BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF052I01

Length=657
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KGN44460.1|  hypothetical protein Csa_7G298765                     96.7    8e-22   Cucumis sativus [cucumbers]
gb|KDO57106.1|  hypothetical protein CISIN_1g048552mg                 98.6    2e-21   Citrus sinensis [apfelsine]
ref|XP_009392917.1|  PREDICTED: uncharacterized protein LOC103978735  96.3    1e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010096477.1|  hypothetical protein L484_006724                 96.3    1e-20   Morus notabilis
ref|XP_006427929.1|  hypothetical protein CICLE_v10026489mg           96.3    1e-20   Citrus clementina [clementine]
gb|KHG16765.1|  hypothetical protein F383_20843                       95.9    2e-20   Gossypium arboreum [tree cotton]
ref|XP_008776936.1|  PREDICTED: uncharacterized protein LOC103696971  95.5    3e-20   Phoenix dactylifera
ref|XP_008808717.1|  PREDICTED: uncharacterized protein LOC103720668  95.1    4e-20   Phoenix dactylifera
ref|XP_002278435.1|  PREDICTED: uncharacterized protein LOC100245741  94.7    4e-20   Vitis vinifera
emb|CAN64859.1|  hypothetical protein VITISV_030494                   94.7    5e-20   Vitis vinifera
ref|XP_007048174.1|  Uncharacterized protein isoform 2                94.7    5e-20   
gb|KJB14929.1|  hypothetical protein B456_002G149700                  94.4    5e-20   Gossypium raimondii
gb|KJB14930.1|  hypothetical protein B456_002G149700                  94.4    5e-20   Gossypium raimondii
ref|XP_007048173.1|  Uncharacterized protein isoform 1                94.7    6e-20   
gb|KJB18360.1|  hypothetical protein B456_003G048500                  94.4    6e-20   Gossypium raimondii
ref|XP_010268579.1|  PREDICTED: uncharacterized protein LOC104605493  94.0    1e-19   Nelumbo nucifera [Indian lotus]
ref|NP_001291356.1|  uncharacterized protein LOC105049617             93.6    1e-19   Elaeis guineensis
ref|XP_010261019.1|  PREDICTED: uncharacterized protein LOC104599958  93.6    1e-19   Nelumbo nucifera [Indian lotus]
ref|XP_009412399.1|  PREDICTED: uncharacterized protein LOC103993894  93.2    2e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010027746.1|  PREDICTED: uncharacterized protein LOC104418182  92.4    3e-19   Eucalyptus grandis [rose gum]
ref|XP_010925082.1|  PREDICTED: uncharacterized protein LOC105047727  92.4    3e-19   Elaeis guineensis
gb|KHG24783.1|  hypothetical protein F383_09417                       92.0    4e-19   Gossypium arboreum [tree cotton]
ref|XP_010915065.1|  PREDICTED: uncharacterized protein LOC105040293  92.0    4e-19   Elaeis guineensis
ref|XP_011100916.1|  PREDICTED: uncharacterized protein LOC105179031  92.0    5e-19   Sesamum indicum [beniseed]
gb|KCW54334.1|  hypothetical protein EUGRSUZ_I00298                   92.8    6e-19   Eucalyptus grandis [rose gum]
ref|XP_010925339.1|  PREDICTED: uncharacterized protein LOC105047906  91.3    8e-19   Elaeis guineensis
ref|XP_011100069.1|  PREDICTED: uncharacterized protein LOC105178309  90.9    1e-18   Sesamum indicum [beniseed]
ref|XP_006383639.1|  hypothetical protein POPTR_0005s21840g           87.4    1e-18   
emb|CDP11436.1|  unnamed protein product                              90.9    1e-18   Coffea canephora [robusta coffee]
ref|XP_010681257.1|  PREDICTED: uncharacterized protein LOC104896...  90.5    1e-18   
ref|XP_010681253.1|  PREDICTED: uncharacterized protein LOC104896...  90.5    2e-18   
ref|XP_008793512.1|  PREDICTED: uncharacterized protein LOC103709793  90.1    2e-18   
ref|XP_008786494.1|  PREDICTED: uncharacterized protein LOC103704817  90.1    2e-18   Phoenix dactylifera
gb|EYU24058.1|  hypothetical protein MIMGU_mgv1a012421mg              90.5    3e-18   Erythranthe guttata [common monkey flower]
ref|XP_007048172.1|  Uncharacterized protein TCM_001288               90.1    3e-18   Theobroma cacao [chocolate]
gb|EYU31112.1|  hypothetical protein MIMGU_mgv1a014609mg              89.4    3e-18   Erythranthe guttata [common monkey flower]
ref|XP_010681250.1|  PREDICTED: uncharacterized protein LOC104896...  90.1    3e-18   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004139686.1|  PREDICTED: uncharacterized protein LOC101216474  89.7    3e-18   Cucumis sativus [cucumbers]
gb|EPS64635.1|  hypothetical protein M569_10142                       89.7    3e-18   Genlisea aurea
ref|XP_008461917.1|  PREDICTED: uncharacterized protein LOC103500405  89.7    3e-18   Cucumis melo [Oriental melon]
ref|XP_009389481.1|  PREDICTED: uncharacterized protein LOC103976031  89.4    4e-18   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFK42100.1|  unknown                                               89.0    6e-18   Lotus japonicus
ref|XP_007200578.1|  hypothetical protein PRUPE_ppa011863mg           88.2    8e-18   
ref|XP_009335132.1|  PREDICTED: uncharacterized protein LOC103927893  88.6    8e-18   Pyrus x bretschneideri [bai li]
ref|XP_011458474.1|  PREDICTED: uncharacterized protein LOC101309208  88.6    8e-18   Fragaria vesca subsp. vesca
ref|XP_008386362.1|  PREDICTED: uncharacterized protein LOC103448885  88.6    9e-18   Malus domestica [apple tree]
ref|XP_009401877.1|  PREDICTED: uncharacterized protein LOC103985...  87.8    9e-18   
ref|XP_008237488.1|  PREDICTED: uncharacterized protein LOC103336223  88.2    1e-17   Prunus mume [ume]
ref|XP_002524331.1|  conserved hypothetical protein                   87.8    1e-17   Ricinus communis
ref|XP_009401860.1|  PREDICTED: uncharacterized protein LOC103985...  87.8    2e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001237965.1|  uncharacterized protein LOC100527566             87.4    2e-17   Glycine max [soybeans]
gb|KDP36560.1|  hypothetical protein JCGZ_08327                       87.0    3e-17   Jatropha curcas
gb|KHN29132.1|  hypothetical protein glysoja_008467                   87.0    3e-17   Glycine soja [wild soybean]
ref|XP_008381858.1|  PREDICTED: uncharacterized protein LOC103444684  87.0    3e-17   Malus domestica [apple tree]
emb|CBI18241.3|  unnamed protein product                              86.3    3e-17   Vitis vinifera
gb|AFK36877.1|  unknown                                               87.0    3e-17   Lotus japonicus
ref|XP_009336494.1|  PREDICTED: uncharacterized protein LOC103929073  86.7    4e-17   Pyrus x bretschneideri [bai li]
ref|XP_010097650.1|  hypothetical protein L484_023790                 86.7    4e-17   
ref|XP_007159785.1|  hypothetical protein PHAVU_002G267000g           86.7    5e-17   Phaseolus vulgaris [French bean]
ref|XP_003525093.1|  PREDICTED: uncharacterized protein LOC100815955  86.3    6e-17   Glycine max [soybeans]
gb|ACU24594.1|  unknown                                               85.9    7e-17   Glycine max [soybeans]
ref|XP_009631427.1|  PREDICTED: uncharacterized protein LOC104121198  85.9    7e-17   Nicotiana tomentosiformis
ref|XP_009761480.1|  PREDICTED: uncharacterized protein LOC104213649  85.9    7e-17   Nicotiana sylvestris
ref|XP_002300905.2|  hypothetical protein POPTR_0002s06540g           85.5    9e-17   Populus trichocarpa [western balsam poplar]
ref|XP_011042891.1|  PREDICTED: uncharacterized protein LOC105138502  85.5    1e-16   Populus euphratica
gb|ABK22079.1|  unknown                                               85.9    1e-16   Picea sitchensis
gb|AFK43213.1|  unknown                                               85.5    1e-16   Lotus japonicus
ref|XP_003634526.1|  PREDICTED: uncharacterized protein LOC100854952  85.1    1e-16   Vitis vinifera
ref|XP_011044272.1|  PREDICTED: uncharacterized protein LOC105139508  84.7    2e-16   Populus euphratica
gb|EPS71131.1|  hypothetical protein M569_03625                       82.4    2e-16   Genlisea aurea
ref|XP_006359041.1|  PREDICTED: uncharacterized protein LOC102584007  84.3    3e-16   Solanum tuberosum [potatoes]
gb|KDO83805.1|  hypothetical protein CISIN_1g028515mg                 84.3    3e-16   Citrus sinensis [apfelsine]
ref|XP_006434518.1|  hypothetical protein CICLE_v10002494mg           84.0    3e-16   Citrus clementina [clementine]
ref|XP_002458073.1|  hypothetical protein SORBIDRAFT_03g026490        83.6    5e-16   Sorghum bicolor [broomcorn]
gb|EAY74747.1|  hypothetical protein OsI_02639                        83.6    5e-16   Oryza sativa Indica Group [Indian rice]
gb|AFK49616.1|  unknown                                               83.6    5e-16   Medicago truncatula
ref|XP_003630138.1|  hypothetical protein MTR_8g092210                83.6    5e-16   Medicago truncatula
ref|XP_007019592.1|  Uncharacterized protein TCM_035706               83.2    6e-16   
gb|AFK38910.1|  unknown                                               82.4    6e-16   Medicago truncatula
ref|XP_004503996.1|  PREDICTED: uncharacterized protein LOC101509322  83.2    6e-16   Cicer arietinum [garbanzo]
ref|XP_010530126.1|  PREDICTED: uncharacterized protein LOC104806765  82.8    6e-16   Tarenaya hassleriana [spider flower]
gb|KHG14904.1|  hypothetical protein F383_02753                       83.6    6e-16   Gossypium arboreum [tree cotton]
ref|XP_003548092.1|  PREDICTED: uncharacterized protein LOC100793841  82.8    7e-16   Glycine max [soybeans]
ref|XP_002872465.1|  hypothetical protein ARALYDRAFT_352054           82.8    8e-16   Arabidopsis lyrata subsp. lyrata
ref|XP_010542952.1|  PREDICTED: uncharacterized protein LOC104815997  82.4    8e-16   Tarenaya hassleriana [spider flower]
gb|AAM62508.1|  unknown                                               82.8    8e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003569287.1|  PREDICTED: uncharacterized protein LOC100830936  82.8    8e-16   Brachypodium distachyon [annual false brome]
ref|NP_192721.1|  uncharacterized protein                             82.4    8e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004288874.1|  PREDICTED: uncharacterized protein LOC101298370  81.3    9e-16   Fragaria vesca subsp. vesca
gb|KFK32043.1|  hypothetical protein AALP_AA6G192700                  82.4    9e-16   Arabis alpina [alpine rockcress]
ref|XP_006644324.1|  PREDICTED: uncharacterized protein LOC102720747  82.4    9e-16   Oryza brachyantha
ref|XP_009610488.1|  PREDICTED: uncharacterized protein LOC104104...  82.8    9e-16   Nicotiana tomentosiformis
gb|KHN00739.1|  hypothetical protein glysoja_000407                   82.8    9e-16   Glycine soja [wild soybean]
ref|NP_001242150.1|  uncharacterized protein LOC100796484             82.4    9e-16   
ref|XP_006397139.1|  hypothetical protein EUTSA_v10028989mg           82.4    1e-15   Eutrema salsugineum [saltwater cress]
ref|XP_010520118.1|  PREDICTED: uncharacterized protein LOC104799345  81.6    1e-15   Tarenaya hassleriana [spider flower]
ref|XP_003592057.1|  hypothetical protein MTR_1g098250                82.4    1e-15   Medicago truncatula
ref|XP_010421889.1|  PREDICTED: uncharacterized protein LOC104707271  82.0    1e-15   Camelina sativa [gold-of-pleasure]
ref|XP_009782198.1|  PREDICTED: uncharacterized protein LOC104230978  82.0    1e-15   Nicotiana sylvestris
ref|XP_010455374.1|  PREDICTED: uncharacterized protein LOC104736976  82.0    1e-15   Camelina sativa [gold-of-pleasure]
ref|XP_010437962.1|  PREDICTED: uncharacterized protein LOC104721627  81.6    1e-15   Camelina sativa [gold-of-pleasure]
ref|XP_007151973.1|  hypothetical protein PHAVU_004G091000g           80.5    2e-15   Phaseolus vulgaris [French bean]
ref|XP_006288727.1|  hypothetical protein CARUB_v10002038mg           81.6    2e-15   Capsella rubella
ref|XP_009610487.1|  PREDICTED: uncharacterized protein LOC104104...  82.0    2e-15   Nicotiana tomentosiformis
gb|KJB28968.1|  hypothetical protein B456_005G077300                  81.6    2e-15   Gossypium raimondii
gb|KHG17592.1|  Nuclear receptor subfamily 2 group C member 2         81.6    2e-15   Gossypium arboreum [tree cotton]
ref|XP_006473103.1|  PREDICTED: uncharacterized protein LOC102626479  81.6    2e-15   Citrus sinensis [apfelsine]
emb|CDX99511.1|  BnaC09g24810D                                        81.3    2e-15   
dbj|BAB89033.1|  putative holocarboxylase synthetase                  81.6    2e-15   Oryza sativa Japonica Group [Japonica rice]
emb|CDX86890.1|  BnaA09g22800D                                        81.3    2e-15   
gb|KJB18358.1|  hypothetical protein B456_003G048400                  81.6    2e-15   Gossypium raimondii
ref|XP_009113575.1|  PREDICTED: uncharacterized protein LOC103838878  81.3    2e-15   Brassica rapa
ref|XP_004969043.1|  PREDICTED: uncharacterized protein LOC101785264  81.3    3e-15   Setaria italica
ref|XP_004252568.1|  PREDICTED: uncharacterized protein LOC101258927  81.3    3e-15   Solanum lycopersicum
ref|XP_006361614.1|  PREDICTED: uncharacterized protein LOC102606378  81.3    3e-15   Solanum tuberosum [potatoes]
ref|XP_004237831.1|  PREDICTED: uncharacterized protein LOC101255194  80.5    5e-15   Solanum lycopersicum
ref|NP_201283.1|  uncharacterized protein                             79.7    6e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001763798.1|  predicted protein                                80.1    6e-15   
ref|XP_006394113.1|  hypothetical protein EUTSA_v10005018mg           79.7    6e-15   Eutrema salsugineum [saltwater cress]
gb|AAM62535.1|  unknown                                               79.7    6e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004489928.1|  PREDICTED: uncharacterized protein LOC101504971  80.1    7e-15   Cicer arietinum [garbanzo]
gb|KJB18359.1|  hypothetical protein B456_003G048500                  80.1    7e-15   Gossypium raimondii
ref|XP_006842211.1|  hypothetical protein AMTR_s00078p00174210        79.7    7e-15   
gb|KJB59481.1|  hypothetical protein B456_009G258500                  80.1    8e-15   Gossypium raimondii
gb|KJB59480.1|  hypothetical protein B456_009G258500                  80.1    9e-15   Gossypium raimondii
gb|EMT31658.1|  hypothetical protein F775_32794                       79.7    9e-15   
ref|XP_006281074.1|  hypothetical protein CARUB_v10027097mg           80.1    9e-15   
ref|XP_009134168.1|  PREDICTED: uncharacterized protein LOC103858542  79.0    2e-14   Brassica rapa
emb|CDY05080.1|  BnaC03g28780D                                        79.0    2e-14   
gb|KHG16766.1|  putative G-protein coupled receptor                   79.0    2e-14   Gossypium arboreum [tree cotton]
gb|KHN17036.1|  hypothetical protein glysoja_011510                   79.0    2e-14   Glycine soja [wild soybean]
ref|NP_001242256.1|  uncharacterized protein LOC100801119             78.2    3e-14   
emb|CDY08851.1|  BnaA06g23730D                                        77.4    3e-14   Brassica napus [oilseed rape]
ref|XP_003592515.1|  hypothetical protein MTR_1g106890                77.8    4e-14   
tpg|DAA58747.1|  TPA: hypothetical protein ZEAMMB73_814484            75.5    4e-14   
ref|XP_002866635.1|  hypothetical protein ARALYDRAFT_496694           77.4    4e-14   
emb|CDY14510.1|  BnaC03g49490D                                        77.0    5e-14   Brassica napus [oilseed rape]
ref|XP_009150556.1|  PREDICTED: uncharacterized protein LOC103873905  77.0    6e-14   Brassica rapa
ref|NP_001043444.2|  Os01g0589500                                     77.4    8e-14   
gb|KFK28167.1|  hypothetical protein AALP_AA8G481100                  76.3    9e-14   Arabis alpina [alpine rockcress]
ref|XP_009407273.1|  PREDICTED: uncharacterized protein LOC103990001  76.6    1e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001136541.1|  hypothetical protein                             76.3    1e-13   Zea mays [maize]
ref|XP_004961026.1|  PREDICTED: uncharacterized protein LOC101766877  76.3    1e-13   Setaria italica
gb|AAP80657.1|AF479038_1  holocarboxylase synthetase                  75.9    2e-13   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010462762.1|  PREDICTED: uncharacterized protein LOC104743362  75.1    2e-13   Camelina sativa [gold-of-pleasure]
ref|XP_007143574.1|  hypothetical protein PHAVU_007G083200g           75.1    4e-13   Phaseolus vulgaris [French bean]
ref|XP_003567792.1|  PREDICTED: uncharacterized protein LOC100842848  74.7    4e-13   Brachypodium distachyon [annual false brome]
ref|XP_001771218.1|  predicted protein                                73.9    4e-13   
ref|XP_010484271.1|  PREDICTED: uncharacterized protein LOC104762640  73.6    9e-13   Camelina sativa [gold-of-pleasure]
emb|CBI28060.3|  unnamed protein product                              73.6    1e-12   Vitis vinifera
ref|XP_009388166.1|  PREDICTED: uncharacterized protein LOC103974984  73.2    1e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006826290.1|  hypothetical protein AMTR_s00004p00061310        73.2    1e-12   Amborella trichopoda
ref|XP_009381149.1|  PREDICTED: uncharacterized protein LOC103969...  72.4    2e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009381148.1|  PREDICTED: uncharacterized protein LOC103969...  72.4    3e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009380423.1|  PREDICTED: uncharacterized protein LOC103968822  70.9    1e-11   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMS62206.1|  hypothetical protein TRIUR3_09092                     70.9    1e-11   Triticum urartu
ref|XP_006660563.1|  PREDICTED: uncharacterized protein LOC102719228  70.1    2e-11   Oryza brachyantha
ref|NP_001062977.1|  Os09g0360400                                     70.1    2e-11   
ref|XP_010238083.1|  PREDICTED: uncharacterized protein LOC104584661  68.9    4e-11   Brachypodium distachyon [annual false brome]
gb|KFK23588.1|  hypothetical protein AALP_AAs40079U000200             67.0    1e-10   Arabis alpina [alpine rockcress]
dbj|BAJ85416.1|  predicted protein                                    67.8    1e-10   Hordeum vulgare subsp. vulgare [two-rowed barley]
tpg|DAA39944.1|  TPA: hypothetical protein ZEAMMB73_654734            65.5    1e-10   
ref|XP_002460104.1|  hypothetical protein SORBIDRAFT_02g022820        66.2    4e-10   Sorghum bicolor [broomcorn]
ref|XP_004956648.1|  PREDICTED: uncharacterized protein LOC101777921  65.9    5e-10   Setaria italica
tpg|DAA39946.1|  TPA: hypothetical protein ZEAMMB73_654734            64.3    6e-10   
gb|KFK23589.1|  hypothetical protein AALP_AAs40079U000200             62.8    9e-10   Arabis alpina [alpine rockcress]
gb|ACR36431.1|  unknown                                               65.1    1e-09   Zea mays [maize]
gb|ACG48000.1|  holocarboxylase synthetase                            64.7    1e-09   Zea mays [maize]
ref|NP_001152515.1|  holocarboxylase synthetase                       64.7    1e-09   Zea mays [maize]
ref|XP_010651390.1|  PREDICTED: uncharacterized protein LOC100256...  60.8    6e-09   Vitis vinifera
ref|XP_006368533.1|  hypothetical protein POPTR_0001s04060g           60.8    1e-08   Populus trichocarpa [western balsam poplar]
ref|XP_011048172.1|  PREDICTED: uncharacterized protein LOC105142304  60.8    1e-08   Populus euphratica
ref|XP_011089711.1|  PREDICTED: uncharacterized protein LOC105170585  60.5    2e-08   Sesamum indicum [beniseed]
ref|XP_010651391.1|  PREDICTED: uncharacterized protein LOC100256...  59.3    2e-08   Vitis vinifera
emb|CAN72568.1|  hypothetical protein VITISV_036994                   58.9    6e-08   Vitis vinifera
ref|XP_010651389.1|  PREDICTED: uncharacterized protein LOC100256...  58.9    7e-08   Vitis vinifera
ref|XP_003574456.1|  PREDICTED: uncharacterized protein LOC100833414  58.5    2e-07   Brachypodium distachyon [annual false brome]
ref|XP_002506431.1|  predicted protein                                58.2    3e-07   Micromonas commoda
gb|AFG60950.1|  hypothetical protein UMN_1305_01                      48.5    1e-04   Pinus taeda
ref|XP_008811245.1|  PREDICTED: uncharacterized protein LOC103722...  50.1    2e-04   Phoenix dactylifera
ref|XP_008811246.1|  PREDICTED: uncharacterized protein LOC103722...  50.1    3e-04   
gb|EMS50630.1|  hypothetical protein TRIUR3_28716                     48.1    3e-04   Triticum urartu
emb|CDM81778.1|  unnamed protein product                              49.7    5e-04   Triticum aestivum [Canadian hard winter wheat]
gb|EMT30986.1|  hypothetical protein F775_22381                       49.3    6e-04   



>gb|KGN44460.1| hypothetical protein Csa_7G298765 [Cucumis sativus]
Length=95

 Score = 96.7 bits (239),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 58/74 (78%), Gaps = 4/74 (5%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHALVR----S  192
            MAKKRKS AT LDEVDRT++++FCSAANSLSQLYTQAM+HQ++S QAGERHA+V     S
Sbjct  1    MAKKRKSIATSLDEVDRTMYASFCSAANSLSQLYTQAMNHQKLSFQAGERHAMVWNFICS  60

Query  193  PLAFPSFFEFTLLI  234
            P     F+  +L +
Sbjct  61   PFPLFGFYHVSLFV  74



>gb|KDO57106.1| hypothetical protein CISIN_1g048552mg [Citrus sinensis]
Length=209

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/53 (87%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            MAKKRKS+ATRLDEVDRT+++TFCSAANSLSQLYTQAM+HQR+S QAGERHAL
Sbjct  1    MAKKRKSDATRLDEVDRTMYTTFCSAANSLSQLYTQAMNHQRLSFQAGERHAL  53



>ref|XP_009392917.1| PREDICTED: uncharacterized protein LOC103978735 [Musa acuminata 
subsp. malaccensis]
Length=210

 Score = 96.3 bits (238),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/53 (87%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            MA+KRK+EATRLDEVDRTL+STFCSAANSLSQLYTQAM+ Q+IS QAGERHAL
Sbjct  1    MARKRKTEATRLDEVDRTLYSTFCSAANSLSQLYTQAMNQQKISFQAGERHAL  53



>ref|XP_010096477.1| hypothetical protein L484_006724 [Morus notabilis]
 gb|EXB64487.1| hypothetical protein L484_006724 [Morus notabilis]
Length=214

 Score = 96.3 bits (238),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHALVR  189
            MAKKRKS+ATRLDEVDRT+++TFCSAANSLSQLY QAM+HQR+S QAGERH L R
Sbjct  1    MAKKRKSDATRLDEVDRTMYTTFCSAANSLSQLYAQAMNHQRLSFQAGERHGLER  55



>ref|XP_006427929.1| hypothetical protein CICLE_v10026489mg [Citrus clementina]
 ref|XP_006464522.1| PREDICTED: uncharacterized protein LOC102606673 [Citrus sinensis]
 gb|ESR41169.1| hypothetical protein CICLE_v10026489mg [Citrus clementina]
Length=209

 Score = 96.3 bits (238),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            MAKKRKS+ATRLDEVDRT+++TFCSAANSLSQLYTQAM+HQR+  QAGERHAL
Sbjct  1    MAKKRKSDATRLDEVDRTMYTTFCSAANSLSQLYTQAMNHQRLCFQAGERHAL  53



>gb|KHG16765.1| hypothetical protein F383_20843 [Gossypium arboreum]
Length=206

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            M KKRKS+ATRLDEVDRT++++FCSAANSLSQLYTQAM+HQR+S QAGERHAL
Sbjct  1    MTKKRKSDATRLDEVDRTMYTSFCSAANSLSQLYTQAMNHQRLSFQAGERHAL  53



>ref|XP_008776936.1| PREDICTED: uncharacterized protein LOC103696971 [Phoenix dactylifera]
Length=216

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHALVR  189
            MA+KRKS+ATRLDEVDRTL+STFCSAANSLSQLYTQAM+ Q+IS QAGERHAL +
Sbjct  1    MARKRKSDATRLDEVDRTLYSTFCSAANSLSQLYTQAMNQQKISFQAGERHALEK  55



>ref|XP_008808717.1| PREDICTED: uncharacterized protein LOC103720668 [Phoenix dactylifera]
Length=216

 Score = 95.1 bits (235),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            MA++RKS+ATRLDEVDRTL+STFCSAANSLSQ YTQAM+HQ++S QAGERHAL
Sbjct  1    MARRRKSDATRLDEVDRTLYSTFCSAANSLSQFYTQAMNHQKLSFQAGERHAL  53



>ref|XP_002278435.1| PREDICTED: uncharacterized protein LOC100245741 [Vitis vinifera]
 emb|CBI21544.3| unnamed protein product [Vitis vinifera]
Length=212

 Score = 94.7 bits (234),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            MAKKRKS+ATRLDEVDRT++++FCSAANSLSQLYTQAM+ QR+S QAGERHAL
Sbjct  1    MAKKRKSDATRLDEVDRTMYTSFCSAANSLSQLYTQAMNQQRLSFQAGERHAL  53



>emb|CAN64859.1| hypothetical protein VITISV_030494 [Vitis vinifera]
Length=212

 Score = 94.7 bits (234),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            MAKKRKS+ATRLDEVDRT++++FCSAANSLSQLYTQAM+ QR+S QAGERHAL
Sbjct  1    MAKKRKSDATRLDEVDRTMYTSFCSAANSLSQLYTQAMNQQRLSFQAGERHAL  53



>ref|XP_007048174.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOX92331.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=204

 Score = 94.7 bits (234),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            MAKKRKS+ATRLDE DR+L+++FCSAANSLSQLYTQAM+HQR+S QAGERHAL
Sbjct  1    MAKKRKSDATRLDEFDRSLYTSFCSAANSLSQLYTQAMNHQRLSFQAGERHAL  53



>gb|KJB14929.1| hypothetical protein B456_002G149700 [Gossypium raimondii]
Length=199

 Score = 94.4 bits (233),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            M+KKRKS+ATRLDEVDR++++TFCSAANSLSQLY+QAM+HQR+S QAGERHAL
Sbjct  1    MSKKRKSDATRLDEVDRSMYTTFCSAANSLSQLYSQAMNHQRLSFQAGERHAL  53



>gb|KJB14930.1| hypothetical protein B456_002G149700 [Gossypium raimondii]
Length=201

 Score = 94.4 bits (233),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            M+KKRKS+ATRLDEVDR++++TFCSAANSLSQLY+QAM+HQR+S QAGERHAL
Sbjct  1    MSKKRKSDATRLDEVDRSMYTTFCSAANSLSQLYSQAMNHQRLSFQAGERHAL  53



>ref|XP_007048173.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOX92330.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=213

 Score = 94.7 bits (234),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            MAKKRKS+ATRLDE DR+L+++FCSAANSLSQLYTQAM+HQR+S QAGERHAL
Sbjct  1    MAKKRKSDATRLDEFDRSLYTSFCSAANSLSQLYTQAMNHQRLSFQAGERHAL  53



>gb|KJB18360.1| hypothetical protein B456_003G048500 [Gossypium raimondii]
Length=206

 Score = 94.4 bits (233),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            M KKRKS+A+RLDEVDRT++++FCSAANSLSQLYTQAM+HQR+S QAGERHAL
Sbjct  1    MTKKRKSDASRLDEVDRTMYTSFCSAANSLSQLYTQAMNHQRLSFQAGERHAL  53



>ref|XP_010268579.1| PREDICTED: uncharacterized protein LOC104605493 [Nelumbo nucifera]
Length=217

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            M KKRKS+ATRLDEVDRT+++TFCSAANSLSQLYTQAM+HQ++  QAGERHAL
Sbjct  1    MGKKRKSDATRLDEVDRTIYTTFCSAANSLSQLYTQAMNHQKLVFQAGERHAL  53



>ref|NP_001291356.1| uncharacterized protein LOC105049617 [Elaeis guineensis]
 ref|XP_010927656.1| PREDICTED: uncharacterized protein LOC105049617 [Elaeis guineensis]
 gb|AFS65094.1| holocarboxylase synthetase [Elaeis guineensis]
Length=216

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHALVR  189
            MA+KRKS+ATRLDEVDRTL+STFCSAANSLSQLYTQAM+ Q++S QAGERH+L +
Sbjct  1    MARKRKSDATRLDEVDRTLYSTFCSAANSLSQLYTQAMNQQKVSFQAGERHSLEK  55



>ref|XP_010261019.1| PREDICTED: uncharacterized protein LOC104599958 [Nelumbo nucifera]
Length=217

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHALVR  189
            M KKRKS+ATRLDEVDRT+++TFCSAANSLSQLYTQAM+HQ++  QAGERH L +
Sbjct  1    MGKKRKSDATRLDEVDRTMYTTFCSAANSLSQLYTQAMNHQKVVFQAGERHGLEK  55



>ref|XP_009412399.1| PREDICTED: uncharacterized protein LOC103993894 [Musa acuminata 
subsp. malaccensis]
Length=211

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            MA+KRK+EA RLDEVDRTL+STFCSAANSLSQLYTQAM+ Q+IS QAGERHA+
Sbjct  1    MARKRKTEAMRLDEVDRTLYSTFCSAANSLSQLYTQAMNQQKISFQAGERHAM  53



>ref|XP_010027746.1| PREDICTED: uncharacterized protein LOC104418182 [Eucalyptus grandis]
Length=214

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            MAKKRKS A+RLDEVDR+L+++FCSAANSLSQLYTQAM HQR+S QAGERHAL
Sbjct  1    MAKKRKSVASRLDEVDRSLYTSFCSAANSLSQLYTQAMSHQRLSFQAGERHAL  53



>ref|XP_010925082.1| PREDICTED: uncharacterized protein LOC105047727 [Elaeis guineensis]
Length=215

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            MA+KRKS+ATRLDEVDRTL+STFCSAANS SQLYTQAM+ Q++S QAGERHAL
Sbjct  1    MARKRKSDATRLDEVDRTLYSTFCSAANSFSQLYTQAMNQQKLSFQAGERHAL  53



>gb|KHG24783.1| hypothetical protein F383_09417 [Gossypium arboreum]
Length=208

 Score = 92.0 bits (227),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            M+KKRKS+ATRLDEVDR++++TFC+AANSLSQLY+QAM+HQR+S QAGERHAL
Sbjct  1    MSKKRKSDATRLDEVDRSMYTTFCAAANSLSQLYSQAMNHQRLSFQAGERHAL  53



>ref|XP_010915065.1| PREDICTED: uncharacterized protein LOC105040293 [Elaeis guineensis]
Length=213

 Score = 92.0 bits (227),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            MAKK KSEATRLDEVDR+++STFCSAANSLSQ+YTQAM  Q++S QAGERHAL
Sbjct  1    MAKKSKSEATRLDEVDRSVYSTFCSAANSLSQIYTQAMAQQKVSFQAGERHAL  53



>ref|XP_011100916.1| PREDICTED: uncharacterized protein LOC105179031 [Sesamum indicum]
Length=205

 Score = 92.0 bits (227),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHALVR  189
            MAKKRKS+ATRLDEVDR +++TFC+AANSLSQLYT AMH QR+S QAGERH+L +
Sbjct  1    MAKKRKSDATRLDEVDRGMYTTFCTAANSLSQLYTHAMHQQRLSFQAGERHSLEK  55



>gb|KCW54334.1| hypothetical protein EUGRSUZ_I00298 [Eucalyptus grandis]
Length=287

 Score = 92.8 bits (229),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +1

Query  22   SMAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            +MAKKRKS A+RLDEVDR+L+++FCSAANSLSQLYTQAM HQR+S QAGERHAL
Sbjct  73   AMAKKRKSVASRLDEVDRSLYTSFCSAANSLSQLYTQAMSHQRLSFQAGERHAL  126



>ref|XP_010925339.1| PREDICTED: uncharacterized protein LOC105047906 [Elaeis guineensis]
Length=209

 Score = 91.3 bits (225),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            M KKRKS+ATRLDEVDR+++STFCSAANSLSQ+YTQAM  Q++S QAGERHAL
Sbjct  1    MVKKRKSDATRLDEVDRSMYSTFCSAANSLSQIYTQAMAQQKVSFQAGERHAL  53



>ref|XP_011100069.1| PREDICTED: uncharacterized protein LOC105178309 [Sesamum indicum]
Length=208

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            MAKKRKS+ATRLDEVDR+++++FCSAANSLSQLY+QA H QR+S QAGERHA+
Sbjct  1    MAKKRKSDATRLDEVDRSMYTSFCSAANSLSQLYSQATHQQRLSFQAGERHAM  53



>ref|XP_006383639.1| hypothetical protein POPTR_0005s21840g [Populus trichocarpa]
 gb|ERP61436.1| hypothetical protein POPTR_0005s21840g [Populus trichocarpa]
Length=73

 Score = 87.4 bits (215),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHALVRSPLAF  204
            M KKRKS AT LDEVDRT++++FCSAANSLSQLYTQ+M+HQ++S QAGER  L  S +  
Sbjct  1    MGKKRKSIATSLDEVDRTMYASFCSAANSLSQLYTQSMNHQKLSFQAGERQGLEASGMWV  60

Query  205  PSFFE  219
              + +
Sbjct  61   FDYLD  65



>emb|CDP11436.1| unnamed protein product [Coffea canephora]
Length=215

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHALVR  189
            MAKKRKS AT LDEVDR+++STFC+AANSLSQLYTQAM+HQ++S QAGERH L +
Sbjct  1    MAKKRKSVATSLDEVDRSMYSTFCTAANSLSQLYTQAMNHQKLSFQAGERHGLEK  55



>ref|XP_010681257.1| PREDICTED: uncharacterized protein LOC104896231 isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=207

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            MAKKRKS AT LDEVDRT++++FCSAANSLSQLYTQAM+HQ++S QAGERH L
Sbjct  1    MAKKRKSIATNLDEVDRTMYTSFCSAANSLSQLYTQAMNHQKLSFQAGERHGL  53



>ref|XP_010681253.1| PREDICTED: uncharacterized protein LOC104896231 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=212

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHALVR  189
            MAKKRKS AT LDEVDRT++++FCSAANSLSQLYTQAM+HQ++S QAGERH L +
Sbjct  1    MAKKRKSIATNLDEVDRTMYTSFCSAANSLSQLYTQAMNHQKLSFQAGERHGLEK  55



>ref|XP_008793512.1| PREDICTED: uncharacterized protein LOC103709793 [Phoenix dactylifera]
Length=205

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHALV  186
            MAKK KSEATRLDEVDR+++STFC AANSLSQ+YTQAM  Q+++ QAGERHAL+
Sbjct  1    MAKKSKSEATRLDEVDRSVYSTFCGAANSLSQIYTQAMAQQKVAFQAGERHALI  54



>ref|XP_008786494.1| PREDICTED: uncharacterized protein LOC103704817 [Phoenix dactylifera]
Length=213

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            MAKKRKS+ATRLDEVDR+L+ TFCSAANSLSQ+YTQAM  Q++S QAGERHAL
Sbjct  1    MAKKRKSDATRLDEVDRSLYLTFCSAANSLSQIYTQAMAQQKLSFQAGERHAL  53



>gb|EYU24058.1| hypothetical protein MIMGU_mgv1a012421mg [Erythranthe guttata]
Length=251

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +1

Query  19   ESMAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            +SM KKRKS+A+RLDEVDR +++TFCSAANSLSQLYT AMH Q++S QAGERH++
Sbjct  43   QSMGKKRKSDASRLDEVDRGMYTTFCSAANSLSQLYTHAMHQQKLSFQAGERHSM  97



>ref|XP_007048172.1| Uncharacterized protein TCM_001288 [Theobroma cacao]
 gb|EOX92329.1| Uncharacterized protein TCM_001288 [Theobroma cacao]
Length=215

 Score = 90.1 bits (222),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHALVR  189
            M+KKRKS+A+RLDEV+R++++TFCSAANSLSQLY+QAM+HQR+S QAGERHAL +
Sbjct  1    MSKKRKSDASRLDEVERSMYTTFCSAANSLSQLYSQAMNHQRLSFQAGERHALEK  55



>gb|EYU31112.1| hypothetical protein MIMGU_mgv1a014609mg [Erythranthe guttata]
Length=184

 Score = 89.4 bits (220),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            MAKKRKS++TRLDEVDR++++ FCS ANSLSQLY+QAMH QR+S Q GERHAL
Sbjct  1    MAKKRKSDSTRLDEVDRSMYTAFCSGANSLSQLYSQAMHQQRLSFQDGERHAL  53



>ref|XP_010681250.1| PREDICTED: uncharacterized protein LOC104896231 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=224

 Score = 90.1 bits (222),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            MAKKRKS AT LDEVDRT++++FCSAANSLSQLYTQAM+HQ++S QAGERH L
Sbjct  1    MAKKRKSIATNLDEVDRTMYTSFCSAANSLSQLYTQAMNHQKLSFQAGERHGL  53



>ref|XP_004139686.1| PREDICTED: uncharacterized protein LOC101216474 [Cucumis sativus]
 ref|XP_004161902.1| PREDICTED: uncharacterized protein LOC101229005 [Cucumis sativus]
Length=217

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHALVR  189
            MAKKRKS AT LDEVDRT++++FCSAANSLSQLYTQAM+HQ++S QAGERHA+ +
Sbjct  1    MAKKRKSIATSLDEVDRTMYASFCSAANSLSQLYTQAMNHQKLSFQAGERHAMEK  55



>gb|EPS64635.1| hypothetical protein M569_10142 [Genlisea aurea]
Length=212

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            MAKKRKS++TRLDE+DR ++S+FCSAANSLSQLY+ AMH QR+S QAGERHAL
Sbjct  1    MAKKRKSDSTRLDEIDRGMYSSFCSAANSLSQLYSHAMHQQRLSFQAGERHAL  53



>ref|XP_008461917.1| PREDICTED: uncharacterized protein LOC103500405 [Cucumis melo]
Length=217

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHALVR  189
            MAKKRKS AT LDEVDRT++++FCSAANSLSQLYTQAM+HQ++S QAGERHA+ +
Sbjct  1    MAKKRKSIATSLDEVDRTMYASFCSAANSLSQLYTQAMNHQKLSFQAGERHAMEK  55



>ref|XP_009389481.1| PREDICTED: uncharacterized protein LOC103976031 [Musa acuminata 
subsp. malaccensis]
Length=211

 Score = 89.4 bits (220),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHALVR  189
            MA+KRKSEAT LDE DRTL+STFC+AANSLSQLYTQAM+ Q+++ QAGERHAL +
Sbjct  1    MARKRKSEATGLDEADRTLYSTFCAAANSLSQLYTQAMNQQKLAFQAGERHALEK  55



>gb|AFK42100.1| unknown [Lotus japonicus]
Length=207

 Score = 89.0 bits (219),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            MAKKRKS AT LDEVDRT+H++FC+AANSLSQLYT AM+HQ++S QAGERH L
Sbjct  1    MAKKRKSIATSLDEVDRTMHASFCTAANSLSQLYTHAMNHQKLSFQAGERHGL  53



>ref|XP_007200578.1| hypothetical protein PRUPE_ppa011863mg [Prunus persica]
 gb|EMJ01777.1| hypothetical protein PRUPE_ppa011863mg [Prunus persica]
Length=193

 Score = 88.2 bits (217),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHALVR  189
            M KKRKS AT LDEVDR+++++FCSAANSLSQLYTQAM+HQ++S QAGERHAL +
Sbjct  1    MGKKRKSIATSLDEVDRSMYTSFCSAANSLSQLYTQAMNHQKLSFQAGERHALDK  55



>ref|XP_009335132.1| PREDICTED: uncharacterized protein LOC103927893 [Pyrus x bretschneideri]
Length=215

 Score = 88.6 bits (218),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHALVR  189
            M KKRKS AT LDEVDR+++++FCSAANSLSQLYTQAM+HQ++S QAGERHAL +
Sbjct  1    MGKKRKSVATSLDEVDRSMYTSFCSAANSLSQLYTQAMNHQKLSFQAGERHALDK  55



>ref|XP_011458474.1| PREDICTED: uncharacterized protein LOC101309208 [Fragaria vesca 
subsp. vesca]
Length=203

 Score = 88.6 bits (218),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHALVR  189
            M KKRKS AT LDEVDR+++++FCSAANSLSQLYTQAM+HQ++S QAGERHAL +
Sbjct  1    MGKKRKSVATSLDEVDRSMYTSFCSAANSLSQLYTQAMNHQKLSFQAGERHALDK  55



>ref|XP_008386362.1| PREDICTED: uncharacterized protein LOC103448885 [Malus domestica]
Length=215

 Score = 88.6 bits (218),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHALVR  189
            M KKRKS AT LDEVDR+++++FCSAANSLSQLYTQAM+HQ++S QAGERHAL +
Sbjct  1    MGKKRKSVATSLDEVDRSMYTSFCSAANSLSQLYTQAMNHQKLSFQAGERHALDK  55



>ref|XP_009401877.1| PREDICTED: uncharacterized protein LOC103985764 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=185

 Score = 87.8 bits (216),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            MA+KRKSEA  LDE DRTL+STFC+AANSLSQ+YTQAM+ Q+IS QAGERHAL
Sbjct  1    MARKRKSEAMGLDEADRTLYSTFCAAANSLSQVYTQAMNQQKISFQAGERHAL  53



>ref|XP_008237488.1| PREDICTED: uncharacterized protein LOC103336223 [Prunus mume]
Length=216

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHALVR  189
            M KKRKS AT LDEVDR+++++FCSAANSLSQLYTQAM+HQ++S QAGERHAL +
Sbjct  1    MGKKRKSIATSLDEVDRSMYTSFCSAANSLSQLYTQAMNHQKLSFQAGERHALDK  55



>ref|XP_002524331.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38071.1| conserved hypothetical protein [Ricinus communis]
Length=203

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHALVR  189
            M KKRKS AT LDEVDRT++++FCSAANSLSQLYTQ+M+HQ++S QAGERH L +
Sbjct  1    MGKKRKSIATSLDEVDRTMYASFCSAANSLSQLYTQSMNHQKLSFQAGERHGLEK  55



>ref|XP_009401860.1| PREDICTED: uncharacterized protein LOC103985764 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009401868.1| PREDICTED: uncharacterized protein LOC103985764 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=212

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            MA+KRKSEA  LDE DRTL+STFC+AANSLSQ+YTQAM+ Q+IS QAGERHAL
Sbjct  1    MARKRKSEAMGLDEADRTLYSTFCAAANSLSQVYTQAMNQQKISFQAGERHAL  53



>ref|NP_001237965.1| uncharacterized protein LOC100527566 [Glycine max]
 gb|ACU16664.1| unknown [Glycine max]
Length=215

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            MAKKRKS ATRLDEVDRT++STFCS ANSLS LYT AM+ Q++S QAGERHAL
Sbjct  1    MAKKRKSVATRLDEVDRTMYSTFCSTANSLSHLYTHAMNQQKLSFQAGERHAL  53



>gb|KDP36560.1| hypothetical protein JCGZ_08327 [Jatropha curcas]
Length=205

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHALVR  189
            M KKRKS AT LDEVDRT++++FC+AANSLSQLYTQ+M+HQ++S QAGERH L +
Sbjct  1    MGKKRKSIATSLDEVDRTMYASFCTAANSLSQLYTQSMNHQKLSFQAGERHGLEK  55



>gb|KHN29132.1| hypothetical protein glysoja_008467 [Glycine soja]
Length=215

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            MAKKRKS ATRLDEVDRT++STFCS ANSLS LYT AM+ Q++S QAGERHAL
Sbjct  1    MAKKRKSVATRLDEVDRTMYSTFCSTANSLSHLYTHAMNQQKLSFQAGERHAL  53



>ref|XP_008381858.1| PREDICTED: uncharacterized protein LOC103444684 [Malus domestica]
Length=212

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHALVR  189
            M KKRKS A+ LDEVDR+++++FCSAANSLSQLYTQAM+HQ++S QAGERHAL +
Sbjct  1    MGKKRKSIASSLDEVDRSMYTSFCSAANSLSQLYTQAMNHQKLSFQAGERHALDK  55



>emb|CBI18241.3| unnamed protein product [Vitis vinifera]
Length=171

 Score = 86.3 bits (212),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            M KKRKS AT LDEVDRT+++TFCSAANSLSQLYTQ M+ Q++S QAGERH L
Sbjct  1    MGKKRKSVATSLDEVDRTMYATFCSAANSLSQLYTQTMNQQKLSFQAGERHGL  53



>gb|AFK36877.1| unknown [Lotus japonicus]
Length=213

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            MAKKRKS ATRLDEVDRT++STFC+ ANSLS LYT AM+ Q++S QAGERHAL
Sbjct  1    MAKKRKSVATRLDEVDRTMYSTFCTTANSLSHLYTHAMNQQKLSFQAGERHAL  53



>ref|XP_009336494.1| PREDICTED: uncharacterized protein LOC103929073 [Pyrus x bretschneideri]
Length=208

 Score = 86.7 bits (213),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHALVR  189
            M KKRKS A+ LDEVDR+++++FCSAANSLSQLYTQAM+HQ++S QAGERHAL +
Sbjct  1    MGKKRKSIASSLDEVDRSMYTSFCSAANSLSQLYTQAMNHQKLSFQAGERHALDK  55



>ref|XP_010097650.1| hypothetical protein L484_023790 [Morus notabilis]
 gb|EXB70605.1| hypothetical protein L484_023790 [Morus notabilis]
Length=233

 Score = 86.7 bits (213),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            M KKRKS AT LDEVDRT++++FC AANSLSQLYTQAM+HQ++S QAGERH+L
Sbjct  1    MGKKRKSIATSLDEVDRTMYASFCGAANSLSQLYTQAMNHQKLSFQAGERHSL  53



>ref|XP_007159785.1| hypothetical protein PHAVU_002G267000g [Phaseolus vulgaris]
 gb|ESW31779.1| hypothetical protein PHAVU_002G267000g [Phaseolus vulgaris]
Length=218

 Score = 86.7 bits (213),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            MAKKRKS ATRLDEVDRT++STFCS ANSLS LYT AM+ Q++S QAGERH L
Sbjct  1    MAKKRKSVATRLDEVDRTMYSTFCSTANSLSHLYTHAMNQQKLSFQAGERHGL  53



>ref|XP_003525093.1| PREDICTED: uncharacterized protein LOC100815955 [Glycine max]
 gb|KHN34025.1| hypothetical protein glysoja_030479 [Glycine soja]
Length=215

 Score = 86.3 bits (212),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            MAKKR+S ATRLDEVDRT++STFCS ANSLS LYT AM+ Q++S QAGERHAL
Sbjct  1    MAKKRRSVATRLDEVDRTMYSTFCSTANSLSHLYTHAMNQQKLSFQAGERHAL  53



>gb|ACU24594.1| unknown [Glycine max]
Length=215

 Score = 85.9 bits (211),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            MAKKR+S ATRLDEVDRT++STFCS ANSLS LYT AM+ Q++S QAGERHAL
Sbjct  1    MAKKRRSVATRLDEVDRTMYSTFCSTANSLSHLYTHAMNQQKLSFQAGERHAL  53



>ref|XP_009631427.1| PREDICTED: uncharacterized protein LOC104121198 [Nicotiana tomentosiformis]
Length=211

 Score = 85.9 bits (211),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            M KKRKS A++LDEVDR+++STFCS ANSLSQLYTQAM+ Q++S QAGERH L
Sbjct  1    MGKKRKSLASKLDEVDRSMYSTFCSGANSLSQLYTQAMNQQKLSFQAGERHGL  53



>ref|XP_009761480.1| PREDICTED: uncharacterized protein LOC104213649 [Nicotiana sylvestris]
Length=211

 Score = 85.9 bits (211),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            M KKRKS A++LDEVDR+++STFCS ANSLSQLYTQAM+ Q++S QAGERH L
Sbjct  1    MGKKRKSLASKLDEVDRSMYSTFCSGANSLSQLYTQAMNQQKLSFQAGERHGL  53



>ref|XP_002300905.2| hypothetical protein POPTR_0002s06540g [Populus trichocarpa]
 gb|EEE80178.2| hypothetical protein POPTR_0002s06540g [Populus trichocarpa]
Length=204

 Score = 85.5 bits (210),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHALVR  189
            M KKRKS AT L+EVDRT++++FCSAANSLSQLYTQ+M+HQ++S QAGERH L +
Sbjct  1    MGKKRKSIATSLEEVDRTMYASFCSAANSLSQLYTQSMNHQKLSFQAGERHGLEK  55



>ref|XP_011042891.1| PREDICTED: uncharacterized protein LOC105138502 [Populus euphratica]
Length=204

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHALVR  189
            M KKRKS AT L+EVDRT++++FCSAANSLSQLYTQ+M+HQ++S QAGERH L +
Sbjct  1    MGKKRKSIATSLEEVDRTMYASFCSAANSLSQLYTQSMNHQKLSFQAGERHGLEK  55



>gb|ABK22079.1| unknown [Picea sitchensis]
Length=253

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHALVR  189
            MAKKRKSE T LDEV++T+++TFCSAANSLSQLYTQA H Q+++ QAGERH L +
Sbjct  1    MAKKRKSENTGLDEVEKTMYTTFCSAANSLSQLYTQAQHQQKLAFQAGERHGLEK  55



>gb|AFK43213.1| unknown [Lotus japonicus]
Length=213

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            MAKKRKS ATRLDEVDRT++STFC+  NSLS LYT AM+ Q++S QAGERHAL
Sbjct  1    MAKKRKSVATRLDEVDRTMYSTFCTTVNSLSHLYTHAMNQQKLSFQAGERHAL  53



>ref|XP_003634526.1| PREDICTED: uncharacterized protein LOC100854952 [Vitis vinifera]
Length=216

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            M KKRKS AT LDEVDRT+++TFCSAANSLSQLYTQ M+ Q++S QAGERH L
Sbjct  1    MGKKRKSVATSLDEVDRTMYATFCSAANSLSQLYTQTMNQQKLSFQAGERHGL  53



>ref|XP_011044272.1| PREDICTED: uncharacterized protein LOC105139508 [Populus euphratica]
 ref|XP_011044273.1| PREDICTED: uncharacterized protein LOC105139508 [Populus euphratica]
Length=204

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHALVR  189
            M KKRKS AT LDEVDRT++++FCSAANSLSQLYTQ+M+HQ++S QAGER  L +
Sbjct  1    MGKKRKSIATSLDEVDRTMYASFCSAANSLSQLYTQSMNHQKLSFQAGERQGLEK  55



>gb|EPS71131.1| hypothetical protein M569_03625, partial [Genlisea aurea]
Length=105

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            MAKKRKS+A RLDEVDR+++STFC+AANSLS LYTQAMH Q++  QAGE  A+
Sbjct  5    MAKKRKSDAARLDEVDRSMYSTFCNAANSLSHLYTQAMHQQKLLFQAGEGQAM  57



>ref|XP_006359041.1| PREDICTED: uncharacterized protein LOC102584007 [Solanum tuberosum]
Length=211

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHALVR  189
            MAKKRKS A+ +DEVDRT++STFCSAANSLSQLY+QA++ Q++S QAGERH L +
Sbjct  1    MAKKRKSLASSIDEVDRTMYSTFCSAANSLSQLYSQALNQQKLSFQAGERHGLEK  55



>gb|KDO83805.1| hypothetical protein CISIN_1g028515mg [Citrus sinensis]
Length=208

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            M KKRKS AT LDEVDR+++++FCSAANSLSQLYTQAM+ Q++S QAGERH L
Sbjct  1    MGKKRKSIATSLDEVDRSMYASFCSAANSLSQLYTQAMNQQKLSFQAGERHGL  53



>ref|XP_006434518.1| hypothetical protein CICLE_v10002494mg [Citrus clementina]
 gb|ESR47758.1| hypothetical protein CICLE_v10002494mg [Citrus clementina]
Length=208

 Score = 84.0 bits (206),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHALVR  189
            M KKRKS AT LDEVDR+++++FCSAANSLSQLYTQAM+ Q++S QAGERH L +
Sbjct  1    MGKKRKSIATSLDEVDRSMYASFCSAANSLSQLYTQAMNQQKLSFQAGERHGLEK  55



>ref|XP_002458073.1| hypothetical protein SORBIDRAFT_03g026490 [Sorghum bicolor]
 gb|EES03193.1| hypothetical protein SORBIDRAFT_03g026490 [Sorghum bicolor]
Length=203

 Score = 83.6 bits (205),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 47/54 (87%), Gaps = 1/54 (2%)
 Frame = +1

Query  25   MAKKRKSEAT-RLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            MA+KRK++A  RLDE DRTL+STFC AANSLSQLYTQAM  Q++S QAGERHAL
Sbjct  1    MARKRKTDAAPRLDEADRTLYSTFCGAANSLSQLYTQAMAQQKLSFQAGERHAL  54



>gb|EAY74747.1| hypothetical protein OsI_02639 [Oryza sativa Indica Group]
Length=225

 Score = 83.6 bits (205),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 48/55 (87%), Gaps = 1/55 (2%)
 Frame = +1

Query  25   MAKKRKSEAT-RLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHALV  186
            MA+KRK++A  RLDE DRTL+STFC AANSLSQLYTQAM  Q++S QAGERH+LV
Sbjct  1    MARKRKTDAAPRLDEADRTLYSTFCGAANSLSQLYTQAMAQQKLSFQAGERHSLV  55



>gb|AFK49616.1| unknown [Medicago truncatula]
Length=212

 Score = 83.6 bits (205),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            MAKKRKS  +RLDEVDRT++STFC+ ANSLS LYT AM+ Q++S QAGERHAL
Sbjct  1    MAKKRKSVESRLDEVDRTMYSTFCTTANSLSHLYTHAMNQQKLSFQAGERHAL  53



>ref|XP_003630138.1| hypothetical protein MTR_8g092210 [Medicago truncatula]
 gb|AET04614.1| holocarboxylase synthetase [Medicago truncatula]
Length=212

 Score = 83.6 bits (205),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            MAKKRKS  +RLDEVDRT++STFC+ ANSLS LYT AM+ Q++S QAGERHAL
Sbjct  1    MAKKRKSVESRLDEVDRTMYSTFCTTANSLSHLYTHAMNQQKLSFQAGERHAL  53



>ref|XP_007019592.1| Uncharacterized protein TCM_035706 [Theobroma cacao]
 gb|EOY16817.1| Uncharacterized protein TCM_035706 [Theobroma cacao]
Length=215

 Score = 83.2 bits (204),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHALVR  189
            M KKRKS AT LDEVDRT++++FCSAANSLSQLYTQAM+ Q++S QAG+RH+L +
Sbjct  1    MGKKRKSIATSLDEVDRTMYASFCSAANSLSQLYTQAMNQQKLSFQAGKRHSLEK  55



>gb|AFK38910.1| unknown [Medicago truncatula]
Length=168

 Score = 82.4 bits (202),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            MAKKRKS AT LDEVDRT++++FCSAANSLSQL+ QA++HQ++S QAG+RH L
Sbjct  1    MAKKRKSIATTLDEVDRTMYASFCSAANSLSQLHMQALNHQKLSFQAGQRHGL  53



>ref|XP_004503996.1| PREDICTED: uncharacterized protein LOC101509322 [Cicer arietinum]
Length=212

 Score = 83.2 bits (204),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            MAKKRKS  +RLDEVDRT++STFC+ ANSLS LYT AM+ Q++S QAGERHAL
Sbjct  1    MAKKRKSVESRLDEVDRTMYSTFCTTANSLSHLYTHAMNQQKLSFQAGERHAL  53



>ref|XP_010530126.1| PREDICTED: uncharacterized protein LOC104806765 [Tarenaya hassleriana]
Length=192

 Score = 82.8 bits (203),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            M KKRKS AT LDEVDRT++++F +AANSLSQLYTQAM+HQ++S QAGERH L
Sbjct  1    MGKKRKSIATSLDEVDRTVYTSFRTAANSLSQLYTQAMNHQKLSFQAGERHGL  53



>gb|KHG14904.1| hypothetical protein F383_02753 [Gossypium arboreum]
Length=263

 Score = 83.6 bits (205),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 63/104 (61%), Gaps = 10/104 (10%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHALVRSP---  195
            M KKRKS AT LDEVDRT++++FCSAANSLS LYTQAM+ Q++S QAG+RH L +     
Sbjct  1    MGKKRKSIATSLDEVDRTMYASFCSAANSLSHLYTQAMNQQKLSFQAGKRHGLNKCSCRY  60

Query  196  ---LAFPSFFEFTLLISASPPLRLCLE----RINPQINLHPVKP  306
               LA        +LIS    L + LE    RI    N +P  P
Sbjct  61   VVHLAKSGTDGLRMLISHGKNLSVDLETTRGRIKSNNNGYPQLP  104



>ref|XP_003548092.1| PREDICTED: uncharacterized protein LOC100793841 [Glycine max]
Length=204

 Score = 82.8 bits (203),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            M KKRKS AT LDEVDRTL+++FC+AANSLSQLYT +M+HQ++S  AGERHAL
Sbjct  1    MPKKRKSIATSLDEVDRTLYASFCTAANSLSQLYTHSMNHQKLSFNAGERHAL  53



>ref|XP_002872465.1| hypothetical protein ARALYDRAFT_352054 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48724.1| hypothetical protein ARALYDRAFT_352054 [Arabidopsis lyrata subsp. 
lyrata]
Length=190

 Score = 82.8 bits (203),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            M KKRKS AT LDEVDRT++++F +AANSLSQLYTQ+M+HQ++S QAGERH L
Sbjct  1    MGKKRKSTATSLDEVDRTVYASFRTAANSLSQLYTQSMNHQKLSFQAGERHGL  53



>ref|XP_010542952.1| PREDICTED: uncharacterized protein LOC104815997 [Tarenaya hassleriana]
Length=188

 Score = 82.4 bits (202),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            M KKRKS AT LDEVDRT++++F +AANSLSQLYTQAM+HQ++S QAGERH L
Sbjct  1    MGKKRKSIATSLDEVDRTVYASFRTAANSLSQLYTQAMNHQKLSFQAGERHGL  53



>gb|AAM62508.1| unknown [Arabidopsis thaliana]
Length=191

 Score = 82.8 bits (203),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            M KKRKS AT LDEVDRT++++F +AANSLSQLYTQ+M+HQ++S QAGERH L
Sbjct  1    MGKKRKSTATSLDEVDRTVYASFRTAANSLSQLYTQSMNHQKLSFQAGERHGL  53



>ref|XP_003569287.1| PREDICTED: uncharacterized protein LOC100830936 [Brachypodium 
distachyon]
Length=200

 Score = 82.8 bits (203),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 48/56 (86%), Gaps = 1/56 (2%)
 Frame = +1

Query  25   MAKKRKSEAT-RLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHALVR  189
            MA+KRKS+A  RLDE DRTL+STFC AANSLSQLY+QAM  Q++S QAGERHAL +
Sbjct  1    MARKRKSDAAPRLDEADRTLYSTFCGAANSLSQLYSQAMSQQKLSFQAGERHALEK  56



>ref|NP_192721.1| uncharacterized protein [Arabidopsis thaliana]
 emb|CAB39650.1| putative protein [Arabidopsis thaliana]
 emb|CAB78106.1| putative protein [Arabidopsis thaliana]
 gb|AAL67034.1| unknown protein [Arabidopsis thaliana]
 gb|AAM14309.1| unknown protein [Arabidopsis thaliana]
 gb|AEE82803.1| uncharacterized protein AT4G09830 [Arabidopsis thaliana]
Length=191

 Score = 82.4 bits (202),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            M KKRKS AT LDEVDRT++++F +AANSLSQLYTQ+M+HQ++S QAGERH L
Sbjct  1    MGKKRKSTATSLDEVDRTVYASFRTAANSLSQLYTQSMNHQKLSFQAGERHGL  53



>ref|XP_004288874.1| PREDICTED: uncharacterized protein LOC101298370 [Fragaria vesca 
subsp. vesca]
Length=130

 Score = 81.3 bits (199),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            M KKRK   T LDEVDR+++++FCSAANSLSQLYTQ M++Q+ S QAGERHAL
Sbjct  1    MGKKRKPITTSLDEVDRSMYASFCSAANSLSQLYTQGMNNQKFSFQAGERHAL  53



>gb|KFK32043.1| hypothetical protein AALP_AA6G192700 [Arabis alpina]
Length=190

 Score = 82.4 bits (202),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            M KKRKS AT LDEVDRT++++F +AANSLSQLYTQ+M+HQ++S QAGERH L
Sbjct  1    MGKKRKSTATSLDEVDRTVYASFRTAANSLSQLYTQSMNHQKLSFQAGERHGL  53



>ref|XP_006644324.1| PREDICTED: uncharacterized protein LOC102720747 [Oryza brachyantha]
Length=200

 Score = 82.4 bits (202),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 48/56 (86%), Gaps = 1/56 (2%)
 Frame = +1

Query  25   MAKKRKSEAT-RLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHALVR  189
            MA+KRK++A  RLDE DRTL+STFC AANSLSQLYTQAM  Q++S QAGERHAL +
Sbjct  1    MARKRKTDAAPRLDEADRTLYSTFCGAANSLSQLYTQAMAQQKLSFQAGERHALEK  56



>ref|XP_009610488.1| PREDICTED: uncharacterized protein LOC104104186 isoform X2 [Nicotiana 
tomentosiformis]
Length=213

 Score = 82.8 bits (203),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            M KKRKS AT LDEVDRT++STFCSAANSLSQLYTQAM+ Q++S  +GERH +
Sbjct  1    MGKKRKSLATSLDEVDRTMYSTFCSAANSLSQLYTQAMNQQKLSFLSGERHGM  53



>gb|KHN00739.1| hypothetical protein glysoja_000407 [Glycine soja]
Length=205

 Score = 82.8 bits (203),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHALVR  189
            MAKKRKS A  LD+VDRTL+++FC+AANSLSQLYT +M+HQ++S  AGERHAL +
Sbjct  1    MAKKRKSIANSLDDVDRTLYTSFCTAANSLSQLYTHSMNHQKLSFNAGERHALEK  55



>ref|NP_001242150.1| uncharacterized protein LOC100796484 [Glycine max]
 gb|ACU19912.1| unknown [Glycine max]
Length=205

 Score = 82.4 bits (202),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHALVR  189
            MAKKRKS A  LD+VDRTL+++FC+AANSLSQLYT +M+HQ++S  AGERHAL +
Sbjct  1    MAKKRKSIANSLDDVDRTLYTSFCTAANSLSQLYTHSMNHQKLSFNAGERHALEK  55



>ref|XP_006397139.1| hypothetical protein EUTSA_v10028989mg [Eutrema salsugineum]
 gb|ESQ38592.1| hypothetical protein EUTSA_v10028989mg [Eutrema salsugineum]
Length=190

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            M KKRKS AT LDEVDRT++++F +AANSLSQLYTQ+M+HQ++S QAGERH L
Sbjct  1    MGKKRKSTATSLDEVDRTVYASFRTAANSLSQLYTQSMNHQKLSFQAGERHGL  53



>ref|XP_010520118.1| PREDICTED: uncharacterized protein LOC104799345 [Tarenaya hassleriana]
Length=161

 Score = 81.6 bits (200),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            MAKKRKSEATRLDE+DRT++S F  AANSLSQLYT AM HQR+S  AGER AL
Sbjct  1    MAKKRKSEATRLDEIDRTMYSAFRGAANSLSQLYTHAMSHQRLSFLAGERRAL  53



>ref|XP_003592057.1| hypothetical protein MTR_1g098250 [Medicago truncatula]
 gb|AES62308.1| holocarboxylase synthetase [Medicago truncatula]
Length=207

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHALVR  189
            MAKKRKS AT LDEVDRT++++FCSAANSLSQL+ QA++HQ++S QAG+RH L +
Sbjct  1    MAKKRKSIATTLDEVDRTMYASFCSAANSLSQLHMQALNHQKLSFQAGQRHGLEK  55



>ref|XP_010421889.1| PREDICTED: uncharacterized protein LOC104707271 [Camelina sativa]
Length=190

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            M KKRKS AT LDEVDRT++++F +AANSLSQLYTQ+M+HQ++S QAGERH L
Sbjct  1    MGKKRKSTATSLDEVDRTVYASFRTAANSLSQLYTQSMNHQKLSFQAGERHGL  53



>ref|XP_009782198.1| PREDICTED: uncharacterized protein LOC104230978 [Nicotiana sylvestris]
Length=212

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHALVR  189
            M KKRKS AT LDEVDRT++STFCSAANSLSQLYTQAM+ Q++S  +GERH + +
Sbjct  1    MGKKRKSLATSLDEVDRTMYSTFCSAANSLSQLYTQAMNQQKLSFLSGERHGMEK  55



>ref|XP_010455374.1| PREDICTED: uncharacterized protein LOC104736976 [Camelina sativa]
Length=190

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            M KKRKS AT LDEVDRT++++F +AANSLSQLYTQ+M+HQ++S QAGERH L
Sbjct  1    MGKKRKSTATSLDEVDRTVYASFRTAANSLSQLYTQSMNHQKLSFQAGERHGL  53



>ref|XP_010437962.1| PREDICTED: uncharacterized protein LOC104721627 [Camelina sativa]
Length=190

 Score = 81.6 bits (200),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            M KKRKS AT LDEVDRT++++F +AANSLSQLYTQ+M+HQ++S QAGERH L
Sbjct  1    MGKKRKSTATSLDEVDRTVYASFRTAANSLSQLYTQSMNHQKLSFQAGERHGL  53



>ref|XP_007151973.1| hypothetical protein PHAVU_004G091000g [Phaseolus vulgaris]
 gb|ESW23967.1| hypothetical protein PHAVU_004G091000g [Phaseolus vulgaris]
Length=128

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            MAKKRKS  T LDEVDRTL+++FC+AANSLSQLYT  M+HQ+ S  AGER +L
Sbjct  1    MAKKRKSITTSLDEVDRTLYASFCTAANSLSQLYTHTMNHQKFSFNAGERQSL  53



>ref|XP_006288727.1| hypothetical protein CARUB_v10002038mg [Capsella rubella]
 gb|EOA21625.1| hypothetical protein CARUB_v10002038mg [Capsella rubella]
Length=190

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            M KKRKS AT LDEVDRT++++F +AANSLSQLYTQ+M+HQ++S QAGERH L
Sbjct  1    MGKKRKSTATSLDEVDRTVYASFRTAANSLSQLYTQSMNHQKLSFQAGERHGL  53



>ref|XP_009610487.1| PREDICTED: uncharacterized protein LOC104104186 isoform X1 [Nicotiana 
tomentosiformis]
Length=239

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            M KKRKS AT LDEVDRT++STFCSAANSLSQLYTQAM+ Q++S  +GERH +
Sbjct  1    MGKKRKSLATSLDEVDRTMYSTFCSAANSLSQLYTQAMNQQKLSFLSGERHGM  53



>gb|KJB28968.1| hypothetical protein B456_005G077300 [Gossypium raimondii]
Length=214

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHALVR  189
            M KKRKS AT LDEVDRT++++FCSAANSLSQLYTQAM+ Q++S QAG+ H+L +
Sbjct  1    MGKKRKSIATSLDEVDRTMYASFCSAANSLSQLYTQAMNQQKLSFQAGKGHSLEK  55



>gb|KHG17592.1| Nuclear receptor subfamily 2 group C member 2 [Gossypium arboreum]
Length=214

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHALVR  189
            M KKRKS AT LDEVDRT++++FCSAANSLSQLYTQAM+ Q++S QAG+ H+L +
Sbjct  1    MGKKRKSIATSLDEVDRTMYASFCSAANSLSQLYTQAMNQQKLSFQAGKGHSLEK  55



>ref|XP_006473103.1| PREDICTED: uncharacterized protein LOC102626479 [Citrus sinensis]
Length=208

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHALVR  189
            M KKRKS AT LDEVDR+++++FCSAANSLS LYTQAM+ Q++S QAGERH L +
Sbjct  1    MGKKRKSIATSLDEVDRSMYASFCSAANSLSHLYTQAMNQQKLSFQAGERHGLEK  55



>emb|CDX99511.1| BnaC09g24810D [Brassica napus]
Length=191

 Score = 81.3 bits (199),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            M KKRK+ AT LDEVDRT++++F +AANSLSQLYTQ+M+HQ++S QAGERH L
Sbjct  1    MGKKRKATATSLDEVDRTVYASFRTAANSLSQLYTQSMNHQKLSFQAGERHGL  53



>dbj|BAB89033.1| putative holocarboxylase synthetase [Oryza sativa Japonica Group]
 dbj|BAC78568.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAG88159.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94159.1| unnamed protein product [Oryza sativa Japonica Group]
Length=200

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 48/56 (86%), Gaps = 1/56 (2%)
 Frame = +1

Query  25   MAKKRKSEAT-RLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHALVR  189
            MA+KRK++A  RLDE DRTL+STFC AANSLSQLYTQAM  Q++S QAGERH+L +
Sbjct  1    MARKRKTDAAPRLDEADRTLYSTFCGAANSLSQLYTQAMAQQKLSFQAGERHSLEK  56



>emb|CDX86890.1| BnaA09g22800D [Brassica napus]
Length=187

 Score = 81.3 bits (199),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            M KKRK+ AT LDEVDRT++++F +AANSLSQLYTQ+M+HQ++S QAGERH L
Sbjct  1    MGKKRKATATSLDEVDRTVYASFRTAANSLSQLYTQSMNHQKLSFQAGERHGL  53



>gb|KJB18358.1| hypothetical protein B456_003G048400 [Gossypium raimondii]
Length=212

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 53/68 (78%), Gaps = 7/68 (10%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHALVRSPLAF  204
            M+KKRKS+ATRLDEV R++++ FCSAANSLSQLY+ +M+HQ +S QAGER+AL +     
Sbjct  1    MSKKRKSDATRLDEVSRSMYTAFCSAANSLSQLYSHSMNHQSLSFQAGERYALEK-----  55

Query  205  PSFFEFTL  228
               FE+ L
Sbjct  56   --LFEWIL  61



>ref|XP_009113575.1| PREDICTED: uncharacterized protein LOC103838878 [Brassica rapa]
Length=190

 Score = 81.3 bits (199),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            M KKRK+ AT LDEVDRT++++F +AANSLSQLYTQ+M+HQ++S QAGERH L
Sbjct  1    MGKKRKATATSLDEVDRTVYASFRTAANSLSQLYTQSMNHQKLSFQAGERHGL  53



>ref|XP_004969043.1| PREDICTED: uncharacterized protein LOC101785264 [Setaria italica]
Length=203

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 46/54 (85%), Gaps = 1/54 (2%)
 Frame = +1

Query  25   MAKKRKSEAT-RLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            MA+KRK++A  RLDE DRTL+STFC AANSLSQLYTQAM  Q++S QAGERHA 
Sbjct  1    MARKRKTDAAPRLDEADRTLYSTFCGAANSLSQLYTQAMAQQKLSFQAGERHAF  54



>ref|XP_004252568.1| PREDICTED: uncharacterized protein LOC101258927 [Solanum lycopersicum]
Length=210

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHALVR  189
            M KKRKS A+ LDEVDRT++STFCSAANSLSQLYTQAM+ Q++S  +GERH + +
Sbjct  1    MGKKRKSLASSLDEVDRTMYSTFCSAANSLSQLYTQAMNQQKLSFLSGERHGMEK  55



>ref|XP_006361614.1| PREDICTED: uncharacterized protein LOC102606378 [Solanum tuberosum]
Length=210

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHALVR  189
            M KKRKS A+ LDEVDRT++STFCSAANSLSQLYTQAM+ Q++S  +GERH + +
Sbjct  1    MGKKRKSLASSLDEVDRTMYSTFCSAANSLSQLYTQAMNQQKLSFLSGERHGMEK  55



>ref|XP_004237831.1| PREDICTED: uncharacterized protein LOC101255194 [Solanum lycopersicum]
Length=211

 Score = 80.5 bits (197),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHALVR  189
            MAKKRKS A+ +DEVDRT++STF SAANSLSQLY+QA++ Q++S QAGERH L +
Sbjct  1    MAKKRKSLASSIDEVDRTMYSTFSSAANSLSQLYSQALNQQKLSFQAGERHGLEK  55



>ref|NP_201283.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAB10311.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL67081.1| unknown protein [Arabidopsis thaliana]
 gb|AAM14195.1| unknown protein [Arabidopsis thaliana]
 dbj|BAE98998.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED97950.1| uncharacterized protein AT5G64780 [Arabidopsis thaliana]
Length=175

 Score = 79.7 bits (195),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            M KKRKSEATRLDEVDRT++  F  AANSLSQLYT AM+HQR+S  AGER  +
Sbjct  1    MGKKRKSEATRLDEVDRTMYGAFRGAANSLSQLYTHAMNHQRVSFLAGERRGM  53



>ref|XP_001763798.1| predicted protein [Physcomitrella patens]
 gb|EDQ71440.1| predicted protein [Physcomitrella patens]
Length=197

 Score = 80.1 bits (196),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            MAKKRKSE   LDEV+RTL+++FC+AANS+SQLYTQA + Q++S QAGERHA+
Sbjct  1    MAKKRKSENAALDEVERTLYTSFCTAANSISQLYTQAQNQQKLSFQAGERHAV  53



>ref|XP_006394113.1| hypothetical protein EUTSA_v10005018mg [Eutrema salsugineum]
 gb|ESQ31399.1| hypothetical protein EUTSA_v10005018mg [Eutrema salsugineum]
Length=172

 Score = 79.7 bits (195),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            MAKKRKSEATRLDEVDRT++  F  AANSLSQLYT AM+HQR S  AGER  L
Sbjct  1    MAKKRKSEATRLDEVDRTMYGAFRGAANSLSQLYTHAMNHQRASFLAGERRGL  53



>gb|AAM62535.1| unknown [Arabidopsis thaliana]
Length=175

 Score = 79.7 bits (195),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            M KKRKSEATRLDEVDRT++  F  AANSLSQLYT AM+HQR+S  AGER  +
Sbjct  1    MGKKRKSEATRLDEVDRTMYDAFRGAANSLSQLYTHAMNHQRVSFLAGERRGM  53



>ref|XP_004489928.1| PREDICTED: uncharacterized protein LOC101504971 [Cicer arietinum]
Length=196

 Score = 80.1 bits (196),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            MAKKRKS AT LDEVDRT++++F +AANSLSQLYT AM+HQ++S  AG+R+AL
Sbjct  1    MAKKRKSTATSLDEVDRTMYASFSTAANSLSQLYTHAMNHQKLSFHAGQRNAL  53



>gb|KJB18359.1| hypothetical protein B456_003G048500 [Gossypium raimondii]
Length=199

 Score = 80.1 bits (196),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQ  162
            M KKRKS+A+RLDEVDRT++++FCSAANSLSQLYTQAM+HQR+S Q
Sbjct  1    MTKKRKSDASRLDEVDRTMYTSFCSAANSLSQLYTQAMNHQRLSFQ  46



>ref|XP_006842211.1| hypothetical protein AMTR_s00078p00174210 [Amborella trichopoda]
 gb|ERN03886.1| hypothetical protein AMTR_s00078p00174210 [Amborella trichopoda]
Length=177

 Score = 79.7 bits (195),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +1

Query  19   ESMAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            E MAKKRKSE T LDEVDR +H+TFC+AANSLS LYT A + Q+++  AGERH +
Sbjct  69   EDMAKKRKSEVTGLDEVDRKMHTTFCNAANSLSLLYTHAQNQQKLAFLAGERHGM  123



>gb|KJB59481.1| hypothetical protein B456_009G258500 [Gossypium raimondii]
 gb|KJB59482.1| hypothetical protein B456_009G258500 [Gossypium raimondii]
Length=214

 Score = 80.1 bits (196),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHALVR  189
            M KKRKS AT LDEVDRT++++FCSAANSLS LYTQ M+ Q++S QAG+RH L +
Sbjct  1    MGKKRKSIATSLDEVDRTMYASFCSAANSLSHLYTQTMNQQKLSFQAGKRHGLEK  55



>gb|KJB59480.1| hypothetical protein B456_009G258500 [Gossypium raimondii]
Length=243

 Score = 80.1 bits (196),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHALVR  189
            M KKRKS AT LDEVDRT++++FCSAANSLS LYTQ M+ Q++S QAG+RH L +
Sbjct  1    MGKKRKSIATSLDEVDRTMYASFCSAANSLSHLYTQTMNQQKLSFQAGKRHGLEK  55



>gb|EMT31658.1| hypothetical protein F775_32794 [Aegilops tauschii]
 emb|CDM83257.1| unnamed protein product [Triticum aestivum]
Length=200

 Score = 79.7 bits (195),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 47/54 (87%), Gaps = 1/54 (2%)
 Frame = +1

Query  25   MAKKRKSEAT-RLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            MA+KRK++A  RLDE DRTL+S+FC AANSLSQLY+QAM  Q++S QAGERHAL
Sbjct  1    MARKRKTDAAPRLDEADRTLYSSFCGAANSLSQLYSQAMAQQKLSFQAGERHAL  54



>ref|XP_006281074.1| hypothetical protein CARUB_v10027097mg, partial [Capsella rubella]
 gb|EOA13972.1| hypothetical protein CARUB_v10027097mg, partial [Capsella rubella]
Length=219

 Score = 80.1 bits (196),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            M KKRKSEATRLDEVDRT++  F  AANSLSQLYT AM+HQR+S  AGER  +
Sbjct  48   MVKKRKSEATRLDEVDRTMYGAFRGAANSLSQLYTHAMNHQRVSFLAGERRGM  100



>ref|XP_009134168.1| PREDICTED: uncharacterized protein LOC103858542 [Brassica rapa]
 emb|CDX90738.1| BnaA03g24180D [Brassica napus]
Length=190

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            M KKRK+  T LDEVDRT++++F +AANSLSQLYTQ+M+HQ++S QAGERH L
Sbjct  1    MGKKRKATETSLDEVDRTVYASFRTAANSLSQLYTQSMNHQKLSFQAGERHGL  53



>emb|CDY05080.1| BnaC03g28780D [Brassica napus]
Length=190

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            M KKRK+  T LDEVDRT++++F +AANSLSQLYTQ+M+HQ++S QAGERH L
Sbjct  1    MGKKRKATETSLDEVDRTVYASFRTAANSLSQLYTQSMNHQKLSFQAGERHGL  53



>gb|KHG16766.1| putative G-protein coupled receptor [Gossypium arboreum]
Length=212

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 51/68 (75%), Gaps = 7/68 (10%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHALVRSPLAF  204
            M+KKRKS+ TRLDEV R++++ FCSAANSLSQLY+ +M+HQ  S QAGER+AL +     
Sbjct  1    MSKKRKSDTTRLDEVSRSMYTAFCSAANSLSQLYSHSMNHQSFSFQAGERYALEK-----  55

Query  205  PSFFEFTL  228
               FE+ L
Sbjct  56   --LFEWIL  61



>gb|KHN17036.1| hypothetical protein glysoja_011510 [Glycine soja]
Length=225

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 50/60 (83%), Gaps = 2/60 (3%)
 Frame = +1

Query  4    GFTKGESMAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            G+ +G  MAKKRKS +T LDEVDRT++S+F SA NSLS LYT +M+HQ++S QAGERH+L
Sbjct  29   GYRRG--MAKKRKSISTSLDEVDRTIYSSFSSATNSLSHLYTLSMNHQKLSFQAGERHSL  86



>ref|NP_001242256.1| uncharacterized protein LOC100801119 [Glycine max]
 gb|ACU20752.1| unknown [Glycine max]
Length=192

 Score = 78.2 bits (191),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            MAKKRKS +T LDEVDRT++S+F SAANSLS LYT +M+HQ +S QAGERH+L
Sbjct  1    MAKKRKSISTSLDEVDRTIYSSFSSAANSLSHLYTLSMNHQELSFQAGERHSL  53



>emb|CDY08851.1| BnaA06g23730D [Brassica napus]
Length=174

 Score = 77.4 bits (189),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            M KKRKS+A+RLDEVDRT++  F  AANSLSQLYT AM+HQR+S  AGER  L
Sbjct  1    MGKKRKSDASRLDEVDRTMYGAFRGAANSLSQLYTHAMNHQRVSFLAGERRGL  53



>ref|XP_003592515.1| hypothetical protein MTR_1g106890 [Medicago truncatula]
 gb|AFK49104.1| unknown [Medicago truncatula]
 gb|KEH26050.1| holocarboxylase synthetase [Medicago truncatula]
Length=195

 Score = 77.8 bits (190),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            MAKKRKS A+ LDEVDRT++++F +AANSLSQLY+ AM+HQ++S  AGER+AL
Sbjct  1    MAKKRKSAASSLDEVDRTMYASFSTAANSLSQLYSHAMNHQKLSFHAGERNAL  53



>tpg|DAA58747.1| TPA: hypothetical protein ZEAMMB73_814484 [Zea mays]
Length=97

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 59/94 (63%), Gaps = 9/94 (10%)
 Frame = +1

Query  25   MAKKRKSEAT-RLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHALVRSPLA  201
            MA++RK++A  RLDE DRTL+STFC AANSLSQLY QAM  Q+++  AGERHAL +    
Sbjct  1    MARRRKTDAPPRLDEADRTLYSTFCGAANSLSQLYAQAMAQQKLNFHAGERHALEK----  56

Query  202  FPSFFEFTLLISASPPLRLCLERINPQINLHPVK  303
                +++ +L       RL +  I   I + P+ 
Sbjct  57   ---LYQW-ILRKHDEEARLTVAEIMSHIQVQPLN  86



>ref|XP_002866635.1| hypothetical protein ARALYDRAFT_496694 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42894.1| hypothetical protein ARALYDRAFT_496694 [Arabidopsis lyrata subsp. 
lyrata]
Length=173

 Score = 77.4 bits (189),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            M KKRKSEATRLDEVDRT++  F  AANSLSQLYT AM+HQ +S  AGER  +
Sbjct  1    MVKKRKSEATRLDEVDRTMYGAFRGAANSLSQLYTHAMNHQNVSFIAGERRGM  53



>emb|CDY14510.1| BnaC03g49490D [Brassica napus]
Length=174

 Score = 77.0 bits (188),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            M KKRKS+A+RLDEVDRT++  F  AANSLSQLYT AM+HQR+S  AGER  L
Sbjct  1    MVKKRKSDASRLDEVDRTMYGAFRGAANSLSQLYTHAMNHQRVSFLAGERRGL  53



>ref|XP_009150556.1| PREDICTED: uncharacterized protein LOC103873905 [Brassica rapa]
Length=174

 Score = 77.0 bits (188),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            M KKRKS+A+RLDEVDRT++  F  AANSLSQLYT AM+HQR+S  AGER  L
Sbjct  1    MGKKRKSDASRLDEVDRTMYGAFRGAANSLSQLYTHAMNHQRVSFLAGERRWL  53



>ref|NP_001043444.2| Os01g0589500 [Oryza sativa Japonica Group]
 dbj|BAF05358.2| Os01g0589500, partial [Oryza sativa Japonica Group]
Length=244

 Score = 77.4 bits (189),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 46/54 (85%), Gaps = 1/54 (2%)
 Frame = +1

Query  31   KKRKSEAT-RLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHALVR  189
            +KRK++A  RLDE DRTL+STFC AANSLSQLYTQAM  Q++S QAGERH+L +
Sbjct  47   RKRKTDAAPRLDEADRTLYSTFCGAANSLSQLYTQAMAQQKLSFQAGERHSLEK  100



>gb|KFK28167.1| hypothetical protein AALP_AA8G481100 [Arabis alpina]
Length=170

 Score = 76.3 bits (186),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            M KKRKSE++RLDEVDRT++  F  AANSLSQLYT AM+HQR+S  AGER  +
Sbjct  1    MVKKRKSESSRLDEVDRTMYGAFRGAANSLSQLYTHAMNHQRVSFLAGERRGM  53



>ref|XP_009407273.1| PREDICTED: uncharacterized protein LOC103990001 [Musa acuminata 
subsp. malaccensis]
Length=212

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 44/56 (79%), Gaps = 1/56 (2%)
 Frame = +1

Query  25   MAKKRKSE-ATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHALVR  189
            M +KRK+E    +DE DRT++STFC AANSLSQLYTQAMH Q +S  AGERHAL +
Sbjct  1    MTRKRKTEEVAPMDEADRTIYSTFCGAANSLSQLYTQAMHQQTLSFDAGERHALEK  56



>ref|NP_001136541.1| hypothetical protein [Zea mays]
 gb|ACF82126.1| unknown [Zea mays]
 tpg|DAA58748.1| TPA: hypothetical protein ZEAMMB73_814484 [Zea mays]
Length=201

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 45/54 (83%), Gaps = 1/54 (2%)
 Frame = +1

Query  25   MAKKRKSEAT-RLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            MA++RK++A  RLDE DRTL+STFC AANSLSQLY QAM  Q+++  AGERHAL
Sbjct  1    MARRRKTDAPPRLDEADRTLYSTFCGAANSLSQLYAQAMAQQKLNFHAGERHAL  54



>ref|XP_004961026.1| PREDICTED: uncharacterized protein LOC101766877 [Setaria italica]
Length=209

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 46/56 (82%), Gaps = 1/56 (2%)
 Frame = +1

Query  25   MAKKRKSE-ATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHALVR  189
            MA+KRK+E A RLDE DRTLHSTFCSAANSLSQLY+QA+  Q+ S  AGE HAL +
Sbjct  1    MARKRKTEVAPRLDEADRTLHSTFCSAANSLSQLYSQAIAQQKQSFHAGELHALDK  56



>gb|AAP80657.1|AF479038_1 holocarboxylase synthetase, partial [Triticum aestivum]
Length=208

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 45/52 (87%), Gaps = 1/52 (2%)
 Frame = +1

Query  31   KKRKSEAT-RLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            +KRK++A  RLDE DRTL+S+FC AANSLSQLY+QAM  Q++S QAGERHAL
Sbjct  11   RKRKTDAAPRLDEADRTLYSSFCGAANSLSQLYSQAMAQQKLSFQAGERHAL  62



>ref|XP_010462762.1| PREDICTED: uncharacterized protein LOC104743362 [Camelina sativa]
 ref|XP_010444425.1| PREDICTED: uncharacterized protein LOC104727113 [Camelina sativa]
Length=174

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 43/54 (80%), Gaps = 1/54 (2%)
 Frame = +1

Query  25   MAKKRKSE-ATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            M KKRKSE ATRLDEVDRT++  F  AANSLSQLYT AM+HQR+S  AGER  +
Sbjct  1    MVKKRKSEEATRLDEVDRTMYGAFRGAANSLSQLYTHAMNHQRVSFLAGERRGM  54



>ref|XP_007143574.1| hypothetical protein PHAVU_007G083200g [Phaseolus vulgaris]
 gb|ESW15568.1| hypothetical protein PHAVU_007G083200g [Phaseolus vulgaris]
Length=203

 Score = 75.1 bits (183),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            MAKKRKS AT +DEVDRT+ S+F +AANSLS LYT +M+H ++S QAGERH+L
Sbjct  1    MAKKRKSIATSMDEVDRTMFSSFSTAANSLSHLYTLSMNHHKLSFQAGERHSL  53



>ref|XP_003567792.1| PREDICTED: uncharacterized protein LOC100842848 [Brachypodium 
distachyon]
Length=195

 Score = 74.7 bits (182),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 45/56 (80%), Gaps = 1/56 (2%)
 Frame = +1

Query  25   MAKKRKSEAT-RLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHALVR  189
            MA+KRK+EA  RLDE DRTL+STFC AANSLSQLY+QAM  Q+ S  AGE HAL +
Sbjct  1    MARKRKTEAPPRLDEADRTLYSTFCGAANSLSQLYSQAMAQQKQSFHAGELHALEK  56



>ref|XP_001771218.1| predicted protein [Physcomitrella patens]
 gb|EDQ63929.1| predicted protein, partial [Physcomitrella patens]
Length=155

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            MAKKRKSE   LDE++RTL+++FC+ ANS+S  YTQA + Q++S QAGERHA+
Sbjct  1    MAKKRKSENAALDEMERTLYTSFCTTANSISHFYTQAQNQQKLSFQAGERHAV  53



>ref|XP_010484271.1| PREDICTED: uncharacterized protein LOC104762640 [Camelina sativa]
Length=173

 Score = 73.6 bits (179),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 42/54 (78%), Gaps = 1/54 (2%)
 Frame = +1

Query  25   MAKKRKSE-ATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            M KKRKSE  TRLDEVDRT++  F  AANSLSQLYT AM+HQR+S  AGER  +
Sbjct  1    MVKKRKSEETTRLDEVDRTMYGAFRGAANSLSQLYTHAMNHQRVSFLAGERRGM  54



>emb|CBI28060.3| unnamed protein product [Vitis vinifera]
Length=216

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +1

Query  22   SMAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            SM KK KS+A  LDEVD T++ + CS  N L+QLYTQAM+ QR+ SQA ERHAL
Sbjct  34   SMVKKSKSDAICLDEVDHTMYVSICSVVNPLTQLYTQAMNQQRLFSQACERHAL  87



>ref|XP_009388166.1| PREDICTED: uncharacterized protein LOC103974984 [Musa acuminata 
subsp. malaccensis]
Length=207

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 47/57 (82%), Gaps = 2/57 (4%)
 Frame = +1

Query  25   MAKKRKSE--ATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHALVR  189
            MA+KRK+E  AT LDE DRTL+STF  AANS+SQLYTQ++HH+ +S  AGERHAL +
Sbjct  1    MARKRKTEEAATPLDEADRTLYSTFRGAANSVSQLYTQSVHHRALSFHAGERHALDK  57



>ref|XP_006826290.1| hypothetical protein AMTR_s00004p00061310 [Amborella trichopoda]
 gb|ERM93527.1| hypothetical protein AMTR_s00004p00061310 [Amborella trichopoda]
Length=207

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHALVR  189
            M+KKRKSE+  LDE++RT+++ F SAANSLS LYTQA + Q+++ QAGERHAL +
Sbjct  1    MSKKRKSESNGLDEIERTMYTAFSSAANSLSLLYTQAQNQQKLAFQAGERHALEK  55



>ref|XP_009381149.1| PREDICTED: uncharacterized protein LOC103969370 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=183

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 45/55 (82%), Gaps = 2/55 (4%)
 Frame = +1

Query  25   MAKKRKSEAT--RLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            MAKKRK EA   RLDEVDRT++STF   ANSLSQ+YTQA+  ++++ QAGER+AL
Sbjct  1    MAKKRKPEAVTRRLDEVDRTIYSTFRGGANSLSQIYTQALAQKKVAFQAGERYAL  55



>ref|XP_009381148.1| PREDICTED: uncharacterized protein LOC103969370 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=210

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 45/55 (82%), Gaps = 2/55 (4%)
 Frame = +1

Query  25   MAKKRKSEAT--RLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            MAKKRK EA   RLDEVDRT++STF   ANSLSQ+YTQA+  ++++ QAGER+AL
Sbjct  1    MAKKRKPEAVTRRLDEVDRTIYSTFRGGANSLSQIYTQALAQKKVAFQAGERYAL  55



>ref|XP_009380423.1| PREDICTED: uncharacterized protein LOC103968822 [Musa acuminata 
subsp. malaccensis]
Length=209

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            M KKRKSE T LDE DRT++S F  AANSLS +YTQAM  Q ++ Q GERHAL
Sbjct  1    MGKKRKSEDTHLDEADRTIYSVFRGAANSLSLIYTQAMTQQELAFQTGERHAL  53



>gb|EMS62206.1| hypothetical protein TRIUR3_09092 [Triticum urartu]
Length=214

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +1

Query  28   AKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
             KKRK+EA RLDE DR ++  F  AANSLSQLYT AM  Q++S QAGERHA+
Sbjct  3    GKKRKAEAARLDETDRAMYGAFRGAANSLSQLYTLAMGGQKLSFQAGERHAM  54



>ref|XP_006660563.1| PREDICTED: uncharacterized protein LOC102719228 [Oryza brachyantha]
Length=196

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 52/86 (60%), Gaps = 8/86 (9%)
 Frame = +1

Query  28   AKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHALVRSPLAFP  207
             KKRK+EA RL+E DR L+  F  AANSLSQLYT AM  Q++S QAGERHA+ +      
Sbjct  4    GKKRKAEAARLEETDRALYGAFRGAANSLSQLYTLAMGGQKLSFQAGERHAMEK------  57

Query  208  SFFEFTLLISASPPLRLCLERINPQI  285
              +E+ +L      LRL +  I   I
Sbjct  58   -LYEW-ILRQHENGLRLTVADIASHI  81



>ref|NP_001062977.1| Os09g0360400 [Oryza sativa Japonica Group]
 dbj|BAD23319.1| putative holocarboxylase synthetase [Oryza sativa Japonica Group]
 dbj|BAF24891.1| Os09g0360400 [Oryza sativa Japonica Group]
 gb|EAZ08783.1| hypothetical protein OsI_31044 [Oryza sativa Indica Group]
 gb|EAZ44445.1| hypothetical protein OsJ_29059 [Oryza sativa Japonica Group]
 dbj|BAG92474.1| unnamed protein product [Oryza sativa Japonica Group]
Length=196

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 52/86 (60%), Gaps = 8/86 (9%)
 Frame = +1

Query  28   AKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHALVRSPLAFP  207
             KKRK+EA RL+E DR L+  F  AANSLSQLYT AM  Q++S QAGERHA+ +      
Sbjct  4    GKKRKAEAARLEETDRALYGAFRGAANSLSQLYTLAMGGQKLSFQAGERHAMEK------  57

Query  208  SFFEFTLLISASPPLRLCLERINPQI  285
              +E+ +L      LRL +  I   I
Sbjct  58   -LYEW-ILRQHENGLRLTVADIASHI  81



>ref|XP_010238083.1| PREDICTED: uncharacterized protein LOC104584661 [Brachypodium 
distachyon]
Length=195

 Score = 68.9 bits (167),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +1

Query  28   AKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHALVR  189
             KKRK+EA RL++ DR ++  F  AANSLSQLYT AM  QR+S QAGERHA+ +
Sbjct  3    GKKRKAEAARLEDTDRAMYGAFRGAANSLSQLYTLAMSGQRLSFQAGERHAMEK  56



>gb|KFK23588.1| hypothetical protein AALP_AAs40079U000200 [Arabis alpina]
Length=141

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 49/76 (64%), Gaps = 2/76 (3%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHALVRSPLAF  204
            M KK+K E++ LDEVDRT++  F  AANSL QLYT AM+HQR+S  A ER  + R  L F
Sbjct  1    MVKKQKFESSCLDEVDRTMYDAFRGAANSLFQLYTHAMNHQRVSFLASERPGM-RDKLCF  59

Query  205  PSFFEFT-LLISASPP  249
              F   +   IS SPP
Sbjct  60   LPFRGASAFAISMSPP  75



>dbj|BAJ85416.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=230

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 43/52 (83%), Gaps = 1/52 (2%)
 Frame = +1

Query  31   KKRKSEAT-RLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            +KRK++A  RLDE DRTL+S+FC AANSLS LY+QA+  Q++S QAGER AL
Sbjct  33   RKRKTDAAPRLDEADRTLYSSFCGAANSLSLLYSQAIAQQKLSFQAGERQAL  84



>tpg|DAA39944.1| TPA: hypothetical protein ZEAMMB73_654734 [Zea mays]
Length=95

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 48/86 (56%), Gaps = 8/86 (9%)
 Frame = +1

Query  28   AKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHALVRSPLAFP  207
             KKRK+EA RL+E DR L+  F  AANSLSQLYT  M  Q+ S  AGERHA+        
Sbjct  3    GKKRKAEAARLEETDRALYGAFRGAANSLSQLYTLGMGAQKASFHAGERHAM-------E  55

Query  208  SFFEFTLLISASPPLRLCLERINPQI  285
              +E+ +L      LRL +  +   I
Sbjct  56   KLYEW-ILRQHENGLRLTVADVASHI  80



>ref|XP_002460104.1| hypothetical protein SORBIDRAFT_02g022820 [Sorghum bicolor]
 gb|EER96625.1| hypothetical protein SORBIDRAFT_02g022820 [Sorghum bicolor]
Length=195

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +1

Query  28   AKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHALVR  189
             KKRK+EA RL+E DR L+  F  AANSLSQLYT AM  Q+ S  AGERHA+ +
Sbjct  3    GKKRKAEAARLEETDRALYGAFRGAANSLSQLYTLAMGAQKASFHAGERHAMEK  56



>ref|XP_004956648.1| PREDICTED: uncharacterized protein LOC101777921 [Setaria italica]
Length=195

 Score = 65.9 bits (159),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +1

Query  28   AKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHALVR  189
             KKRK+EA RL+E DR L+  F  AANSLSQLYT AM  Q+ S  AGERHA+ +
Sbjct  3    GKKRKAEAARLEETDRALYGAFRGAANSLSQLYTLAMGAQKGSFHAGERHAMEK  56



>tpg|DAA39946.1| TPA: hypothetical protein ZEAMMB73_654734 [Zea mays]
Length=128

 Score = 64.3 bits (155),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = +1

Query  28   AKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
             KKRK+EA RL+E DR L+  F  AANSLSQLYT  M  Q+ S  AGERHA+
Sbjct  3    GKKRKAEAARLEETDRALYGAFRGAANSLSQLYTLGMGAQKASFHAGERHAM  54



>gb|KFK23589.1| hypothetical protein AALP_AAs40079U000200 [Arabis alpina]
Length=73

 Score = 62.8 bits (151),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGER  174
            M KK+K E++ LDEVDRT++  F  AANSL QLYT AM+HQR+S  A ER
Sbjct  1    MVKKQKFESSCLDEVDRTMYDAFRGAANSLFQLYTHAMNHQRVSFLASER  50



>gb|ACR36431.1| unknown [Zea mays]
 tpg|DAA61150.1| TPA: holocarboxylase synthetase [Zea mays]
Length=195

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = +1

Query  28   AKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
             KKRK+EA RL+E D+ L+  F  AANSLSQLYT AM  Q+ S  AGERHA+
Sbjct  3    GKKRKAEAARLEETDQALYGAFRGAANSLSQLYTLAMGAQKASFNAGERHAM  54



>gb|ACG48000.1| holocarboxylase synthetase [Zea mays]
Length=195

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +1

Query  28   AKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHALVR  189
             KKRK+EA RL+E DR L+  F  AANSLSQLYT  M  Q+ S  AGERHA+ +
Sbjct  3    GKKRKAEAARLEETDRALYGAFRGAANSLSQLYTLGMGAQKASFHAGERHAMEK  56



>ref|NP_001152515.1| holocarboxylase synthetase [Zea mays]
 gb|ACN27860.1| unknown [Zea mays]
 tpg|DAA39945.1| TPA: holocarboxylase synthetase [Zea mays]
Length=195

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +1

Query  28   AKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHALVR  189
             KKRK+EA RL+E DR L+  F  AANSLSQLYT  M  Q+ S  AGERHA+ +
Sbjct  3    GKKRKAEAARLEETDRALYGAFRGAANSLSQLYTLGMGAQKASFHAGERHAMEK  56



>ref|XP_010651390.1| PREDICTED: uncharacterized protein LOC100256958 isoform X2 [Vitis 
vinifera]
Length=98

 Score = 60.8 bits (146),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 53/94 (56%), Gaps = 17/94 (18%)
 Frame = +1

Query  25   MAKKRKSEATRL--DEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHALVR---  189
            MA+KRK E T    DE DR L+S F SAA  LS LY+QA++H +++ +AG+RHAL +   
Sbjct  1    MAQKRKVEVTTDIDDESDRVLYSVFRSAAGGLSHLYSQALNHHKVAFEAGQRHALEKLNE  60

Query  190  ------------SPLAFPSFFEFTLLISASPPLR  255
                        +     ++ + +++I + PP R
Sbjct  61   WMTVKHQEGMLVTTADISAYLQVSVIILSQPPKR  94



>ref|XP_006368533.1| hypothetical protein POPTR_0001s04060g [Populus trichocarpa]
 gb|ERP65102.1| hypothetical protein POPTR_0001s04060g [Populus trichocarpa]
Length=135

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 42/55 (76%), Gaps = 2/55 (4%)
 Frame = +1

Query  25   MAKKRKSE--ATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            MA+KRK E  A  +DE D+ L+S F ++AN LSQLY+QA+ H ++S +AG+RHAL
Sbjct  1    MARKRKVESSAAIVDESDKVLYSAFRNSANELSQLYSQAISHNKLSFEAGQRHAL  55



>ref|XP_011048172.1| PREDICTED: uncharacterized protein LOC105142304 [Populus euphratica]
Length=135

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 42/55 (76%), Gaps = 2/55 (4%)
 Frame = +1

Query  25   MAKKRKSE--ATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            MA+KRK E  A  +DE D+ L+S F ++AN LSQLY+QA+ H ++S +AG+RHAL
Sbjct  1    MARKRKVESSAAIVDESDKVLYSAFRNSANELSQLYSQAISHNKLSFEAGQRHAL  55



>ref|XP_011089711.1| PREDICTED: uncharacterized protein LOC105170585 [Sesamum indicum]
Length=138

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHALVR  189
            MA+KRK E T +DE +R L S F + ANSLSQ YTQ+++ Q+++ +AG+ +AL++
Sbjct  1    MAQKRKMEITVVDENERALFSMFQNTANSLSQFYTQSVNQQKLAFEAGQNYALLK  55



>ref|XP_010651391.1| PREDICTED: uncharacterized protein LOC100256958 isoform X3 [Vitis 
vinifera]
Length=98

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 40/55 (73%), Gaps = 2/55 (4%)
 Frame = +1

Query  25   MAKKRKSEATRL--DEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            MA+KRK E T    DE DR L+S F SAA  LS LY+QA++H +++ +AG+RHAL
Sbjct  1    MAQKRKVEVTTDIDDESDRVLYSVFRSAAGGLSHLYSQALNHHKVAFEAGQRHAL  55



>emb|CAN72568.1| hypothetical protein VITISV_036994 [Vitis vinifera]
Length=135

 Score = 58.9 bits (141),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 40/55 (73%), Gaps = 2/55 (4%)
 Frame = +1

Query  25   MAKKRKSEATRL--DEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            MA+KRK E T    DE DR L+S F SAA  LS LY+QA++H +++ +AG+RHAL
Sbjct  1    MAQKRKVEVTTDIDDESDRVLYSVFRSAAGGLSHLYSQALNHHKVAFEAGQRHAL  55



>ref|XP_010651389.1| PREDICTED: uncharacterized protein LOC100256958 isoform X1 [Vitis 
vinifera]
 emb|CBI16543.3| unnamed protein product [Vitis vinifera]
Length=135

 Score = 58.9 bits (141),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 40/55 (73%), Gaps = 2/55 (4%)
 Frame = +1

Query  25   MAKKRKSEATRL--DEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            MA+KRK E T    DE DR L+S F SAA  LS LY+QA++H +++ +AG+RHAL
Sbjct  1    MAQKRKVEVTTDIDDESDRVLYSVFRSAAGGLSHLYSQALNHHKVAFEAGQRHAL  55



>ref|XP_003574456.1| PREDICTED: uncharacterized protein LOC100833414 [Brachypodium 
distachyon]
Length=199

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 39/54 (72%), Gaps = 2/54 (4%)
 Frame = +1

Query  28   AKKRKSEATRL--DEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
             +KRK+EA R+  DE DR L+S F  AANSLSQ++  A  HQR+S  AGERHA+
Sbjct  3    GRKRKAEAARVLEDEADRPLYSAFRGAANSLSQMHALAGVHQRLSFHAGERHAM  56



>ref|XP_002506431.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO67689.1| predicted protein [Micromonas sp. RCC299]
Length=214

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHALVR  189
            M KKRK+EA  LDE+DR L+ TF +AANS+S LYT ++  Q+ +  AG RHA  R
Sbjct  1    MPKKRKAEANGLDEMDRQLYGTFRTAANSISALYTSSLSLQKRAFNAGARHATER  55



>gb|AFG60950.1| hypothetical protein UMN_1305_01, partial [Pinus taeda]
Length=32

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 24/32 (75%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQ  120
            MAKKRKSE T LDEV++T+++TFC AANSLSQ
Sbjct  1    MAKKRKSENTGLDEVEKTMYTTFCGAANSLSQ  32



>ref|XP_008811245.1| PREDICTED: uncharacterized protein LOC103722457 isoform X1 [Phoenix 
dactylifera]
Length=199

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 32/53 (60%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            M   R SE+  +DEVDR + S +    N LSQLY  +   Q ++ QAGERH+L
Sbjct  1    MDVNRSSESINMDEVDRAMSSAYSMVVNGLSQLYHLSQSQQMLAFQAGERHSL  53



>ref|XP_008811246.1| PREDICTED: uncharacterized protein LOC103722457 isoform X2 [Phoenix 
dactylifera]
Length=196

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 32/53 (60%), Gaps = 0/53 (0%)
 Frame = +1

Query  25   MAKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
            M   R SE+  +DEVDR + S +    N LSQLY  +   Q ++ QAGERH+L
Sbjct  1    MDVNRSSESINMDEVDRAMSSAYSMVVNGLSQLYHLSQSQQMLAFQAGERHSL  53



>gb|EMS50630.1| hypothetical protein TRIUR3_28716 [Triticum urartu]
Length=100

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 34/52 (65%), Gaps = 4/52 (8%)
 Frame = +1

Query  28   AKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHAL  183
             KKR  E    D+ +  +H TF  AAN+LSQLY QA+ +Q+ S  AGERHA+
Sbjct  8    GKKRGPE----DDAEAEVHHTFRGAANALSQLYAQAVANQKASFIAGERHAM  55



>emb|CDM81778.1| unnamed protein product [Triticum aestivum]
Length=230

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 36/55 (65%), Gaps = 4/55 (7%)
 Frame = +1

Query  28   AKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHALVRS  192
             KKR  +    DE +  +H TF  AAN+LSQLY QA+ +Q+ S  AGERHA+ R+
Sbjct  8    GKKRGPD----DEAEAEVHHTFRGAANALSQLYAQAVANQKASFIAGERHAMERA  58



>gb|EMT30986.1| hypothetical protein F775_22381 [Aegilops tauschii]
Length=203

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 36/55 (65%), Gaps = 4/55 (7%)
 Frame = +1

Query  28   AKKRKSEATRLDEVDRTLHSTFCSAANSLSQLYTQAMHHQRISSQAGERHALVRS  192
             KKR  +    DE +  +H TF  AAN+LSQLY QA+ +Q+ S  AGERHA+ R+
Sbjct  8    GKKRGPD----DEAEAEVHHTFRGAANALSQLYAQAVANQKASFIAGERHAMERT  58



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1028498319500