   323 bits (827),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 147/183 (80%), Positives = 167/183 (91%), Gaps = 0/183 (0%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            MEPDVSIET  +IR+AVLPIG+IP PL RDY SML+RHHT++LS+ISSFYTEHQKSPF++
Sbjct  1    MEPDVSIETLSIIRIAVLPIGTIPPPLLRDYHSMLLRHHTIALSAISSFYTEHQKSPFTN  60

Query  294  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  473
            QPWDSGSLRFKF+ GGSP SPWEDFQSNRKILAV+G+CHCPSSPDL SV E FNV+C+ Y
Sbjct  61   QPWDSGSLRFKFVLGGSPPSPWEDFQSNRKILAVIGLCHCPSSPDLVSVTESFNVACRSY  120

Query  474  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFEK  653
            SS+LV+RCFAFCPGDSQLED   KG N++LFPP+D+ TQEFHLQTMMQDIAASLLMEFEK
Sbjct  121  SSALVRRCFAFCPGDSQLEDGDKKGENLILFPPSDKQTQEFHLQTMMQDIAASLLMEFEK  180

Query  654  WVL  662
            WVL
Sbjct  181  WVL  183



>emb|CDX97076.1| BnaC09g45490D [Brassica napus]
Length=1183

 Score =   323 bits (827),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 147/183 (80%), Positives = 167/183 (91%), Gaps = 0/183 (0%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            MEPDVSIET  +IR+AVLPIG+IP PL RDY SML+RHHT++LS+ISSFYTEHQKSPF++
Sbjct  1    MEPDVSIETLSIIRIAVLPIGTIPPPLLRDYHSMLLRHHTIALSAISSFYTEHQKSPFTN  60

Query  294  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  473
            QPWDSGSLRFKF+ GGSP SPWEDFQSNRKILAV+G+CHCPSSPDL SV E FNV+C+ Y
Sbjct  61   QPWDSGSLRFKFVLGGSPPSPWEDFQSNRKILAVIGLCHCPSSPDLVSVTESFNVACRSY  120

Query  474  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFEK  653
            SS+LV+RCFAFCPGDSQLED   KG N++LFPP+D+ TQEFHLQTMMQDIAASLLMEFEK
Sbjct  121  SSALVRRCFAFCPGDSQLEDGDKKGENLILFPPSDKQTQEFHLQTMMQDIAASLLMEFEK  180

Query  654  WVL  662
            WVL
Sbjct  181  WVL  183



>emb|CDX69788.1| BnaA10g21370D [Brassica napus]
Length=1183

 Score =   322 bits (826),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 147/183 (80%), Positives = 167/183 (91%), Gaps = 0/183 (0%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            MEPDVSIET  +IR+AVLPIG+IP PL RDY SML+RHHT++LS+ISSFYTEHQKSPF++
Sbjct  1    MEPDVSIETLSIIRIAVLPIGTIPPPLLRDYHSMLLRHHTIALSAISSFYTEHQKSPFTN  60

Query  294  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  473
            QPWDSGSLRFKF+ GGSP SPWEDFQSNRKILAV+G+CHCPSSPDL SV E FNV+C+ Y
Sbjct  61   QPWDSGSLRFKFVLGGSPPSPWEDFQSNRKILAVIGLCHCPSSPDLVSVTESFNVACRSY  120

Query  474  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFEK  653
            SS+LV+RCFAFCPGDSQLED   KG N++LFPP+D+ TQEFHLQTMMQDIAASLLMEFEK
Sbjct  121  SSALVRRCFAFCPGDSQLEDGDKKGENLILFPPSDKQTQEFHLQTMMQDIAASLLMEFEK  180

Query  654  WVL  662
            WVL
Sbjct  181  WVL  183



>gb|KFK37733.1| hypothetical protein AALP_AA3G022200 [Arabis alpina]
Length=1187

 Score =   321 bits (823),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 147/183 (80%), Positives = 166/183 (91%), Gaps = 0/183 (0%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            MEPDVSIET  +IR+AVLPIG+IP  L RDY SML+RHHT++LS+ISSFYTEHQKSPF++
Sbjct  1    MEPDVSIETLSIIRIAVLPIGTIPPSLLRDYHSMLLRHHTIALSAISSFYTEHQKSPFTN  60

Query  294  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  473
            QPWDSGSLRFKF+ GGSP SPWEDFQSNRKILAV+G+CHCPSSPDL SV E FNV+CK Y
Sbjct  61   QPWDSGSLRFKFVLGGSPPSPWEDFQSNRKILAVIGLCHCPSSPDLVSVTEDFNVACKSY  120

Query  474  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFEK  653
            SS+LV+RCFAFCPGDSQLED   KG N++LFPP+D+ TQEFHLQTMMQDIAASLLMEFEK
Sbjct  121  SSALVRRCFAFCPGDSQLEDGDKKGENLILFPPSDKQTQEFHLQTMMQDIAASLLMEFEK  180

Query  654  WVL  662
            WVL
Sbjct  181  WVL  183



>ref|XP_010519641.1| PREDICTED: trafficking protein particle complex subunit 9 [Tarenaya 
hassleriana]
Length=1188

 Score =   321 bits (822),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 146/183 (80%), Positives = 167/183 (91%), Gaps = 0/183 (0%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            MEPDVSIETS MIR+AVLPIG+IP  + R+Y S+L+RHHT+ LS+ISSFYTEHQKSPF++
Sbjct  1    MEPDVSIETSSMIRIAVLPIGTIPPAILREYHSILLRHHTIPLSAISSFYTEHQKSPFTN  60

Query  294  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  473
            QPWDSGSLRFKF+ GG+P SPWEDFQS+RKILAV+G+CHCPSSPDL +V EQFNV+CK Y
Sbjct  61   QPWDSGSLRFKFVLGGAPPSPWEDFQSHRKILAVIGLCHCPSSPDLAAVIEQFNVACKSY  120

Query  474  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFEK  653
            SS+LV+RCFAFCPGDSQLED   KG N++LFPPADR TQEFHLQTMMQDIAASLLMEFEK
Sbjct  121  SSALVRRCFAFCPGDSQLEDGDKKGDNLILFPPADRRTQEFHLQTMMQDIAASLLMEFEK  180

Query  654  WVL  662
            WVL
Sbjct  181  WVL  183



>ref|XP_006286928.1| hypothetical protein CARUB_v10000071mg [Capsella rubella]
 gb|EOA19826.1| hypothetical protein CARUB_v10000071mg [Capsella rubella]
Length=1186

 Score =   320 bits (821),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 146/183 (80%), Positives = 168/183 (92%), Gaps = 0/183 (0%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            MEPDVSIETS +IR+AVLPIG+IP  L RDY SML+RHHT++LS+ISSFYTEHQKSPF++
Sbjct  1    MEPDVSIETSSIIRIAVLPIGTIPPTLLRDYHSMLLRHHTIALSAISSFYTEHQKSPFTN  60

Query  294  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  473
            QPWDSGSLRFKF+ GGSP SPWEDFQSNRKILAV+G+CHCPSSPDL+ V E+FNV+CK Y
Sbjct  61   QPWDSGSLRFKFVLGGSPPSPWEDFQSNRKILAVIGLCHCPSSPDLDYVTEKFNVACKSY  120

Query  474  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFEK  653
            SS+LV+RCFAF PGDSQLED   KG+N++LFPP+D+ TQEFHLQTMMQDIAASLLMEFEK
Sbjct  121  SSALVRRCFAFSPGDSQLEDGDKKGANLILFPPSDKQTQEFHLQTMMQDIAASLLMEFEK  180

Query  654  WVL  662
            WVL
Sbjct  181  WVL  183



>ref|XP_010453144.1| PREDICTED: trafficking protein particle complex subunit 9-like 
[Camelina sativa]
Length=1186

 Score =   320 bits (820),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 145/183 (79%), Positives = 167/183 (91%), Gaps = 0/183 (0%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            MEPDVSIET  +IR+AVLPIG+IP  L RDY SML+RHHT++LS++SSFYTEHQKSPF++
Sbjct  1    MEPDVSIETLSIIRIAVLPIGTIPPTLLRDYHSMLLRHHTIALSAVSSFYTEHQKSPFTN  60

Query  294  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  473
            QPWDSGSLRFKF+ GGSP SPWEDFQSNRKILAV+G+CHCPSSPDL+SV E+FNV+CK Y
Sbjct  61   QPWDSGSLRFKFVLGGSPPSPWEDFQSNRKILAVIGLCHCPSSPDLDSVTEKFNVACKSY  120

Query  474  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFEK  653
            SS+LV+RCFAF PGDSQLED   KG N++LFPP+D+ TQEFHLQTMMQDIAASLLMEFEK
Sbjct  121  SSALVRRCFAFSPGDSQLEDGDKKGENVILFPPSDKQTQEFHLQTMMQDIAASLLMEFEK  180

Query  654  WVL  662
            WVL
Sbjct  181  WVL  183



>ref|XP_010419658.1| PREDICTED: trafficking protein particle complex subunit 9-like 
isoform X1 [Camelina sativa]
 ref|XP_010419659.1| PREDICTED: trafficking protein particle complex subunit 9-like 
isoform X2 [Camelina sativa]
Length=1186

 Score =   320 bits (820),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 145/183 (79%), Positives = 167/183 (91%), Gaps = 0/183 (0%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            MEPDVSIET  +IR+AVLPIG+IP  L RDY SML+RHHT++LS++SSFYTEHQKSPF++
Sbjct  1    MEPDVSIETLSIIRIAVLPIGTIPQTLLRDYHSMLLRHHTIALSAVSSFYTEHQKSPFTN  60

Query  294  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  473
            QPWDSGSLRFKF+ GGSP SPWEDFQSNRKILAV+G+CHCPSSPDL+SV E+FNV+CK Y
Sbjct  61   QPWDSGSLRFKFVLGGSPPSPWEDFQSNRKILAVIGLCHCPSSPDLDSVTEKFNVACKSY  120

Query  474  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFEK  653
            SS+LV+RCFAF PGDSQLED   KG N++LFPP+D+ TQEFHLQTMMQDIAASLLMEFEK
Sbjct  121  SSALVRRCFAFSPGDSQLEDGDKKGENLILFPPSDKQTQEFHLQTMMQDIAASLLMEFEK  180

Query  654  WVL  662
            WVL
Sbjct  181  WVL  183



>ref|XP_010491797.1| PREDICTED: trafficking protein particle complex subunit 9-like 
isoform X1 [Camelina sativa]
Length=1186

 Score =   320 bits (820),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 145/183 (79%), Positives = 166/183 (91%), Gaps = 0/183 (0%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            MEPDVSIET  +IR+AVLPIG+IP  L RDY SML+RHHT++LS++SSFYTEHQKSPF++
Sbjct  1    MEPDVSIETLSIIRIAVLPIGTIPQTLLRDYHSMLLRHHTIALSAVSSFYTEHQKSPFTN  60

Query  294  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  473
            QPWDSGSLRFKF+ GGSP SPWEDFQSNRKILAV+G+CHCPSSPDL+SV E FNV+CK Y
Sbjct  61   QPWDSGSLRFKFVLGGSPPSPWEDFQSNRKILAVIGLCHCPSSPDLDSVTENFNVACKSY  120

Query  474  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFEK  653
            SS+LV+RCFAF PGDSQLED   KG N++LFPP+D+ TQEFHLQTMMQDIAASLLMEFEK
Sbjct  121  SSALVRRCFAFSPGDSQLEDGDKKGENLILFPPSDKQTQEFHLQTMMQDIAASLLMEFEK  180

Query  654  WVL  662
            WVL
Sbjct  181  WVL  183



>ref|XP_010048925.1| PREDICTED: trafficking protein particle complex subunit 9 isoform 
X2 [Eucalyptus grandis]
Length=1198

 Score =   320 bits (820),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 145/183 (79%), Positives = 164/183 (90%), Gaps = 0/183 (0%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            MEPDVSIET  MIRVAVLP+G +P PL RDY +ML+RH +VSLS+ISSFYTEHQKSPF++
Sbjct  1    MEPDVSIETGAMIRVAVLPVGHVPTPLLRDYAAMLLRHGSVSLSAISSFYTEHQKSPFAN  60

Query  294  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  473
            QPWDSGSLRFKF+ GGSP SPWEDFQSNRKILAV+G+CHCPSSPDL+ V EQF V CKGY
Sbjct  61   QPWDSGSLRFKFVIGGSPPSPWEDFQSNRKILAVVGVCHCPSSPDLDDVIEQFGVKCKGY  120

Query  474  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFEK  653
            +S+LV+RCFAFCP D+QLED + K SN+ LFPPADR TQEFHLQTMMQD+AASLLMEFEK
Sbjct  121  ASALVRRCFAFCPSDTQLEDGSKKDSNLKLFPPADRQTQEFHLQTMMQDVAASLLMEFEK  180

Query  654  WVL  662
            WVL
Sbjct  181  WVL  183



>ref|XP_010491799.1| PREDICTED: trafficking protein particle complex subunit 9-like 
isoform X2 [Camelina sativa]
Length=1196

 Score =   320 bits (819),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 145/183 (79%), Positives = 166/183 (91%), Gaps = 0/183 (0%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            MEPDVSIET  +IR+AVLPIG+IP  L RDY SML+RHHT++LS++SSFYTEHQKSPF++
Sbjct  1    MEPDVSIETLSIIRIAVLPIGTIPQTLLRDYHSMLLRHHTIALSAVSSFYTEHQKSPFTN  60

Query  294  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  473
            QPWDSGSLRFKF+ GGSP SPWEDFQSNRKILAV+G+CHCPSSPDL+SV E FNV+CK Y
Sbjct  61   QPWDSGSLRFKFVLGGSPPSPWEDFQSNRKILAVIGLCHCPSSPDLDSVTENFNVACKSY  120

Query  474  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFEK  653
            SS+LV+RCFAF PGDSQLED   KG N++LFPP+D+ TQEFHLQTMMQDIAASLLMEFEK
Sbjct  121  SSALVRRCFAFSPGDSQLEDGDKKGENLILFPPSDKQTQEFHLQTMMQDIAASLLMEFEK  180

Query  654  WVL  662
            WVL
Sbjct  181  WVL  183



>ref|XP_010048924.1| PREDICTED: trafficking protein particle complex subunit 9 isoform 
X1 [Eucalyptus grandis]
 gb|KCW81340.1| hypothetical protein EUGRSUZ_C02726 [Eucalyptus grandis]
Length=1202

 Score =   320 bits (819),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 145/183 (79%), Positives = 164/183 (90%), Gaps = 0/183 (0%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            MEPDVSIET  MIRVAVLP+G +P PL RDY +ML+RH +VSLS+ISSFYTEHQKSPF++
Sbjct  1    MEPDVSIETGAMIRVAVLPVGHVPTPLLRDYAAMLLRHGSVSLSAISSFYTEHQKSPFAN  60

Query  294  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  473
            QPWDSGSLRFKF+ GGSP SPWEDFQSNRKILAV+G+CHCPSSPDL+ V EQF V CKGY
Sbjct  61   QPWDSGSLRFKFVIGGSPPSPWEDFQSNRKILAVVGVCHCPSSPDLDDVIEQFGVKCKGY  120

Query  474  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFEK  653
            +S+LV+RCFAFCP D+QLED + K SN+ LFPPADR TQEFHLQTMMQD+AASLLMEFEK
Sbjct  121  ASALVRRCFAFCPSDTQLEDGSKKDSNLKLFPPADRQTQEFHLQTMMQDVAASLLMEFEK  180

Query  654  WVL  662
            WVL
Sbjct  181  WVL  183



>ref|XP_006399603.1| hypothetical protein EUTSA_v10012483mg [Eutrema salsugineum]
 gb|ESQ41056.1| hypothetical protein EUTSA_v10012483mg [Eutrema salsugineum]
Length=1187

 Score =   319 bits (818),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 146/183 (80%), Positives = 166/183 (91%), Gaps = 0/183 (0%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            MEPDVSIET  +IR+AVLPIG+IP  L +DY SML+RHHT++LS+ISSFYTEHQKSPF++
Sbjct  1    MEPDVSIETLSIIRIAVLPIGTIPPALLQDYHSMLLRHHTIALSAISSFYTEHQKSPFTN  60

Query  294  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  473
            QPWDSGSLRFKF+ GGSP SPWEDFQSNRKILAV+G+CHCPSSPDL SV E FNV+CK Y
Sbjct  61   QPWDSGSLRFKFVLGGSPPSPWEDFQSNRKILAVIGLCHCPSSPDLISVTESFNVACKSY  120

Query  474  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFEK  653
            SS+LV+RCFAFCPGDSQLED   KG N++LFPP+D+ TQEFHLQTMMQDIAASLLMEFEK
Sbjct  121  SSALVRRCFAFCPGDSQLEDGDKKGENLILFPPSDKQTQEFHLQTMMQDIAASLLMEFEK  180

Query  654  WVL  662
            WVL
Sbjct  181  WVL  183



>ref|NP_196665.1| protein TRS120 [Arabidopsis thaliana]
 sp|Q9FY61.1|TR120_ARATH RecName: Full=Trafficking protein particle complex II-specific 
subunit 120 homolog; Short=AtTRS120; Short=TRAPP II-specific 
subunit 120 homolog; AltName: Full=Protein VASCULAR NETWORK 
DEFECTIVE 4 [Arabidopsis thaliana]
 emb|CAC03452.1| putative protein [Arabidopsis thaliana]
 gb|AED91628.1| protein TRS120 [Arabidopsis thaliana]
Length=1186

 Score =   318 bits (816),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 145/183 (79%), Positives = 167/183 (91%), Gaps = 0/183 (0%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            MEPDVSIET  +IR+AVLPIG+IP  L RDY SML+RHHT++LS+ISSFYTEHQKSPF++
Sbjct  1    MEPDVSIETLSIIRIAVLPIGTIPPTLLRDYHSMLLRHHTIALSAISSFYTEHQKSPFTN  60

Query  294  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  473
            QPWDSGSLRFKF+ GGSP SPWEDFQSNRK+LAV+G+CHCPSSPDL+SV E+FNV+CK Y
Sbjct  61   QPWDSGSLRFKFVLGGSPPSPWEDFQSNRKMLAVIGLCHCPSSPDLDSVTEKFNVACKSY  120

Query  474  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFEK  653
            SS+LV+RCFAF PGDSQLED   KG N++LFPP+D+ TQEFHLQTMMQDIAASLLMEFEK
Sbjct  121  SSALVRRCFAFSPGDSQLEDGDKKGENLILFPPSDKQTQEFHLQTMMQDIAASLLMEFEK  180

Query  654  WVL  662
            WVL
Sbjct  181  WVL  183



>ref|XP_002871450.1| hypothetical protein ARALYDRAFT_487936 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47709.1| hypothetical protein ARALYDRAFT_487936 [Arabidopsis lyrata subsp. 
lyrata]
Length=1186

 Score =   316 bits (809),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 144/183 (79%), Positives = 166/183 (91%), Gaps = 0/183 (0%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            MEPDVSIET  +IR+AVLPIG+IP  L RDY SML+RHHT++LS+ISSFYTEHQKSPF++
Sbjct  1    MEPDVSIETLSIIRIAVLPIGTIPPTLLRDYHSMLLRHHTIALSAISSFYTEHQKSPFTN  60

Query  294  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  473
            QPWDSGSLRFKF+ GGSP SPWEDFQSNRK+LAV+G+CHCPSSPDL+SV E+FNV+CK Y
Sbjct  61   QPWDSGSLRFKFVLGGSPPSPWEDFQSNRKMLAVIGLCHCPSSPDLDSVTEKFNVACKSY  120

Query  474  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFEK  653
            SS+LV+RCFAF P DSQLED   KG N++LFPP+D+ TQEFHLQTMMQDIAASLLMEFEK
Sbjct  121  SSALVRRCFAFSPDDSQLEDGDKKGENLILFPPSDKQTQEFHLQTMMQDIAASLLMEFEK  180

Query  654  WVL  662
            WVL
Sbjct  181  WVL  183



>gb|KDO46778.1| hypothetical protein CISIN_1g045708mg [Citrus sinensis]
Length=1196

 Score =   315 bits (808),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 143/183 (78%), Positives = 165/183 (90%), Gaps = 0/183 (0%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            MEPDVS+ETS MIR+AVLPIG++P  L RDY SML+RHHT+ LS+ISSFYTEHQKSPF++
Sbjct  1    MEPDVSMETSSMIRIAVLPIGTVPPTLLRDYHSMLLRHHTIPLSAISSFYTEHQKSPFTN  60

Query  294  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  473
            QPWDSGSLRFKF+ GG+P SPWEDFQSNRKILAV+GICHCPSSPDL+SV EQFN +CKGY
Sbjct  61   QPWDSGSLRFKFVLGGAPPSPWEDFQSNRKILAVIGICHCPSSPDLDSVIEQFNAACKGY  120

Query  474  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFEK  653
            +S+LV+RCFAF P DS LE+   KG N+++FPPAD+ TQEFHLQTMMQDIAASLLMEFEK
Sbjct  121  NSALVKRCFAFSPCDSHLEEGGKKGDNLIMFPPADQQTQEFHLQTMMQDIAASLLMEFEK  180

Query  654  WVL  662
            WVL
Sbjct  181  WVL  183



>ref|XP_006483432.1| PREDICTED: uncharacterized protein LOC102615624 [Citrus sinensis]
Length=1196

 Score =   315 bits (808),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 143/183 (78%), Positives = 165/183 (90%), Gaps = 0/183 (0%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            MEPDVS+ETS MIR+AVLPIG++P  L RDY SML+RHHT+ LS+ISSFYTEHQKSPF++
Sbjct  1    MEPDVSMETSSMIRIAVLPIGTVPPTLLRDYHSMLLRHHTIPLSAISSFYTEHQKSPFTN  60

Query  294  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  473
            QPWDSGSLRFKF+ GG+P SPWEDFQSNRKILAV+GICHCPSSPDL+SV EQFN +CKGY
Sbjct  61   QPWDSGSLRFKFVLGGAPPSPWEDFQSNRKILAVIGICHCPSSPDLDSVIEQFNAACKGY  120

Query  474  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFEK  653
            +S+LV+RCFAF P DS LE+   KG N+++FPPAD+ TQEFHLQTMMQDIAASLLMEFEK
Sbjct  121  NSALVKRCFAFSPCDSHLEEGGKKGDNLIMFPPADQQTQEFHLQTMMQDIAASLLMEFEK  180

Query  654  WVL  662
            WVL
Sbjct  181  WVL  183



>ref|XP_006450337.1| hypothetical protein CICLE_v10007276mg [Citrus clementina]
 gb|ESR63577.1| hypothetical protein CICLE_v10007276mg [Citrus clementina]
Length=1193

 Score =   315 bits (808),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 143/183 (78%), Positives = 165/183 (90%), Gaps = 0/183 (0%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            MEPDVS+ETS MIR+AVLPIG++P  L RDY SML+RHHT+ LS+ISSFYTEHQKSPF++
Sbjct  1    MEPDVSMETSSMIRIAVLPIGTVPPTLLRDYHSMLLRHHTIPLSAISSFYTEHQKSPFTN  60

Query  294  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  473
            QPWDSGSLRFKF+ GG+P SPWEDFQSNRKILAV+GICHCPSSPDL+SV EQFN +CKGY
Sbjct  61   QPWDSGSLRFKFVLGGAPPSPWEDFQSNRKILAVIGICHCPSSPDLDSVIEQFNAACKGY  120

Query  474  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFEK  653
            +S+LV+RCFAF P DS LE+   KG N+++FPPAD+ TQEFHLQTMMQDIAASLLMEFEK
Sbjct  121  NSALVKRCFAFSPCDSHLEEGGKKGDNLIMFPPADQQTQEFHLQTMMQDIAASLLMEFEK  180

Query  654  WVL  662
            WVL
Sbjct  181  WVL  183



>ref|XP_004145518.1| PREDICTED: uncharacterized protein LOC101217047 [Cucumis sativus]
 ref|XP_004157090.1| PREDICTED: uncharacterized LOC101217047 [Cucumis sativus]
 gb|KGN55459.1| hypothetical protein Csa_4G652710 [Cucumis sativus]
Length=1196

 Score =   315 bits (807),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 147/183 (80%), Positives = 160/183 (87%), Gaps = 0/183 (0%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            MEPDVSIETS MIRVAVLPIGS+P  L RDY SML+RH  + LS+ISSFYTEHQKSPFSH
Sbjct  1    MEPDVSIETSSMIRVAVLPIGSVPPTLLRDYLSMLLRHQLIPLSAISSFYTEHQKSPFSH  60

Query  294  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  473
            QPWDSGSLRFKF+ GG P +PWEDFQSNRKILAV+GICHCPSSPDL+SV +QFN SCK Y
Sbjct  61   QPWDSGSLRFKFILGGDPPNPWEDFQSNRKILAVIGICHCPSSPDLDSVIDQFNASCKSY  120

Query  474  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFEK  653
             S+LV+RCFAFCP DSQLE+   KG N+ LFPPADR TQEFHL TMMQDIAASLLMEFEK
Sbjct  121  PSALVERCFAFCPDDSQLEEGCKKGGNLRLFPPADRQTQEFHLNTMMQDIAASLLMEFEK  180

Query  654  WVL  662
            WVL
Sbjct  181  WVL  183



>ref|XP_008219550.1| PREDICTED: trafficking protein particle complex subunit 9 isoform 
X2 [Prunus mume]
Length=1200

 Score =   314 bits (804),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 145/183 (79%), Positives = 163/183 (89%), Gaps = 0/183 (0%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            MEPDVSIETS MIRVAVLPIG +P  L RDY SML+RH T+ LS+ISSFYTEHQKSPFS+
Sbjct  1    MEPDVSIETSSMIRVAVLPIGHVPPVLLRDYHSMLLRHQTIPLSAISSFYTEHQKSPFSN  60

Query  294  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  473
            QPWDSGSLRFKF+ GG+P SPWEDFQSNRK LAV+GICHCPSSPDL+SV +QF+ + + Y
Sbjct  61   QPWDSGSLRFKFIVGGAPPSPWEDFQSNRKTLAVIGICHCPSSPDLDSVIDQFDSARRAY  120

Query  474  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFEK  653
            +S+LV RCFAFCPGDSQLED + KG N++LFPPADR TQEFHLQTMMQDIAASLLMEFEK
Sbjct  121  ASALVDRCFAFCPGDSQLEDGSKKGGNLMLFPPADRATQEFHLQTMMQDIAASLLMEFEK  180

Query  654  WVL  662
            WVL
Sbjct  181  WVL  183



>ref|XP_008219549.1| PREDICTED: trafficking protein particle complex subunit 9 isoform 
X1 [Prunus mume]
Length=1201

 Score =   314 bits (804),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 145/183 (79%), Positives = 163/183 (89%), Gaps = 0/183 (0%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            MEPDVSIETS MIRVAVLPIG +P  L RDY SML+RH T+ LS+ISSFYTEHQKSPFS+
Sbjct  1    MEPDVSIETSSMIRVAVLPIGHVPPVLLRDYHSMLLRHQTIPLSAISSFYTEHQKSPFSN  60

Query  294  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  473
            QPWDSGSLRFKF+ GG+P SPWEDFQSNRK LAV+GICHCPSSPDL+SV +QF+ + + Y
Sbjct  61   QPWDSGSLRFKFIVGGAPPSPWEDFQSNRKTLAVIGICHCPSSPDLDSVIDQFDSARRAY  120

Query  474  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFEK  653
            +S+LV RCFAFCPGDSQLED + KG N++LFPPADR TQEFHLQTMMQDIAASLLMEFEK
Sbjct  121  ASALVDRCFAFCPGDSQLEDGSKKGGNLMLFPPADRATQEFHLQTMMQDIAASLLMEFEK  180

Query  654  WVL  662
            WVL
Sbjct  181  WVL  183



>ref|XP_008452884.1| PREDICTED: transport protein particle subunit trs120 [Cucumis 
melo]
Length=1196

 Score =   313 bits (802),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 143/183 (78%), Positives = 160/183 (87%), Gaps = 0/183 (0%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            MEPDVSIET  MIRVAVLP+GS+P  L RDY SML+RH  + LS+ISSFYTEHQKSPFSH
Sbjct  1    MEPDVSIETGSMIRVAVLPVGSVPPTLLRDYLSMLLRHQLIPLSAISSFYTEHQKSPFSH  60

Query  294  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  473
            QPWDSGSLRFKF+ GG P +PWEDFQSNRKILAV+GICHCPSSPDL+S  +QFN +CK Y
Sbjct  61   QPWDSGSLRFKFILGGDPPNPWEDFQSNRKILAVIGICHCPSSPDLDSAIDQFNAACKSY  120

Query  474  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFEK  653
            +S+LV+RCFAFCP DSQLE+ + KG N+ LFPPADR TQEFHL TMMQDIAASLLMEFEK
Sbjct  121  TSALVERCFAFCPDDSQLEEGSKKGGNLRLFPPADRQTQEFHLNTMMQDIAASLLMEFEK  180

Query  654  WVL  662
            WVL
Sbjct  181  WVL  183



>ref|XP_010265703.1| PREDICTED: trafficking protein particle complex subunit 9-like 
[Nelumbo nucifera]
Length=1204

 Score =   313 bits (801),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 140/183 (77%), Positives = 161/183 (88%), Gaps = 0/183 (0%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            MEPDVSIE+ CM+R+AVLPIG++P    RDY SMLVRH  V LS+ISSFYTEHQKSPF++
Sbjct  1    MEPDVSIESGCMLRIAVLPIGTVPQAQLRDYVSMLVRHRKVELSAISSFYTEHQKSPFAN  60

Query  294  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  473
            QPWD+GSLRFKFM GGSP SPWEDFQSNRKILAV+GICHCPSSPDL+ VA+QF++ CK Y
Sbjct  61   QPWDTGSLRFKFMVGGSPPSPWEDFQSNRKILAVIGICHCPSSPDLDVVADQFSIVCKNY  120

Query  474  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFEK  653
            +S++VQRCFAF PGD+QLED   +G N++LFPPADR T EFHL TMMQDIAASLLMEFEK
Sbjct  121  TSAVVQRCFAFSPGDAQLEDGGKRGDNLILFPPADRQTLEFHLLTMMQDIAASLLMEFEK  180

Query  654  WVL  662
            WVL
Sbjct  181  WVL  183



>ref|XP_009342628.1| PREDICTED: LOW QUALITY PROTEIN: trafficking protein particle 
complex subunit 9-like [Pyrus x bretschneideri]
Length=824

 Score =   306 bits (785),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 142/183 (78%), Positives = 160/183 (87%), Gaps = 0/183 (0%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            MEPDVSIETS MIRVAVLPIG +   L RDY SML+RHHT+ LS+ISSFYTEHQKSPF+H
Sbjct  1    MEPDVSIETSAMIRVAVLPIGHVAPVLLRDYHSMLLRHHTIPLSAISSFYTEHQKSPFAH  60

Query  294  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  473
            QPWDSG+LRFKF+ GG+P SPWEDFQSNRK LAV+GICHCPSSPDL+S+ +QF+ +   Y
Sbjct  61   QPWDSGNLRFKFVLGGAPPSPWEDFQSNRKTLAVIGICHCPSSPDLDSIIDQFDSARLAY  120

Query  474  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFEK  653
            SS+LV RCFAFCP DSQLED + KG N++LFPPAD  TQEFHLQTMMQDIAASLLMEFEK
Sbjct  121  SSALVDRCFAFCPADSQLEDGSKKGGNLMLFPPADLATQEFHLQTMMQDIAASLLMEFEK  180

Query  654  WVL  662
            WVL
Sbjct  181  WVL  183



>ref|XP_009355810.1| PREDICTED: trafficking protein particle complex subunit 9 isoform 
X1 [Pyrus x bretschneideri]
Length=1202

 Score =   312 bits (799),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 144/183 (79%), Positives = 162/183 (89%), Gaps = 0/183 (0%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            MEPDVSIETS MIRVAVLPIG +P  L RDY SML+RH T+ LS+ISSFYTEHQKSPF+H
Sbjct  1    MEPDVSIETSSMIRVAVLPIGHVPPVLLRDYHSMLLRHQTIPLSAISSFYTEHQKSPFAH  60

Query  294  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  473
            QPWDSG+LRFKF+ GG+P SPWEDFQSNRK LAV+GICHCPSSPDL+SV +QF+ + + Y
Sbjct  61   QPWDSGNLRFKFVLGGAPPSPWEDFQSNRKTLAVIGICHCPSSPDLDSVIDQFDSARRAY  120

Query  474  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFEK  653
            SS+LV RCFAFCPGDSQLED + KG N++LFPPADR T EFHLQTMMQDIAASLLMEFEK
Sbjct  121  SSALVDRCFAFCPGDSQLEDGSKKGGNLMLFPPADRATLEFHLQTMMQDIAASLLMEFEK  180

Query  654  WVL  662
            WVL
Sbjct  181  WVL  183



>emb|CBI21099.3| unnamed protein product [Vitis vinifera]
Length=1056

 Score =   310 bits (795),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 140/183 (77%), Positives = 164/183 (90%), Gaps = 0/183 (0%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            MEPDVSIETS MIRVAV+P+G +P    RDY++ML+RH T+SLS+ISSFYTEHQKSPFS+
Sbjct  1    MEPDVSIETSSMIRVAVIPVGPVPPNHLRDYSAMLLRHCTISLSTISSFYTEHQKSPFSN  60

Query  294  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  473
            QPWDSGSLRFKFM GGSP+SPWEDFQSNRKILAV+G+CHCPSSPDL++V +QF  +CKGY
Sbjct  61   QPWDSGSLRFKFMLGGSPSSPWEDFQSNRKILAVIGLCHCPSSPDLDAVVDQFAAACKGY  120

Query  474  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFEK  653
             S+LVQRCF FCPGDSQLED + +  N++LFPP+DR TQEFH+ TM+QDIAASLLMEFEK
Sbjct  121  PSALVQRCFGFCPGDSQLEDGSKREGNLILFPPSDRQTQEFHMNTMVQDIAASLLMEFEK  180

Query  654  WVL  662
            WVL
Sbjct  181  WVL  183



>ref|XP_010648709.1| PREDICTED: trafficking protein particle complex subunit 9 isoform 
X1 [Vitis vinifera]
Length=1206

 Score =   311 bits (796),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 140/183 (77%), Positives = 164/183 (90%), Gaps = 0/183 (0%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            MEPDVSIETS MIRVAV+P+G +P    RDY++ML+RH T+SLS+ISSFYTEHQKSPFS+
Sbjct  1    MEPDVSIETSSMIRVAVIPVGPVPPNHLRDYSAMLLRHCTISLSTISSFYTEHQKSPFSN  60

Query  294  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  473
            QPWDSGSLRFKFM GGSP+SPWEDFQSNRKILAV+G+CHCPSSPDL++V +QF  +CKGY
Sbjct  61   QPWDSGSLRFKFMLGGSPSSPWEDFQSNRKILAVIGLCHCPSSPDLDAVVDQFAAACKGY  120

Query  474  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFEK  653
             S+LVQRCF FCPGDSQLED + +  N++LFPP+DR TQEFH+ TM+QDIAASLLMEFEK
Sbjct  121  PSALVQRCFGFCPGDSQLEDGSKREGNLILFPPSDRQTQEFHMNTMVQDIAASLLMEFEK  180

Query  654  WVL  662
            WVL
Sbjct  181  WVL  183



>ref|XP_010648710.1| PREDICTED: trafficking protein particle complex subunit 9 isoform 
X2 [Vitis vinifera]
Length=1202

 Score =   311 bits (796),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 140/183 (77%), Positives = 164/183 (90%), Gaps = 0/183 (0%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            MEPDVSIETS MIRVAV+P+G +P    RDY++ML+RH T+SLS+ISSFYTEHQKSPFS+
Sbjct  1    MEPDVSIETSSMIRVAVIPVGPVPPNHLRDYSAMLLRHCTISLSTISSFYTEHQKSPFSN  60

Query  294  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  473
            QPWDSGSLRFKFM GGSP+SPWEDFQSNRKILAV+G+CHCPSSPDL++V +QF  +CKGY
Sbjct  61   QPWDSGSLRFKFMLGGSPSSPWEDFQSNRKILAVIGLCHCPSSPDLDAVVDQFAAACKGY  120

Query  474  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFEK  653
             S+LVQRCF FCPGDSQLED + +  N++LFPP+DR TQEFH+ TM+QDIAASLLMEFEK
Sbjct  121  PSALVQRCFGFCPGDSQLEDGSKREGNLILFPPSDRQTQEFHMNTMVQDIAASLLMEFEK  180

Query  654  WVL  662
            WVL
Sbjct  181  WVL  183



>ref|XP_008394132.1| PREDICTED: trafficking protein particle complex subunit 9 isoform 
X1 [Malus domestica]
Length=1202

 Score =   310 bits (794),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 143/183 (78%), Positives = 161/183 (88%), Gaps = 0/183 (0%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            MEPDVSIETS MIRV VLPIG +P  L RDY SML+RH T+ LS+ISSFYTEHQKSPF+H
Sbjct  1    MEPDVSIETSSMIRVTVLPIGHVPPVLLRDYHSMLLRHQTIPLSAISSFYTEHQKSPFAH  60

Query  294  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  473
            QPWDSG+LRFKF+ GG+P SPWEDFQSNRK LAV+GICHCPSSPDL+SV +QF+ + + Y
Sbjct  61   QPWDSGNLRFKFVLGGAPPSPWEDFQSNRKTLAVIGICHCPSSPDLDSVIDQFDSARRAY  120

Query  474  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFEK  653
            SS+LV RCFAFCPGDSQLED + KG N++LFPPADR T EFHLQTMMQDIAASLLMEFEK
Sbjct  121  SSALVDRCFAFCPGDSQLEDGSKKGGNLMLFPPADRATLEFHLQTMMQDIAASLLMEFEK  180

Query  654  WVL  662
            WVL
Sbjct  181  WVL  183



>ref|XP_004290928.1| PREDICTED: trafficking protein particle complex II-specific subunit 
120 homolog isoform X2 [Fragaria vesca subsp. vesca]
Length=1198

 Score =   310 bits (794),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 141/183 (77%), Positives = 161/183 (88%), Gaps = 0/183 (0%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            MEPDVSIETS MIRVAVLPIG +P  L RDY +ML+RH T+ LS++SSFYTEHQKSPF+H
Sbjct  1    MEPDVSIETSSMIRVAVLPIGHVPPVLLRDYHAMLLRHQTIPLSAVSSFYTEHQKSPFAH  60

Query  294  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  473
            QPWDSGSLRFKF+ GG+P SPWEDFQSNRK LAV+GICHCPSSPDL SV +QF+ +C+ Y
Sbjct  61   QPWDSGSLRFKFVLGGAPPSPWEDFQSNRKTLAVIGICHCPSSPDLGSVMDQFDTACRAY  120

Query  474  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFEK  653
             ++LV+RCFAF P DSQLED + KG N++LFPPADR TQEFHLQTMMQDIAASLLMEFEK
Sbjct  121  PAALVERCFAFSPADSQLEDGSKKGWNLMLFPPADRATQEFHLQTMMQDIAASLLMEFEK  180

Query  654  WVL  662
            WVL
Sbjct  181  WVL  183



>ref|XP_011458836.1| PREDICTED: trafficking protein particle complex II-specific subunit 
120 homolog isoform X1 [Fragaria vesca subsp. vesca]
Length=1199

 Score =   310 bits (794),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 141/183 (77%), Positives = 161/183 (88%), Gaps = 0/183 (0%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            MEPDVSIETS MIRVAVLPIG +P  L RDY +ML+RH T+ LS++SSFYTEHQKSPF+H
Sbjct  1    MEPDVSIETSSMIRVAVLPIGHVPPVLLRDYHAMLLRHQTIPLSAVSSFYTEHQKSPFAH  60

Query  294  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  473
            QPWDSGSLRFKF+ GG+P SPWEDFQSNRK LAV+GICHCPSSPDL SV +QF+ +C+ Y
Sbjct  61   QPWDSGSLRFKFVLGGAPPSPWEDFQSNRKTLAVIGICHCPSSPDLGSVMDQFDTACRAY  120

Query  474  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFEK  653
             ++LV+RCFAF P DSQLED + KG N++LFPPADR TQEFHLQTMMQDIAASLLMEFEK
Sbjct  121  PAALVERCFAFSPADSQLEDGSKKGWNLMLFPPADRATQEFHLQTMMQDIAASLLMEFEK  180

Query  654  WVL  662
            WVL
Sbjct  181  WVL  183



>ref|XP_007225443.1| hypothetical protein PRUPE_ppa000412mg [Prunus persica]
 gb|EMJ26642.1| hypothetical protein PRUPE_ppa000412mg [Prunus persica]
Length=1200

 Score =   310 bits (793),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 144/183 (79%), Positives = 162/183 (89%), Gaps = 0/183 (0%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            MEPDVSIETS MIRVAVLPIG +P  L RDY SML+R  T+ LS+ISSFYTEHQKSPFS+
Sbjct  1    MEPDVSIETSSMIRVAVLPIGHVPPVLLRDYHSMLLRLQTIPLSAISSFYTEHQKSPFSN  60

Query  294  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  473
            QPWDSGSLRFKF+ GG+P SPWEDFQSNRK LAV+GICHCPSSPDL+SV +QF+ + + Y
Sbjct  61   QPWDSGSLRFKFIVGGAPPSPWEDFQSNRKTLAVIGICHCPSSPDLDSVIDQFDSARRAY  120

Query  474  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFEK  653
            +S+LV RCFAFCPGDSQLED + KG N++LFPPADR TQEFHLQTMMQDIAASLLMEFEK
Sbjct  121  ASALVDRCFAFCPGDSQLEDGSKKGGNLMLFPPADRATQEFHLQTMMQDIAASLLMEFEK  180

Query  654  WVL  662
            WVL
Sbjct  181  WVL  183



>gb|KDP33546.1| hypothetical protein JCGZ_07117 [Jatropha curcas]
Length=1193

 Score =   308 bits (789),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 140/183 (77%), Positives = 161/183 (88%), Gaps = 0/183 (0%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            MEPDVSIETSCMIR+AVLPIG +P  + RDY SM +RHH + LS+ISSFYTEHQKSPF++
Sbjct  1    MEPDVSIETSCMIRIAVLPIGPVPPNVLRDYYSMFLRHHIIPLSAISSFYTEHQKSPFAN  60

Query  294  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  473
            QPWD+GSLRF+F+ GGSP +PWEDFQSNRKILAV+G+CHCPSSPDL SV +QFNV+CK Y
Sbjct  61   QPWDTGSLRFRFVLGGSPPNPWEDFQSNRKILAVIGVCHCPSSPDLGSVVDQFNVACKNY  120

Query  474  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFEK  653
            +S+LV RCFAFCP DSQLE+ + KG N+ LFPPADR T E HLQTMMQDIAASLLMEFEK
Sbjct  121  ASALVMRCFAFCPCDSQLENSSKKGENLRLFPPADRETLEVHLQTMMQDIAASLLMEFEK  180

Query  654  WVL  662
            WVL
Sbjct  181  WVL  183



>gb|KHG29759.1| Trafficking particle complex subunit 9 [Gossypium arboreum]
Length=1200

 Score =   306 bits (784),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 142/183 (78%), Positives = 159/183 (87%), Gaps = 1/183 (1%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            MEPDVSIETSCMIR+AVLPIG +P PL RDY SML+ HHT+ LS+ISSFYTEHQKSPF+H
Sbjct  1    MEPDVSIETSCMIRIAVLPIGKVPPPLLRDYHSMLLPHHTIPLSTISSFYTEHQKSPFAH  60

Query  294  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  473
            QPWD+GSL+FKF+ GGSP SPWEDFQ  RK L+V+GICHCPSSPDL+ V +QFN +CK Y
Sbjct  61   QPWDTGSLQFKFLLGGSPPSPWEDFQPYRKFLSVIGICHCPSSPDLDHVIDQFNAACKIY  120

Query  474  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFEK  653
            +S+LV RCFAFCPGDSQL DD  K  N+VLFPPADR  QEFHL TMMQDIAASLLMEFEK
Sbjct  121  TSALVLRCFAFCPGDSQL-DDGKKRENLVLFPPADRTMQEFHLHTMMQDIAASLLMEFEK  179

Query  654  WVL  662
            WVL
Sbjct  180  WVL  182



>ref|XP_010244785.1| PREDICTED: trafficking protein particle complex subunit 9-like 
isoform X1 [Nelumbo nucifera]
Length=1204

 Score =   305 bits (782),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 138/183 (75%), Positives = 158/183 (86%), Gaps = 0/183 (0%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            MEPDVSIE+ CMIR+AVLPIG +P    RDY SMLVRH  V LS+ISSFYTEHQKSPF+H
Sbjct  1    MEPDVSIESGCMIRIAVLPIGPVPQAQLRDYLSMLVRHRKVELSAISSFYTEHQKSPFAH  60

Query  294  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  473
            QPWD+GSLRFKFM GGSP SPW DFQSNRKI AV+G+CHCPSSPDL+ VA QF+++CK Y
Sbjct  61   QPWDTGSLRFKFMVGGSPPSPWADFQSNRKIHAVIGLCHCPSSPDLDVVAAQFSIACKSY  120

Query  474  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFEK  653
            +S+LV+RCFAF PGD+QLED   +G N++LFPPAD  T EFHLQTM+QDIAASLLMEFEK
Sbjct  121  TSALVKRCFAFSPGDAQLEDGGKRGDNLILFPPADLQTLEFHLQTMVQDIAASLLMEFEK  180

Query  654  WVL  662
            WVL
Sbjct  181  WVL  183



>ref|XP_010244786.1| PREDICTED: trafficking protein particle complex subunit 9-like 
isoform X2 [Nelumbo nucifera]
Length=1180

 Score =   305 bits (782),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 138/183 (75%), Positives = 158/183 (86%), Gaps = 0/183 (0%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            MEPDVSIE+ CMIR+AVLPIG +P    RDY SMLVRH  V LS+ISSFYTEHQKSPF+H
Sbjct  1    MEPDVSIESGCMIRIAVLPIGPVPQAQLRDYLSMLVRHRKVELSAISSFYTEHQKSPFAH  60

Query  294  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  473
            QPWD+GSLRFKFM GGSP SPW DFQSNRKI AV+G+CHCPSSPDL+ VA QF+++CK Y
Sbjct  61   QPWDTGSLRFKFMVGGSPPSPWADFQSNRKIHAVIGLCHCPSSPDLDVVAAQFSIACKSY  120

Query  474  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFEK  653
            +S+LV+RCFAF PGD+QLED   +G N++LFPPAD  T EFHLQTM+QDIAASLLMEFEK
Sbjct  121  TSALVKRCFAFSPGDAQLEDGGKRGDNLILFPPADLQTLEFHLQTMVQDIAASLLMEFEK  180

Query  654  WVL  662
            WVL
Sbjct  181  WVL  183



>emb|CDP18799.1| unnamed protein product [Coffea canephora]
Length=1204

 Score =   301 bits (771),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 146/185 (79%), Positives = 162/185 (88%), Gaps = 2/185 (1%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            MEPDVSIETSCMIRVAVLPIG IP  LFR Y+S+L+RHHTVSLSSISSFYT+HQKSPFSH
Sbjct  1    MEPDVSIETSCMIRVAVLPIGPIPPHLFRHYSSLLLRHHTVSLSSISSFYTQHQKSPFSH  60

Query  294  QPWDS--GSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCK  467
            QPWDS   SLRFKF+  GSP SPWEDFQSNRKILAV+GI HCPSSPDL+S+A  F  + K
Sbjct  61   QPWDSPSASLRFKFILAGSPPSPWEDFQSNRKILAVIGISHCPSSPDLHSLALHFASASK  120

Query  468  GYSSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEF  647
             YSSSLV RCFAF PGDSQLED+++KG+N++LFPPAD  TQE HL TMMQD+AASLLMEF
Sbjct  121  PYSSSLVHRCFAFSPGDSQLEDESHKGTNLILFPPADPQTQELHLLTMMQDLAASLLMEF  180

Query  648  EKWVL  662
            EKWVL
Sbjct  181  EKWVL  185



>ref|XP_010105451.1| hypothetical protein L484_003461 [Morus notabilis]
 gb|EXC04752.1| hypothetical protein L484_003461 [Morus notabilis]
Length=1203

 Score =   300 bits (768),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 136/183 (74%), Positives = 160/183 (87%), Gaps = 0/183 (0%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            MEPD SIETS MIRVAVLPIG +P  + RDY+SML+RH T+ LS+ISSFYTEHQKSPF+H
Sbjct  1    MEPDASIETSSMIRVAVLPIGEVPPAVMRDYSSMLLRHQTIPLSAISSFYTEHQKSPFAH  60

Query  294  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  473
            QPWDSGSLRFKF+ GG+P SPWEDFQSNRKILA++G+CHCPSSPDL+S+  +FN + K Y
Sbjct  61   QPWDSGSLRFKFILGGAPPSPWEDFQSNRKILALIGLCHCPSSPDLSSLLGRFNAASKAY  120

Query  474  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFEK  653
            SS+L+ RCFAF P DSQLE+ + KG N++LFPPADR TQE HLQTMMQ+IAA+LLMEFEK
Sbjct  121  SSALIHRCFAFSPADSQLEEWSKKGGNLMLFPPADRETQELHLQTMMQEIAAALLMEFEK  180

Query  654  WVL  662
            WVL
Sbjct  181  WVL  183



>gb|KJB07659.1| hypothetical protein B456_001G035900 [Gossypium raimondii]
Length=1200

 Score =   298 bits (763),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 139/183 (76%), Positives = 158/183 (86%), Gaps = 1/183 (1%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            MEPDVSIETSCMIR+AVLPIG +P  L RDY SML+RH T+ LS+ISSFYTEHQKSPF+H
Sbjct  1    MEPDVSIETSCMIRIAVLPIGDVPSTLLRDYHSMLLRHCTIPLSTISSFYTEHQKSPFAH  60

Query  294  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  473
            QPW++GSLRFKF+ GG+P SPWEDFQ +RKIL V+GICHCPSSPDL+ V +QFN + +GY
Sbjct  61   QPWETGSLRFKFVLGGAPPSPWEDFQPHRKILGVIGICHCPSSPDLDLVIDQFNAAWRGY  120

Query  474  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFEK  653
            SS LVQRCFAF PGDSQLE D  K  N+VLFPP+DR  QE HLQTMMQDI+ASLLMEFEK
Sbjct  121  SSVLVQRCFAFSPGDSQLE-DTKKRENLVLFPPSDRSAQELHLQTMMQDISASLLMEFEK  179

Query  654  WVL  662
            WVL
Sbjct  180  WVL  182



>ref|XP_002515463.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46912.1| conserved hypothetical protein [Ricinus communis]
Length=1195

 Score =   292 bits (748),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 136/183 (74%), Positives = 155/183 (85%), Gaps = 2/183 (1%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            MEPDVSIETSCMIR+A++PIG++P  + RDY SM    H + LS+ISSFYTEHQKSPF++
Sbjct  1    MEPDVSIETSCMIRIAIIPIGAVPAKILRDYYSMFEGQHRIPLSAISSFYTEHQKSPFAN  60

Query  294  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  473
            QPWD+GSLRFKF+ GGSP SPWEDFQSNRKILAV+G+CHCPSSPDL+SV +QFN SCK Y
Sbjct  61   QPWDTGSLRFKFVLGGSPPSPWEDFQSNRKILAVIGVCHCPSSPDLDSVLDQFNASCKYY  120

Query  474  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFEK  653
            +S+LV RCFAF P DSQ  D   KG N+ LFPPADR T E HLQTMMQDIAASLLMEFEK
Sbjct  121  ASALVSRCFAFSPCDSQ--DGGKKGENLKLFPPADRETLEIHLQTMMQDIAASLLMEFEK  178

Query  654  WVL  662
            WVL
Sbjct  179  WVL  181



>ref|XP_010942155.1| PREDICTED: trafficking protein particle complex subunit 9 [Elaeis 
guineensis]
 ref|XP_010942156.1| PREDICTED: trafficking protein particle complex subunit 9 [Elaeis 
guineensis]
Length=1207

 Score =   288 bits (737),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 132/184 (72%), Positives = 156/184 (85%), Gaps = 1/184 (1%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIG-SIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFS  290
            MEPDVS+ET  MIR+AVLP+G +IP    R+Y +ML RH  + LSSISSFY EHQKSPF+
Sbjct  1    MEPDVSMETGSMIRIAVLPVGGAIPHHQLREYAAMLGRHTRIDLSSISSFYKEHQKSPFA  60

Query  291  HQPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKG  470
            HQPW++G LRFK+M GG+P SPWEDFQS RKILAV+G+CHCPSSPDL+ VAEQF  +CKG
Sbjct  61   HQPWETGCLRFKYMLGGAPPSPWEDFQSCRKILAVVGLCHCPSSPDLDLVAEQFAAACKG  120

Query  471  YSSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFE  650
            YSS+L +RCFAFCP DSQLEDD  K  NI+LFPP+DR TQEFH+ TM+QD+AA+LLMEFE
Sbjct  121  YSSALAKRCFAFCPTDSQLEDDGKKRENIILFPPSDRQTQEFHMLTMVQDLAATLLMEFE  180

Query  651  KWVL  662
            KWVL
Sbjct  181  KWVL  184



>ref|XP_002309653.2| hypothetical protein POPTR_0006s27580g [Populus trichocarpa]
 gb|EEE93176.2| hypothetical protein POPTR_0006s27580g [Populus trichocarpa]
Length=1183

 Score =   288 bits (736),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 134/183 (73%), Positives = 151/183 (83%), Gaps = 0/183 (0%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            MEPDVSIET  MIR+A+LPIG IP    RDY SM +  HT+ LSSISSFYTE QKSPF++
Sbjct  1    MEPDVSIETFSMIRIAILPIGKIPHQTLRDYYSMFLHQHTIPLSSISSFYTEEQKSPFTN  60

Query  294  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  473
            QPWD+GSLRFKF+ GGSP SPWEDFQSNRKILAV+G+CHCP SPDL+SV E+FN  CKGY
Sbjct  61   QPWDTGSLRFKFILGGSPPSPWEDFQSNRKILAVIGVCHCPLSPDLDSVIEEFNGVCKGY  120

Query  474  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFEK  653
            +S+ V RCF F P DSQLED   KG N+ LFPPADR TQE HLQTMMQ+IAASLLMEFEK
Sbjct  121  ASARVTRCFGFLPCDSQLEDGGKKGDNLRLFPPADRQTQEMHLQTMMQEIAASLLMEFEK  180

Query  654  WVL  662
            +V 
Sbjct  181  YVF  183



>ref|XP_011036636.1| PREDICTED: trafficking protein particle complex subunit 9-like 
isoform X1 [Populus euphratica]
Length=1187

 Score =   286 bits (733),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 131/183 (72%), Positives = 153/183 (84%), Gaps = 0/183 (0%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            MEPDVS+ETS MIR+A++PIG IP    RDY SM + HHT+ LSSISSFYTE QKSPF++
Sbjct  1    MEPDVSVETSAMIRIAIIPIGKIPHQTLRDYYSMFLHHHTIPLSSISSFYTEEQKSPFTN  60

Query  294  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  473
            QPW++GSLRFKF+ GG+P SPWEDFQSNRKILAV+G+CHCP SPDL+SV E+F+  CKGY
Sbjct  61   QPWETGSLRFKFVLGGAPPSPWEDFQSNRKILAVIGVCHCPLSPDLDSVIEEFDGVCKGY  120

Query  474  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFEK  653
            +S+ V RCF F P DSQLED   KG N+ LFPPADR TQE HLQTMMQ+IAASLLMEFEK
Sbjct  121  ASARVTRCFGFFPCDSQLEDGGKKGENLRLFPPADRQTQEMHLQTMMQEIAASLLMEFEK  180

Query  654  WVL  662
            +V 
Sbjct  181  YVF  183



>ref|XP_011036637.1| PREDICTED: trafficking protein particle complex subunit 9-like 
isoform X2 [Populus euphratica]
Length=1183

 Score =   286 bits (733),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 131/183 (72%), Positives = 153/183 (84%), Gaps = 0/183 (0%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            MEPDVS+ETS MIR+A++PIG IP    RDY SM + HHT+ LSSISSFYTE QKSPF++
Sbjct  1    MEPDVSVETSAMIRIAIIPIGKIPHQTLRDYYSMFLHHHTIPLSSISSFYTEEQKSPFTN  60

Query  294  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  473
            QPW++GSLRFKF+ GG+P SPWEDFQSNRKILAV+G+CHCP SPDL+SV E+F+  CKGY
Sbjct  61   QPWETGSLRFKFVLGGAPPSPWEDFQSNRKILAVIGVCHCPLSPDLDSVIEEFDGVCKGY  120

Query  474  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFEK  653
            +S+ V RCF F P DSQLED   KG N+ LFPPADR TQE HLQTMMQ+IAASLLMEFEK
Sbjct  121  ASARVTRCFGFFPCDSQLEDGGKKGENLRLFPPADRQTQEMHLQTMMQEIAASLLMEFEK  180

Query  654  WVL  662
            +V 
Sbjct  181  YVF  183



>ref|XP_006848818.1| hypothetical protein AMTR_s00026p00150010 [Amborella trichopoda]
 gb|ERN10399.1| hypothetical protein AMTR_s00026p00150010 [Amborella trichopoda]
Length=1207

 Score =   286 bits (731),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 131/185 (71%), Positives = 156/185 (84%), Gaps = 2/185 (1%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            MEPDVSIE+ CMIR+AVLP+G +P    RDY SML+R + + LSSISSFYTEHQKSPF+H
Sbjct  1    MEPDVSIESGCMIRIAVLPVGDMPRSNMRDYVSMLLRLNKIELSSISSFYTEHQKSPFAH  60

Query  294  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  473
            QPW++GSLRFKF+ GG+  S WEDFQSNRKIL V+G+CHCPSSPDL +V EQF    K Y
Sbjct  61   QPWENGSLRFKFLVGGAQPSAWEDFQSNRKILGVIGLCHCPSSPDLGAVYEQFQGIRKAY  120

Query  474  SSSLVQRCFAFCPGDS--QLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEF  647
            SS+LV++CFAFCP DS  QLED   KG+N++LFPPADR TQEFH+QTMMQD+AA+LLMEF
Sbjct  121  SSALVEKCFAFCPSDSQVQLEDGGKKGNNLILFPPADRQTQEFHIQTMMQDLAAALLMEF  180

Query  648  EKWVL  662
            EK+VL
Sbjct  181  EKYVL  185



>ref|XP_008784808.1| PREDICTED: trafficking protein particle complex subunit 9 [Phoenix 
dactylifera]
Length=1209

 Score =   284 bits (727),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 130/184 (71%), Positives = 155/184 (84%), Gaps = 1/184 (1%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIG-SIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFS  290
            MEPDVS+ET  MIR+AVLP+G +IP    R+Y +ML R   + LSSISSFY EHQKSPF+
Sbjct  1    MEPDVSMETGSMIRIAVLPVGGAIPHRQLREYAAMLGRQTRIDLSSISSFYKEHQKSPFA  60

Query  291  HQPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKG  470
            HQPW++G LRFK+M GG+P SPWEDFQS RKILAV+G+CHCPSSPDL+ VA+QF  +CKG
Sbjct  61   HQPWETGCLRFKYMLGGAPPSPWEDFQSCRKILAVVGLCHCPSSPDLDLVADQFAAACKG  120

Query  471  YSSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFE  650
            YSS+L +RCFAFCP DSQLEDD  K  NI+LFPP+DR TQEFH+ TM+QD+AA+LLMEFE
Sbjct  121  YSSALAKRCFAFCPTDSQLEDDGKKRENIILFPPSDRQTQEFHMLTMVQDLAATLLMEFE  180

Query  651  KWVL  662
            KWVL
Sbjct  181  KWVL  184



>ref|XP_010665754.1| PREDICTED: trafficking protein particle complex subunit 9 [Beta 
vulgaris subsp. vulgaris]
Length=1185

 Score =   283 bits (725),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 129/183 (70%), Positives = 149/183 (81%), Gaps = 0/183 (0%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            MEPDVSIE+ C IR+AV+PIG I   LFR+Y S+L  H  + LSSISSFYTEHQKSPF+H
Sbjct  1    MEPDVSIESMCTIRIAVVPIGQISPSLFREYASLLTLHSKIDLSSISSFYTEHQKSPFTH  60

Query  294  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  473
            QPWD+G LRFKF+ GGSP SPWEDFQSNRKIL+V+GI HCPSSPDL+SV + F + CKGY
Sbjct  61   QPWDTGCLRFKFILGGSPPSPWEDFQSNRKILSVIGIFHCPSSPDLDSVNDHFGLVCKGY  120

Query  474  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFEK  653
            +SSL Q+CF FCPGD QL+D   +  N+ LFPPADR T E H+ TMMQDIAASLLMEFE 
Sbjct  121  ASSLAQKCFGFCPGDQQLKDGNKRQDNLNLFPPADRQTLEMHMHTMMQDIAASLLMEFEN  180

Query  654  WVL  662
            WVL
Sbjct  181  WVL  183



>ref|XP_007161157.1| hypothetical protein PHAVU_001G047300g [Phaseolus vulgaris]
 gb|ESW33151.1| hypothetical protein PHAVU_001G047300g [Phaseolus vulgaris]
Length=1196

 Score =   283 bits (724),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 132/183 (72%), Positives = 154/183 (84%), Gaps = 0/183 (0%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            MEP+VSIE S MI+VAV+PIG++P  L RDY SML+  HT+ LS+ISSFYTEHQKSPF+ 
Sbjct  1    MEPEVSIEGSAMIQVAVVPIGTVPSNLLRDYYSMLIPLHTIPLSAISSFYTEHQKSPFAV  60

Query  294  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  473
            QPWDSGSLRFKF+ GG+P SPWEDFQSNRK LAV+G+ HCPSSPDL++  + F+ +CK +
Sbjct  61   QPWDSGSLRFKFVLGGAPPSPWEDFQSNRKTLAVVGVVHCPSSPDLDTAVDVFSNACKSF  120

Query  474  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFEK  653
             SSLV RCFAFCP DSQLED + KG N+ LFPPADR T EFHL TMMQ+IAASLLMEFEK
Sbjct  121  PSSLVDRCFAFCPNDSQLEDGSKKGGNLRLFPPADRPTLEFHLNTMMQEIAASLLMEFEK  180

Query  654  WVL  662
            WVL
Sbjct  181  WVL  183



>ref|XP_011039615.1| PREDICTED: trafficking protein particle complex subunit 9 [Populus 
euphratica]
Length=1182

 Score =   283 bits (724),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 133/183 (73%), Positives = 150/183 (82%), Gaps = 0/183 (0%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            MEPDVSIET  MIR+A+LPIG IP    RDY SM +  HT+ LSSISSFYTE QKSPF++
Sbjct  1    MEPDVSIETFSMIRIAILPIGQIPHQTLRDYYSMFLHQHTIPLSSISSFYTEEQKSPFTN  60

Query  294  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  473
            QPWD+GSLRFKF+ GGSP SPWEDFQSNRKILAV+G+ HCP SPDL+SV E+FN  CKGY
Sbjct  61   QPWDTGSLRFKFILGGSPPSPWEDFQSNRKILAVIGVFHCPLSPDLDSVIEEFNGVCKGY  120

Query  474  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFEK  653
            +S+ V RCF F P DSQLED   KG N+ LFPPADR TQE HLQTMMQ+IAASLLMEFEK
Sbjct  121  ASARVARCFGFFPCDSQLEDGGKKGENLRLFPPADRQTQEMHLQTMMQEIAASLLMEFEK  180

Query  654  WVL  662
            +V 
Sbjct  181  YVF  183



>gb|KEH39853.1| transporter TRS120 [Medicago truncatula]
Length=1183

 Score =   279 bits (714),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 132/183 (72%), Positives = 151/183 (83%), Gaps = 0/183 (0%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            MEP+VSIE S  I++AV+PIG IP PL RDY S+L+  HT+ LS+ISSFYTEHQKSPF+H
Sbjct  1    MEPEVSIEGSSTIQIAVIPIGQIPPPLLRDYYSLLLPLHTIPLSAISSFYTEHQKSPFAH  60

Query  294  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  473
            QPWDSGSLRFKF+ GG+  SPWEDFQS+RK LAV+GI HCPSS DLN V +QF  SCK Y
Sbjct  61   QPWDSGSLRFKFVLGGATPSPWEDFQSHRKTLAVVGIVHCPSSLDLNDVVDQFASSCKSY  120

Query  474  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFEK  653
             SSLV RCFAF P DSQLED + +G N+ LFPPADR T EFHL TMMQ++AASLLMEFEK
Sbjct  121  PSSLVDRCFAFYPNDSQLEDGSKRGGNLRLFPPADRATLEFHLNTMMQEVAASLLMEFEK  180

Query  654  WVL  662
            WVL
Sbjct  181  WVL  183



>ref|XP_003550201.1| PREDICTED: trafficking protein particle complex subunit 9-like 
[Glycine max]
Length=1198

 Score =   278 bits (712),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 129/183 (70%), Positives = 153/183 (84%), Gaps = 0/183 (0%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            MEP+VSIE S MI+VAV+PIG++P  + RDY SML+  HT+ LS+ISSFYTEHQKSPF+ 
Sbjct  1    MEPEVSIEGSAMIQVAVVPIGAVPANVLRDYYSMLLPLHTIPLSAISSFYTEHQKSPFAV  60

Query  294  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  473
            QPWDSGSLRFKF+ GG+P SPWEDFQS+RK LA++G+ HCPSSPDL +V + F  +CK +
Sbjct  61   QPWDSGSLRFKFVLGGAPPSPWEDFQSHRKTLAIVGVVHCPSSPDLEAVVDVFASACKSF  120

Query  474  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFEK  653
             SSLV RCFAFCP D+QLED + KG N+ LFPPADR T EFHL TMMQ+IAASLLMEFEK
Sbjct  121  PSSLVDRCFAFCPNDTQLEDGSKKGGNLRLFPPADRPTLEFHLNTMMQEIAASLLMEFEK  180

Query  654  WVL  662
            WVL
Sbjct  181  WVL  183



>ref|XP_004498769.1| PREDICTED: trafficking protein particle complex subunit 9-like 
[Cicer arietinum]
Length=1188

 Score =   278 bits (712),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 132/183 (72%), Positives = 154/183 (84%), Gaps = 0/183 (0%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            MEP+VSIE S MI+VAV+PIG++P  + RDY SML+  HT+ LS+ISSFYTEHQKSPF+H
Sbjct  1    MEPEVSIEGSSMIQVAVIPIGTVPPNVLRDYYSMLLPLHTIPLSAISSFYTEHQKSPFAH  60

Query  294  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  473
            QPWDSGSLRFKF+ GG+  SPWEDFQS RK LAVLGI HCPSSPDL++V +QF+ SCK Y
Sbjct  61   QPWDSGSLRFKFVLGGATPSPWEDFQSYRKNLAVLGIVHCPSSPDLDAVIDQFSNSCKSY  120

Query  474  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFEK  653
            +SSLV RCFAF P DSQLED + +  N+ LFPPADR T EFHL TMMQ++AASLLMEFEK
Sbjct  121  TSSLVDRCFAFYPNDSQLEDGSKRDGNLRLFPPADRSTLEFHLNTMMQEVAASLLMEFEK  180

Query  654  WVL  662
            WVL
Sbjct  181  WVL  183



>ref|XP_006595493.1| PREDICTED: uncharacterized protein LOC100305609 isoform X1 [Glycine 
max]
Length=1200

 Score =   275 bits (704),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 129/183 (70%), Positives = 153/183 (84%), Gaps = 0/183 (0%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            MEP+VSIE S MI+VAV+PIG++P  + RDY SML+  HT+ LS+ISSFYTEHQKSPF+ 
Sbjct  1    MEPEVSIEGSAMIQVAVVPIGTVPSNVMRDYYSMLLPLHTIPLSAISSFYTEHQKSPFAV  60

Query  294  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  473
            QPWDSGSL FKF+ GG+P SPWEDFQS+RK LAV+G+ HCPSSPDL++V + F  +CK +
Sbjct  61   QPWDSGSLLFKFVLGGAPPSPWEDFQSHRKTLAVVGVVHCPSSPDLDAVVDVFANACKSF  120

Query  474  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFEK  653
             SSLV RCFAFCP DSQLED + KG N+ LFPPADR T EFHL TMMQ++AASLLMEFEK
Sbjct  121  PSSLVDRCFAFCPDDSQLEDGSKKGGNLRLFPPADRPTLEFHLNTMMQEVAASLLMEFEK  180

Query  654  WVL  662
            WVL
Sbjct  181  WVL  183



>ref|XP_009381560.1| PREDICTED: trafficking protein particle complex subunit 9 [Musa 
acuminata subsp. malaccensis]
Length=1213

 Score =   271 bits (693),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 127/184 (69%), Positives = 150/184 (82%), Gaps = 1/184 (1%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIG-SIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFS  290
            MEPDVS ET  MIR+AVLP+G SIP    R Y  ML RH  + LSSISSFY+EHQKSPF+
Sbjct  1    MEPDVSFETGSMIRIAVLPVGGSIPHARLRSYVEMLGRHTRIDLSSISSFYSEHQKSPFT  60

Query  291  HQPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKG  470
            HQPW++GSLRFKFM GG+P S WEDFQS RKILAV+G+CHCP+SPDL+ VA+QF  + K 
Sbjct  61   HQPWETGSLRFKFMLGGAPPSAWEDFQSCRKILAVIGLCHCPASPDLDLVADQFATASKA  120

Query  471  YSSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFE  650
            Y+S+L +RCFAF P DSQLE+   K  NI+LFPP+D+ TQEFH+ TMMQD+AASLLMEFE
Sbjct  121  YTSALAKRCFAFFPTDSQLEEGDNKRENILLFPPSDQKTQEFHMLTMMQDLAASLLMEFE  180

Query  651  KWVL  662
            KWVL
Sbjct  181  KWVL  184



>emb|CAN82119.1| hypothetical protein VITISV_024254 [Vitis vinifera]
Length=191

 Score =   240 bits (613),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 134/159 (84%), Gaps = 0/159 (0%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            MEPDVSIETS MIRVAV+P+G +P    RDY++ML+RH T+SLS+ISSFYTEHQKSPFS+
Sbjct  1    MEPDVSIETSSMIRVAVIPVGPVPPNHLRDYSAMLLRHCTISLSTISSFYTEHQKSPFSN  60

Query  294  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  473
            QPWD+GSLRFKFM GGSP+SPWEDFQSNRKILAV+G+CHCPSSPDL++V +QF  +CKGY
Sbjct  61   QPWDTGSLRFKFMLGGSPSSPWEDFQSNRKILAVIGLCHCPSSPDLDAVVDQFAAACKGY  120

Query  474  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQ  590
             S+LVQRCF FCPGDSQ    + + S +V+  P  R+ Q
Sbjct  121  PSALVQRCFGFCPGDSQETTSSTRLSLLVVLGPLGRVAQ  159



>emb|CAN76628.1| hypothetical protein VITISV_003544 [Vitis vinifera]
Length=153

 Score =   233 bits (593),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 108/144 (75%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            MEPDVSIETS MIRVAV+P+G +P    RDY++ML+RH T+SLS+ISSFYTEHQKSPFS+
Sbjct  1    MEPDVSIETSSMIRVAVIPVGPVPPNHLRDYSAMLLRHCTISLSTISSFYTEHQKSPFSN  60

Query  294  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  473
            QPWD GSLRFKFM GGSP+SPWEDFQSNRKILAV+G+CHCPSSPDL++V +QF  +CKGY
Sbjct  61   QPWDXGSLRFKFMLGGSPSSPWEDFQSNRKILAVIGLCHCPSSPDLDAVVDQFAAACKGY  120

Query  474  SSSLVQRCFAFCPGDSQLEDDAYK  545
             S+LVQRCF FCPGDSQ+   A K
Sbjct  121  PSALVQRCFGFCPGDSQVRLVAEK  144



>gb|EPS63566.1| hypothetical protein M569_11217, partial [Genlisea aurea]
Length=1100

 Score =   237 bits (605),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = +3

Query  270  HQKSPFSHQPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQ  449
            HQKSPF++QPWDSGSLRFKF+ GGSP SPWEDFQSNRKILAV+G CHCPSSPDL  +A+Q
Sbjct  1    HQKSPFANQPWDSGSLRFKFILGGSPPSPWEDFQSNRKILAVIGFCHCPSSPDLQDIADQ  60

Query  450  FNVSCKGYSSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAA  629
            F  +CKGYSSSLVQRCFAFCP DSQLE+++  GSN+VLFPPAD+ TQE+HLQTMMQD+AA
Sbjct  61   FAAACKGYSSSLVQRCFAFCPRDSQLEEESCNGSNLVLFPPADQQTQEYHLQTMMQDVAA  120

Query  630  SLLMEFEKWVL  662
            +LLMEFEKWVL
Sbjct  121  TLLMEFEKWVL  131



>ref|XP_004976134.1| PREDICTED: trafficking protein particle complex subunit 9-like 
isoform X2 [Setaria italica]
Length=1182

 Score =   237 bits (605),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 108/184 (59%), Positives = 141/184 (77%), Gaps = 1/184 (1%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIG-SIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFS  290
            MEP +SIE+   IRVAVLP+G +IP P  R+Y +++ RH  V L+S+ ++Y EHQKSPF+
Sbjct  1    MEPGLSIESGSAIRVAVLPVGGTIPPPRLREYMALVSRHARVDLASLRTYYAEHQKSPFA  60

Query  291  HQPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKG  470
            HQPW++G LR KF+ GG   SPWEDFQS+RK+LAV+GICH PSSPDL+ VA  F  + + 
Sbjct  61   HQPWETGCLRLKFVLGGCVPSPWEDFQSSRKVLAVIGICHLPSSPDLDRVAADFVDTARS  120

Query  471  YSSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFE  650
            YSS+L  RCFAFCP D Q+   A K  +I++FPP+D+ + E H+ TM+QD+AASLLMEFE
Sbjct  121  YSSALANRCFAFCPTDEQVRMAAKKRDDIIMFPPSDQQSLELHMVTMIQDLAASLLMEFE  180

Query  651  KWVL  662
            KWVL
Sbjct  181  KWVL  184



>ref|XP_004976133.1| PREDICTED: trafficking protein particle complex subunit 9-like 
isoform X1 [Setaria italica]
Length=1185

 Score =   234 bits (597),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 108/184 (59%), Positives = 141/184 (77%), Gaps = 3/184 (2%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIG-SIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFS  290
            MEP +SIE+   IRVAVLP+G +IP P  R+Y +++ RH  V L+S+ ++Y EHQKSPF+
Sbjct  1    MEPGLSIESGSAIRVAVLPVGGTIPPPRLREYMALVSRHARVDLASLRTYYAEHQKSPFA  60

Query  291  HQPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKG  470
            HQPW++G LR KF+ GG   SPWEDFQS+RK+LAV+GICH PSSPDL+ VA  F  + + 
Sbjct  61   HQPWETGCLRLKFVLGGCVPSPWEDFQSSRKVLAVIGICHLPSSPDLDRVAADFVDTARS  120

Query  471  YSSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFE  650
            YSS+L  RCFAFCP D Q+   A K  +I++FPP+D+ + E H+ TM+QD+AASLLMEFE
Sbjct  121  YSSALANRCFAFCPTDEQMA--AKKRDDIIMFPPSDQQSLELHMVTMIQDLAASLLMEFE  178

Query  651  KWVL  662
            KWVL
Sbjct  179  KWVL  182



>tpg|DAA37075.1| TPA: hypothetical protein ZEAMMB73_993824 [Zea mays]
Length=1163

 Score =   233 bits (594),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 108/184 (59%), Positives = 139/184 (76%), Gaps = 3/184 (2%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGS-IPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFS  290
            MEP +SIE+   IRVAVLP+G  IP P  R+Y +++ RH  V L+S+ ++Y EHQKSPF 
Sbjct  1    MEPGLSIESGSAIRVAVLPVGGPIPPPRLREYAALVARHARVDLASLRTYYAEHQKSPFQ  60

Query  291  HQPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKG  470
            HQPW++G LR KF+ GG   SPWEDFQS+RK+LAV+GICH PSSPDL+ VA  F  + + 
Sbjct  61   HQPWETGCLRLKFVLGGCVPSPWEDFQSSRKVLAVIGICHLPSSPDLDHVAADFIDAARS  120

Query  471  YSSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFE  650
            Y S+L  RCFAFCP D+QL   A K  +I++FPP+D+ + E H+ TM+QD+AASLLMEFE
Sbjct  121  YPSALANRCFAFCPTDAQLS--AKKRDDIIMFPPSDQQSLELHMLTMIQDLAASLLMEFE  178

Query  651  KWVL  662
            KWVL
Sbjct  179  KWVL  182



>ref|XP_008669201.1| PREDICTED: trafficking protein particle complex subunit 9 [Zea 
mays]
 tpg|DAA37076.1| TPA: hypothetical protein ZEAMMB73_993824 [Zea mays]
Length=1178

 Score =   233 bits (593),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 108/184 (59%), Positives = 139/184 (76%), Gaps = 3/184 (2%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGS-IPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFS  290
            MEP +SIE+   IRVAVLP+G  IP P  R+Y +++ RH  V L+S+ ++Y EHQKSPF 
Sbjct  1    MEPGLSIESGSAIRVAVLPVGGPIPPPRLREYAALVARHARVDLASLRTYYAEHQKSPFQ  60

Query  291  HQPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKG  470
            HQPW++G LR KF+ GG   SPWEDFQS+RK+LAV+GICH PSSPDL+ VA  F  + + 
Sbjct  61   HQPWETGCLRLKFVLGGCVPSPWEDFQSSRKVLAVIGICHLPSSPDLDHVAADFIDAARS  120

Query  471  YSSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFE  650
            Y S+L  RCFAFCP D+QL   A K  +I++FPP+D+ + E H+ TM+QD+AASLLMEFE
Sbjct  121  YPSALANRCFAFCPTDAQLS--AKKRDDIIMFPPSDQQSLELHMLTMIQDLAASLLMEFE  178

Query  651  KWVL  662
            KWVL
Sbjct  179  KWVL  182



>ref|XP_002446750.1| hypothetical protein SORBIDRAFT_06g021740 [Sorghum bicolor]
 gb|EES11078.1| hypothetical protein SORBIDRAFT_06g021740 [Sorghum bicolor]
Length=1163

 Score =   230 bits (587),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 107/184 (58%), Positives = 137/184 (74%), Gaps = 3/184 (2%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGS-IPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFS  290
            MEP +SIE+   IRVAVLP+G  IP P  R+Y +++ RH  V L+S+ ++Y EHQKSPF 
Sbjct  1    MEPGLSIESGSAIRVAVLPVGGPIPPPRLREYAALVARHARVDLASLRTYYAEHQKSPFQ  60

Query  291  HQPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKG  470
            HQPW++G LR KF+ GG   SPWEDFQS+RK+LAV+GICH PSSPDL+ VA  F  S + 
Sbjct  61   HQPWETGCLRLKFVLGGCVPSPWEDFQSSRKVLAVIGICHLPSSPDLDRVAADFIDSARS  120

Query  471  YSSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFE  650
            Y S+L  RCFAFCP D+QL     K  +I++ PP+D+ + E H+ TM+QD+AASLLMEFE
Sbjct  121  YPSALANRCFAFCPTDAQLS--GKKRDDIIMLPPSDQQSLELHMLTMIQDLAASLLMEFE  178

Query  651  KWVL  662
            KWVL
Sbjct  179  KWVL  182



>ref|XP_010227185.1| PREDICTED: LOW QUALITY PROTEIN: trafficking protein particle 
complex subunit 9 [Brachypodium distachyon]
Length=1210

 Score =   230 bits (586),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 108/184 (59%), Positives = 137/184 (74%), Gaps = 3/184 (2%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGS-IPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFS  290
            MEP +SIE+   IRVAVLP+G  IP    RDY +++ +H  V L+S+  +Y+EHQKSPFS
Sbjct  1    MEPGLSIESGSAIRVAVLPVGGPIPPQCLRDYAALVAQHARVDLASLRPYYSEHQKSPFS  60

Query  291  HQPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKG  470
            HQPWD+G LR KF+ GG   SPWEDFQS+RK+LAV+GICH PSSPDL  VA  F  + + 
Sbjct  61   HQPWDTGCLRLKFVLGGCVPSPWEDFQSSRKVLAVVGICHLPSSPDLGKVAADFVDAART  120

Query  471  YSSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFE  650
            Y S+L  RCFAFCP D+QL +   K   I++FPP+D+ + E H+ TM+QD+AASLLMEFE
Sbjct  121  YPSALASRCFAFCPTDAQLAEK--KSDGIIMFPPSDQKSLELHMLTMIQDLAASLLMEFE  178

Query  651  KWVL  662
            KWVL
Sbjct  179  KWVL  182



>emb|CAE01639.1| OSJNBa0029H02.30 [Oryza sativa Japonica Group]
Length=1193

 Score =   226 bits (576),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 107/184 (58%), Positives = 134/184 (73%), Gaps = 3/184 (2%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGS-IPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFS  290
            MEP VSIE+   IRVAVLP+G  I     RDY +++ RH  V L+S+  +Y+EHQKSPF+
Sbjct  1    MEPGVSIESGSAIRVAVLPVGGPISPARLRDYAALVARHARVDLASLRPYYSEHQKSPFA  60

Query  291  HQPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKG  470
            HQPW  G LR KF+ GG   SPWEDFQS+RK+LAV+GICH PSSPDL  VA  F  + + 
Sbjct  61   HQPWGGGCLRLKFVLGGCVPSPWEDFQSSRKVLAVVGICHLPSSPDLGRVAADFVDAARS  120

Query  471  YSSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFE  650
            Y S+L  RCFAFCP D+QL     K  NI++FPP+D+ + E H+ TM+QD++ASLLMEFE
Sbjct  121  YPSALASRCFAFCPTDAQLVQK--KRDNIIMFPPSDQQSLELHMLTMIQDLSASLLMEFE  178

Query  651  KWVL  662
            KWVL
Sbjct  179  KWVL  182



>ref|NP_001053234.1| Os04g0502200 [Oryza sativa Japonica Group]
 sp|Q0JBY9.1|TR120_ORYSJ RecName: Full=Trafficking protein particle complex II-specific 
subunit 120 homolog; Short=TRAPP II-specific subunit 120 homolog 
[Oryza sativa Japonica Group]
 dbj|BAF15148.1| Os04g0502200 [Oryza sativa Japonica Group]
Length=1187

 Score =   226 bits (575),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 107/184 (58%), Positives = 134/184 (73%), Gaps = 3/184 (2%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGS-IPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFS  290
            MEP VSIE+   IRVAVLP+G  I     RDY +++ RH  V L+S+  +Y+EHQKSPF+
Sbjct  1    MEPGVSIESGSAIRVAVLPVGGPISPARLRDYAALVARHARVDLASLRPYYSEHQKSPFA  60

Query  291  HQPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKG  470
            HQPW  G LR KF+ GG   SPWEDFQS+RK+LAV+GICH PSSPDL  VA  F  + + 
Sbjct  61   HQPWGGGCLRLKFVLGGCVPSPWEDFQSSRKVLAVVGICHLPSSPDLGRVAADFVDAARS  120

Query  471  YSSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFE  650
            Y S+L  RCFAFCP D+QL     K  NI++FPP+D+ + E H+ TM+QD++ASLLMEFE
Sbjct  121  YPSALASRCFAFCPTDAQLVQK--KRDNIIMFPPSDQQSLELHMLTMIQDLSASLLMEFE  178

Query  651  KWVL  662
            KWVL
Sbjct  179  KWVL  182



>gb|EEC77580.1| hypothetical protein OsI_16530 [Oryza sativa Indica Group]
Length=1167

 Score =   225 bits (574),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 107/184 (58%), Positives = 134/184 (73%), Gaps = 3/184 (2%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGS-IPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFS  290
            MEP VSIE+   IRVAVLP+G  I     RDY +++ RH  V L+S+  +Y+EHQKSPF+
Sbjct  1    MEPGVSIESGSAIRVAVLPVGGPISPARLRDYAALVARHARVDLASLRPYYSEHQKSPFA  60

Query  291  HQPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKG  470
            HQPW  G LR KF+ GG   SPWEDFQS+RK+LAV+GICH PSSPDL  VA  F  + + 
Sbjct  61   HQPWGGGCLRLKFVLGGCVPSPWEDFQSSRKVLAVVGICHLPSSPDLGRVAADFVDAARS  120

Query  471  YSSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFE  650
            Y S+L  RCFAFCP D+QL     K  NI++FPP+D+ + E H+ TM+QD++ASLLMEFE
Sbjct  121  YPSALASRCFAFCPTDAQLVQK--KRDNIIMFPPSDQQSLELHMLTMIQDLSASLLMEFE  178

Query  651  KWVL  662
            KWVL
Sbjct  179  KWVL  182



>ref|XP_001777714.1| predicted protein [Physcomitrella patens]
 gb|EDQ57494.1| predicted protein [Physcomitrella patens]
Length=1123

 Score =   223 bits (568),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 103/184 (56%), Positives = 133/184 (72%), Gaps = 1/184 (1%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            MEP+VS+E   MIRVAV+ IG +P   FRDY  MLV+H  + LS++S++YTEHQKSPFS 
Sbjct  1    MEPEVSVEGGSMIRVAVVAIGEMPPSQFRDYVEMLVQHAQIPLSTVSTYYTEHQKSPFSQ  60

Query  294  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  473
            Q W++GSL  KFM GG+  SPWEDFQ++RKIL V+G+CH P +PD+++  +QF   CK Y
Sbjct  61   QLWETGSLLLKFMVGGASKSPWEDFQAHRKILGVIGLCHLPLTPDISTAYDQFLTICKAY  120

Query  474  SSSLVQRCFAFCPGDSQLE-DDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFE  650
             S+ V RCFAF P D Q++ DD  K   +V+FP  DR   + H+Q +MQD AASLLM FE
Sbjct  121  PSAQVTRCFAFHPTDVQIDSDDEKKKEFLVMFPTMDRQKLKSHMQILMQDFAASLLMAFE  180

Query  651  KWVL  662
             WVL
Sbjct  181  SWVL  184



>gb|EMT13211.1| hypothetical protein F775_03305 [Aegilops tauschii]
Length=1214

 Score =   222 bits (566),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 107/184 (58%), Positives = 135/184 (73%), Gaps = 3/184 (2%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGS-IPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFS  290
            MEP +SIE+   IRVAVLP+G  IP    RD  +++  H  V L+S+  +Y+EHQKSPFS
Sbjct  1    MEPGLSIESGSAIRVAVLPVGGPIPPQRLRDDAALVAEHARVDLASLRPYYSEHQKSPFS  60

Query  291  HQPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKG  470
            H PWD+ SLR KF+ GG   SPWEDFQS+RK+LAV+GICH PSSPDL  VA  F  + + 
Sbjct  61   HPPWDTASLRLKFVLGGCVPSPWEDFQSSRKVLAVVGICHLPSSPDLARVAADFLDAART  120

Query  471  YSSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFE  650
            Y SSL  RCFAFCP D+QL ++   G  I++FPP+D+ + E H+ TM+QD+AASLLMEFE
Sbjct  121  YPSSLASRCFAFCPTDAQLLEERKDG--IIMFPPSDQKSLELHMLTMIQDLAASLLMEFE  178

Query  651  KWVL  662
            KWVL
Sbjct  179  KWVL  182



>ref|XP_001774293.1| predicted protein [Physcomitrella patens]
 gb|EDQ60929.1| predicted protein [Physcomitrella patens]
Length=1118

 Score =   215 bits (547),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 100/184 (54%), Positives = 133/184 (72%), Gaps = 1/184 (1%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            MEPDV +E   +IR+AV+  G +P   FRDY  ML++H  + LSS+S +YTEHQKSPFS 
Sbjct  1    MEPDVRVEGGSIIRLAVVATGEMPPSHFRDYVEMLLQHTKIPLSSVSPYYTEHQKSPFSQ  60

Query  294  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  473
            QPWD+GSL  KF+ GG+ +SPWEDFQ++RKIL V+G+CHCP + +++S  EQF   CK Y
Sbjct  61   QPWDTGSLLLKFVVGGATSSPWEDFQTHRKILGVIGLCHCPLTSEISSAYEQFLTICKAY  120

Query  474  SSSLVQRCFAFCPGDSQLE-DDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFE  650
             S+ V RCFAF P  +Q++ D+  K   +V+FP ADR   + H+QT+MQD +ASLLM FE
Sbjct  121  PSAQVMRCFAFHPTPAQMDLDEEKKKEFLVMFPSADRQQLKTHMQTLMQDFSASLLMAFE  180

Query  651  KWVL  662
              VL
Sbjct  181  SSVL  184



>emb|CAH67557.1| H0311C03.11 [Oryza sativa Indica Group]
Length=1187

 Score =   213 bits (543),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 102/184 (55%), Positives = 130/184 (71%), Gaps = 3/184 (2%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGS-IPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFS  290
            MEP VSIE+   IRVAVLP+G  I     RDY +++ RH  V L+S+  +Y+EHQKSPF+
Sbjct  1    MEPGVSIESGSAIRVAVLPVGGPISPARLRDYAALVARHARVDLASLRPYYSEHQKSPFA  60

Query  291  HQPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKG  470
            HQPW  G LR KF+ GG   SPWEDFQS+RK+LAV+GICH PSSPDL   A     + + 
Sbjct  61   HQPWGGGCLRLKFVLGGCVPSPWEDFQSSRKVLAVVGICHLPSSPDLGRGAADVVDAARS  120

Query  471  YSSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFE  650
              ++   RCFAFCP D+QL     K  NI++FPP+D+ + E H+ TM+QD++ASLLMEFE
Sbjct  121  DPAARASRCFAFCPTDAQLVQK--KRDNIIMFPPSDQQSLELHMLTMIQDLSASLLMEFE  178

Query  651  KWVL  662
            KWVL
Sbjct  179  KWVL  182



>ref|XP_008347735.1| PREDICTED: uncharacterized protein LOC103410865 [Malus domestica]
 ref|XP_008347736.1| PREDICTED: uncharacterized protein LOC103410865 [Malus domestica]
Length=184

 Score =   194 bits (493),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            MEPDVSIETS MIRVAVLPIG +     RDY SML+RHHT+ LS+ISSFYTEHQKSPF+H
Sbjct  1    MEPDVSIETSAMIRVAVLPIGHVAPVFLRDYHSMLLRHHTIPLSAISSFYTEHQKSPFAH  60

Query  294  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFN  455
            QPWDSG+LRFKF+ GG+P SPWEDFQSNRK LAV+GICHCPSSPDL+S+ EQF+
Sbjct  61   QPWDSGNLRFKFVLGGAPPSPWEDFQSNRKTLAVIGICHCPSSPDLDSIIEQFD  114



>ref|XP_008664222.1| PREDICTED: LOW QUALITY PROTEIN: trafficking protein particle 
complex subunit 9-like [Zea mays]
Length=1113

 Score =   195 bits (496),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 99/184 (54%), Positives = 130/184 (71%), Gaps = 6/184 (3%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPL-FRDYTSMLVRHHTVSLSSISSFYTEHQKSPFS  290
            MEP + IE+   IRVAV+P+G    P   R+Y +++ R+  V L+S+ ++Y EHQKSPF 
Sbjct  1    MEPGLRIESGSAIRVAVVPVGGPIPPPRLREYAALVARNARVDLASVRTYYAEHQKSPFQ  60

Query  291  HQPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKG  470
            HQPW++G LR KF+ GG   SPWEDFQS+RK+LAV+GICH PSS     VA  F  + + 
Sbjct  61   HQPWETGCLRLKFVLGGCVPSPWEDFQSSRKVLAVIGICHLPSS---XRVAADFIDAARS  117

Query  471  YSSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFE  650
            Y S+L  RCFAFCP D+QL     K   I++FPP+D+ + E H+ TM+QD+AASLLMEFE
Sbjct  118  YPSALANRCFAFCPTDAQLS--GKKRDTIIMFPPSDQQSLELHMLTMIQDLAASLLMEFE  175

Query  651  KWVL  662
            KWVL
Sbjct  176  KWVL  179



>ref|XP_002965121.1| hypothetical protein SELMODRAFT_83253 [Selaginella moellendorffii]
 gb|EFJ33959.1| hypothetical protein SELMODRAFT_83253 [Selaginella moellendorffii]
Length=1091

 Score =   194 bits (492),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 89/184 (48%), Positives = 124/184 (67%), Gaps = 1/184 (1%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            ME D +++   +IRVAVL +G +P    RDY   +V+H  + L S+ +FY EHQKSPF+ 
Sbjct  1    MELDATLDDFSVIRVAVLAMGQMPPVYLRDYVETIVKHTDMDLRSVRAFYIEHQKSPFTQ  60

Query  294  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  473
              W++G LR KFM GG+  SPWEDFQ++RKI  V+G+CHCP S DL +  ++F   C  Y
Sbjct  61   LAWETGKLRIKFMVGGAVRSPWEDFQAHRKIHGVIGLCHCPLSHDLGATYDKFLTICASY  120

Query  474  SSSLVQRCFAFCPGDSQLE-DDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFE  650
             S+ V+RCF F   D+QLE +D  K S+ +LFP AD  T E H++ +MQ  AA++LM+FE
Sbjct  121  PSAQVKRCFGFHASDNQLEQEDKSKNSDFILFPSADYETLELHIKALMQAFAAAMLMDFE  180

Query  651  KWVL  662
            + VL
Sbjct  181  RRVL  184



>ref|XP_002962206.1| hypothetical protein SELMODRAFT_77626 [Selaginella moellendorffii]
 gb|EFJ37466.1| hypothetical protein SELMODRAFT_77626 [Selaginella moellendorffii]
Length=1091

 Score =   191 bits (486),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 87/184 (47%), Positives = 124/184 (67%), Gaps = 1/184 (1%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            ME D +++   +IRVAVL +G +P    RDY   +V+H  + L S+ +FY EHQKSPF+ 
Sbjct  1    MELDATLDDFSVIRVAVLAMGQMPPVYLRDYVETIVKHTDMDLRSVRAFYIEHQKSPFTQ  60

Query  294  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  473
              W++G LR KFM GG+  +PWEDFQ++RKI  V+G+CHCP S DL +  ++F   C  Y
Sbjct  61   LAWETGKLRIKFMVGGAVRNPWEDFQAHRKIHGVIGLCHCPLSHDLGATYDKFLTICASY  120

Query  474  SSSLVQRCFAFCPGDSQL-EDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFE  650
             S+ V+RCF F   D+QL ++D  K S+ +LFP AD  T E H++ +MQ  AA++LM+FE
Sbjct  121  PSAQVKRCFGFHASDNQLKQEDKSKNSDFILFPSADYETLELHIKALMQAFAAAMLMDFE  180

Query  651  KWVL  662
            + VL
Sbjct  181  RRVL  184



>ref|XP_002963095.1| hypothetical protein SELMODRAFT_165701 [Selaginella moellendorffii]
 gb|EFJ36558.1| hypothetical protein SELMODRAFT_165701 [Selaginella moellendorffii]
Length=1000

 Score =   187 bits (475),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 87/183 (48%), Positives = 118/183 (64%), Gaps = 2/183 (1%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            MEPDV IE  C IRV V+ +GS+P+   RDYT M+ +H  + L + SSFY E QKSPF  
Sbjct  1    MEPDVCIENGCKIRVVVVGVGSMPLHRLRDYTEMVTQHARIELQATSSFYKEDQKSPFGL  60

Query  294  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  473
            QPW++G LRF+F+ G +  S WEDFQ++RK+   +G+ HCP   DL++  E+F   C  Y
Sbjct  61   QPWENGCLRFQFVIGRANRSQWEDFQAHRKVHGCIGVLHCPDVADLDAAYEKFVEICNEY  120

Query  474  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFEK  653
             ++  +RCFAF P   Q +D   K   +VLFPP D+   + H+ T+M D AAS+LM FE 
Sbjct  121  PAAQTRRCFAFSPTQEQQDDK--KRQQMVLFPPVDKQMLKHHVGTLMHDFAASILMAFES  178

Query  654  WVL  662
             VL
Sbjct  179  RVL  181



>ref|XP_002980237.1| hypothetical protein SELMODRAFT_444472 [Selaginella moellendorffii]
 gb|EFJ18497.1| hypothetical protein SELMODRAFT_444472 [Selaginella moellendorffii]
Length=1093

 Score =   181 bits (458),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 88/207 (43%), Positives = 119/207 (57%), Gaps = 24/207 (12%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            MEPDV IE  C IRV V+ +GS+P+   RDYT M+ +H  + L + SSFY E QKSPF  
Sbjct  1    MEPDVCIENGCKIRVVVVGVGSMPLHRLRDYTEMVTQHARIELQATSSFYKEDQKSPFGL  60

Query  294  QPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  473
            QPW++G LRF+F+ G +  S WEDFQ++RK+   +G+ HCP   DL++  E+F   C  Y
Sbjct  61   QPWENGCLRFQFVIGRANRSQWEDFQAHRKVHGCIGVLHCPDVADLDAAYEKFVEICNEY  120

Query  474  SSSLVQRCFAFCPGDSQ------------------------LEDDAYKGSNIVLFPPADR  581
             ++  +RCFAF P   Q                        +E D  K   +VLFPP D+
Sbjct  121  PAAQTRRCFAFSPTQEQALLLFFLELMDSFNLHFIFLAYRRVEQDDKKRQQMVLFPPVDK  180

Query  582  LTQEFHLQTMMQDIAASLLMEFEKWVL  662
               + H+ T+M D AAS+LM FE  VL
Sbjct  181  QMLKHHVGTLMHDFAASILMAFESRVL  207



>ref|XP_005844832.1| hypothetical protein CHLNCDRAFT_138272 [Chlorella variabilis]
 gb|EFN52730.1| hypothetical protein CHLNCDRAFT_138272 [Chlorella variabilis]
Length=1511

 Score =   155 bits (392),  Expect = 4e-39, Method: Composition-based stats.
 Identities = 75/192 (39%), Positives = 112/192 (58%), Gaps = 4/192 (2%)
 Frame = +3

Query  93   PISDSLIMEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEH  272
            P++ +L  E  V++ ++  IRV +LP+G  P  +F+ Y S++VRH  V L+++ SFY E 
Sbjct  7    PVARTL--EAGVTLFSAAEIRVVLLPVGEAPEAVFQRYASLIVRHRQVELNNVRSFYKEA  64

Query  273  QKSPFSHQPWDSGSLRFKFMAG--GSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAE  446
            QKSPF   PW  G++ F+F+       ASP     S+R++L V+GI HCP   D+     
Sbjct  65   QKSPFKFFPWKQGNMHFRFLPEELALEASPLAPLHSHRRVLGVIGIMHCPEVQDVAKAYL  124

Query  447  QFNVSCKGYSSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIA  626
            QF   CK +  +   RCFAF P D Q+++D     N ++FPP D    + H + +M D A
Sbjct  125  QFEQRCKAFPDAFTLRCFAFEPSDEQIQEDRKGQRNFIMFPPGDYEQLDNHAEVVMHDFA  184

Query  627  ASLLMEFEKWVL  662
            A LL E E+W+L
Sbjct  185  ACLLAELERWML  196



>ref|XP_002324891.2| hypothetical protein POPTR_0018s02220g [Populus trichocarpa]
 gb|EEF03456.2| hypothetical protein POPTR_0018s02220g [Populus trichocarpa]
Length=1087

 Score =   143 bits (361),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 63/88 (72%), Positives = 75/88 (85%), Gaps = 0/88 (0%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            MEPDVS+ETS MIR+A++PIG IP    RDY SM + HHT+ LSSISSFYTE QKSPF++
Sbjct  1    MEPDVSVETSAMIRIAIIPIGKIPHQTLRDYYSMFLHHHTIPLSSISSFYTEEQKSPFTN  60

Query  294  QPWDSGSLRFKFMAGGSPASPWEDFQSN  377
            QPW++GSLRFKF+ GG+P SPWEDFQSN
Sbjct  61   QPWETGSLRFKFVLGGAPPSPWEDFQSN  88



>ref|XP_008377455.1| PREDICTED: cytochrome P450 82A3-like [Malus domestica]
Length=215

 Score =   133 bits (335),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 71/89 (80%), Gaps = 0/89 (0%)
 Frame = +3

Query  258  FYTEHQKSPFSHQPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNS  437
             YTEH  SPF+HQP DSG++RFKF+ GG+P SPWEDFQ NRK L V+ I HCPSSP+L+S
Sbjct  44   IYTEHLXSPFAHQPLDSGNIRFKFVLGGAPLSPWEDFQXNRKTLVVISIYHCPSSPNLDS  103

Query  438  VAEQFNVSCKGYSSSLVQRCFAFCPGDSQ  524
            + +QF+ + + YSS+LV RCFAFCP D Q
Sbjct  104  IIDQFDSALRTYSSALVNRCFAFCPDDFQ  132



>ref|XP_006653574.1| PREDICTED: trafficking protein particle complex subunit 9-like 
[Oryza brachyantha]
Length=1113

 Score =   141 bits (355),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/109 (60%), Positives = 84/109 (77%), Gaps = 2/109 (2%)
 Frame = +3

Query  336  GGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGYSSSLVQRCFAFCPG  515
            GG   SPWEDFQS+RK+LAV+GICH PSSPDL+ VA  F  + + Y S+L  RCFAFCP 
Sbjct  5    GGCVPSPWEDFQSSRKVLAVVGICHLPSSPDLDRVAADFVDAARSYPSALANRCFAFCPT  64

Query  516  DSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFEKWVL  662
            D+QL +   K  +I++FPP+D+ + E H+ TM+QD++ASLLMEFEKWVL
Sbjct  65   DAQLVEK--KRDDIIMFPPSDQQSLELHMLTMIQDLSASLLMEFEKWVL  111



>gb|AFW58777.1| hypothetical protein ZEAMMB73_746167 [Zea mays]
Length=106

 Score =   117 bits (294),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 77/104 (74%), Gaps = 1/104 (1%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPL-FRDYTSMLVRHHTVSLSSISSFYTEHQKSPFS  290
            MEP + IE+   IRVAV+P+G    P   R+Y +++ R+  V L+S+ ++Y EHQKSPF 
Sbjct  1    MEPGLRIESGSAIRVAVVPVGGPIPPPRLREYAALVARNARVDLASVRTYYAEHQKSPFQ  60

Query  291  HQPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSS  422
            HQPW++G LR KF+ GG   SPWEDFQS+RK+LAV+GICH PSS
Sbjct  61   HQPWETGCLRLKFVLGGCVPSPWEDFQSSRKVLAVIGICHLPSS  104



>ref|XP_011399423.1| Trafficking protein particle complex subunit 9 [Auxenochlorella 
protothecoides]
 gb|KFM26485.1| Trafficking protein particle complex subunit 9 [Auxenochlorella 
protothecoides]
Length=702

 Score =   122 bits (306),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 61/185 (33%), Positives = 97/185 (52%), Gaps = 3/185 (2%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            +EP++++ +   IRVA++P+G  P   F+   S++ RH  V LS + +F+ E  K+PF H
Sbjct  12   VEPNITLFSPAEIRVAMIPVGEAPDAEFQRCASLITRHKQVKLSHVRTFHHEAHKTPFKH  71

Query  294  QPWDSGSLRFKFMAGGSP--ASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCK  467
             PW SG++ FKF+   +    SP     ++R +L V+GI HC  + DL      F   C 
Sbjct  72   IPWKSGNMNFKFLGEEAALGPSPLSTLHAHRAVLGVIGILHCGHTRDLAKACRAFQQRCH  131

Query  468  GYSSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPP-ADRLTQEFHLQTMMQDIAASLLME  644
             +  +   R F F P D+Q+         +  FPP A     + H + +M D AA +L E
Sbjct  132  AFKGAFTVRLFGFDPTDAQVGGGLLALPGLDTFPPGATPEHLQHHAEVVMHDYAACMLGE  191

Query  645  FEKWV  659
             E+W+
Sbjct  192  LERWM  196



>gb|EEE61278.1| hypothetical protein OsJ_15360 [Oryza sativa Japonica Group]
Length=1247

 Score =   117 bits (294),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 75/197 (38%), Positives = 100/197 (51%), Gaps = 28/197 (14%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGS-IPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFS  290
            MEP VSIE+   IRVAVLP+G  I     RDY +++ RH  V     ++      + P  
Sbjct  1    MEPGVSIESGSAIRVAVLPVGGPISPARLRDYAALVARHARVDSRLAAALLLGAPEEPL-  59

Query  291  HQPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSS-------------PDL  431
                       +  A G    P +      + LAV G+   P               PDL
Sbjct  60   -----------RAPAVGRRLPPPQVRARRLRALAVAGLPVLPQGCSPSSASATSPSFPDL  108

Query  432  NSVAEQFNVSCKGYSSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTM  611
              VA  F  + + Y S+L  RCFAFCP D+QL     K  NI++FPP+D+ + E H+ TM
Sbjct  109  GRVAADFVDAARSYPSALASRCFAFCPTDAQLVQK--KRDNIIMFPPSDQQSLELHMLTM  166

Query  612  MQDIAASLLMEFEKWVL  662
            +QD++ASLLMEFEKWVL
Sbjct  167  IQDLSASLLMEFEKWVL  183



>gb|KDD72036.1| hypothetical protein H632_c3968p0, partial [Helicosporidium sp. 
ATCC 50920]
Length=241

 Score =   111 bits (278),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 70/210 (33%), Positives = 94/210 (45%), Gaps = 45/210 (21%)
 Frame = +3

Query  162  VLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSHQPWDSGSLRFKFM---  332
            +L +G     +F  Y S++ RH  V LSSI SFY E QKSPF   PW +G + F F+   
Sbjct  1    LLCVGEASPAVFDKYASLITRHRQVELSSIKSFYKEAQKSPFKFFPWRTGHMSFSFLEEE  60

Query  333  AGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGYSSSLVQRCFAFCP  512
               +PA P     S+R +  V+G+ HCPS PD+     QF   C+ +  +   R  AF P
Sbjct  61   EALTPA-PLSPLHSHRAVAGVIGVLHCPSVPDVAREVAQFEKVCRTFKGASTVRLAAFGP  119

Query  513  GDSQLEDDAYKGSNIVLFPPADRLTQ----------------------------------  590
             DSQ+ D A K  NI LFPP+    +                                  
Sbjct  120  SDSQMADLAKK-DNIFLFPPSVEEEEQRAEGAESGPPGEESRGSLSVTPPSTPPAARAPR  178

Query  591  ------EFHLQTMMQDIAASLLMEFEKWVL  662
                  E H + MM D AA +L E E+W+L
Sbjct  179  SAPSVLEQHAEIMMTDFAACVLTELERWML  208



>ref|XP_643937.1| hypothetical protein DDB_G0274803 [Dictyostelium discoideum AX4]
 gb|EAL70294.1| hypothetical protein DDB_G0274803 [Dictyostelium discoideum AX4]
Length=1464

 Score = 96.7 bits (239),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 59/184 (32%), Positives = 99/184 (54%), Gaps = 6/184 (3%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            ME +++   +  I++ +LPIG I    +++YTS++   + + LSSI+   ++++ SPF  
Sbjct  1    MEMNLTFTENRSIKILILPIGDISPEKYKEYTSLIKTINIIELSSITR--SQNELSPFEK  58

Query  294  QPWDSGSLRFKFMAGGS-PASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKG  470
              W  GS+   F+  GS   S +ED Q+ +K+  V+G+  C  S DL      F ++   
Sbjct  59   ISWVDGSMILNFVDIGSFQRSEYEDLQTYKKVFGVIGVVDCKKSKDLQETKRLFEIAVAQ  118

Query  471  YSSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP-PADRLTQEFHLQTMMQDIAASLLMEF  647
            Y S +   C AF P D Q   D   G+N+++ P  +DR    F+L T++ D +  +L  F
Sbjct  119  YPSCVSSLCCAFDPMDDQ--PDLGLGANLIMIPNNSDRKHLIFYLTTLLIDFSHMILKYF  176

Query  648  EKWV  659
            EK V
Sbjct  177  EKMV  180



>ref|XP_003290001.1| hypothetical protein DICPUDRAFT_154468 [Dictyostelium purpureum]
 gb|EGC33478.1| hypothetical protein DICPUDRAFT_154468 [Dictyostelium purpureum]
Length=1287

 Score = 94.4 bits (233),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 58/184 (32%), Positives = 99/184 (54%), Gaps = 6/184 (3%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            ME +++   +  I+V +LPIG I    +++YTS++   + + LSSI+   ++++ +PF  
Sbjct  1    MEMNLTFTENRSIKVIILPIGDISPEKYKEYTSLIKTINIIELSSITR--SQNESTPFEK  58

Query  294  QPWDSGSLRFKFMAGGS-PASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKG  470
              W  GS+   F+   S   S +E+FQ+ +K+  V+G+  C  S DL    + F  +   
Sbjct  59   ISWVDGSMLLNFVDASSYQRSEYEEFQTYKKVFGVIGVVDCKKSKDLMVTKKLFEQAVNQ  118

Query  471  YSSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFP-PADRLTQEFHLQTMMQDIAASLLMEF  647
            Y S +   C AF P D Q   D   G+N+++ P  +DR    F+L T++ D +  +L  F
Sbjct  119  YPSCVSSLCCAFDPMDDQ--QDLGLGANLIMIPNNSDRKHLIFYLTTLLIDFSHMILKHF  176

Query  648  EKWV  659
            EK V
Sbjct  177  EKVV  180



>gb|EMS61444.1| hypothetical protein TRIUR3_09999 [Triticum urartu]
Length=1134

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 65/101 (64%), Gaps = 7/101 (7%)
 Frame = +3

Query  360  EDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGYSSSLVQRCFAFCPGDSQLEDDA  539
             D    R+IL  + ICH     +L  VA  F  + + Y S+L  RCFAFCP D+QL +  
Sbjct  11   RDDSKQRRILTSV-ICHA----ELYWVAADFLDASRTYPSALASRCFAFCPTDAQLLEQR  65

Query  540  YKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFEKWVL  662
              G  I++FPP+D+ + E H+ TM+QD+AASLLMEFEKWVL
Sbjct  66   KDG--IIMFPPSDQKSLELHMLTMIQDLAASLLMEFEKWVL  104



>dbj|GAM26879.1| hypothetical protein SAMD00019534_100540 [Acytostelium subglobosum 
LB1]
Length=1028

 Score = 91.3 bits (225),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 53/185 (29%), Positives = 94/185 (51%), Gaps = 7/185 (4%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            M+ +++   +  IRVA+LPIG I +  FR Y++++     + LS I+    E +      
Sbjct  1    MDINLTFIENRAIRVAILPIGDISLDSFRHYSNLIKTLAIIELSGITRDAKESR--VLEK  58

Query  294  QPWDSGSLRFKFMAGGSP-ASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKG  470
              W  G +   F+   +P  S WED   ++++  V+G+  C  + DL      F+++   
Sbjct  59   INWVDGHMLLNFLDSTTPPTSEWEDIHVHKRVFGVIGVVDCKRAKDLTETKRLFDLAIAP  118

Query  471  YSSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPA-DRLTQEFHLQTMMQDIAASLLMEF  647
            Y S++   C+AF P D Q +   ++    V+ P A D+    F+L T++ D + +LL  F
Sbjct  119  YKSAVATVCYAFDPLDEQAD---FEPGKFVMIPNAGDQKHLLFYLNTLLFDFSLTLLRHF  175

Query  648  EKWVL  662
            EK V+
Sbjct  176  EKMVV  180



>emb|CEP15600.1| hypothetical protein [Parasitella parasitica]
Length=1363

 Score = 91.3 bits (225),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 55/181 (30%), Positives = 96/181 (53%), Gaps = 9/181 (5%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            M+  + + +SC +RV ++P+  I    F  Y  ++   + V L  ++    +   + FS 
Sbjct  1    MDLAIDVTSSCKVRVLLVPVAPIKKATFNKYVELVKTFNLVRLGDVTPDMKKGANAMFSS  60

Query  294  QPWDSGSLRFKFMAGGS-PASPWEDFQSNRKILAVLGICHCP--SSPDLNSVAEQFNVSC  464
            Q +  G + F+F+   +   +  EDFQ +R+I  V+GI  C    S DLN   +QF+   
Sbjct  61   QAFQEGQMHFQFITHWTRDHAELEDFQPHRRIFGVIGIMDCQEWKSRDLNEGYKQFSRGL  120

Query  465  KGYSSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLME  644
              Y +++  RCFAF P +SQ EDD  KG  +++ P    ++  F++ TM+ D A+ +L +
Sbjct  121  DQYPTAVATRCFAFDPSESQ-EDDT-KG--LIMIPNVGNMS--FYMSTMICDFASEILEQ  174

Query  645  F  647
            F
Sbjct  175  F  175



>gb|KFH70946.1| hypothetical protein MVEG_03792 [Mortierella verticillata NRRL 
6337]
Length=1465

 Score = 90.1 bits (222),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 57/179 (32%), Positives = 93/179 (52%), Gaps = 8/179 (4%)
 Frame = +3

Query  126  VSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSHQPWD  305
            V+  ++  IRV ++P+G I    F  +  ML  H++V L  +S      + S FS     
Sbjct  4    VNFISAARIRVLLVPVGPIKKATFERHAKMLRNHNSVKLEEVS-MGPRTENSFFSQNVPH  62

Query  306  SGSLRFKFMAGGSPASPW-EDFQSNRKILAVLGICHCPSSPDLNSVA--EQFNVSCKGYS  476
             G L F+F+   S    + E+FQ +R++  V+GI  C   PD N VA  +QF      Y 
Sbjct  63   EGQLYFQFVTSYSNEHQYLEEFQMHRRVFGVIGIMDCQEWPDGNMVAGYQQFQQILAKYP  122

Query  477  SSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFEK  653
            S++  +CFAF P + Q +D   +G  I++ P     +  F+L+ ++ D+A ++L EFE 
Sbjct  123  SAVANQCFAFDPSEQQPDDP--RGGGIIMIPNVGNTS--FYLRVLICDLARTILTEFEN  177



>dbj|GAN03919.1| hypercellular protein [Mucor ambiguus]
Length=1434

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 54/183 (30%), Positives = 96/183 (52%), Gaps = 9/183 (5%)
 Frame = +3

Query  108  LIMEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPF  287
            L M+  + + +SC +RV ++P+  I    F  Y  ++   H V L  ++    +   + F
Sbjct  41   LDMDLAIDVTSSCRVRVLLVPVSPIKKSTFYKYVELVKTFHLVRLGDVTPDLKKGANAMF  100

Query  288  SHQPWDSGSLRFKFMAGGSPA-SPWEDFQSNRKILAVLGICHCP--SSPDLNSVAEQFNV  458
            S Q +  G + F+F+   +   +  EDFQ +R+I  V+GI  C      DL+   +QF+ 
Sbjct  101  SSQVFQEGQMHFQFITHWTREHAELEDFQPHRRIFGVIGIMDCQEWKDKDLSGAYKQFSQ  160

Query  459  SCKGYSSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLL  638
                Y +++  RCFAF P ++Q EDD  KG  +++ P    ++  F++ TM+ D A+ +L
Sbjct  161  DLDQYPTAVATRCFAFDPSETQ-EDDT-KG--LIMIPNVGNMS--FYMSTMICDFASEIL  214

Query  639  MEF  647
             +F
Sbjct  215  EQF  217



>gb|EPB91027.1| hypothetical protein HMPREF1544_02096 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=1379

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 53/181 (29%), Positives = 96/181 (53%), Gaps = 9/181 (5%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            M+  + + +SC +RV ++P+  I    F  Y  ++   H V L  ++    +   + FS 
Sbjct  1    MDLAIDVTSSCRVRVLLVPVSPIKKSTFYKYVELVKTFHLVRLGDVTPDLKKGANAMFSS  60

Query  294  QPWDSGSLRFKFMAGGS-PASPWEDFQSNRKILAVLGICHCPS--SPDLNSVAEQFNVSC  464
            Q +  G + F+F+   +   +  EDFQ +R+I  V+GI  C    + DL+   +QF+   
Sbjct  61   QAFQEGQMHFQFITHWTREHAELEDFQPHRRIFGVIGIMDCQEWKNKDLSEGYKQFSQDL  120

Query  465  KGYSSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLME  644
              Y +++  RCFAF P ++Q EDD  KG  +++ P    ++  F++ TM+ D A+ +L +
Sbjct  121  DQYPTAVATRCFAFDPSETQ-EDDT-KG--LIMIPNVGNMS--FYMSTMICDFASEILEQ  174

Query  645  F  647
            F
Sbjct  175  F  175



>gb|ESA21684.1| hypothetical protein GLOINDRAFT_119508 [Rhizophagus irregularis 
DAOM 181602]
Length=1326

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 51/167 (31%), Positives = 84/167 (50%), Gaps = 7/167 (4%)
 Frame = +3

Query  150  IRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSHQPWDSGSLRFKF  329
            IRV ++P+  I  P F  +  ++   + V L  ++      Q + FS Q +  G L F F
Sbjct  12   IRVLLVPVHPIKAPTFHRHVQLVKNFNVVRLGDVTPDMRGVQSAMFSSQLFHEGQLHFNF  71

Query  330  MAGGSPASPW-EDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGYSSSLVQRCFAF  506
            +    P   + E+FQ +R+I  V+GI  C    DL     +F+   K Y +++  RCFAF
Sbjct  72   VTSYEPEHAYLEEFQMHRRIFGVIGIMDCCEWSDLKEGYNKFSEIIKNYRTAVAHRCFAF  131

Query  507  CPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEF  647
             P + Q +D   KG  +++ P    +   F++ TM+ D A ++L EF
Sbjct  132  DPSEDQPDDT--KG--LIMIPNVGEMN--FYMSTMISDFANNILTEF  172



>ref|XP_002682761.1| hypothetical protein NAEGRDRAFT_77990 [Naegleria gruberi]
 gb|EFC50017.1| hypothetical protein NAEGRDRAFT_77990 [Naegleria gruberi]
Length=1102

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 55/182 (30%), Positives = 88/182 (48%), Gaps = 10/182 (5%)
 Frame = +3

Query  126  VSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSHQPWD  305
            + + T+ +IR+A+ PIG I    F+ + SM+    +  + S++ F  ++ KSPF  Q W 
Sbjct  11   LGVVTNTLIRIAIFPIGKINASTFKKFVSMIQACDSKPIKSLTRFRDDNLKSPFQKQDWS  70

Query  306  SGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKG----Y  473
               L+F+F+   S  + + DF   R +  V+GI  C S     SVA  F    K     Y
Sbjct  71   RSVLKFQFVDETSINTGYSDFHQYRNVHGVIGIMSCLSE---ESVASGFTKYKKQKLQLY  127

Query  474  SSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFEK  653
              ++V RCFA    +   E  A +   +V+ P  D      H+  +  D+A  +L+ FEK
Sbjct  128  GKNIVGRCFAV---EQDPETMAPEDEELVVIPNQDENHVGCHIDYLFSDLARQILIRFEK  184

Query  654  WV  659
             V
Sbjct  185  IV  186



>gb|EFA80348.1| histidine kinase DhkG [Polysphondylium pallidum PN500]
Length=1230

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 52/171 (30%), Positives = 85/171 (50%), Gaps = 5/171 (3%)
 Frame = +3

Query  150  IRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSHQPWDSGSLRFKF  329
            I+VA+LPIG I    FR+Y+S++     + LS I+    E +        W  G +   F
Sbjct  13   IKVAILPIGDISTDSFREYSSLIKTLGIIELSGITRDAKESR--VLEKINWVDGHMLLNF  70

Query  330  MA-GGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGYSSSLVQRCFAF  506
            ++   + +S WED    ++I  V+G+  C  S DL +  + F  +   Y S++   C+AF
Sbjct  71   VSPNTAQSSEWEDILIYKRIFGVIGVVDCKRSRDLAATKQLFEEAIGPYRSAVATICYAF  130

Query  507  CPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFEKWV  659
             P D Q   D  +G  +++    D+    F+L T++ D +  LL  FEK V
Sbjct  131  DPLDEQ--QDLERGKFVMIPNAGDKKHLLFYLSTLLFDFSYQLLRHFEKMV  179



>ref|XP_006682591.1| hypothetical protein BATDEDRAFT_28213 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF76651.1| hypothetical protein BATDEDRAFT_28213 [Batrachochytrium dendrobatidis 
JAM81]
Length=1804

 Score = 84.0 bits (206),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 52/167 (31%), Positives = 91/167 (54%), Gaps = 9/167 (5%)
 Frame = +3

Query  150  IRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSHQPWDSGSLRFKF  329
            I++ V+P+  I    F  Y  +L +  +VSL  ++    + + + F++Q +  G + F F
Sbjct  80   IKILVVPVHPIRQDTFNTYLHLLSQFGSVSLKDLTP--PDAKTAKFTNQFYHDGCIHFNF  137

Query  330  MAGGSPA-SPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGYSSSLVQRCFAF  506
                +   SP E+ Q +R++L V+GI +C  +P+L    ++F    + Y+++L  RCF F
Sbjct  138  ATSHNKEHSPLEEIQLSRQVLGVIGIMNCQQTPNLLDGYKRFQHIVQRYTTTLAYRCFGF  197

Query  507  CPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEF  647
             P D+Q   D  KG  +V+ P    ++  F+LQTM+ D  A LL+ F
Sbjct  198  EPLDTQA--DNIKG--LVMIPNVGNIS--FYLQTMIADFTADLLLAF  238



>ref|XP_004361713.1| histidine kinase [Dictyostelium fasciculatum]
 gb|EGG23862.1| histidine kinase [Dictyostelium fasciculatum]
Length=1180

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 52/183 (28%), Positives = 89/183 (49%), Gaps = 5/183 (3%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            M+ +++   +  IRV VLPIG I    F++YTS++     + LS I+     ++      
Sbjct  1    MDINLTFVENRAIRVVVLPIGDISNESFKEYTSLIRTLGIIELSGITR--DANESKILEK  58

Query  294  QPWDSGSLRFKFM-AGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKG  470
              W  G +   F+ +   P   WE+    +KI  V+G+  C  S DL    +QF  +   
Sbjct  59   ISWVDGHMLLNFLDSTVPPKDEWEELHIYKKIFGVIGVVDCKRSRDLQETKKQFEQAVSR  118

Query  471  YSSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFE  650
            Y S++   C+AF P + Q   D  +G  +++    D+    F+L T++ D + +LL  FE
Sbjct  119  YPSAVATVCYAFDPLEDQ--QDLERGKFVMIPNVGDKKHLLFYLSTLLFDFSHTLLKHFE  176

Query  651  KWV  659
            K +
Sbjct  177  KMI  179



>gb|KDO21720.1| hypothetical protein SPRG_13136 [Saprolegnia parasitica CBS 223.65]
Length=956

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 96/186 (52%), Gaps = 13/186 (7%)
 Frame = +3

Query  126  VSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSIS--SFYTEHQKSPFSHQP  299
            + +  +  I V  +P+G++ + L+ +Y  +L     + +SS++    Y+  + SPF    
Sbjct  1    MGLHANAEILVYTMPVGNLSMELYEEYMGVLQSAAVIPISSLTRPGGYSA-ELSPFRSLS  59

Query  300  WDSG-SLRFKFMAGGSPAS-PWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGY  473
            W+S  +++++F+        P E+  ++R+ LA+LGICHCP++ +L      F      +
Sbjct  60   WESSQAIKYRFLDMNRVLHLPCEEVHASRRPLALLGICHCPTTENLREAYHHFTTVAAQF  119

Query  474  SSSLVQRCFAF--CPGDSQLEDDAYKGSNIVLFPPADRL-----TQEFHLQTMMQDIAAS  632
             +++  +CFAF    G   L+D A    N+V+FP A  L     T   HLQ ++  +  +
Sbjct  120  PTTIAHKCFAFEHAFGAGTLDDVAVL-DNLVMFPLAAPLSDGHTTVSLHLQVVLDSLTVT  178

Query  633  LLMEFE  650
            +LM  E
Sbjct  179  ILMSLE  184



>ref|XP_009530723.1| hypothetical protein PHYSODRAFT_513497 [Phytophthora sojae]
 gb|EGZ13294.1| hypothetical protein PHYSODRAFT_513497 [Phytophthora sojae]
Length=1465

 Score = 81.3 bits (199),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 58/183 (32%), Positives = 90/183 (49%), Gaps = 22/183 (12%)
 Frame = +3

Query  156  VAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSIS--SFYTEHQKSPFSHQPW-DSGSLRFK  326
            V ++P+G IP  +F  Y  +L RH  + L S++    Y   + SPF    W  +GSLRF+
Sbjct  17   VYLVPVGGIPADVFAGYARLLQRHSELPLCSLTRPGGYAA-ELSPFRGLDWAGAGSLRFR  75

Query  327  FMAGGS--PASPWEDFQSNRKILAVLGICHCPS---SPDLNSVAEQFNVSCKGYSSSLVQ  491
            F++      A   ED  ++R+++ VLG+CH PS   S  L +   QF  S + +   L+ 
Sbjct  76   FVSTAERVDACDGEDAHASRRVVGVLGVCHSPSLTLSGGLRAAHAQFEASVRRFPGLLLH  135

Query  492  RCFAFCPGDSQLEDDAYKG----SNIVLFPPADRL------TQEFHLQTMMQDIAASLLM  641
            + FAF   +   ED          ++V+FP    L      T   HLQ +M  +A ++LM
Sbjct  136  KLFAF---EHAFEDATAAECEGLGDLVMFPVHHELEGTGESTVSLHLQVVMDTLAVNVLM  192

Query  642  EFE  650
              E
Sbjct  193  SLE  195



>ref|XP_008618120.1| hypothetical protein SDRG_13800 [Saprolegnia diclina VS20]
 gb|EQC28472.1| hypothetical protein SDRG_13800 [Saprolegnia diclina VS20]
Length=1187

 Score = 80.9 bits (198),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 52/182 (29%), Positives = 94/182 (52%), Gaps = 15/182 (8%)
 Frame = +3

Query  150  IRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSIS---SFYTEHQKSPFSHQPWDSG-SL  317
            I V  +P+G++ + L+ +Y  +L     + +SS++    + TE   SPF    W+S  ++
Sbjct  9    ILVYTMPVGNLSMELYEEYMGVLQSAAVIPISSLTRPGGYSTE--LSPFRSLSWESSQAI  66

Query  318  RFKFMAGGSPAS-PWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGYSSSLVQR  494
            +++F+        P E+  ++R+ LA+LGICHCP++ +L      F      + +++  +
Sbjct  67   KYRFLDMNQVLHVPCEEVHASRRPLALLGICHCPTTENLREAYHHFTTVAAQFPTTIAHK  126

Query  495  CFAF--CPGDSQLEDDAYKGSNIVLFPPADRL-----TQEFHLQTMMQDIAASLLMEFEK  653
            CFAF    G   L+D A    N+V+FP A  L     T   HLQ ++  +  ++LM  E 
Sbjct  127  CFAFEHAFGAGTLDDVAVL-DNLVMFPLAAPLSDGHTTVSLHLQVVLDSLTVTILMSLES  185

Query  654  WV  659
             +
Sbjct  186  LI  187



>gb|EIE80684.1| hypothetical protein RO3G_05389 [Rhizopus delemar RA 99-880]
Length=1267

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 52/181 (29%), Positives = 94/181 (52%), Gaps = 9/181 (5%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            M+  V I +SC +RV ++P+  I    F  +  ++ + +TV L  ++    +   + FS 
Sbjct  1    MDLAVDITSSCRVRVLLVPVSPIKKSSFWRHVELVRKFNTVRLGDVTPDLHKGANAKFSS  60

Query  294  QPWDSGSLRFKFMAG-GSPASPWEDFQSNRKILAVLGICHCP--SSPDLNSVAEQFNVSC  464
            Q +  G + F+F+       S  EDFQ +R+I  V+GI  C      DL+   ++F    
Sbjct  61   QVFQEGQMHFQFVTKYNRDHSHLEDFQPHRRIFGVIGIMDCQEWKDKDLSEGYKEFVDML  120

Query  465  KGYSSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLME  644
              Y +++  RCFAF P ++Q +D   KG  +++ P    ++  F++ TM+ D A+ +L +
Sbjct  121  VQYPTAVATRCFAFDPTENQPDDT--KG--LIMIPNVGNMS--FYMSTMICDFASEILDQ  174

Query  645  F  647
            F
Sbjct  175  F  175



>gb|ETL89091.1| hypothetical protein L917_11910 [Phytophthora parasitica]
Length=1451

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/183 (31%), Positives = 89/183 (49%), Gaps = 16/183 (9%)
 Frame = +3

Query  156  VAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSIS--SFYTEHQKSPFSHQPW-DSGSLRFK  326
            V ++P+G IP  LF  Y  +L  H  + L S++    Y   + SPF    W  +GSLRF 
Sbjct  17   VYLVPVGGIPSDLFASYARLLQSHSELPLRSLTRPGGYAA-ELSPFRGLDWTGTGSLRFH  75

Query  327  FMAGGSPASPW--EDFQSNRKILAVLGICHCPS---SPDLNSVAEQFNVSCKGYSSSLVQ  491
            F++       +  ED  ++R+++  LG+CH PS   S  L +   QF  S + +   L+ 
Sbjct  76   FVSTAEHVESYDGEDVHASRRVIGALGVCHSPSLTLSGGLRAAHAQFEASVQRFPGLLMH  135

Query  492  RCFAFCPGDSQLEDDAYKG-SNIVLFPPADRL------TQEFHLQTMMQDIAASLLMEFE  650
            + FAF      +     +G S++V+FP    L      T   HLQ +M  +A ++LM  E
Sbjct  136  KLFAFEHAFEDVTSSECEGLSDLVMFPVHHELEGTGESTVTLHLQVVMDTLAVNILMALE  195

Query  651  KWV  659
              +
Sbjct  196  SAI  198



>gb|ETK82491.1| hypothetical protein L915_12150 [Phytophthora parasitica]
 gb|ETP12188.1| hypothetical protein F441_12410 [Phytophthora parasitica CJ01A1]
Length=1451

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/183 (31%), Positives = 89/183 (49%), Gaps = 16/183 (9%)
 Frame = +3

Query  156  VAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSIS--SFYTEHQKSPFSHQPW-DSGSLRFK  326
            V ++P+G IP  LF  Y  +L  H  + L S++    Y   + SPF    W  +GSLRF 
Sbjct  17   VYLVPVGGIPSDLFASYARLLQSHSELPLRSLTRPGGYAA-ELSPFRGLDWTGTGSLRFH  75

Query  327  FMAGGSPASPW--EDFQSNRKILAVLGICHCPS---SPDLNSVAEQFNVSCKGYSSSLVQ  491
            F++       +  ED  ++R+++  LG+CH PS   S  L +   QF  S + +   L+ 
Sbjct  76   FVSTAEHVESYDGEDVHASRRVIGALGVCHSPSLTLSGGLRAAHAQFEASVQRFPGLLMH  135

Query  492  RCFAFCPGDSQLEDDAYKG-SNIVLFPPADRL------TQEFHLQTMMQDIAASLLMEFE  650
            + FAF      +     +G S++V+FP    L      T   HLQ +M  +A ++LM  E
Sbjct  136  KLFAFEHAFEDVTSSECEGLSDLVMFPVHHELEGTGESTVTLHLQVVMDTLAVNILMALE  195

Query  651  KWV  659
              +
Sbjct  196  SAI  198



>gb|ETO71095.1| hypothetical protein F444_12526 [Phytophthora parasitica P1976]
Length=1451

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/183 (31%), Positives = 89/183 (49%), Gaps = 16/183 (9%)
 Frame = +3

Query  156  VAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSIS--SFYTEHQKSPFSHQPW-DSGSLRFK  326
            V ++P+G IP  LF  Y  +L  H  + L S++    Y   + SPF    W  +GSLRF 
Sbjct  17   VYLVPVGGIPSDLFASYARLLQSHSELPLRSLTRPGGYAA-ELSPFRGLDWTGTGSLRFH  75

Query  327  FMAGGSPASPW--EDFQSNRKILAVLGICHCPS---SPDLNSVAEQFNVSCKGYSSSLVQ  491
            F++       +  ED  ++R+++  LG+CH PS   S  L +   QF  S + +   L+ 
Sbjct  76   FVSTAEHVESYDGEDVHASRRVIGALGVCHSPSLTLSGGLRAAHAQFEASVQRFPGLLMH  135

Query  492  RCFAFCPGDSQLEDDAYKG-SNIVLFPPADRL------TQEFHLQTMMQDIAASLLMEFE  650
            + FAF      +     +G S++V+FP    L      T   HLQ +M  +A ++LM  E
Sbjct  136  KLFAFEHAFEDVTSSECEGLSDLVMFPVHHELEGTGESTVTLHLQVVMDTLAVNILMALE  195

Query  651  KWV  659
              +
Sbjct  196  SAI  198



>gb|ETL35876.1| hypothetical protein L916_12075 [Phytophthora parasitica]
Length=1451

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/183 (31%), Positives = 89/183 (49%), Gaps = 16/183 (9%)
 Frame = +3

Query  156  VAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSIS--SFYTEHQKSPFSHQPW-DSGSLRFK  326
            V ++P+G IP  LF  Y  +L  H  + L S++    Y   + SPF    W  +GSLRF 
Sbjct  17   VYLVPVGGIPSDLFASYARLLQSHSELPLRSLTRPGGYAA-ELSPFRGLDWTGTGSLRFH  75

Query  327  FMAGGSPASPW--EDFQSNRKILAVLGICHCPS---SPDLNSVAEQFNVSCKGYSSSLVQ  491
            F++       +  ED  ++R+++  LG+CH PS   S  L +   QF  S + +   L+ 
Sbjct  76   FVSTAEHVESYDGEDVHASRRVIGALGVCHSPSLTLSGGLRAAHAQFEASVQRFPGLLMH  135

Query  492  RCFAFCPGDSQLEDDAYKG-SNIVLFPPADRL------TQEFHLQTMMQDIAASLLMEFE  650
            + FAF      +     +G S++V+FP    L      T   HLQ +M  +A ++LM  E
Sbjct  136  KLFAFEHAFEDVTSSECEGLSDLVMFPVHHELEGTGESTVTLHLQVVMDTLAVNILMALE  195

Query  651  KWV  659
              +
Sbjct  196  SAI  198



>ref|XP_008908759.1| hypothetical protein PPTG_14018 [Phytophthora parasitica INRA-310]
 gb|ETN06257.1| hypothetical protein PPTG_14018 [Phytophthora parasitica INRA-310]
Length=1451

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/183 (31%), Positives = 89/183 (49%), Gaps = 16/183 (9%)
 Frame = +3

Query  156  VAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSIS--SFYTEHQKSPFSHQPW-DSGSLRFK  326
            V ++P+G IP  LF  Y  +L  H  + L S++    Y   + SPF    W  +GSLRF 
Sbjct  17   VYLVPVGGIPSDLFASYARLLQSHSELPLRSLTRPGGYAA-ELSPFRGLDWTGTGSLRFH  75

Query  327  FMAGGSPASPW--EDFQSNRKILAVLGICHCPS---SPDLNSVAEQFNVSCKGYSSSLVQ  491
            F++       +  ED  ++R+++  LG+CH PS   S  L +   QF  S + +   L+ 
Sbjct  76   FVSTAEHVDSYDGEDVHASRRVIGALGVCHSPSLTLSGGLRAAHAQFEASVQRFPGLLMH  135

Query  492  RCFAFCPGDSQLEDDAYKG-SNIVLFPPADRL------TQEFHLQTMMQDIAASLLMEFE  650
            + FAF      +     +G S++V+FP    L      T   HLQ +M  +A ++LM  E
Sbjct  136  KLFAFEHAFEDVTSSECEGLSDLVMFPVHHELEGTGESTVTLHLQVVMDTLAVNILMALE  195

Query  651  KWV  659
              +
Sbjct  196  SAI  198



>gb|ETI42476.1| hypothetical protein F443_12424 [Phytophthora parasitica P1569]
 gb|ETM42371.1| hypothetical protein L914_11983 [Phytophthora parasitica]
Length=1451

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/183 (31%), Positives = 89/183 (49%), Gaps = 16/183 (9%)
 Frame = +3

Query  156  VAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSIS--SFYTEHQKSPFSHQPW-DSGSLRFK  326
            V ++P+G IP  LF  Y  +L  H  + L S++    Y   + SPF    W  +GSLRF 
Sbjct  17   VYLVPVGGIPSDLFASYARLLQSHSELPLRSLTRPGGYAA-ELSPFRGLGWTGTGSLRFH  75

Query  327  FMAGGSPASPW--EDFQSNRKILAVLGICHCPS---SPDLNSVAEQFNVSCKGYSSSLVQ  491
            F++       +  ED  ++R+++  LG+CH PS   S  L +   QF  S + +   L+ 
Sbjct  76   FVSTAEHVESYDGEDVHASRRVIGALGVCHSPSLTLSGGLRAAHAQFEASVQRFPGLLMH  135

Query  492  RCFAFCPGDSQLEDDAYKG-SNIVLFPPADRL------TQEFHLQTMMQDIAASLLMEFE  650
            + FAF      +     +G S++V+FP    L      T   HLQ +M  +A ++LM  E
Sbjct  136  KLFAFEHAFEDVTSSECEGLSDLVMFPVHHELEGTGESTVTLHLQVVMDTLAVNILMALE  195

Query  651  KWV  659
              +
Sbjct  196  SAI  198



>gb|ETP40315.1| hypothetical protein F442_12346 [Phytophthora parasitica P10297]
Length=1451

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/183 (31%), Positives = 89/183 (49%), Gaps = 16/183 (9%)
 Frame = +3

Query  156  VAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSIS--SFYTEHQKSPFSHQPW-DSGSLRFK  326
            V ++P+G IP  LF  Y  +L  H  + L S++    Y   + SPF    W  +GSLRF 
Sbjct  17   VYLVPVGGIPSDLFASYARLLQSHSELPLRSLTRPGGYAA-ELSPFRGLDWTGTGSLRFH  75

Query  327  FMAGGSPASPW--EDFQSNRKILAVLGICHCPS---SPDLNSVAEQFNVSCKGYSSSLVQ  491
            F++       +  ED  ++R+++  LG+CH PS   S  L +   QF  S + +   L+ 
Sbjct  76   FVSTAEHVDSYDGEDVHASRRVIGALGVCHSPSLTLSGGLRAAHAQFEASVQRFPGLLMH  135

Query  492  RCFAFCPGDSQLEDDAYKG-SNIVLFPPADRL------TQEFHLQTMMQDIAASLLMEFE  650
            + FAF      +     +G S++V+FP    L      T   HLQ +M  +A ++LM  E
Sbjct  136  KLFAFEHAFEDVTSSECEGLSDLVMFPVHHELEGTGESTVTLHLQVVMDTLAVNILMALE  195

Query  651  KWV  659
              +
Sbjct  196  SAI  198



>emb|CEG81602.1| hypothetical protein RMATCC62417_15784 [Rhizopus microsporus]
Length=1232

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 52/179 (29%), Positives = 85/179 (47%), Gaps = 12/179 (7%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            M+  V I   C IRV ++P+  I    F+ Y  ++   HT+ L  +    T +    F+ 
Sbjct  1    MDIAVDITCLCRIRVLLVPVFPIKRSTFKKYVQLIQSLHTIRLGDV----TPNLNDTFNS  56

Query  294  QPWDSGSLRFKFMAG-GSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKG  470
            Q +  G L F+F+    +     +DFQ  R++  V+GI  C    DL+   +QF    + 
Sbjct  57   QVFPEGQLHFEFLTHVANDHVELQDFQPYRRLFGVIGIMDCQEWKDLSEGYDQFMKMAQT  116

Query  471  YSSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEF  647
             ++  V RCFAF P    +E+ A     +++ P    +   F++ TMM D A  +L EF
Sbjct  117  IAAP-VTRCFAFDP----IENQADNAKGLIMIPNVGNMV--FYMSTMMNDFANEVLAEF  168



>emb|CEG65590.1| hypothetical protein RMATCC62417_02344 [Rhizopus microsporus]
Length=1232

 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 52/179 (29%), Positives = 85/179 (47%), Gaps = 12/179 (7%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            M+  V I   C IRV ++P+  I    F+ Y  ++   HT+ L  +    T +    F+ 
Sbjct  1    MDIAVDITCLCRIRVLLVPVFPIKRSTFKKYVQLIQSLHTIRLGDV----TPNLNDKFNS  56

Query  294  QPWDSGSLRFKFMAG-GSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKG  470
            Q +  G L F+F+    +     +DFQ  R++  V+GI  C    DL+   +QF    + 
Sbjct  57   QMFPEGQLHFEFLTHVTNDHVELQDFQPCRRLFGVIGIMDCREWKDLSEGYDQFMKMAQT  116

Query  471  YSSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEF  647
             ++  V RCFAF P    +E+ A     +++ P    +   F++ TMM D A  +L EF
Sbjct  117  IAAP-VTRCFAFDP----IENQADNAKGLIMIPNVGNMV--FYMSTMMNDFANEVLAEF  168



>ref|XP_008876428.1| hypothetical protein H310_11503 [Aphanomyces invadans]
 gb|ETV94837.1| hypothetical protein H310_11503 [Aphanomyces invadans]
Length=1349

 Score = 78.2 bits (191),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 58/186 (31%), Positives = 92/186 (49%), Gaps = 18/186 (10%)
 Frame = +3

Query  150  IRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSIS--SFYTEHQKSPFSHQPWDSG-SLR  320
            I V V+P+G++   ++ +   ML     + +SS++    Y+  + SPF    WDS  S  
Sbjct  14   ILVYVMPVGNMSPRMYMEGVKMLQASSDIPMSSLTRPGGYSS-ELSPFRSLSWDSSTSFV  72

Query  321  FKFMAGGSPAS------PWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGYSSS  482
            ++F    S AS      P ED  +  + LA+LG+CHCPS+ +L      F      Y S+
Sbjct  73   YRFEDTTSNASSVSTPVPCEDVHAWNRPLAILGLCHCPSTANLRDAYTDFKRVAANYPSA  132

Query  483  LVQRCFAF--CPGDSQLEDDAYKGSNIVLFPPADRLTQ-----EFHLQTMMQDIAASLLM  641
            ++Q+ +AF    GD  L DD     ++V+FP A  LT        HLQ ++  +  ++LM
Sbjct  133  ILQKVYAFEHAFGDGTL-DDVSALDDLVMFPLAAPLTDGHTTVSLHLQVVLDAMTVTILM  191

Query  642  EFEKWV  659
              E  V
Sbjct  192  SLESTV  197



>emb|CEI98563.1| hypothetical protein RMCBS344292_12669 [Rhizopus microsporus]
Length=1152

 Score = 77.4 bits (189),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 51/179 (28%), Positives = 85/179 (47%), Gaps = 12/179 (7%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            M+  V I   C IRV ++P+  I    F+ Y  ++   HT+ L  +    T +    F+ 
Sbjct  1    MDIAVDITCLCRIRVLLVPVFPIKRSTFKKYVQLIQSLHTIRLGDV----TPNLNDKFNS  56

Query  294  QPWDSGSLRFKFMAG-GSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKG  470
            Q +  G L F+F+    +     +DFQ  R++  V+GI  C    DL+   +QF    + 
Sbjct  57   QMFPEGQLHFEFLTHVTNDHVELQDFQPCRRLFGVIGIMDCREWKDLSEGYDQFMKMAQT  116

Query  471  YSSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEF  647
             ++  + RCFAF P    +E+ A     +++ P    +   F++ TMM D A  +L EF
Sbjct  117  IAAP-ITRCFAFDP----IENQADNAKGLIMIPNVGNMV--FYMSTMMNDFANEVLAEF  168



>emb|CEI86846.1| hypothetical protein RMCBS344292_01273 [Rhizopus microsporus]
Length=595

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/181 (28%), Positives = 91/181 (50%), Gaps = 9/181 (5%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            M+  V I + C +RV ++P+  I    F  +  ++ +   V L  ++    +   + FS 
Sbjct  1    MDLAVDITSCCRVRVLLVPVSPIKKSSFWRHVELVKKFSLVRLGDVTPDLQKGANAKFSS  60

Query  294  QPWDSGSLRFKFMAG-GSPASPWEDFQSNRKILAVLGICHCP--SSPDLNSVAEQFNVSC  464
            Q +  G + F+F+       S  EDFQ +R+I  V+GI  C      DL+   ++F    
Sbjct  61   QVFQEGHMHFQFVTKYNREHSHLEDFQPHRRIFGVIGIMDCQEWKDKDLSEGYQKFVDML  120

Query  465  KGYSSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLME  644
              Y +++  RCFAF P ++Q +D   KG  +++ P    ++  F++ TM+ D A+ +L +
Sbjct  121  VQYPTAIATRCFAFDPTENQPDDT--KG--LIMIPNVGNMS--FYMSTMICDFASEILNQ  174

Query  645  F  647
            F
Sbjct  175  F  175



>emb|CAN71170.1| hypothetical protein VITISV_022666 [Vitis vinifera]
Length=657

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +3

Query  525  LEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFEKWVL  662
            LED + +  N++LFPP+DR TQEFH+ TM+QDIAASLLMEFEKWVL
Sbjct  481  LEDGSKREGNLILFPPSDRQTQEFHMNTMVQDIAASLLMEFEKWVL  526



>emb|CEJ01961.1| hypothetical protein RMCBS344292_15981 [Rhizopus microsporus]
Length=595

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/181 (28%), Positives = 91/181 (50%), Gaps = 9/181 (5%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            M+  V I + C +RV ++P+  I    F  +  ++ +   V L  ++    +   + FS 
Sbjct  1    MDLAVDITSCCRVRVLLVPVSPIKKSSFWRHVELVKKFSLVRLGDVTPDLQKGANAKFSS  60

Query  294  QPWDSGSLRFKFMAG-GSPASPWEDFQSNRKILAVLGICHCP--SSPDLNSVAEQFNVSC  464
            Q +  G + F+F+       S  EDFQ +R+I  V+GI  C      DL+   ++F    
Sbjct  61   QVFQEGHMHFQFVTKYNRDHSHLEDFQPHRRIFGVIGIMDCQEWKDKDLSEGYQKFVDML  120

Query  465  KGYSSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLME  644
              Y +++  RCFAF P ++Q +D   KG  +++ P    ++  F++ TM+ D A+ +L +
Sbjct  121  VQYPTAIATRCFAFDPTENQPDDT--KG--LIMIPNVGNMS--FYMSTMICDFASEILNQ  174

Query  645  F  647
            F
Sbjct  175  F  175



>emb|CDS05824.1| hypothetical protein LRAMOSA08352 [Absidia idahoensis var. thermophila]
Length=1384

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/181 (27%), Positives = 92/181 (51%), Gaps = 9/181 (5%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            M+  ++I +SC +RV ++P+  I    F  +  ++ +   V L  ++        + FS 
Sbjct  1    MDLAINITSSCRVRVLLVPVPPIKSSTFWKHVELVKKFSVVRLGDVTPDLQNGAGAMFSS  60

Query  294  QPWDSGSLRFKFMAGGS-PASPWEDFQSNRKILAVLGICHCP--SSPDLNSVAEQFNVSC  464
            Q +  G + F+F    +   +  EDFQ +R+I  V+GI  C      DL+   + F  + 
Sbjct  61   QVFQEGQMHFQFTTTYTRDHAHLEDFQPHRRIFGVIGIMDCQEWKDKDLSEGHKHFVDTL  120

Query  465  KGYSSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLME  644
              Y +++  RCFAF P ++Q +D   KG  +++ P    ++  F++ TM+ D A+ +L +
Sbjct  121  HKYPTAIATRCFAFDPTETQPDDT--KG--LIMIPNVGNMS--FYMSTMICDFASEILSQ  174

Query  645  F  647
            F
Sbjct  175  F  175



>emb|CEG76765.1| hypothetical protein RMATCC62417_11620 [Rhizopus microsporus]
Length=930

 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 50/181 (28%), Positives = 91/181 (50%), Gaps = 9/181 (5%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            M+  V I + C +RV ++P+  I    F  +  ++ +   V L  ++    +   + FS 
Sbjct  1    MDLAVDITSCCRVRVLLVPVSPIKKSSFWRHVELVKKFSLVRLGDVTPDLQKGANAKFSS  60

Query  294  QPWDSGSLRFKFMAG-GSPASPWEDFQSNRKILAVLGICHCP--SSPDLNSVAEQFNVSC  464
            Q +  G + F+F+       S  EDFQ +R+I  V+GI  C      DL+   ++F    
Sbjct  61   QVFQEGHMHFQFVTKYNRDHSHLEDFQPHRRIFGVIGIMDCQEWKDKDLSEGYQKFVDML  120

Query  465  KGYSSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLME  644
              Y +++  RCFAF P ++Q +D   KG  +++ P    ++  F++ TM+ D A+ +L +
Sbjct  121  VQYPTAIATRCFAFDPTENQPDDT--KG--LIMIPNVGNMS--FYMSTMICDFASEILNQ  174

Query  645  F  647
            F
Sbjct  175  F  175



>ref|XP_002896003.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gb|EEY53716.1| conserved hypothetical protein [Phytophthora infestans T30-4]
Length=1398

 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 56/180 (31%), Positives = 85/180 (47%), Gaps = 16/180 (9%)
 Frame = +3

Query  156  VAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSIS--SFYTEHQKSPFSHQPW-DSGSLRFK  326
            V ++P+G IP  LF  Y  +L  H  + L S++    Y   + SPF    W   GSLRF 
Sbjct  17   VYLVPVGGIPSDLFTSYARLLQTHSELPLRSLTRPGGYAA-ELSPFRGLDWTGKGSLRFH  75

Query  327  FMAGGS--PASPWEDFQSNRKILAVLGICHCPS---SPDLNSVAEQFNVSCKGYSSSLVQ  491
            F++      +   ED   +R+++  LG+CH PS   S  L +   QF  S + + + L+ 
Sbjct  76   FVSTAEHVESCDGEDVHVSRRVIGALGVCHSPSLTLSGGLQAAHAQFEASVRRFPALLMH  135

Query  492  RCFAFCPGDSQLEDDAYKGSN-IVLFPPADRL------TQEFHLQTMMQDIAASLLMEFE  650
            + FAF            +G N +V+FP    L      T   HLQ +M  +A ++LM  E
Sbjct  136  KLFAFEHTFEVATSSECEGLNDLVMFPVHHELEGTGESTVTLHLQVVMDTLAVNILMALE  195



>emb|CBN75733.1| OSJNBa0029H02.30 [Ectocarpus siliculosus]
Length=467

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 50/181 (28%), Positives = 81/181 (45%), Gaps = 18/181 (10%)
 Frame = +3

Query  153  RVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISS-FYTEHQKSPFSHQPWDSGSLRFKF  329
            +V ++P+G+IP  ++  Y  +L R  T+ + ++++      Q S   H  W  G   F F
Sbjct  19   QVLLVPLGNIPPDVYAKYCEILRRFSTIPMQNLTAPGDWNRQNSALKHFNWSEGCFNFHF  78

Query  330  MA-----GGSPASPWEDFQSNRKILAVLGICHCPS----SPDLNSVAEQFNVSCKGYSSS  482
            +      GG   S WED+Q+ R++L  +G+ H PS      D   + +QFN    GY   
Sbjct  79   IDQDTTDGG--LSDWEDYQAYRRVLGAIGVVHFPSCEGGRADFKELEKQFNQVVAGYKHV  136

Query  483  LVQRCFAFCPGDSQLE-DDAYKGSNIVLFPPADRL-----TQEFHLQTMMQDIAASLLME  644
               R FAF     Q +  D       ++FPP         T E H+   + D+A S++  
Sbjct  137  HATRMFAFGHSFEQGDYPDILDPQRDIVFPPEQEFEGGGSTTELHMAVSLYDVAVSIIKN  196

Query  645  F  647
             
Sbjct  197  L  197



>dbj|GAN09915.1| hypercellular protein [Mucor ambiguus]
Length=1369

 Score = 74.7 bits (182),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 48/181 (27%), Positives = 91/181 (50%), Gaps = 9/181 (5%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            M+  + I ++C +RV ++P+  I    F  +  ++ +   V L  ++    +   + FS 
Sbjct  1    MDLALDITSACRVRVLLVPVSPIKKSTFWHHVELVRKFSLVRLGDVTPDLHKGANAKFSS  60

Query  294  QPWDSGSLRFKFMAG-GSPASPWEDFQSNRKILAVLGICHCP--SSPDLNSVAEQFNVSC  464
            Q +  G + F+F+          EDFQ +R+I  V+GI  C      DL+   ++F    
Sbjct  61   QVFQEGQMHFQFVTKYNRDHCHLEDFQPHRRIFGVIGIMDCQEWKDKDLSEGYKKFVDML  120

Query  465  KGYSSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLME  644
              Y +++  RCFAF P ++Q +D   KG  +++ P    ++  F++ TM+ D A+ +L +
Sbjct  121  SQYPTAVATRCFAFDPNENQPDDT--KG--LIMIPNVGNMS--FYMSTMICDFASEILDQ  174

Query  645  F  647
            F
Sbjct  175  F  175



>gb|EPB81036.1| hypothetical protein HMPREF1544_12262 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=1381

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/181 (27%), Positives = 91/181 (50%), Gaps = 9/181 (5%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            M+  + I ++C +RV ++P+  I    F  +  ++ +   V L  ++    +   + FS 
Sbjct  1    MDLALDITSACRVRVLLVPVSPIKKSTFWHHVELVRKFSLVRLGDVTPDLHKGANAKFSS  60

Query  294  QPWDSGSLRFKFMAG-GSPASPWEDFQSNRKILAVLGICHCP--SSPDLNSVAEQFNVSC  464
            Q +  G + F+F+          EDFQ +R+I  V+GI  C      DL+   ++F    
Sbjct  61   QVFQEGQMHFQFVTKYNRDHCHLEDFQPHRRIFGVIGIMDCQEWKDKDLSEGYKKFVDML  120

Query  465  KGYSSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLME  644
              Y +++  RCFAF P ++Q +D   KG  +++ P    ++  F++ TM+ D A+ +L +
Sbjct  121  SQYPTAVATRCFAFDPTENQPDDT--KG--LIMIPNVGNMS--FYMSTMICDFASEILDQ  174

Query  645  F  647
            F
Sbjct  175  F  175



>emb|CEP12553.1| hypothetical protein [Parasitella parasitica]
Length=1394

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/181 (27%), Positives = 89/181 (49%), Gaps = 9/181 (5%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            M+  + I ++C +RV ++P+  I    F  +  ++ +   V L  ++    +   + FS 
Sbjct  1    MDLALDITSACRVRVLLVPVSPIKKSTFWRHVELVRKFSLVRLGDVTPDLHQGTNAKFSS  60

Query  294  QPWDSGSLRFKFMAG-GSPASPWEDFQSNRKILAVLGICHCP--SSPDLNSVAEQFNVSC  464
            Q +  G + F+F+          EDFQ +R+I  V+GI  C      DLN    +F    
Sbjct  61   QAFQEGQMHFQFVTKYNQDHCHLEDFQPHRRIFGVIGIMDCREWKDKDLNEGYRKFVGML  120

Query  465  KGYSSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLME  644
              Y ++L  R FAF P ++Q +D   KG  +++ P    ++  F++ TM+ D A+ +L +
Sbjct  121  GQYPTALATRFFAFDPTENQPDDT--KG--LIMIPNVGNMS--FYMSTMICDFASQILDQ  174

Query  645  F  647
            F
Sbjct  175  F  175



>ref|XP_002954311.1| hypothetical protein VOLCADRAFT_106329 [Volvox carteri f. nagariensis]
 gb|EFJ44735.1| hypothetical protein VOLCADRAFT_106329 [Volvox carteri f. nagariensis]
Length=196

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/159 (26%), Positives = 67/159 (42%), Gaps = 39/159 (25%)
 Frame = +3

Query  156  VAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEH-----------------QKSP  284
             AVLP+G++P     +Y  ++ R          SFY E                   K P
Sbjct  41   AAVLPVGAVPRDAMEEYLELINR----------SFYRESPVVQAAAVSAAGLAGGVSKPP  90

Query  285  FSHQPWDSGSLRFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSC  464
                 W +  L  +F+               R++LA+LG+ HCP   ++    ++F   C
Sbjct  91   LQLLDWSNSYLHLRFL----------QLYPGRQVLAILGVVHCPMCSNVQQAYDEFKKIC  140

Query  465  KGYSSSLVQRCFAFCPGDSQL--EDDAYKGSNIVLFPPA  575
            + Y  +LV RCF F P +  +  E D  + S++V+FPP 
Sbjct  141  RSYPEALVTRCFVFEPSEDHIRQERDCQQLSDLVMFPPG  179



>ref|XP_005819358.1| trafficking protein particle complex 9 [Guillardia theta CCMP2712]
 gb|EKX32378.1| trafficking protein particle complex 9 [Guillardia theta CCMP2712]
Length=1818

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 63/129 (49%), Gaps = 6/129 (5%)
 Frame = +3

Query  150  IRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKS---PFSHQPWDSGSLR  320
            +RVA++P+G I    F  Y  +L    ++ +  +         S   PFS    D G LR
Sbjct  18   VRVALMPVGRISPERFERYARVLTDVRSIDVRVVDRTEVSSASSHAFPFSEGLADYGQLR  77

Query  321  FKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQF---NVSCKGYSSSLVQ  491
              F+  G   SPW+  Q++R++LAV+GIC+CP + D  S  E F     S   +  ++  
Sbjct  78   ILFVDVGYSNSPWDSLQASRQVLAVVGICYCPEADDFLSAWESFLHDVQSSHVWRGAISV  137

Query  492  RCFAFCPGD  518
             C A  PG+
Sbjct  138  HCIAIEPGE  146



>ref|XP_009845683.1| hypothetical protein H257_18343 [Aphanomyces astaci]
 gb|ETV64826.1| hypothetical protein H257_18343 [Aphanomyces astaci]
Length=1399

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 53/188 (28%), Positives = 93/188 (49%), Gaps = 20/188 (11%)
 Frame = +3

Query  150  IRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSIS--SFYTEHQKSPFSHQPWDSG-SLR  320
            I V V+P+G+IP  ++ +   ML     + +SS++    Y+  + SPF    WDS  S+ 
Sbjct  14   ILVYVMPVGNIPRHMYMEGIRMLQASAVIPMSSLTRPGGYSA-ELSPFRALSWDSTTSIV  72

Query  321  FKF--------MAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGYS  476
            ++F         +    ++  ++  +  + L V+G+CHCPS+ DL      F  +   Y 
Sbjct  73   YRFEDTLSQASSSSTLSSASCDEVHAWNRPLGVIGLCHCPSTADLRDAYADFKRAALKYP  132

Query  477  SSLVQRCFAF--CPGDSQLEDDAYKGSNIVLFPPADRL-----TQEFHLQTMMQDIAASL  635
            S+++Q+ +AF    G   LED +    ++V+FP A  L     T   HLQ ++  +  ++
Sbjct  133  SAIIQKVYAFEHAFGAGTLEDVSAL-DDLVMFPLAAPLSDGHTTVSLHLQVVLDAMTVTI  191

Query  636  LMEFEKWV  659
            LM  E  V
Sbjct  192  LMSLESTV  199



>gb|EPZ33229.1| TRAPP II complex, Trs120 domain-containing protein [Rozella allomycis 
CSF55]
Length=988

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 35/98 (36%), Positives = 50/98 (51%), Gaps = 5/98 (5%)
 Frame = +3

Query  360  EDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGYSSSLVQRCFAFCPGDSQLEDDA  539
            EDFQ  R+I  ++GI HCP   DL    E+FN     +   + +RCFAF P + Q ++  
Sbjct  43   EDFQIYRQISGIIGIVHCPQYDDLGEAHERFNKITSKFPQIINKRCFAFEPREDQPDNS-  101

Query  540  YKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEFEK  653
                N+++ P  D     F+L TM+ D   S L  F K
Sbjct  102  ---KNVIMIPNQDE-QLSFYLSTMINDFTCSFLQTFGK  135



>ref|XP_007321257.1| hypothetical protein SERLADRAFT_451500 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EGO21471.1| hypothetical protein SERLADRAFT_451500 [Serpula lacrymans var. 
lacrymans S7.9]
Length=1349

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 50/181 (28%), Positives = 86/181 (48%), Gaps = 12/181 (7%)
 Frame = +3

Query  144  CMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSHQPWDSGSLRF  323
             ++R+ +LP+G I  P F  Y + +     + L  I +  T+  ++ F   P  +G L  
Sbjct  10   ALVRILLLPVGGISGPTFEKYAAEIRNFDNIRLGDIPA-ETKEDRARFMPNPLSTGYLHL  68

Query  324  KFMAGGSP--ASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGYSSS-----  482
             F +   P   SP   F+ +   L V+GI  C  +  LNS+ E+F  S    SSS     
Sbjct  69   AFPSHPPPFTHSPLSLFRPSHFSLGVVGIAVCSQTEPLNSILEKFEHSLGEISSSGSTFP  128

Query  483  LVQRCFAFCPGDSQLEDDAYKGSNI--VLFPPADRLTQEFHLQTMMQDIAASLLMEFEKW  656
            L + CF F   DS+    +  G NI  ++  P+    ++ ++ T++ D+ + +L EF + 
Sbjct  129  LAKICFVF--EDSEETAGSNLGENIPGLVVIPSVMGNKKLYIGTLLADLCSQILGEFSRI  186

Query  657  V  659
            V
Sbjct  187  V  187



>gb|EMD38404.1| hypothetical protein CERSUDRAFT_113560 [Ceriporiopsis subvermispora 
B]
Length=1353

 Score = 62.0 bits (149),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 48/185 (26%), Positives = 84/185 (45%), Gaps = 9/185 (5%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            MEP ++  +   +RV +LP+G+I  P F  +   +    ++ L  I S +++  ++ F  
Sbjct  1    MEP-LAFASLAHVRVLLLPVGNIRKPDFERWAGEIAGFESIRLGDIPS-HSKDDRARFMP  58

Query  294  QPWDSGSLRFKFMAGGSPAS--PWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSC-  464
             P  SG L   F    +P S  P    + +   L V+GI  C  +  L+SV   FN    
Sbjct  59   NPLSSGFLHLSFTTHPAPTSHVPLSLIRPSDFPLGVIGIASCSQTDALSSVLADFNEVVS  118

Query  465  ----KGYSSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAAS  632
                +G +  L + CF F   D     D       ++  PA    ++ H+ T++ D+ ++
Sbjct  119  NLFPEGATYPLAKNCFVFEESDGNTNIDVGNHFPGLVVIPALLGNKQLHIGTLLADLCSN  178

Query  633  LLMEF  647
            +L EF
Sbjct  179  ILGEF  183



>ref|XP_004345847.1| hypothetical protein ACA1_182040 [Acanthamoeba castellanii str. 
Neff]
 gb|ELR21303.1| hypothetical protein ACA1_182040 [Acanthamoeba castellanii str. 
Neff]
Length=1019

 Score = 61.6 bits (148),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 40/126 (32%), Positives = 67/126 (53%), Gaps = 4/126 (3%)
 Frame = +3

Query  276  KSPFSHQPWDSGSLRFKFM-AGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQF  452
            +S  + + W  G +  +F+ +  +  S WEDFQ +RK L V+GI HC    DL+    +F
Sbjct  3    RSGSTQRWWQGGRVYPRFVDSRTTHRSDWEDFQVHRKTLGVVGIIHCAQWRDLSDAYTEF  62

Query  453  NVSCKGYSSSLVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAAS  632
                + + +++   CFAF P D Q +   +   N+V+ P  D+    F+L T++ D  A+
Sbjct  63   ERLRRQHPTAVAVTCFAFEPRDDQPD---FAKDNLVMIPNGDQKRLLFYLNTLLLDFMAT  119

Query  633  LLMEFE  650
            +L E E
Sbjct  120  ILKELE  125



>gb|EMS24343.1| hypothetical protein RHTO_06347 [Rhodosporidium toruloides NP11]
 emb|CDR41949.1| RHTO0S06e08130g1_1 [Rhodosporidium toruloides]
Length=1432

 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 41/177 (23%), Positives = 82/177 (46%), Gaps = 12/177 (7%)
 Frame = +3

Query  144  CMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSHQPWDSGSLRF  323
              ++V ++P+  I    F  Y  ++ +  ++ L+ +       +++ FS  P   G+L F
Sbjct  8    AKLQVLLVPVHPIKRSKFERYVQLIRKFGSIPLAEVPP-DRRGERAVFSSSPTTPGTLLF  66

Query  324  KFMAGGS-----PASPWEDFQSNRKILAVLGICHCPSSPD--LNSVAEQFNVSCKGYSSS  482
             ++   +     P +   +FQ +R+I  ++GI       D  L      F+ S +    +
Sbjct  67   DYLTPTTYAPLHPLAFLSEFQVHRRIQGIIGILDASEYSDKALADAVTAFHASLRDLPKT  126

Query  483  LVQRCFAFCPGDSQLEDDA--YKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEF  647
               + + F PG+ QLE+     +G  +V+ P A  ++  F L+T++ D A  +L EF
Sbjct  127  FATKVYGFDPGEKQLEEARAIQEGEGLVMVPAAGDVS--FFLKTVLADFAGDILFEF  181



>emb|CDP20750.1| unnamed protein product [Coffea canephora]
Length=123

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 40/55 (73%), Gaps = 2/55 (4%)
 Frame = +3

Query  210  SMLVRHHTVSLSSISSFYTEHQKSPFSHQPWD--SGSLRFKFMAGGSPASPWEDF  368
            S+L+  HTVSLSSISSF  +H K PF  QPWD  S SLRFKF+  GSP S WEDF
Sbjct  69   SLLLHRHTVSLSSISSFSAQHHKIPFFDQPWDSPSASLRFKFILAGSPLSHWEDF  123



>ref|XP_004345072.1| hypothetical protein CAOG_06323 [Capsaspora owczarzaki ATCC 30864]
 gb|KJE95934.1| hypothetical protein CAOG_006323 [Capsaspora owczarzaki ATCC 
30864]
Length=1274

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 51/92 (55%), Gaps = 4/92 (4%)
 Frame = +3

Query  363  DFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGYSSSLVQRCFAFCPGDSQLEDDAY  542
            DF  +++ L + GI +C  + DL     +F  +C  + + L  RCFAF P D+Q +++ +
Sbjct  275  DFHFSKRTLVIFGIINCQHTVDLRLAYREFQAACSQFPTVLDVRCFAFEPQDAQEDNEKH  334

Query  543  KGSNIVLFPPADRLTQEFHLQTMMQDIAASLL  638
                ++L P   R   +F++ T++ D+  SL+
Sbjct  335  ----VILIPNQAREHVQFYISTILNDMTLSLV  362



>gb|EGU12099.1| Transport protein particle complex subunit [Rhodotorula glutinis 
ATCC 204091]
Length=1432

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/177 (23%), Positives = 82/177 (46%), Gaps = 12/177 (7%)
 Frame = +3

Query  144  CMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSHQPWDSGSLRF  323
              ++V ++P+  I    F  Y  ++ +  ++ L+ +       +++ FS  P   G+L F
Sbjct  8    AKLQVLLVPVHPIKRSKFERYVELIRKFGSIPLAEVPP-DRRGERAVFSSSPTTPGTLLF  66

Query  324  KFMAGGSPA-----SPWEDFQSNRKILAVLGICHCPSSPD--LNSVAEQFNVSCKGYSSS  482
             ++   + A     +   +FQ +R+I  ++GI       D  L      F+ S +    +
Sbjct  67   DYLTPTTYAPLHTLAFLSEFQVHRRIQGIIGILDASEYSDKALADAVTAFHASLRDLPKT  126

Query  483  LVQRCFAFCPGDSQLEDDA--YKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEF  647
               + + F PG+ QLE+     +G  +V+ P A  ++  F L+T++ D A  +L EF
Sbjct  127  FATKVYGFDPGEKQLEEARAIQEGEGLVMVPAAGDVS--FFLKTVLADFAGDILFEF  181



>gb|KDR81631.1| hypothetical protein GALMADRAFT_239700 [Galerina marginata CBS 
339.88]
Length=1334

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 85/186 (46%), Gaps = 26/186 (14%)
 Frame = +3

Query  150  IRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSHQPWDSGSLRFKF  329
            +R+ ++P+G IP  LF  YT  +    ++ L  I +   + + + F   P   G+L   F
Sbjct  12   VRILLIPVGLIPQSLFAAYTEEIRSFESIRLGEIPAETRDGRAARFLPNPLSKGNLLISF  71

Query  330  MAGGSPASPWEDFQSNRKI-------LAVLGICHCPSSPDLNSVAEQFNVSC-----KGY  473
                 P  P     S   +       LAV+G+  C  +  L S+  QFN S       G 
Sbjct  72   -----PTHPPPQSHSILSLVRPSHFPLAVIGVATCSQTDSLKSLYTQFNASLADVFPSGS  126

Query  474  SSSLVQRCFAF--CPGDSQLE-DDAYKGSNIVLFPPADRLT-QEFHLQTMMQDIAASLLM  641
               LV+ C+AF    G   L+ D+   G  +V+ P   R+T ++ H+ T++ D+ + ++ 
Sbjct  127  IYPLVKNCYAFEEIEGSVNLDLDEDLPG--LVIVP---RITNRKLHIGTLIGDLCSQIMT  181

Query  642  EFEKWV  659
            EFE  V
Sbjct  182  EFEVLV  187



>gb|KII88477.1| hypothetical protein PLICRDRAFT_110169 [Plicaturopsis crispa 
FD-325 SS-3]
Length=1353

 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 43/176 (24%), Positives = 85/176 (48%), Gaps = 14/176 (8%)
 Frame = +3

Query  150  IRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSHQPWDSGSLRFKF  329
            +R+ ++P+GSI   +F  Y + +     + LS I +  T+ +K  F  +P  +G +   +
Sbjct  12   LRILLVPVGSIQQSVFEKYAAEIRSFDEIRLSDIPA-DTKDEKVRFMPKPLQAGYIHISY  70

Query  330  MAGGSPAS--PWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSC-----KGYSSSLV  488
             +   P++  P   F+ +   L V+G+  C  +  L+S+  QFN         G    L 
Sbjct  71   PSHPPPSAHAPLSLFRPSHFPLGVIGVAACSETESLSSILTQFNAMLFNMFPTGSMFPLA  130

Query  489  QRCFAFCPGDSQLE---DDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEF  647
            + CF F  GDS+     D++  G  ++   P+    ++ ++ T++ D+ + +L EF
Sbjct  131  RNCFVFEDGDSKTNLNLDESMPGLVVI---PSIMGNKKLYVGTLLADLCSRILGEF  183



>gb|EWM27764.1| TRAPP II complex, Trs120 protein [Nannochloropsis gaditana]
Length=176

 Score = 53.9 bits (128),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 56/99 (57%), Gaps = 7/99 (7%)
 Frame = +3

Query  117  EPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVR-HHTVSLSSISSFYT-EHQKSPFS  290
            EP+ S      +RVAV+P+G +P   FR Y S+L R  H + ++++S   + + + SPF 
Sbjct  10   EPN-SFAAHRQLRVAVVPLGGVPGARFRVYLSLLRRSFHELPMANLSKPGSWKKESSPFK  68

Query  291  HQPWDSGSLRFKFMAGGSP----ASPWEDFQSNRKILAV  395
            H  W  G+L  +++    P    +S W+DFQ+ R+  AV
Sbjct  69   HFSWFDGNLLLQYLDRAPPSTSASSEWQDFQAFRRTWAV  107



>ref|XP_007843830.1| hypercellular protein [Moniliophthora roreri MCA 2997]
 gb|ESK96998.1| hypercellular protein [Moniliophthora roreri MCA 2997]
Length=1306

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 44/175 (25%), Positives = 80/175 (46%), Gaps = 11/175 (6%)
 Frame = +3

Query  144  CMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSHQPWDSGSLRF  323
              +R+ ++P+G I    F  Y S +    ++ L  I    T  +++ F+ +P  +G L  
Sbjct  10   AQVRILLVPVGPISSHSFEKYASEITSFDSIRLGDIPE-ATNDERARFTPKPLSTGHLHL  68

Query  324  KFMAGGSPAS--PWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFN-----VSCKGYSSS  482
             F +   P S  P    + +   LAV+GI  C    +L ++  QFN     +   G    
Sbjct  69   SFPSHPPPISHNPLSLIRPSHFPLAVIGIASCSHPDNLGAMLAQFNGILMDMFPGGSIYP  128

Query  483  LVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEF  647
            L + CF F  GD     ++  G  +V+F P     ++ ++ T++ D+ + +L EF
Sbjct  129  LAKNCFVFEEGDGTCSSESIPG--LVVF-PGMMGNRKLYIGTLLADLCSHVLGEF  180



>gb|KJB65888.1| hypothetical protein B456_010G117200 [Gossypium raimondii]
Length=1024

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +3

Query  588  QEFHLQTMMQDIAASLLMEFEKWVL  662
            QEFHL TMMQDIAASLLMEFEKWVL
Sbjct  2    QEFHLHTMMQDIAASLLMEFEKWVL  26



>gb|KJB65886.1| hypothetical protein B456_010G117200 [Gossypium raimondii]
Length=1044

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +3

Query  588  QEFHLQTMMQDIAASLLMEFEKWVL  662
            QEFHL TMMQDIAASLLMEFEKWVL
Sbjct  2    QEFHLHTMMQDIAASLLMEFEKWVL  26



>emb|CEG65184.1| hypothetical protein RMATCC62417_02017 [Rhizopus microsporus]
Length=1322

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 33/101 (33%), Positives = 56/101 (55%), Gaps = 8/101 (8%)
 Frame = +3

Query  351  SPWEDFQSNRKILAVLGICHCPS--SPDLNSVAEQFNVSCKGYSSSLVQRCFAFCPGDSQ  524
            S  EDFQ +R+I  V+GI  C      DL+   ++F      Y +++  RCFAF P ++Q
Sbjct  14   SHLEDFQPHRRIFGVIGIMDCQEWKDKDLSEGYQKFVDMLVQYPTAIATRCFAFDPTENQ  73

Query  525  LEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEF  647
             +D   KG  +++ P    ++  F++ TM+ D A+ +L +F
Sbjct  74   PDDT--KG--LIMIPNVGNMS--FYMSTMICDFASEILNQF  108



>gb|KIK57801.1| hypothetical protein GYMLUDRAFT_45995 [Gymnopus luxurians FD-317 
M1]
Length=1295

 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 41/175 (23%), Positives = 80/175 (46%), Gaps = 8/175 (5%)
 Frame = +3

Query  144  CMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSHQPWDSGSLRF  323
              IR+ ++PIG+I    F  Y S +     + L+ I+      +++ F  +P  +G L  
Sbjct  10   AQIRILLVPIGTISHQTFEKYASEIRSFDAIRLADIAVEGNRDERARFQPKPLSTGYLHL  69

Query  324  KFMAGGSPAS--PWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGYSSS-----  482
             F +   P S  P    + +   LA++G+  C S   L ++  QF+ +      +     
Sbjct  70   SFPSHPPPHSHQPLALIRPSHFPLAIIGVTTCSSPQILPNILAQFDDTVTDMFPASGFYP  129

Query  483  LVQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASLLMEF  647
            L ++CF F  G S     + +   +V+FP      ++ H+ T++ +I +++  EF
Sbjct  130  LEKKCFVFEEGASVAISSSDQHPELVVFPEM-MGNRKLHIGTLLGEICSTIFGEF  183



>ref|XP_007764740.1| hypothetical protein CONPUDRAFT_141859 [Coniophora puteana RWD-64-598 
SS2]
 gb|EIW85166.1| hypothetical protein CONPUDRAFT_141859 [Coniophora puteana RWD-64-598 
SS2]
Length=1325

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 85/186 (46%), Gaps = 8/186 (4%)
 Frame = +3

Query  114  MEPDVSIETSCMIRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSH  293
            MEP  +  +   +R+ VLP+G+I    F +Y S +    T+ LS I +   + +++ F  
Sbjct  1    MEPH-AFASLAHLRLLVLPVGTISKSAFEEYASEIRCFDTIKLSDIPA-SVKDERARFLP  58

Query  294  QPWDSGSL--RFKFMAGGSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFN--VS  461
             P  SGSL  RF    G S  +P    + ++  L ++G+  C S     ++  QFN   S
Sbjct  59   NPLSSGSLHLRFSSYVGPSVRAPLSLIRPSQSTLGIVGVGVCSSKQTPTTLQRQFNKLAS  118

Query  462  CKGYSSSL--VQRCFAFCPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQDIAASL  635
                ++S    + CFAF   +        +    V   P     ++ ++ T++ D+ + +
Sbjct  119  SLALTNSFPTSKVCFAFEESEEVAGAAMSEAVPGVTVIPHLMGNKKLYIGTLLADLCSQI  178

Query  636  LMEFEK  653
            L EF +
Sbjct  179  LGEFGR  184



>gb|KIK47079.1| hypothetical protein CY34DRAFT_9254 [Suillus luteus UH-Slu-Lm8-n1]
Length=1348

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 46/184 (25%), Positives = 84/184 (46%), Gaps = 26/184 (14%)
 Frame = +3

Query  150  IRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSHQPWDSGSLRFKF  329
            I + VLP+G IP  +F  Y + +    ++ L  I +   + +++ F   P  SG L   +
Sbjct  12   IPILVLPVGPIPRTVFEKYAAEIRTFDSIRLGDIPTGMKD-ERARFMPNPLSSGYLYLSY  70

Query  330  MAGGSPASP----WEDFQSNRKILAVLGICHCPSSPDLNSVAEQF-----NVSCKGYSSS  482
             +   PA P       F+ +   L ++G+  C SS  L S  EQF     ++S +G +  
Sbjct  71   PS--HPAPPRHMSLSLFRPSHFTLGIIGVAACSSSYSLTSALEQFDKTVLDISPEGSTFP  128

Query  483  LVQRCFAFCPGDSQLEDDAYKGSN-------IVLFPPADRLTQEFHLQTMMQDIAASLLM  641
            L + CFAF       ED+   GS         ++  P+    ++ ++ T++ D+ + +L 
Sbjct  129  LAKVCFAF-------EDEESAGSTGLGDTLPGIVSIPSVMGNKKLYIGTLLADLCSHILA  181

Query  642  EFEK  653
            E  +
Sbjct  182  ELGR  185



>ref|NP_001169811.1| uncharacterized protein LOC100383703 [Zea mays]
 gb|ACN34971.1| unknown [Zea mays]
Length=118

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = -2

Query  403  MPRTARILRLDWKSSQGLAGEPPAMNLNRRLPESQGW  293
            MP TA  LR DWKSSQG   +PP+ NL RR P SQGW
Sbjct  1    MPITASTLREDWKSSQGEGTQPPSTNLRRRHPVSQGW  37



>ref|NP_594102.1| TRAPP complex subunit Trs120 (predicted) [Schizosaccharomyces 
pombe 972h-]
 sp|O14251.1|TR120_SCHPO RecName: Full=Transport protein particle subunit trs120; Short=TRAPP 
subunit trs120 [Schizosaccharomyces pombe 972h-]
 emb|CAB11291.1| TRAPP complex subunit Trs120 (predicted) [Schizosaccharomyces 
pombe]
Length=1210

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 40/172 (23%), Positives = 76/172 (44%), Gaps = 14/172 (8%)
 Frame = +3

Query  150  IRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSHQPWDSGSLRFKF  329
            ++  VLP G +    F  Y  +L R   + LS +       + S F+   +  G L + F
Sbjct  14   VQSLVLPFGRVRRKSFSSYLQLLRRVSHIQLSDVPVATATRKSSSFNPLAFPLGRLVYNF  73

Query  330  MAG-GSPASPWEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGYSSSLVQRCFAF  506
            +       +  E+F+  R++  ++GI       ++  +    +V  +    +LV +C  F
Sbjct  74   LTSLDDQQALLEEFEYFRRVFVLIGIVDGSEEQEVEQLCSTLDVWRRRIPHALVAKCIVF  133

Query  507  -CPGDSQLEDDAYKGSNIVLFPPADRLTQEFHLQTMMQ----DIAASLLMEF  647
             CP D   +++ +   NI++ P +D     F + ++M+    DI A LL  F
Sbjct  134  NCPED---KENIFNAPNIIIGPRSD-----FSINSVMRSILCDITAELLEGF  177



>gb|KDQ60798.1| hypothetical protein JAAARDRAFT_31778 [Jaapia argillacea MUCL 
33604]
Length=1354

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 43/183 (23%), Positives = 83/183 (45%), Gaps = 20/183 (11%)
 Frame = +3

Query  150  IRVAVLPIGSIPIPLFRDYTSMLVRHHTVSLSSISSFYTEHQKSPFSHQPWDSGSLRFKF  329
            +R+ ++P+GSI  P+F  + + + +  +++L  + +      ++ F   P  SGSL   F
Sbjct  12   VRILLIPVGSIEPPVFDKWAAEIRQFDSIALGDVPA-DNRDDRARFMPNPLASGSLHVDF  70

Query  330  MAGGSPASP--WEDFQSNRKILAVLGICHCPSSPDLNSVAEQFNVSCKGYSSS-----LV  488
                 P+S      F+ +   L V+G+  C  +  L+S+  +FN S      S     L 
Sbjct  71   PTHPPPSSHELLSLFRPSHFPLGVIGVACCSGTDSLSSIQARFNASLTQMLPSNSMFPLA  130

Query  489  QRCFAFCPGDSQLEDDAYKGSNI------VLFPPADRLTQEFHLQTMMQDIAASLLMEFE  650
            + CF F       EDD     N+      ++  P+    ++ ++ T++ D+ + +L EF 
Sbjct  131  RNCFVFE------EDDGNTNLNLGDHLPGLVVIPSMMGNKKLYIGTLLADLCSQILGEFS  184

Query  651  KWV  659
              V
Sbjct  185  ALV  187



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1023687230320