BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF052E10

Length=702
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AFU52654.1|  beta-1,3-glucanase 21                                   292   5e-93   Solanum tuberosum [potatoes]
ref|XP_006354142.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    293   1e-92   Solanum tuberosum [potatoes]
ref|XP_010316236.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      291   4e-92   Solanum lycopersicum
ref|XP_009631831.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      290   2e-91   
ref|XP_009778460.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      288   8e-91   Nicotiana sylvestris
ref|XP_011087559.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    278   8e-88   
ref|XP_011087532.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    278   4e-87   Sesamum indicum [beniseed]
gb|KDP42112.1|  hypothetical protein JCGZ_01900                         278   5e-87   Jatropha curcas
ref|XP_011025159.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    276   2e-86   Populus euphratica
ref|XP_002304004.2|  hypothetical protein POPTR_0003s21250g             273   3e-86   
emb|CAN72077.1|  hypothetical protein VITISV_020314                     275   5e-86   Vitis vinifera
ref|XP_008354983.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    275   6e-86   
ref|XP_010651369.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    275   7e-86   Vitis vinifera
ref|XP_009375652.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    275   1e-85   Pyrus x bretschneideri [bai li]
emb|CDP16794.1|  unnamed protein product                                275   1e-85   Coffea canephora [robusta coffee]
ref|XP_008352033.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    272   6e-85   
ref|XP_008384395.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    272   9e-85   
ref|XP_008229211.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      271   2e-84   Prunus mume [ume]
ref|XP_004294998.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      271   2e-84   Fragaria vesca subsp. vesca
ref|XP_007205107.1|  hypothetical protein PRUPE_ppa004732mg             271   3e-84   Prunus persica
ref|XP_009364124.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    271   3e-84   Pyrus x bretschneideri [bai li]
ref|XP_011048218.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    268   3e-83   Populus euphratica
ref|XP_004504325.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    267   9e-83   Cicer arietinum [garbanzo]
ref|XP_002297638.2|  hypothetical protein POPTR_0001s04360g             266   2e-82   
ref|XP_007161273.1|  hypothetical protein PHAVU_001G056400g             265   9e-82   Phaseolus vulgaris [French bean]
ref|XP_010276339.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    263   9e-82   Nelumbo nucifera [Indian lotus]
ref|XP_006601114.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    264   1e-81   Glycine max [soybeans]
gb|KHN12071.1|  Glucan endo-1,3-beta-glucosidase 4                      264   1e-81   Glycine soja [wild soybean]
gb|KJB23365.1|  hypothetical protein B456_004G094500                    264   1e-81   Gossypium raimondii
gb|KHG18393.1|  hypothetical protein F383_22096                         263   2e-81   Gossypium arboreum [tree cotton]
ref|XP_010276332.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    263   2e-81   Nelumbo nucifera [Indian lotus]
ref|XP_007159412.1|  hypothetical protein PHAVU_002G236300g             263   4e-81   Phaseolus vulgaris [French bean]
ref|XP_006596127.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    261   1e-80   Glycine max [soybeans]
ref|XP_006495278.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    257   2e-80   
ref|XP_003531243.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    261   2e-80   Glycine max [soybeans]
ref|XP_003524953.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    259   6e-80   Glycine max [soybeans]
ref|XP_010044948.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      259   1e-79   Eucalyptus grandis [rose gum]
ref|XP_006445640.1|  hypothetical protein CICLE_v10015028mg             258   2e-79   
ref|XP_007014685.1|  O-Glycosyl hydrolases family 17 protein isof...    258   2e-79   
ref|XP_010257592.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    259   2e-79   Nelumbo nucifera [Indian lotus]
ref|XP_006488904.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    257   4e-79   Citrus sinensis [apfelsine]
ref|XP_003629715.1|  Glucan endo-1,3-beta-glucosidase                   257   5e-79   Medicago truncatula
ref|XP_010097806.1|  Glucan endo-1,3-beta-glucosidase 4                 256   1e-78   Morus notabilis
gb|KJB66066.1|  hypothetical protein B456_010G126400                    255   2e-78   Gossypium raimondii
ref|XP_011093510.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    256   2e-78   Sesamum indicum [beniseed]
gb|AFK37243.1|  unknown                                                 255   3e-78   Medicago truncatula
ref|XP_010673492.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      255   4e-78   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008354986.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    251   9e-77   
ref|XP_004502208.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    250   2e-76   
ref|XP_004502207.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    250   3e-76   Cicer arietinum [garbanzo]
ref|XP_003601614.1|  Glucan endo-1,3-beta-glucosidase                   248   2e-75   Medicago truncatula
ref|XP_010673491.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    247   4e-75   Beta vulgaris subsp. vulgaris [field beet]
gb|KHG04722.1|  hypothetical protein F383_29074                         246   8e-75   Gossypium arboreum [tree cotton]
ref|XP_004139073.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    243   1e-73   Cucumis sativus [cucumbers]
ref|XP_008450301.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    243   2e-73   Cucumis melo [Oriental melon]
gb|EYU27069.1|  hypothetical protein MIMGU_mgv1a004989mg                243   2e-73   Erythranthe guttata [common monkey flower]
gb|EPS57592.1|  hypothetical protein M569_17225                         234   5e-73   Genlisea aurea
ref|XP_002884972.1|  glycosyl hydrolase family 17 protein               241   8e-73   
ref|XP_010542461.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    241   1e-72   Tarenaya hassleriana [spider flower]
dbj|BAH57260.1|  AT3G13560                                              238   6e-72   Arabidopsis thaliana [mouse-ear cress]
gb|KGN54064.1|  hypothetical protein Csa_4G280410                       239   1e-71   Cucumis sativus [cucumbers]
gb|KJB66065.1|  hypothetical protein B456_010G126400                    237   2e-71   Gossypium raimondii
ref|XP_004142250.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    239   2e-71   
ref|NP_187965.1|  glucan endo-1,3-beta-glucosidase 4                    238   2e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009413316.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    237   3e-71   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008449817.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    237   6e-71   Cucumis melo [Oriental melon]
ref|XP_004162024.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    239   9e-71   
ref|XP_009146477.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      235   2e-70   Brassica rapa
ref|XP_009406533.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    235   2e-70   
ref|XP_008449819.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    235   2e-70   Cucumis melo [Oriental melon]
ref|XP_010552278.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    235   2e-70   Tarenaya hassleriana [spider flower]
ref|XP_009406534.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    234   3e-70   
ref|XP_008449814.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    235   3e-70   Cucumis melo [Oriental melon]
ref|NP_001060087.2|  Os07g0577300                                       234   3e-70   
ref|XP_006407197.1|  hypothetical protein EUTSA_v10020572mg             234   4e-70   Eutrema salsugineum [saltwater cress]
ref|XP_009406531.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    235   4e-70   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEC82319.1|  hypothetical protein OsI_26597                          234   5e-70   Oryza sativa Indica Group [Indian rice]
ref|XP_010500722.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      234   8e-70   Camelina sativa [gold-of-pleasure]
ref|XP_006658732.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    232   8e-70   
ref|XP_010465199.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      233   1e-69   Camelina sativa [gold-of-pleasure]
gb|EEE67465.1|  hypothetical protein OsJ_24859                          234   2e-69   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008789151.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    231   3e-69   
ref|XP_008789143.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    231   5e-69   Phoenix dactylifera
ref|XP_006297495.1|  hypothetical protein CARUB_v10013514mg             231   9e-69   Capsella rubella
dbj|BAC83070.1|  putative elicitor inducible beta-1,3-glucanase         234   2e-68   Oryza sativa Japonica Group [Japonica rice]
gb|EMT26371.1|  Glucan endo-1,3-beta-glucosidase 4                      226   4e-68   
ref|XP_010934539.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      228   6e-68   Elaeis guineensis
tpg|DAA63295.1|  TPA: putative O-Glycosyl hydrolase superfamily p...    226   3e-67   
ref|XP_009762818.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    227   4e-67   Nicotiana sylvestris
ref|XP_010236492.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      226   6e-67   Brachypodium distachyon [annual false brome]
ref|XP_004958122.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    229   8e-67   
ref|XP_002460914.1|  hypothetical protein SORBIDRAFT_02g037380          225   9e-67   Sorghum bicolor [broomcorn]
ref|XP_010527795.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      225   1e-66   Tarenaya hassleriana [spider flower]
ref|NP_001131285.1|  putative O-Glycosyl hydrolase superfamily pr...    224   2e-66   Zea mays [maize]
ref|NP_001149308.1|  glucan endo-1,3-beta-glucosidase 4 precursor       224   3e-66   Zea mays [maize]
gb|EMS60322.1|  Glucan endo-1,3-beta-glucosidase 4                      226   6e-66   Triticum urartu
gb|EMS53703.1|  Glucan endo-1,3-beta-glucosidase 4                      223   8e-66   Triticum urartu
ref|XP_009602434.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    223   1e-65   Nicotiana tomentosiformis
ref|XP_004236940.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      223   1e-65   Solanum lycopersicum
ref|XP_006599426.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    221   1e-65   Glycine max [soybeans]
ref|XP_006828511.1|  hypothetical protein AMTR_s00060p00188740          223   2e-65   
ref|XP_009388452.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    222   2e-65   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003548935.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    222   2e-65   Glycine max [soybeans]
emb|CDY23618.1|  BnaC05g39760D                                          219   3e-65   Brassica napus [oilseed rape]
gb|KEH40580.1|  glucan endo-1,3-beta-glucosidase-like protein           221   6e-65   Medicago truncatula
gb|KEH40581.1|  glucan endo-1,3-beta-glucosidase-like protein           221   6e-65   Medicago truncatula
ref|XP_010653417.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    220   7e-65   Vitis vinifera
dbj|BAJ89950.1|  predicted protein                                      220   8e-65   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFU52641.1|  beta-1,3-glucanase 6                                    220   8e-65   Solanum tuberosum [potatoes]
dbj|BAB01763.1|  beta-1,3-glucanase-like protein                        219   9e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010653375.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    221   9e-65   Vitis vinifera
emb|CBI26850.3|  unnamed protein product                                220   1e-64   Vitis vinifera
ref|XP_006355069.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    220   1e-64   Solanum tuberosum [potatoes]
emb|CDP00829.1|  unnamed protein product                                219   3e-64   Coffea canephora [robusta coffee]
ref|XP_010271297.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 2      218   4e-64   Nelumbo nucifera [Indian lotus]
ref|XP_006378439.1|  hypothetical protein POPTR_0010s11880g             216   4e-64   
ref|XP_006448191.1|  hypothetical protein CICLE_v10014990mg             218   4e-64   Citrus clementina [clementine]
ref|XP_004297451.2|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      219   5e-64   Fragaria vesca subsp. vesca
ref|XP_011021800.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    218   6e-64   Populus euphratica
ref|XP_011021799.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    218   6e-64   Populus euphratica
ref|XP_006378440.1|  hypothetical protein POPTR_0010s11880g             217   1e-63   
ref|XP_002314794.2|  hypothetical protein POPTR_0010s11880g             217   1e-63   Populus trichocarpa [western balsam poplar]
ref|XP_010528550.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 2      217   2e-63   Tarenaya hassleriana [spider flower]
ref|XP_007045239.1|  O-Glycosyl hydrolases family 17 protein            217   2e-63   
ref|XP_004159096.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    211   3e-63   
ref|XP_010651370.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    214   3e-63   
gb|KDO64566.1|  hypothetical protein CISIN_1g0108331mg                  215   4e-63   Citrus sinensis [apfelsine]
gb|KJB30775.1|  hypothetical protein B456_005G159100                    215   4e-63   Gossypium raimondii
gb|KJB15377.1|  hypothetical protein B456_002G174100                    214   5e-63   Gossypium raimondii
ref|XP_011070588.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      216   5e-63   Sesamum indicum [beniseed]
gb|KHN00662.1|  Glucan endo-1,3-beta-glucosidase 3                      215   6e-63   Glycine soja [wild soybean]
ref|XP_003518194.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    215   6e-63   
gb|EMT28432.1|  Glucan endo-1,3-beta-glucosidase 4                      219   7e-63   
ref|XP_004498268.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    215   8e-63   Cicer arietinum [garbanzo]
gb|KJB30776.1|  hypothetical protein B456_005G159100                    215   9e-63   Gossypium raimondii
gb|KHG06295.1|  hypothetical protein F383_32557                         215   9e-63   Gossypium arboreum [tree cotton]
ref|XP_009351539.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      215   1e-62   Pyrus x bretschneideri [bai li]
gb|KHG27056.1|  hypothetical protein F383_08405                         214   2e-62   Gossypium arboreum [tree cotton]
ref|XP_007151812.1|  hypothetical protein PHAVU_004G077000g             214   2e-62   Phaseolus vulgaris [French bean]
gb|KJB15376.1|  hypothetical protein B456_002G174100                    214   2e-62   Gossypium raimondii
ref|XP_008366987.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    213   3e-62   
ref|XP_010267790.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    213   4e-62   Nelumbo nucifera [Indian lotus]
ref|XP_004140301.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    213   4e-62   Cucumis sativus [cucumbers]
ref|XP_008460531.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    213   5e-62   Cucumis melo [Oriental melon]
ref|XP_007160410.1|  hypothetical protein PHAVU_002G319500g             209   5e-62   Phaseolus vulgaris [French bean]
gb|KFK41053.1|  hypothetical protein AALP_AA2G079300                    213   5e-62   Arabis alpina [alpine rockcress]
ref|XP_008221445.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      213   7e-62   Prunus mume [ume]
gb|EYU41109.1|  hypothetical protein MIMGU_mgv1a005128mg                213   7e-62   Erythranthe guttata [common monkey flower]
gb|KHG27055.1|  hypothetical protein F383_08405                         214   8e-62   Gossypium arboreum [tree cotton]
ref|XP_007141916.1|  hypothetical protein PHAVU_008G236700g             212   1e-61   Phaseolus vulgaris [French bean]
ref|XP_009388453.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    211   1e-61   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008775310.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    211   1e-61   
ref|XP_006575486.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    212   1e-61   Glycine max [soybeans]
ref|XP_002527772.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    213   1e-61   
ref|XP_004288596.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 2      212   2e-61   Fragaria vesca subsp. vesca
ref|XP_006372566.1|  glycosyl hydrolase family 17 family protein        211   2e-61   
ref|XP_008775304.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    211   3e-61   Phoenix dactylifera
ref|XP_002531922.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    211   3e-61   Ricinus communis
ref|XP_010926119.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    211   3e-61   Elaeis guineensis
ref|XP_010066584.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    211   3e-61   Eucalyptus grandis [rose gum]
ref|XP_003519328.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    211   3e-61   Glycine max [soybeans]
ref|XP_006596503.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    209   4e-61   
ref|XP_010553889.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    211   4e-61   Tarenaya hassleriana [spider flower]
gb|KDP38099.1|  hypothetical protein JCGZ_04742                         211   4e-61   Jatropha curcas
ref|XP_004503127.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    210   9e-61   Cicer arietinum [garbanzo]
ref|XP_003544983.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    209   1e-60   Glycine max [soybeans]
ref|XP_002532062.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    208   1e-60   
ref|XP_011001568.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 2      209   1e-60   Populus euphratica
ref|XP_002887020.1|  glycosyl hydrolase family 17 protein               209   1e-60   Arabidopsis lyrata subsp. lyrata
gb|EPS61988.1|  hypothetical protein M569_12804                         207   1e-60   Genlisea aurea
ref|XP_004142367.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    209   1e-60   Cucumis sativus [cucumbers]
ref|XP_007160409.1|  hypothetical protein PHAVU_002G319500g             209   2e-60   Phaseolus vulgaris [French bean]
ref|XP_002265396.3|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    209   2e-60   Vitis vinifera
gb|KDP25782.1|  hypothetical protein JCGZ_22504                         209   2e-60   Jatropha curcas
ref|XP_002305879.1|  glycosyl hydrolase family 17 family protein        208   3e-60   
ref|XP_006391369.1|  hypothetical protein EUTSA_v10018427mg             209   3e-60   Eutrema salsugineum [saltwater cress]
ref|XP_006364623.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    208   3e-60   Solanum tuberosum [potatoes]
ref|NP_001275288.1|  glucan endo-1,3-beta-glucosidase 2-like prec...    208   3e-60   Solanum tuberosum [potatoes]
ref|XP_006858991.1|  hypothetical protein AMTR_s00068p00134210          208   3e-60   Amborella trichopoda
ref|XP_010681923.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    208   3e-60   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011097437.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    208   5e-60   Sesamum indicum [beniseed]
ref|XP_007215258.1|  hypothetical protein PRUPE_ppa004534mg             208   5e-60   Prunus persica
ref|XP_008452393.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    207   5e-60   Cucumis melo [Oriental melon]
ref|XP_008361481.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    207   6e-60   
ref|XP_007163382.1|  hypothetical protein PHAVU_001G230000g             207   9e-60   Phaseolus vulgaris [French bean]
emb|CDY58676.1|  BnaCnng33550D                                          207   9e-60   Brassica napus [oilseed rape]
ref|XP_010415170.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    207   1e-59   Camelina sativa [gold-of-pleasure]
ref|XP_010511554.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    207   1e-59   Camelina sativa [gold-of-pleasure]
ref|XP_004244387.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    207   1e-59   Solanum lycopersicum
ref|XP_010324460.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    207   1e-59   Solanum lycopersicum
ref|XP_007032976.1|  Glucan endo-1,3-beta-glucosidase, putative i...    206   1e-59   
ref|XP_009382992.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    208   1e-59   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010470501.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    207   1e-59   Camelina sativa [gold-of-pleasure]
ref|XP_010470500.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    207   2e-59   Camelina sativa [gold-of-pleasure]
gb|AES70967.2|  glucan endo-1,3-beta-glucosidase-like protein           206   2e-59   Medicago truncatula
ref|XP_004490818.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    205   2e-59   
gb|EYU45799.1|  hypothetical protein MIMGU_mgv1a004953mg                206   2e-59   Erythranthe guttata [common monkey flower]
ref|XP_003600716.1|  Glucan endo-1,3-beta-glucosidase                   206   2e-59   
ref|XP_010108988.1|  Glucan endo-1,3-beta-glucosidase 2                 206   2e-59   Morus notabilis
ref|XP_007032975.1|  Glucan endo-1,3-beta-glucosidase, putative i...    206   2e-59   
ref|XP_009127476.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    206   2e-59   Brassica rapa
emb|CDY16440.1|  BnaA02g12440D                                          206   2e-59   Brassica napus [oilseed rape]
ref|XP_006430586.1|  hypothetical protein CICLE_v10011549mg             206   3e-59   Citrus clementina [clementine]
ref|XP_006482110.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    206   3e-59   Citrus sinensis [apfelsine]
ref|XP_004490817.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    206   4e-59   Cicer arietinum [garbanzo]
ref|XP_009129217.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      205   7e-59   Brassica rapa
ref|XP_006395868.1|  hypothetical protein EUTSA_v10004013mg             202   1e-58   
ref|XP_010670126.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    204   1e-58   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB10513.1|  hypothetical protein B456_001G204900                    205   1e-58   Gossypium raimondii
gb|KCW69377.1|  hypothetical protein EUGRSUZ_F02860                     203   2e-58   Eucalyptus grandis [rose gum]
emb|CDY48807.1|  BnaC02g34070D                                          204   2e-58   Brassica napus [oilseed rape]
ref|XP_011021801.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    203   2e-58   Populus euphratica
gb|KHG17836.1|  hypothetical protein F383_07126                         204   2e-58   Gossypium arboreum [tree cotton]
ref|XP_008802448.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    204   2e-58   Phoenix dactylifera
gb|KJB10512.1|  hypothetical protein B456_001G204900                    205   3e-58   Gossypium raimondii
ref|XP_010062264.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 2      203   3e-58   Eucalyptus grandis [rose gum]
ref|XP_011007238.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    203   4e-58   Populus euphratica
gb|EPS65983.1|  hypothetical protein M569_08793                         202   5e-58   Genlisea aurea
ref|XP_006395869.1|  hypothetical protein EUTSA_v10004013mg             202   5e-58   
ref|XP_011023920.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    202   5e-58   Populus euphratica
ref|XP_011023912.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    202   6e-58   Populus euphratica
ref|XP_006395867.1|  hypothetical protein EUTSA_v10004013mg             202   9e-58   Eutrema salsugineum [saltwater cress]
emb|CAN82488.1|  hypothetical protein VITISV_006804                     201   2e-57   Vitis vinifera
gb|KHN32747.1|  Glucan endo-1,3-beta-glucosidase 3                      200   2e-57   Glycine soja [wild soybean]
ref|XP_006293165.1|  hypothetical protein CARUB_v10019481mg             201   2e-57   Capsella rubella
ref|XP_009390355.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    201   2e-57   
ref|XP_002876767.1|  hypothetical protein ARALYDRAFT_484077             201   3e-57   
ref|NP_001077866.1|  glucan endo-1,3-beta-glucosidase 3                 198   3e-57   Arabidopsis thaliana [mouse-ear cress]
gb|KHN17951.1|  Glucan endo-1,3-beta-glucosidase 2                      200   3e-57   Glycine soja [wild soybean]
ref|XP_006300850.1|  hypothetical protein CARUB_v10019942mg             202   4e-57   
ref|XP_003538392.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    200   4e-57   Glycine max [soybeans]
ref|XP_010100650.1|  Glucan endo-1,3-beta-glucosidase 3                 199   4e-57   
ref|NP_176799.2|  glucan endo-1,3-beta-glucosidase 2                    200   5e-57   Arabidopsis thaliana [mouse-ear cress]
gb|ABI93926.1|  At1g66250                                               200   5e-57   Arabidopsis thaliana [mouse-ear cress]
emb|CDY59252.1|  BnaA05g36990D                                          197   6e-57   Brassica napus [oilseed rape]
ref|XP_008777063.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    199   7e-57   Phoenix dactylifera
ref|XP_008777061.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    199   8e-57   Phoenix dactylifera
ref|XP_008777062.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    199   8e-57   Phoenix dactylifera
emb|CBI16509.3|  unnamed protein product                                200   9e-57   Vitis vinifera
gb|EMS47617.1|  Glucan endo-1,3-beta-glucosidase 3                      199   1e-56   Triticum urartu
ref|XP_006602009.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    197   2e-56   Glycine max [soybeans]
ref|XP_008460530.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    197   3e-56   
gb|EMT05308.1|  Glucan endo-1,3-beta-glucosidase 3                      197   3e-56   
ref|XP_010513892.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    197   4e-56   Camelina sativa [gold-of-pleasure]
emb|CDP01635.1|  unnamed protein product                                197   4e-56   Coffea canephora [robusta coffee]
ref|NP_565269.1|  glucan endo-1,3-beta-glucosidase 3                    197   4e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010424935.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      197   5e-56   Camelina sativa [gold-of-pleasure]
ref|XP_010502143.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    197   5e-56   Camelina sativa [gold-of-pleasure]
gb|AIR93909.1|  glucanase                                               196   6e-56   Cicer arietinum [garbanzo]
ref|XP_006599427.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    195   7e-56   Glycine max [soybeans]
ref|XP_007225735.1|  hypothetical protein PRUPE_ppa005356mg             196   7e-56   
ref|XP_003552878.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    197   8e-56   Glycine max [soybeans]
gb|KJB15378.1|  hypothetical protein B456_002G174100                    196   1e-55   Gossypium raimondii
gb|ACN30650.1|  unknown                                                 196   1e-55   Zea mays [maize]
ref|NP_001150141.1|  glucan endo-1,3-beta-glucosidase 3 precursor       196   1e-55   
ref|XP_010916186.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    196   1e-55   
ref|XP_003616282.1|  Glucan endo-1,3-beta-glucosidase                   199   1e-55   
ref|XP_002468258.1|  hypothetical protein SORBIDRAFT_01g042560          196   1e-55   Sorghum bicolor [broomcorn]
ref|XP_004503372.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    196   1e-55   Cicer arietinum [garbanzo]
ref|XP_003558472.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      196   1e-55   Brachypodium distachyon [annual false brome]
ref|XP_009792881.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    196   2e-55   Nicotiana sylvestris
gb|AAK85402.2|  beta-1,3-glucanase                                      195   3e-55   Camellia sinensis [black tea]
ref|NP_001130376.1|  putative O-Glycosyl hydrolase superfamily pr...    195   4e-55   Zea mays [maize]
gb|KHN07542.1|  Glucan endo-1,3-beta-glucosidase 2                      194   4e-55   Glycine soja [wild soybean]
gb|EPS74061.1|  hypothetical protein M569_00697                         193   4e-55   Genlisea aurea
ref|NP_001049413.1|  Os03g0221500                                       194   9e-55   
ref|XP_006580439.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    193   1e-54   Glycine max [soybeans]
ref|XP_009589694.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    193   1e-54   Nicotiana tomentosiformis
ref|XP_010686818.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 1      193   2e-54   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB22745.1|  hypothetical protein B456_004G064200                    192   4e-54   Gossypium raimondii
ref|XP_010324461.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    191   5e-54   
ref|XP_009593892.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 1      192   6e-54   Nicotiana tomentosiformis
ref|XP_009772723.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 1      192   7e-54   Nicotiana sylvestris
ref|XP_008452394.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    191   8e-54   Cucumis melo [Oriental melon]
ref|XP_006649652.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    192   9e-54   Oryza brachyantha
ref|XP_011096055.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 1      191   1e-53   Sesamum indicum [beniseed]
ref|NP_172647.2|  O-glycosyl hydrolases family 17 protein               188   2e-53   Arabidopsis thaliana [mouse-ear cress]
gb|KHG14816.1|  hypothetical protein F383_17797                         190   2e-53   Gossypium arboreum [tree cotton]
ref|XP_006855931.1|  hypothetical protein AMTR_s00037p00209440          189   3e-53   
ref|XP_009127478.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    189   3e-53   
ref|XP_002312452.2|  glucan endo-1 family protein                       187   1e-52   
gb|KDO78272.1|  hypothetical protein CISIN_1g010394mg                   188   2e-52   
gb|AAC17632.1|  Similar to glucan endo-1,3-beta-D-glucosidase pre...    187   2e-52   
ref|XP_011008030.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    188   2e-52   
ref|XP_008384081.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    189   2e-52   
ref|XP_008224690.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 1      189   2e-52   
ref|XP_009359235.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    188   2e-52   
ref|XP_007211541.1|  hypothetical protein PRUPE_ppa003984mg             188   2e-52   
ref|XP_006348130.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    188   2e-52   
ref|NP_001184967.1|  O-glycosyl hydrolases family 17 protein            187   3e-52   
ref|XP_004232702.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 1      188   3e-52   
ref|XP_007026106.1|  O-Glycosyl hydrolases family 17 protein            187   3e-52   
ref|XP_002892658.1|  predicted protein                                  187   3e-52   
ref|XP_009357466.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    187   5e-52   
ref|XP_008365635.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    187   8e-52   
ref|XP_010476119.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    186   9e-52   
gb|KDP20735.1|  hypothetical protein JCGZ_21206                         186   1e-51   
ref|XP_010476120.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    186   1e-51   
ref|XP_010493346.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 1      186   1e-51   
ref|XP_003610449.1|  Glucan endo-1,3-beta-glucosidase                   186   1e-51   
gb|EYU27773.1|  hypothetical protein MIMGU_mgv1a006342mg                184   1e-51   
ref|XP_006389594.1|  hypothetical protein POPTR_0021s00450g             186   1e-51   
ref|XP_006584084.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    186   2e-51   
ref|XP_003529639.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    186   2e-51   
gb|KHN35732.1|  Glucan endo-1,3-beta-glucosidase 1                      186   2e-51   
gb|KFK43454.1|  hypothetical protein AALP_AA1G127200                    185   2e-51   
ref|XP_010052862.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    184   3e-51   
ref|XP_010458588.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    185   3e-51   
gb|AAG51762.1|AC066691_2  beta-1,3-glucanase precursor, putative;...    183   3e-51   
ref|XP_010458589.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    185   3e-51   
ref|XP_010458590.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    185   3e-51   
ref|XP_006467418.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    184   3e-51   
gb|KJB57758.1|  hypothetical protein B456_009G179400                    184   4e-51   
gb|KHG03844.1|  hypothetical protein F383_07460                         184   4e-51   
ref|XP_010916187.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    183   4e-51   
gb|KJB57757.1|  hypothetical protein B456_009G179400                    184   5e-51   
gb|ACF80565.1|  unknown                                                 183   6e-51   
gb|KJB57756.1|  hypothetical protein B456_009G179400                    184   7e-51   
ref|XP_010052861.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    184   8e-51   
emb|CDP04414.1|  unnamed protein product                                188   1e-50   
ref|XP_006417308.1|  hypothetical protein EUTSA_v10006713mg             186   2e-50   
ref|XP_009110702.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 1      182   2e-50   
ref|XP_010546762.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 1      182   2e-50   
gb|KEH28239.1|  glucan endo-1,3-beta-glucosidase-like protein           184   3e-50   
ref|XP_010278647.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    182   5e-50   
ref|XP_010278646.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    182   5e-50   
ref|XP_006600304.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    181   5e-50   
ref|XP_003632942.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 1      182   6e-50   
ref|XP_010244498.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    181   7e-50   
ref|XP_010244497.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    181   7e-50   
ref|XP_009792882.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    180   8e-50   
ref|XP_003549783.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    181   9e-50   
ref|XP_006584862.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    180   1e-49   
ref|XP_003532507.2|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    180   1e-49   
ref|XP_002518468.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    181   1e-49   
ref|XP_010094029.1|  Glucan endo-1,3-beta-glucosidase 1                 180   2e-49   
ref|XP_004295275.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    180   2e-49   
ref|XP_011459999.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    180   2e-49   
emb|CDY31214.1|  BnaC08g15090D                                          179   4e-49   
ref|XP_006306488.1|  hypothetical protein CARUB_v10012467mg             182   5e-49   
ref|XP_002973118.1|  hypothetical protein SELMODRAFT_442025             178   6e-49   
ref|XP_007153962.1|  hypothetical protein PHAVU_003G079900g             179   7e-49   
ref|XP_010553447.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    179   7e-49   
emb|CBI23232.3|  unnamed protein product                                182   7e-49   
gb|KHN21581.1|  Glucan endo-1,3-beta-glucosidase 3                      176   8e-49   
ref|XP_010057914.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    179   9e-49   
ref|XP_002967282.1|  hypothetical protein SELMODRAFT_87871              177   1e-48   
ref|XP_010553445.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    179   1e-48   
ref|XP_011046950.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 1      178   1e-48   
ref|XP_002976593.1|  hypothetical protein SELMODRAFT_443280             176   2e-48   
ref|XP_002960438.1|  hypothetical protein SELMODRAFT_75479              176   3e-48   
gb|ACF87545.1|  unknown                                                 174   5e-48   
ref|XP_004507681.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    176   1e-47   
ref|XP_004158003.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    174   5e-47   
ref|XP_004145115.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    173   6e-47   
ref|XP_008440948.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 1      172   1e-46   
ref|XP_004486169.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    169   2e-45   
gb|AIR93901.1|  glucanase                                               169   2e-45   
ref|XP_010681924.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    165   3e-44   
gb|KHN16561.1|  Glucan endo-1,3-beta-glucosidase 3                      164   3e-44   
ref|XP_002962275.1|  hypothetical protein SELMODRAFT_76256              163   6e-44   
ref|XP_006584863.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    163   1e-43   
ref|XP_002965189.1|  hypothetical protein SELMODRAFT_82513              161   3e-43   
ref|XP_002974888.1|  hypothetical protein SELMODRAFT_102117             159   6e-42   
ref|XP_002963799.1|  hypothetical protein SELMODRAFT_79527              158   1e-41   
ref|XP_010553446.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    158   3e-41   
ref|XP_006383906.1|  hypothetical protein POPTR_0004s01110g             156   5e-41   
ref|XP_010059559.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    154   4e-40   
ref|XP_007147720.1|  hypothetical protein PHAVU_006G149100g             150   1e-38   
ref|XP_007147719.1|  hypothetical protein PHAVU_006G149100g             150   2e-38   
ref|XP_002962313.1|  hypothetical protein SELMODRAFT_438073             149   2e-38   
ref|XP_002965231.1|  hypothetical protein SELMODRAFT_439107             149   6e-38   
ref|XP_010923877.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    148   7e-38   
ref|XP_010923875.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    147   1e-37   
gb|KJB10701.1|  hypothetical protein B456_001G216900                    146   3e-37   
gb|KJB10702.1|  hypothetical protein B456_001G216900                    145   5e-37   
gb|KHG05496.1|  hypothetical protein F383_30989                         145   7e-37   
ref|XP_007049174.1|  O-Glycosyl hydrolases family 17 protein isof...    145   9e-37   
ref|XP_007049173.1|  O-Glycosyl hydrolases family 17 protein isof...    145   1e-36   
ref|XP_006599425.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    144   2e-36   
ref|XP_009414127.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    144   2e-36   
ref|XP_010448205.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    144   2e-36   
ref|XP_002274828.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     143   5e-36   
ref|XP_006283767.1|  hypothetical protein CARUB_v10004853mg             142   7e-36   
dbj|BAF01341.1|  putative beta-1,3-glucanase                            139   8e-36   
gb|KDO36784.1|  hypothetical protein CISIN_1g009301mg                   142   8e-36   
dbj|BAD93486.1|  pollen allergen CJP38                                  140   9e-36   
ref|XP_007141644.1|  hypothetical protein PHAVU_008G213400g             142   9e-36   
ref|XP_009397776.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    142   1e-35   
ref|XP_006447645.1|  hypothetical protein CICLE_v10015086mg             142   1e-35   
ref|XP_006469612.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    142   1e-35   
gb|AAD10386.1|  beta-1,3-glucanase precursor                            140   1e-35   
ref|XP_001766544.1|  predicted protein                                  141   2e-35   
ref|XP_008245888.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    141   2e-35   
ref|XP_007209174.1|  hypothetical protein PRUPE_ppa006239mg             140   2e-35   
ref|XP_007209175.1|  hypothetical protein PRUPE_ppa006239mg             140   2e-35   
ref|XP_010467085.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    141   2e-35   
ref|XP_010488778.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    141   2e-35   
ref|XP_001767901.1|  predicted protein                                  141   2e-35   
gb|KCW75916.1|  hypothetical protein EUGRSUZ_D00293                     139   2e-35   
ref|XP_010236896.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    141   2e-35   
ref|XP_009344064.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    140   2e-35   
ref|XP_009344063.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    140   3e-35   
ref|XP_008449478.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     140   3e-35   
ref|XP_010052055.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 11     140   3e-35   
ref|NP_001048260.1|  Os02g0771700                                       140   4e-35   
gb|ACN39797.1|  unknown                                                 140   5e-35   
ref|XP_010433433.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    140   5e-35   
ref|XP_010252551.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    140   6e-35   
ref|XP_006853717.1|  hypothetical protein AMTR_s00056p00158530          140   6e-35   
ref|XP_010438690.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    139   7e-35   
gb|KDP30806.1|  hypothetical protein JCGZ_13749                         139   7e-35   
ref|XP_001772420.1|  predicted protein                                  140   8e-35   
ref|XP_001751439.1|  predicted protein                                  139   8e-35   
gb|KHN44765.1|  Glucan endo-1,3-beta-glucosidase 11                     138   9e-35   
ref|XP_010412737.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    139   9e-35   
ref|XP_006396136.1|  hypothetical protein EUTSA_v10002515mg             139   1e-34   
ref|XP_004140120.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    139   1e-34   
ref|XP_004140121.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    139   1e-34   
ref|XP_006837267.1|  hypothetical protein AMTR_s00112p00108890          139   1e-34   
ref|XP_006647977.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    139   1e-34   
ref|XP_006575581.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    139   2e-34   
ref|XP_006595830.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    139   2e-34   
ref|XP_008230022.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 11     137   2e-34   
emb|CDY18049.1|  BnaC07g04210D                                          138   2e-34   
ref|XP_009102359.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     138   2e-34   
ref|XP_008352157.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    137   2e-34   
gb|AAD26909.1|  putative beta-1,3-glucanase                             138   2e-34   
ref|NP_178637.2|  O-glycosyl hydrolases family 17 protein               138   3e-34   
emb|CDY56498.1|  BnaAnng14330D                                          137   3e-34   
ref|XP_002961242.1|  hypothetical protein SELMODRAFT_402967             138   3e-34   
ref|XP_010094541.1|  Glucan endo-1,3-beta-glucosidase 12                138   3e-34   
ref|XP_008374135.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    137   3e-34   
ref|XP_004965529.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    137   3e-34   
ref|XP_002969476.1|  hypothetical protein SELMODRAFT_231287             137   4e-34   
ref|XP_001780506.1|  predicted protein                                  136   4e-34   
gb|AFS50099.1|  glucan endo-1,3-beta-glucosidase                        137   4e-34   
ref|XP_007039343.1|  Glucan endo-1,3-beta-glucosidase 11 isoform 1      137   4e-34   
ref|XP_007039348.1|  Glucan endo-1,3-beta-glucosidase 11 isoform 6      136   5e-34   
gb|ABR16583.1|  unknown                                                 136   5e-34   
ref|XP_002883709.1|  hypothetical protein ARALYDRAFT_480193             137   5e-34   
ref|XP_007039344.1|  Glucan endo-1,3-beta-glucosidase 11 isoform 2      136   5e-34   
ref|XP_007039345.1|  Glucan endo-1,3-beta-glucosidase 11 isoform 3      136   5e-34   
ref|XP_007039346.1|  Glucan endo-1,3-beta-glucosidase 11 isoform 4      136   5e-34   
ref|XP_009360206.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    137   5e-34   
ref|XP_002525335.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    137   6e-34   
ref|XP_002964439.1|  hypothetical protein SELMODRAFT_230318             135   7e-34   
dbj|BAD54223.1|  putative beta-1,3-glucanase precursor                  135   9e-34   
ref|XP_007215327.1|  hypothetical protein PRUPE_ppa005206mg             136   9e-34   
ref|XP_001771454.1|  predicted protein                                  136   1e-33   
dbj|BAJ87688.1|  predicted protein                                      136   1e-33   
ref|XP_009622831.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 11     135   1e-33   
ref|XP_010541008.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     136   1e-33   
ref|XP_002300634.2|  hypothetical protein POPTR_0002s00860g             136   1e-33   
ref|XP_009778930.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 11     135   2e-33   
gb|AFU52665.1|  putative PD beta-1,3-glucanase 1                        135   2e-33   
ref|XP_004294409.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    135   2e-33   
ref|XP_011034841.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    135   2e-33   
ref|XP_010110627.1|  Glucan endo-1,3-beta-glucosidase 13                135   2e-33   
ref|XP_004252615.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    135   2e-33   
ref|XP_008392643.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    135   2e-33   
ref|XP_002962000.1|  hypothetical protein SELMODRAFT_437861             135   2e-33   
ref|XP_002462968.1|  hypothetical protein SORBIDRAFT_02g035490          136   2e-33   
ref|XP_010928243.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    135   2e-33   
gb|KDO62115.1|  hypothetical protein CISIN_1g0115512mg                  135   2e-33   
ref|XP_010270042.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     135   2e-33   
gb|KDO62116.1|  hypothetical protein CISIN_1g0115512mg                  135   2e-33   
gb|EEC80746.1|  hypothetical protein OsI_23229                          135   2e-33   
ref|XP_010913393.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    135   2e-33   
ref|XP_006413135.1|  hypothetical protein EUTSA_v10026799mg             135   3e-33   
gb|KDO62114.1|  hypothetical protein CISIN_1g0115512mg                  135   3e-33   
ref|XP_006360726.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    134   3e-33   
ref|XP_010227646.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    134   3e-33   
ref|XP_008392645.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    134   3e-33   
ref|XP_006285688.1|  hypothetical protein CARUB_v10007158mg             135   3e-33   
ref|XP_002971086.1|  hypothetical protein SELMODRAFT_94863              135   3e-33   
ref|NP_001057782.1|  Os06g0531000                                       135   3e-33   
ref|XP_008805608.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    135   3e-33   
ref|XP_008392644.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    134   3e-33   
gb|AES71661.2|  glycoside hydrolase family 17 protein                   134   3e-33   
ref|XP_004309523.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    134   4e-33   
ref|XP_011470886.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    134   4e-33   
emb|CDY06818.1|  BnaC01g09170D                                          135   4e-33   
ref|NP_001151472.1|  hydrolase, hydrolyzing O-glycosyl compounds ...    135   4e-33   
ref|XP_004491104.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    134   4e-33   
ref|XP_004491103.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    134   4e-33   
ref|XP_009128829.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     135   4e-33   
ref|XP_006297583.1|  hypothetical protein CARUB_v10013604mg             134   5e-33   
tpg|DAA62996.1|  TPA: putative O-glycosyl hydrolase family 17 pro...    135   5e-33   
gb|KHG26459.1|  hypothetical protein F383_04538                         134   5e-33   
gb|EEE65821.1|  hypothetical protein OsJ_21560                          134   6e-33   
ref|XP_011009684.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    134   6e-33   
gb|KFK29497.1|  hypothetical protein AALP_AA7G142000                    134   6e-33   
ref|XP_006475009.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    134   7e-33   
ref|XP_006452449.1|  hypothetical protein CICLE_v10008176mg             134   7e-33   
ref|XP_003616906.1|  Glucan endo-1,3-beta-glucosidase                   134   7e-33   
emb|CDP18512.1|  unnamed protein product                                133   7e-33   
ref|XP_003601410.1|  Glucan endo-1,3-beta-glucosidase                   134   7e-33   
ref|XP_002320484.1|  glycosyl hydrolase family 17 family protein        134   7e-33   
ref|XP_006386788.1|  hypothetical protein POPTR_0002s21700g             134   8e-33   



>gb|AFU52654.1| beta-1,3-glucanase 21 [Solanum tuberosum]
Length=443

 Score =   292 bits (747),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 154/184 (84%), Positives = 168/184 (91%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            VGINIGTDV+NLP A DVV LLKARQI HVRLF+ADAHML AL+NT IEVI+GVTN EVL
Sbjct  28   VGINIGTDVTNLPPASDVVALLKARQITHVRLFNADAHMLKALANTSIEVIIGVTNEEVL  87

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIG+S S AAAWVN+NVAAY+P TNITAIAVGSEVLT+IPNAAPVLVPAMNYLHKALV++
Sbjct  88   GIGESPSTAAAWVNRNVAAYMPGTNITAIAVGSEVLTAIPNAAPVLVPAMNYLHKALVAS  147

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
             LN+QVKVSTPQS D+IAK FPPSTATFN S NST+FQILQFL+NTNSYYMLNAYPYYEY
Sbjct  148  RLNNQVKVSTPQSMDVIAKAFPPSTATFNSSWNSTIFQILQFLRNTNSYYMLNAYPYYEY  207

Query  691  VKSD  702
            V SD
Sbjct  208  VHSD  211



>ref|XP_006354142.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Solanum tuberosum]
Length=501

 Score =   293 bits (749),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 154/184 (84%), Positives = 169/184 (92%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            VGINIGTDV+NLP A DVV LLKARQI HVRLF+ADAHML+AL+NT IEVI+GVTN EVL
Sbjct  28   VGINIGTDVTNLPPASDVVALLKARQITHVRLFNADAHMLNALANTSIEVIIGVTNEEVL  87

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIG+S S AAAWVN+NVAAY+P TNITAIAVGSEVLT+IPNAAPVLVPAMNYLHKALV++
Sbjct  88   GIGESPSTAAAWVNRNVAAYMPGTNITAIAVGSEVLTAIPNAAPVLVPAMNYLHKALVAS  147

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
             LN+QVKVSTPQS D+IAK FPPSTATFN S NST+FQILQFL+NTNSYYMLNAYPYYEY
Sbjct  148  RLNNQVKVSTPQSMDVIAKAFPPSTATFNSSWNSTIFQILQFLRNTNSYYMLNAYPYYEY  207

Query  691  VKSD  702
            V SD
Sbjct  208  VHSD  211



>ref|XP_010316236.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Solanum lycopersicum]
 ref|XP_010316237.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Solanum lycopersicum]
Length=501

 Score =   291 bits (745),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 152/184 (83%), Positives = 170/184 (92%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            VG+NIGTDV+NLP A DVV LLKARQI HVRLF+ADAHML+AL+NT IEVI+GVTN EVL
Sbjct  28   VGVNIGTDVTNLPPASDVVALLKARQITHVRLFNADAHMLNALANTSIEVIIGVTNEEVL  87

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIG+S S AAAWVN+NVAAY+P TNITAIAVGSEVLT+IPNAAPVLVPA+NYLHKALV++
Sbjct  88   GIGESPSTAAAWVNRNVAAYMPGTNITAIAVGSEVLTAIPNAAPVLVPALNYLHKALVAS  147

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
             LN+QVKVSTPQS D+IAK FPPSTATFN S NST+FQILQFL+NTNSYYMLNAYPYYEY
Sbjct  148  RLNNQVKVSTPQSMDVIAKAFPPSTATFNSSWNSTIFQILQFLRNTNSYYMLNAYPYYEY  207

Query  691  VKSD  702
            V+SD
Sbjct  208  VQSD  211



>ref|XP_009631831.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Nicotiana tomentosiformis]
 ref|XP_009631832.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Nicotiana tomentosiformis]
 ref|XP_009631833.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Nicotiana tomentosiformis]
 ref|XP_009631834.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Nicotiana tomentosiformis]
 ref|XP_009631835.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Nicotiana tomentosiformis]
 ref|XP_009631836.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Nicotiana tomentosiformis]
Length=499

 Score =   290 bits (741),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 152/184 (83%), Positives = 170/184 (92%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            VGINIGTDVSNLP A DVV LLKA QI HVRLF+ADAHML+AL+N+ IEV++GVTN+EVL
Sbjct  28   VGINIGTDVSNLPPASDVVALLKANQITHVRLFNADAHMLNALANSSIEVVIGVTNDEVL  87

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIG+S S AAAWVNKNVAAY+PSTNITAIAVGSEVLT+IPNAAPVLVPAMNYLHKALV++
Sbjct  88   GIGESPSAAAAWVNKNVAAYIPSTNITAIAVGSEVLTAIPNAAPVLVPAMNYLHKALVAS  147

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
             LN+QVKVSTPQS D+IA+ FPPSTATFN S NST+FQILQFL+NTNSY+MLNAYPYYEY
Sbjct  148  QLNNQVKVSTPQSMDVIARAFPPSTATFNSSWNSTIFQILQFLRNTNSYFMLNAYPYYEY  207

Query  691  VKSD  702
            V SD
Sbjct  208  VHSD  211



>ref|XP_009778460.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Nicotiana sylvestris]
 ref|XP_009778461.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Nicotiana sylvestris]
 ref|XP_009778462.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Nicotiana sylvestris]
 ref|XP_009778463.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Nicotiana sylvestris]
 ref|XP_009778464.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Nicotiana sylvestris]
 ref|XP_009778465.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Nicotiana sylvestris]
Length=496

 Score =   288 bits (737),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 152/184 (83%), Positives = 168/184 (91%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            VGINIGTDVSNLP A DVV LLK  QI HVRLF+ADAHML+AL+N+ IEVI+GVTN+EVL
Sbjct  25   VGINIGTDVSNLPPASDVVALLKVNQITHVRLFNADAHMLNALANSSIEVIIGVTNDEVL  84

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIG+S S AAAWVNKNVAAY+PSTNITAIAVGSEVLT+IPNAAPVLVPAMNYLHKALV++
Sbjct  85   GIGESPSAAAAWVNKNVAAYMPSTNITAIAVGSEVLTAIPNAAPVLVPAMNYLHKALVAS  144

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
             LN QVKVSTPQS D+IA+ FPPSTATFN S NST+FQILQFL+NTNSY+MLNAYPYYEY
Sbjct  145  QLNHQVKVSTPQSMDVIARAFPPSTATFNSSWNSTIFQILQFLRNTNSYFMLNAYPYYEY  204

Query  691  VKSD  702
            V SD
Sbjct  205  VHSD  208



>ref|XP_011087559.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X2 
[Sesamum indicum]
Length=440

 Score =   278 bits (712),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 149/193 (77%), Positives = 170/193 (88%), Gaps = 0/193 (0%)
 Frame = +1

Query  124  VIVQFRRCVVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVI  303
            V  +     VGINIGTDVSNLPSA D+V +LKA+QI HVRLFDADAHML+ALSNTGIEV+
Sbjct  16   VFFKASGAFVGINIGTDVSNLPSAVDIVGILKAQQITHVRLFDADAHMLNALSNTGIEVM  75

Query  304  VGVTNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMN  483
            V VTN EVLGIG+  S AAAWVNKNVAAY+PSTNITAIAVGSEVLTSIP+AAP+LVPAMN
Sbjct  76   VSVTNEEVLGIGELPSTAAAWVNKNVAAYVPSTNITAIAVGSEVLTSIPHAAPILVPAMN  135

Query  484  YLHKALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYM  663
             L+KAL+++NLN QVK+STP S D+I + FPPSTATFN +SNST+FQILQFL+NT SYYM
Sbjct  136  NLYKALLASNLNYQVKISTPHSMDIIPRSFPPSTATFNATSNSTIFQILQFLKNTKSYYM  195

Query  664  LNAYPYYEYVKSD  702
            LNAYPYYEYVKS+
Sbjct  196  LNAYPYYEYVKSN  208



>ref|XP_011087532.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X1 
[Sesamum indicum]
 ref|XP_011087540.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X1 
[Sesamum indicum]
 ref|XP_011087550.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X1 
[Sesamum indicum]
Length=499

 Score =   278 bits (712),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 149/193 (77%), Positives = 170/193 (88%), Gaps = 0/193 (0%)
 Frame = +1

Query  124  VIVQFRRCVVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVI  303
            V  +     VGINIGTDVSNLPSA D+V +LKA+QI HVRLFDADAHML+ALSNTGIEV+
Sbjct  16   VFFKASGAFVGINIGTDVSNLPSAVDIVGILKAQQITHVRLFDADAHMLNALSNTGIEVM  75

Query  304  VGVTNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMN  483
            V VTN EVLGIG+  S AAAWVNKNVAAY+PSTNITAIAVGSEVLTSIP+AAP+LVPAMN
Sbjct  76   VSVTNEEVLGIGELPSTAAAWVNKNVAAYVPSTNITAIAVGSEVLTSIPHAAPILVPAMN  135

Query  484  YLHKALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYM  663
             L+KAL+++NLN QVK+STP S D+I + FPPSTATFN +SNST+FQILQFL+NT SYYM
Sbjct  136  NLYKALLASNLNYQVKISTPHSMDIIPRSFPPSTATFNATSNSTIFQILQFLKNTKSYYM  195

Query  664  LNAYPYYEYVKSD  702
            LNAYPYYEYVKS+
Sbjct  196  LNAYPYYEYVKSN  208



>gb|KDP42112.1| hypothetical protein JCGZ_01900 [Jatropha curcas]
Length=496

 Score =   278 bits (711),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 146/184 (79%), Positives = 164/184 (89%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            VGINIGTDVSNLP A D+V +LKA QI HVRLFDADAHML AL+N+GIEV+VGVTN EVL
Sbjct  26   VGINIGTDVSNLPPASDIVAILKANQITHVRLFDADAHMLKALANSGIEVMVGVTNEEVL  85

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIG+S + AAAWVNKNV +YLP+TNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV++
Sbjct  86   GIGESPATAAAWVNKNVNSYLPATNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVAS  145

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NLN QVKVSTPQS D+I + FPPSTATFN S NST++Q+LQFL+NTNSYYMLNAYPYY Y
Sbjct  146  NLNFQVKVSTPQSMDVIPRPFPPSTATFNSSWNSTIYQLLQFLKNTNSYYMLNAYPYYGY  205

Query  691  VKSD  702
               +
Sbjct  206  TTGN  209



>ref|XP_011025159.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011025160.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011025161.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011025162.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
Length=493

 Score =   276 bits (707),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 143/184 (78%), Positives = 166/184 (90%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            VGINIGTDVSN+PSA DVV +LKA QI HVRL+DADAHML AL+++GIEV+VGVTN E+L
Sbjct  22   VGINIGTDVSNMPSAPDVVAMLKANQITHVRLYDADAHMLKALADSGIEVMVGVTNEEIL  81

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIG+S+S+AAAW+N+NVAAYLPSTNITAIAVGSEVLT+IPN  PVLVPAMNYLHKALV++
Sbjct  82   GIGESASKAAAWINQNVAAYLPSTNITAIAVGSEVLTTIPNVVPVLVPAMNYLHKALVAS  141

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NLN QVKVSTPQ+ D+I K FPPSTATFN S NST++QILQFL+NTNSYYMLNAYPY+ Y
Sbjct  142  NLNFQVKVSTPQAMDVIPKPFPPSTATFNSSWNSTIYQILQFLKNTNSYYMLNAYPYFGY  201

Query  691  VKSD  702
               +
Sbjct  202  TSGN  205



>ref|XP_002304004.2| hypothetical protein POPTR_0003s21250g [Populus trichocarpa]
 gb|EEE78983.2| hypothetical protein POPTR_0003s21250g [Populus trichocarpa]
Length=412

 Score =   273 bits (699),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 140/184 (76%), Positives = 165/184 (90%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            VGINIGTDVSN+PSA DVV +LK  QI HVRL+DADAHML AL+++GIEV+VGVTN E+L
Sbjct  22   VGINIGTDVSNMPSAPDVVAILKTNQITHVRLYDADAHMLKALADSGIEVMVGVTNEEIL  81

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIG+S+S+AAAW+N+NVAAYLPSTNITAIAVGSEVLT+IPN  PVLVPAMNYLHKALV++
Sbjct  82   GIGESASKAAAWINQNVAAYLPSTNITAIAVGSEVLTTIPNVVPVLVPAMNYLHKALVAS  141

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NLN QVKVSTPQ+ D+I + FPPSTATFN S +ST++QILQFL+NTNSYYMLNAYPY+ Y
Sbjct  142  NLNFQVKVSTPQAMDVIPRPFPPSTATFNSSWDSTIYQILQFLKNTNSYYMLNAYPYFGY  201

Query  691  VKSD  702
               +
Sbjct  202  TSGN  205



>emb|CAN72077.1| hypothetical protein VITISV_020314 [Vitis vinifera]
Length=473

 Score =   275 bits (702),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 142/184 (77%), Positives = 164/184 (89%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            VG+NIGTDVSNLPSA  +V +LKA QI HVRL+DADAHML+AL+NTGIEV+VGVTN EVL
Sbjct  26   VGVNIGTDVSNLPSASVLVGILKAHQITHVRLYDADAHMLNALANTGIEVVVGVTNEEVL  85

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIGQS S AA W+N+NVAAY+PSTNITAIAVGSEVLTSIP+AAPVLVPAMNYLHKALV++
Sbjct  86   GIGQSPSTAATWINRNVAAYVPSTNITAIAVGSEVLTSIPHAAPVLVPAMNYLHKALVAS  145

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NLN Q+KVS PQS D+I + FPPSTATFN + NST++Q+LQFL+NTNSY+MLNAYPYY Y
Sbjct  146  NLNFQIKVSAPQSLDIIPRPFPPSTATFNSTWNSTIYQMLQFLKNTNSYFMLNAYPYYGY  205

Query  691  VKSD  702
               D
Sbjct  206  TNGD  209



>ref|XP_008354983.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X1 
[Malus domestica]
 ref|XP_008354984.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X1 
[Malus domestica]
 ref|XP_008354985.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X1 
[Malus domestica]
Length=494

 Score =   275 bits (704),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 142/184 (77%), Positives = 163/184 (89%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +GINIGTDVS+LPS  D V LLKA QI HVRL++ADAHML ALSN+GIEV+VGVTN EVL
Sbjct  26   IGINIGTDVSDLPSETDTVALLKAHQITHVRLYNADAHMLKALSNSGIEVMVGVTNEEVL  85

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIG+S+S AAAW+NKNVAAYLPSTNITAIAVGSEV+T+IPNAAPVLV AMNYLHKALV++
Sbjct  86   GIGESASAAAAWINKNVAAYLPSTNITAIAVGSEVITTIPNAAPVLVSAMNYLHKALVAS  145

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NLN Q+KVSTPQS D+I K FPPSTATFN+S   T+++ILQF++NTNSYYMLNAYPYY Y
Sbjct  146  NLNFQIKVSTPQSMDIIPKPFPPSTATFNYSWGPTIYRILQFIKNTNSYYMLNAYPYYGY  205

Query  691  VKSD  702
               D
Sbjct  206  TSGD  209



>ref|XP_010651369.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X1 [Vitis 
vinifera]
Length=494

 Score =   275 bits (703),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 142/184 (77%), Positives = 164/184 (89%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            VG+NIGTDVSNLPSA  +V +LKA QI HVRL+DADAHML+AL+NTGIEV+VGVTN EVL
Sbjct  26   VGVNIGTDVSNLPSASVLVGILKAHQITHVRLYDADAHMLNALANTGIEVVVGVTNEEVL  85

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIGQS S AA W+N+NVAAY+PSTNITAIAVGSEVLTSIP+AAPVLVPAMNYLHKALV++
Sbjct  86   GIGQSPSTAATWINRNVAAYVPSTNITAIAVGSEVLTSIPHAAPVLVPAMNYLHKALVAS  145

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NLN Q+KVS PQS D+I + FPPSTATFN + NST++Q+LQFL+NTNSY+MLNAYPYY Y
Sbjct  146  NLNFQIKVSAPQSLDIIPRPFPPSTATFNSTWNSTIYQMLQFLKNTNSYFMLNAYPYYGY  205

Query  691  VKSD  702
               D
Sbjct  206  TNGD  209



>ref|XP_009375652.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Pyrus x bretschneideri]
 ref|XP_009375659.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Pyrus x bretschneideri]
Length=494

 Score =   275 bits (702),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 142/184 (77%), Positives = 163/184 (89%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +GINIGTDVS+LPS  D V LLKA QI HVRL++ADAHML ALSN+GIEV+VGVTN EVL
Sbjct  26   IGINIGTDVSDLPSETDTVALLKAHQITHVRLYNADAHMLKALSNSGIEVMVGVTNEEVL  85

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIG+S+S AAAW+NKNVAAYLPSTNITAIAVGSEV+T+IPNAAPVLV AMNYLHKALV++
Sbjct  86   GIGESASVAAAWINKNVAAYLPSTNITAIAVGSEVITTIPNAAPVLVSAMNYLHKALVAS  145

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NLN Q+KVSTPQS D+I K FPPSTATFN+S   T+++ILQF++NTNSYYMLNAYPYY Y
Sbjct  146  NLNFQIKVSTPQSMDIIPKPFPPSTATFNYSWGPTIYRILQFIKNTNSYYMLNAYPYYGY  205

Query  691  VKSD  702
               D
Sbjct  206  TSGD  209



>emb|CDP16794.1| unnamed protein product [Coffea canephora]
Length=503

 Score =   275 bits (702),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 145/208 (70%), Positives = 172/208 (83%), Gaps = 7/208 (3%)
 Frame = +1

Query  100  RNFPAYMRVIVQFRRC-------VVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDAD  258
            R    ++ +I+ F  C        VG NIGTD+SNLPSA +VV +LKA QI HVRLFDAD
Sbjct  5    RMLKLWLGIIILFITCPSIAAGAFVGFNIGTDLSNLPSATNVVAILKAHQITHVRLFDAD  64

Query  259  AHMLSALSNTGIEVIVGVTNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVL  438
            AHML+AL++TGIEV+V VTN E+LGIGQS S AAAWVNKNVAA++PSTNITAIAVGSEVL
Sbjct  65   AHMLTALADTGIEVMVSVTNEEILGIGQSPSVAAAWVNKNVAAFVPSTNITAIAVGSEVL  124

Query  439  TSIPNAAPVLVPAMNYLHKALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstV  618
            T+IPNAA +LVP+MNYL KALV++NLN Q+KVSTPQS D+I + FPPSTA FN + NST+
Sbjct  125  TTIPNAARILVPSMNYLQKALVASNLNDQIKVSTPQSMDVIPRPFPPSTAAFNSTWNSTI  184

Query  619  FQILQFLQNTNSYYMLNAYPYYEYVKSD  702
            FQ+LQFL+NTNSYYMLNAYPYY YV S+
Sbjct  185  FQMLQFLKNTNSYYMLNAYPYYGYVNSN  212



>ref|XP_008352033.1| PREDICTED: LOW QUALITY PROTEIN: glucan endo-1,3-beta-glucosidase 
4 [Malus domestica]
Length=469

 Score =   272 bits (695),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 141/184 (77%), Positives = 162/184 (88%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G NIGTDVS+LPS  D V LLKA QI HVRL++ADAHML ALSN+GIEV+VGVTN EVL
Sbjct  1    MGDNIGTDVSDLPSETDTVALLKAHQITHVRLYNADAHMLKALSNSGIEVMVGVTNEEVL  60

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIG+S+S AAAW+NKNVAAYLPSTNITAIAVGSEV+T+IPNAAPVLV AMNYLHKALV++
Sbjct  61   GIGESASAAAAWINKNVAAYLPSTNITAIAVGSEVITTIPNAAPVLVSAMNYLHKALVAS  120

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NLN Q+KVSTPQS D+I K FPPSTATFN+S   T+++ILQF++NTNSYYMLNAYPYY Y
Sbjct  121  NLNFQIKVSTPQSMDIIPKPFPPSTATFNYSWGPTIYRILQFIKNTNSYYMLNAYPYYGY  180

Query  691  VKSD  702
               D
Sbjct  181  TSGD  184



>ref|XP_008384395.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Malus domestica]
 ref|XP_008349413.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Malus domestica]
 ref|XP_008349414.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Malus domestica]
Length=494

 Score =   272 bits (696),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 141/193 (73%), Positives = 164/193 (85%), Gaps = 0/193 (0%)
 Frame = +1

Query  124  VIVQFRRCVVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVI  303
            +    +   +GINIGTDVS+LPS  D V LLKA QI HVRL++ADAH+L ALSN+GIEV+
Sbjct  17   MFTDVQGAFIGINIGTDVSDLPSETDTVALLKAHQITHVRLYNADAHILKALSNSGIEVM  76

Query  304  VGVTNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMN  483
            VG+TN EVL +G+SSS AAAW+NKNVAAYLPSTNITAIAVGSEV+TSIP+AAPVLV AMN
Sbjct  77   VGITNEEVLSVGESSSAAAAWINKNVAAYLPSTNITAIAVGSEVITSIPHAAPVLVDAMN  136

Query  484  YLHKALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYM  663
            YLHKALV++NLN QVKVSTPQS D+I K FPPSTATFN+S   T++QILQF++NTNSYYM
Sbjct  137  YLHKALVASNLNFQVKVSTPQSMDIIPKPFPPSTATFNYSWGHTIYQILQFIKNTNSYYM  196

Query  664  LNAYPYYEYVKSD  702
            LNAYPYY Y   D
Sbjct  197  LNAYPYYGYTNGD  209



>ref|XP_008229211.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Prunus mume]
 ref|XP_008229885.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Prunus mume]
 ref|XP_008230593.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Prunus mume]
Length=494

 Score =   271 bits (694),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 141/184 (77%), Positives = 159/184 (86%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +GINIGTDVS+LPS  D V LLKA QI HVRL++AD HML ALSN+GIEV+VGVTN E+L
Sbjct  26   IGINIGTDVSDLPSETDTVALLKAHQISHVRLYNADTHMLKALSNSGIEVMVGVTNEEIL  85

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIGQS S AAAW+NKNVAAYLPSTNITAIAVGSEVLTSIP+AAPVLV AMN LHKALV++
Sbjct  86   GIGQSPSTAAAWINKNVAAYLPSTNITAIAVGSEVLTSIPHAAPVLVSAMNSLHKALVAS  145

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NLN QVKVSTPQS D+I K FPPSTA FN S   T++QILQF++NTNSYYMLNAYPYY Y
Sbjct  146  NLNYQVKVSTPQSMDIIPKPFPPSTAGFNLSWGPTIYQILQFIKNTNSYYMLNAYPYYGY  205

Query  691  VKSD  702
             + +
Sbjct  206  TEGN  209



>ref|XP_004294998.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Fragaria vesca 
subsp. vesca]
 ref|XP_011461676.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Fragaria vesca 
subsp. vesca]
Length=494

 Score =   271 bits (693),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 143/184 (78%), Positives = 161/184 (88%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+NIGTDVS+LPSA ++V +L A QI HVRL+DADAHML ALSN+GIEV+VG+TN EVL
Sbjct  26   IGVNIGTDVSDLPSATEMVAILTAHQITHVRLYDADAHMLRALSNSGIEVVVGITNEEVL  85

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIG+S S AAAWVNKNVA YLPSTNITAIAVGSEVLT IP+A+ VLV AMNY+HKALV+ 
Sbjct  86   GIGESPSVAAAWVNKNVAPYLPSTNITAIAVGSEVLTQIPHASSVLVSAMNYIHKALVAT  145

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NLN QVKVSTPQS D+I K FPPSTATF+ S NSTVFQILQFL+NTNSYYMLNAYPYY Y
Sbjct  146  NLNFQVKVSTPQSMDVIPKAFPPSTATFDPSWNSTVFQILQFLKNTNSYYMLNAYPYYGY  205

Query  691  VKSD  702
             K D
Sbjct  206  TKGD  209



>ref|XP_007205107.1| hypothetical protein PRUPE_ppa004732mg [Prunus persica]
 gb|EMJ06306.1| hypothetical protein PRUPE_ppa004732mg [Prunus persica]
Length=494

 Score =   271 bits (693),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 141/184 (77%), Positives = 159/184 (86%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +GINIGTDVS+LPS  D V LLKA QI HVRL++AD HML ALSN+GIEV+VGVTN E+L
Sbjct  26   IGINIGTDVSDLPSETDTVALLKAHQISHVRLYNADTHMLKALSNSGIEVMVGVTNEEIL  85

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIGQS S AAAW+NKNVAAYLPSTNITAIAVGSEVLTSIP+AAPVLV AMN LHKALV++
Sbjct  86   GIGQSPSTAAAWINKNVAAYLPSTNITAIAVGSEVLTSIPHAAPVLVSAMNSLHKALVAS  145

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NLN QVKVSTPQS D+I K FPPSTA FN S   T++QILQF++NTNSYYMLNAYPYY Y
Sbjct  146  NLNYQVKVSTPQSMDVIPKPFPPSTAGFNLSWGPTIYQILQFIKNTNSYYMLNAYPYYGY  205

Query  691  VKSD  702
             + +
Sbjct  206  TEGN  209



>ref|XP_009364124.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Pyrus x bretschneideri]
Length=493

 Score =   271 bits (692),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 141/184 (77%), Positives = 161/184 (88%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +GINIGTDVS+LPS  D V LLKA QI HVRL++ADAHML ALSN+ IEV+VGVTN EVL
Sbjct  26   IGINIGTDVSDLPSETDTVALLKAHQITHVRLYNADAHMLKALSNSRIEVMVGVTNEEVL  85

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
             +G+SSS AAAW+NKNVAAYLPSTNITAIAVGSEV+TSIP+AAPVLV AMNYLHKALV++
Sbjct  86   SVGESSSAAAAWINKNVAAYLPSTNITAIAVGSEVITSIPHAAPVLVDAMNYLHKALVAS  145

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NLN QVK+STPQS D+I K FPPSTATFN+S   T++QILQF++NTNSYYMLNAYPYY Y
Sbjct  146  NLNFQVKISTPQSMDIIPKPFPPSTATFNYSWGHTIYQILQFIKNTNSYYMLNAYPYYGY  205

Query  691  VKSD  702
               D
Sbjct  206  TNGD  209



>ref|XP_011048218.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011048220.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011048221.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011048222.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011048223.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011048224.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011016027.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011016028.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011016029.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011016030.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011016031.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011016032.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011016033.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011016034.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
Length=493

 Score =   268 bits (685),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 136/184 (74%), Positives = 165/184 (90%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            VGIN+GTDVSN+PSA DVV +LKA QI H+RL+DADAHML AL+++GI+V+VGV N EVL
Sbjct  22   VGINLGTDVSNMPSAPDVVSILKANQITHLRLYDADAHMLKALADSGIKVMVGVPNEEVL  81

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIG+S+S+AAAW+N+NVAAYLPSTNITAIAVGSEVL+SIPN  PVLVPAMNYLHKALV++
Sbjct  82   GIGESASKAAAWINQNVAAYLPSTNITAIAVGSEVLSSIPNLVPVLVPAMNYLHKALVAS  141

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NLN QVK+STPQ+ D+I + FPPSTATFN S ++TV+QILQFL+NT+SYYMLNAYPY+ Y
Sbjct  142  NLNFQVKISTPQAMDIIPRPFPPSTATFNSSWSATVYQILQFLKNTDSYYMLNAYPYFGY  201

Query  691  VKSD  702
               +
Sbjct  202  TSGN  205



>ref|XP_004504325.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Cicer arietinum]
Length=496

 Score =   267 bits (682),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 142/184 (77%), Positives = 162/184 (88%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            VG+NIGTDVS++PSA +VV +LKA QI HVRL+DA+AH+L ALSNTGI+VIVGVTN EVL
Sbjct  26   VGVNIGTDVSDMPSASNVVAILKANQITHVRLYDANAHLLQALSNTGIDVIVGVTNEEVL  85

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
             IG+S S AAAW+NKNV AYLPSTNITAIAVGSEVL++IPN APVLVPAMN LHKALV+A
Sbjct  86   KIGESPSAAAAWINKNVVAYLPSTNITAIAVGSEVLSTIPNVAPVLVPAMNSLHKALVAA  145

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NLN +VKVSTPQS D+I K FPPSTATFN S NST++Q+LQFL+NTNS YMLNAYPYY Y
Sbjct  146  NLNFRVKVSTPQSMDIIPKSFPPSTATFNSSWNSTIYQLLQFLKNTNSSYMLNAYPYYGY  205

Query  691  VKSD  702
             K D
Sbjct  206  TKGD  209



>ref|XP_002297638.2| hypothetical protein POPTR_0001s04360g [Populus trichocarpa]
 gb|EEE82443.2| hypothetical protein POPTR_0001s04360g [Populus trichocarpa]
Length=493

 Score =   266 bits (680),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 136/184 (74%), Positives = 164/184 (89%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            VGIN+GTDVSN+PSA DVV +LKA QI H+RL+DADAHML AL+++GIEV+VGVTN EVL
Sbjct  22   VGINLGTDVSNMPSAPDVVSILKANQITHLRLYDADAHMLKALADSGIEVMVGVTNEEVL  81

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIG+S S+AAAW+N+NVAAYLPST+ITAIAVGSEVLTSIPN   VLVPAMNYLHKALV++
Sbjct  82   GIGESPSKAAAWINQNVAAYLPSTSITAIAVGSEVLTSIPNLVTVLVPAMNYLHKALVAS  141

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NLN QVK+STPQ+ D+I + FPPSTATFN S ++TV+QILQFL+NT+S+YMLNAYPY+ Y
Sbjct  142  NLNFQVKISTPQAMDIIPRPFPPSTATFNSSWSATVYQILQFLKNTDSFYMLNAYPYFGY  201

Query  691  VKSD  702
               +
Sbjct  202  TSGN  205



>ref|XP_007161273.1| hypothetical protein PHAVU_001G056400g [Phaseolus vulgaris]
 gb|ESW33267.1| hypothetical protein PHAVU_001G056400g [Phaseolus vulgaris]
Length=503

 Score =   265 bits (676),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 136/184 (74%), Positives = 164/184 (89%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            VG+NIGTDV++LPSA ++V +LKA QI HVRL+DA+ HML ALS TGIEVIVGVT+ E+L
Sbjct  29   VGVNIGTDVTDLPSASNMVAILKAHQITHVRLYDANEHMLQALSKTGIEVIVGVTDEEIL  88

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIG+S+S AAAW++KNVAAY+PSTNITAI+VGSEVLTS+P  APVLVPAMN+LHKALV++
Sbjct  89   GIGESASVAAAWISKNVAAYMPSTNITAISVGSEVLTSVPKVAPVLVPAMNHLHKALVAS  148

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NLN +VK+STPQS D+I++ FPPSTATFN S NST++Q+LQFLQNTNS YMLNAYPYY Y
Sbjct  149  NLNFRVKISTPQSMDIISRPFPPSTATFNSSWNSTIYQLLQFLQNTNSSYMLNAYPYYGY  208

Query  691  VKSD  702
             K D
Sbjct  209  TKGD  212



>ref|XP_010276339.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X2 [Nelumbo 
nucifera]
Length=453

 Score =   263 bits (672),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 137/184 (74%), Positives = 160/184 (87%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            VGINIGT V++LPSA DVV +LKA QI HVRL+DAD HML+AL+ TG+EV+VGVTN EVL
Sbjct  27   VGINIGTAVTDLPSAADVVAMLKANQITHVRLYDADGHMLNALAGTGVEVMVGVTNEEVL  86

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIG+S S AAAWVNKNVA+YLP TNITAIAVGSEVLTSIPNAAPVLV AMNYLH AL+++
Sbjct  87   GIGESPSAAAAWVNKNVASYLPETNITAIAVGSEVLTSIPNAAPVLVRAMNYLHHALLAS  146

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NLN QVKVS+PQS D+I + FPPSTATFN + NST++Q LQFL+NT S+YMLNAYPYY Y
Sbjct  147  NLNFQVKVSSPQSMDMIPRPFPPSTATFNSTWNSTMYQFLQFLKNTGSFYMLNAYPYYGY  206

Query  691  VKSD  702
             + +
Sbjct  207  TRGN  210



>ref|XP_006601114.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Glycine max]
Length=498

 Score =   264 bits (675),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 136/184 (74%), Positives = 165/184 (90%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            VG+NIGTDV++LPSA +VV +LK+ QI HVRL++A+ HML ALSNTGIEVIVGVT+ E+L
Sbjct  26   VGVNIGTDVTDLPSASNVVAILKSHQITHVRLYNANGHMLQALSNTGIEVIVGVTDEEIL  85

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIG+S+S AAAW++KNVAAY+PSTNITAI+VGSEVLTS+PN APVLVPAMN+LH ALV++
Sbjct  86   GIGESASVAAAWISKNVAAYMPSTNITAISVGSEVLTSVPNVAPVLVPAMNHLHTALVAS  145

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NLN +VKVSTPQS D+I++ FPPSTATFN S NST++Q+LQFL+NTNS YMLNAYPYY Y
Sbjct  146  NLNFRVKVSTPQSMDVISRPFPPSTATFNSSWNSTIYQLLQFLKNTNSSYMLNAYPYYGY  205

Query  691  VKSD  702
             K D
Sbjct  206  TKGD  209



>gb|KHN12071.1| Glucan endo-1,3-beta-glucosidase 4, partial [Glycine soja]
Length=501

 Score =   264 bits (675),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 136/184 (74%), Positives = 165/184 (90%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            VG+NIGTDV++LPSA +VV +LK+ QI HVRL++A+ HML ALSNTGIEVIVGVT+ E+L
Sbjct  29   VGVNIGTDVTDLPSASNVVAILKSHQITHVRLYNANGHMLQALSNTGIEVIVGVTDEEIL  88

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIG+S+S AAAW++KNVAAY+PSTNITAI+VGSEVLTS+PN APVLVPAMN+LH ALV++
Sbjct  89   GIGESASVAAAWISKNVAAYMPSTNITAISVGSEVLTSVPNVAPVLVPAMNHLHTALVAS  148

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NLN +VKVSTPQS D+I++ FPPSTATFN S NST++Q+LQFL+NTNS YMLNAYPYY Y
Sbjct  149  NLNFRVKVSTPQSMDVISRPFPPSTATFNSSWNSTIYQLLQFLKNTNSSYMLNAYPYYGY  208

Query  691  VKSD  702
             K D
Sbjct  209  TKGD  212



>gb|KJB23365.1| hypothetical protein B456_004G094500 [Gossypium raimondii]
Length=492

 Score =   264 bits (674),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 138/184 (75%), Positives = 161/184 (88%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            VG+NIGTDVS++P A DVV ++KA QI H+RL+DAD HML AL+ +GIEV VGVTN EVL
Sbjct  25   VGVNIGTDVSSMPPASDVVAIVKAHQITHIRLYDADPHMLKALAGSGIEVTVGVTNEEVL  84

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIG+S+S AAAW+NKNVAAY+PSTNITAIAVGSEVLTS+P+AAPVLV AMN LHKALV+A
Sbjct  85   GIGESASAAAAWINKNVAAYMPSTNITAIAVGSEVLTSVPHAAPVLVTAMNNLHKALVAA  144

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            +LN QVKVSTPQS D+I K FPPSTATFN S NST++Q+LQFL+NTNSYYMLNAYPYY Y
Sbjct  145  DLNFQVKVSTPQSMDIIPKPFPPSTATFNSSWNSTIYQLLQFLKNTNSYYMLNAYPYYGY  204

Query  691  VKSD  702
               +
Sbjct  205  TNGN  208



>gb|KHG18393.1| hypothetical protein F383_22096 [Gossypium arboreum]
Length=492

 Score =   263 bits (673),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 136/184 (74%), Positives = 161/184 (88%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            VG+NIGTDVS++P A DVV ++KA QI H+RL+DAD HML AL+ +GIEV VGVTN EVL
Sbjct  25   VGVNIGTDVSSMPPASDVVAIVKAHQITHIRLYDADPHMLKALAGSGIEVTVGVTNEEVL  84

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIG+S+S AAAW+NKNVAAY+PSTNITAIAVGSEVLTS+P+AAPVLV AMN LHKALV+A
Sbjct  85   GIGESASAAAAWINKNVAAYMPSTNITAIAVGSEVLTSVPHAAPVLVTAMNNLHKALVAA  144

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            +LN Q+KVSTPQS D+I K FPPST+TFN S NST++Q+LQFL+NTNSYYMLNAYPYY Y
Sbjct  145  DLNFQIKVSTPQSMDIIPKPFPPSTSTFNSSWNSTIYQLLQFLKNTNSYYMLNAYPYYGY  204

Query  691  VKSD  702
               +
Sbjct  205  TNGN  208



>ref|XP_010276332.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010276333.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010276334.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010276335.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010276336.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010276337.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010276338.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X1 [Nelumbo 
nucifera]
Length=496

 Score =   263 bits (673),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 137/184 (74%), Positives = 160/184 (87%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            VGINIGT V++LPSA DVV +LKA QI HVRL+DAD HML+AL+ TG+EV+VGVTN EVL
Sbjct  27   VGINIGTAVTDLPSAADVVAMLKANQITHVRLYDADGHMLNALAGTGVEVMVGVTNEEVL  86

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIG+S S AAAWVNKNVA+YLP TNITAIAVGSEVLTSIPNAAPVLV AMNYLH AL+++
Sbjct  87   GIGESPSAAAAWVNKNVASYLPETNITAIAVGSEVLTSIPNAAPVLVRAMNYLHHALLAS  146

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NLN QVKVS+PQS D+I + FPPSTATFN + NST++Q LQFL+NT S+YMLNAYPYY Y
Sbjct  147  NLNFQVKVSSPQSMDMIPRPFPPSTATFNSTWNSTMYQFLQFLKNTGSFYMLNAYPYYGY  206

Query  691  VKSD  702
             + +
Sbjct  207  TRGN  210



>ref|XP_007159412.1| hypothetical protein PHAVU_002G236300g [Phaseolus vulgaris]
 ref|XP_007159413.1| hypothetical protein PHAVU_002G236300g [Phaseolus vulgaris]
 gb|ESW31406.1| hypothetical protein PHAVU_002G236300g [Phaseolus vulgaris]
 gb|ESW31407.1| hypothetical protein PHAVU_002G236300g [Phaseolus vulgaris]
Length=492

 Score =   263 bits (671),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 137/185 (74%), Positives = 161/185 (87%), Gaps = 0/185 (0%)
 Frame = +1

Query  148  VVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEV  327
            +VG+NIGTDVS++PSA ++V++L+A QI HVRL+DA+ H+L ALSNT IEVIVGVTN EV
Sbjct  25   LVGVNIGTDVSDMPSASNIVDILQANQITHVRLYDANVHLLQALSNTSIEVIVGVTNEEV  84

Query  328  LGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVS  507
            L IG+S S AAAW+NKNV AY+PSTNITAIAVGSEVL++IPN APVLVPAMN LHKALV+
Sbjct  85   LKIGESPSAAAAWINKNVVAYVPSTNITAIAVGSEVLSTIPNVAPVLVPAMNSLHKALVA  144

Query  508  ANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYE  687
            ANLN QVKVSTPQS D+I K FPPS A+FN S NST++Q+LQFL+NTNS YMLNAYPYY 
Sbjct  145  ANLNFQVKVSTPQSMDIIPKPFPPSAASFNSSWNSTMYQLLQFLKNTNSSYMLNAYPYYG  204

Query  688  YVKSD  702
            Y K D
Sbjct  205  YTKGD  209



>ref|XP_006596127.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Glycine max]
 gb|KHN20600.1| Glucan endo-1,3-beta-glucosidase 4 [Glycine soja]
Length=501

 Score =   261 bits (668),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 135/184 (73%), Positives = 164/184 (89%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            VG+NIGTDV++LPSA +VV +LKA QI HVRL++A+ HML ALSNTGIEVIVGVT+ E+L
Sbjct  29   VGVNIGTDVTDLPSASNVVAILKAHQITHVRLYNANEHMLRALSNTGIEVIVGVTDEEIL  88

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIG+S+S AAAW++KNVAAY+PSTNITAI+VGSEVLTS+PN APVLVPAMN+LH ALV++
Sbjct  89   GIGESASVAAAWISKNVAAYMPSTNITAISVGSEVLTSVPNVAPVLVPAMNHLHTALVAS  148

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NLN ++KVSTP S D+I++ FPPSTATFN S NST++Q+LQFL+NTNS YMLNAYPYY Y
Sbjct  149  NLNFRIKVSTPLSMDIISRPFPPSTATFNSSWNSTIYQLLQFLKNTNSSYMLNAYPYYGY  208

Query  691  VKSD  702
             K D
Sbjct  209  TKGD  212



>ref|XP_006495278.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like, partial [Citrus 
sinensis]
Length=373

 Score =   257 bits (657),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 133/184 (72%), Positives = 159/184 (86%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            VG+NIGTDVSN+PSA D+V +L+A QI HVRL+DAD+HML ALS +GIEVIVGV N EVL
Sbjct  26   VGVNIGTDVSNMPSASDIVAILRANQITHVRLYDADSHMLKALSKSGIEVIVGVLNEEVL  85

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIG+S+S AA W+NKNVAAY+P+TNITAIAVGS+VLTSIPNAA VLV AMN LHKALV++
Sbjct  86   GIGESASAAAGWINKNVAAYMPTTNITAIAVGSQVLTSIPNAASVLVSAMNNLHKALVAS  145

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            +LN QVK+STP S D+I + FPPSTATFN + NST++QILQFL+NT S+YMLNAYPYY Y
Sbjct  146  DLNFQVKISTPHSMDIIPRPFPPSTATFNSAWNSTIYQILQFLKNTKSFYMLNAYPYYGY  205

Query  691  VKSD  702
               +
Sbjct  206  TNGN  209



>ref|XP_003531243.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Glycine max]
 gb|KHN47972.1| Glucan endo-1,3-beta-glucosidase 4 [Glycine soja]
Length=496

 Score =   261 bits (667),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 138/184 (75%), Positives = 160/184 (87%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            VG+NIGTDVS+LPSA ++V++L+A QI HVRL+DA+AH+L ALSNT IEVIVGVTN EVL
Sbjct  26   VGVNIGTDVSDLPSASNIVDILQANQITHVRLYDANAHLLQALSNTSIEVIVGVTNEEVL  85

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
             IG+S S AA W+NKNV AY+PSTNIT IAVGSEVL++IPN APVLVPAMN LHKALV+A
Sbjct  86   RIGESPSAAATWINKNVVAYVPSTNITGIAVGSEVLSTIPNVAPVLVPAMNSLHKALVAA  145

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NLN +VKVSTPQS D+I K FPPSTATFN S NST++Q+LQFL+NTNS YMLNAYPYY Y
Sbjct  146  NLNFRVKVSTPQSMDIIPKPFPPSTATFNSSWNSTIYQLLQFLKNTNSSYMLNAYPYYGY  205

Query  691  VKSD  702
             K D
Sbjct  206  TKGD  209



>ref|XP_003524953.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Glycine max]
Length=496

 Score =   259 bits (663),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 139/195 (71%), Positives = 162/195 (83%), Gaps = 0/195 (0%)
 Frame = +1

Query  118  MRVIVQFRRCVVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIE  297
            + V+       VG+NIGTDVS+LPSA ++V +L+A QI H RL+DA+AH+L ALSNT IE
Sbjct  15   IAVLTNTLGAFVGVNIGTDVSDLPSASNIVGILQANQITHARLYDANAHLLQALSNTSIE  74

Query  298  VIVGVTNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPA  477
            VIVGVTN EVL IG+S S AAAW+NKNV AY+PSTNIT IAVGSEVL++IPN APVLVPA
Sbjct  75   VIVGVTNEEVLRIGESPSAAAAWINKNVVAYVPSTNITGIAVGSEVLSTIPNVAPVLVPA  134

Query  478  MNYLHKALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSY  657
            MN LHKALV+ANLN +VKVSTPQS D+I K FPPSTATFN S NST++Q+LQFL+NTNS 
Sbjct  135  MNSLHKALVAANLNFRVKVSTPQSMDIIPKPFPPSTATFNSSWNSTIYQLLQFLKNTNSS  194

Query  658  YMLNAYPYYEYVKSD  702
            YMLNAYPYY Y K D
Sbjct  195  YMLNAYPYYGYTKGD  209



>ref|XP_010044948.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Eucalyptus grandis]
 ref|XP_010044949.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Eucalyptus grandis]
 gb|KCW87080.1| hypothetical protein EUGRSUZ_B03614 [Eucalyptus grandis]
Length=495

 Score =   259 bits (662),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 135/184 (73%), Positives = 160/184 (87%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            VGINIGTDV+NLP A D+V +LK+ +I HVRL++ADAHML AL+N+GI V+VGVTN EVL
Sbjct  26   VGINIGTDVTNLPEASDIVAVLKSNEITHVRLYNADAHMLKALANSGINVMVGVTNEEVL  85

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIG+  + AAAW+NKNVAAYLP+TNITAIAVGSEVLT+IP+AAPVLVPAMN LHKALV++
Sbjct  86   GIGEYPATAAAWINKNVAAYLPATNITAIAVGSEVLTAIPHAAPVLVPAMNNLHKALVAS  145

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NLN  VKVSTPQSTD+I K FPPS A FN S NST++Q+LQFL+NTNS YMLNAYPYY Y
Sbjct  146  NLNFVVKVSTPQSTDVIPKPFPPSAAAFNSSWNSTLYQLLQFLKNTNSSYMLNAYPYYGY  205

Query  691  VKSD  702
             + +
Sbjct  206  TQGN  209



>ref|XP_006445640.1| hypothetical protein CICLE_v10015028mg [Citrus clementina]
 ref|XP_006445641.1| hypothetical protein CICLE_v10015028mg [Citrus clementina]
 gb|ESR58880.1| hypothetical protein CICLE_v10015028mg [Citrus clementina]
 gb|ESR58881.1| hypothetical protein CICLE_v10015028mg [Citrus clementina]
Length=493

 Score =   258 bits (660),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 134/184 (73%), Positives = 160/184 (87%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            VG+NIGTDVSN+PSA D+V +L+A QI HVRL+DAD+HML ALS +GIEVIVGV N EVL
Sbjct  26   VGVNIGTDVSNMPSASDIVAILRANQITHVRLYDADSHMLKALSKSGIEVIVGVLNEEVL  85

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIG+S+S AAAW+NKNVAAY+P+TNITAIAVGS+VLTSIPNAA VLV AMN LHKALV++
Sbjct  86   GIGESASAAAAWINKNVAAYMPTTNITAIAVGSQVLTSIPNAASVLVSAMNNLHKALVAS  145

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            +LN QVK+STP S D+I + FPPSTATFN + NST++QILQFL+NT S+YMLNAYPYY Y
Sbjct  146  DLNFQVKISTPHSMDIIPRPFPPSTATFNSAWNSTIYQILQFLKNTKSFYMLNAYPYYGY  205

Query  691  VKSD  702
               +
Sbjct  206  TNGN  209



>ref|XP_007014685.1| O-Glycosyl hydrolases family 17 protein isoform 1 [Theobroma 
cacao]
 ref|XP_007014686.1| O-Glycosyl hydrolases family 17 protein isoform 1 [Theobroma 
cacao]
 gb|EOY32304.1| O-Glycosyl hydrolases family 17 protein isoform 1 [Theobroma 
cacao]
 gb|EOY32305.1| O-Glycosyl hydrolases family 17 protein isoform 1 [Theobroma 
cacao]
Length=496

 Score =   258 bits (660),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 135/184 (73%), Positives = 160/184 (87%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            VGINIGTDVS++PSA +VV ++KA QI H+RL+DAD+HML A +++GIEV VGVTN EVL
Sbjct  26   VGINIGTDVSSMPSASEVVAVVKAHQITHIRLYDADSHMLKAFADSGIEVTVGVTNEEVL  85

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIG+S+S AA W+NKNVA+Y+PSTNITAIAVGSEVLTSIP+AA VLV AMN LHKALV++
Sbjct  86   GIGESASAAAVWINKNVASYVPSTNITAIAVGSEVLTSIPHAASVLVTAMNNLHKALVAS  145

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NLN QVKVSTPQS D+I K FPPSTA FN S NST++Q+LQFL+NTNSYYMLNAYPYY Y
Sbjct  146  NLNFQVKVSTPQSMDIIPKPFPPSTAAFNSSWNSTIYQLLQFLKNTNSYYMLNAYPYYGY  205

Query  691  VKSD  702
               +
Sbjct  206  TNGN  209



>ref|XP_010257592.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Nelumbo nucifera]
 ref|XP_010257593.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Nelumbo nucifera]
 ref|XP_010257594.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Nelumbo nucifera]
 ref|XP_010257595.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Nelumbo nucifera]
 ref|XP_010257598.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Nelumbo nucifera]
Length=514

 Score =   259 bits (661),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 133/184 (72%), Positives = 156/184 (85%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            VGINIG DV++LPSA DVV +LKA QI HVRL+DAD  ML+AL+ TGIEV+VGV N EVL
Sbjct  43   VGINIGMDVTDLPSASDVVAILKANQITHVRLYDADNRMLNALAGTGIEVMVGVANEEVL  102

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIGQS S AAAW+NKNV +YLPSTNITAIAVGSEVLTSIPNAAP+LVPAMNYLH ALV++
Sbjct  103  GIGQSPSVAAAWINKNVVSYLPSTNITAIAVGSEVLTSIPNAAPILVPAMNYLHNALVAS  162

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            N+N QVKVS+PQS D+I + FPPS ATFN + +S ++Q LQFL+NT S+YMLNA PYY Y
Sbjct  163  NINFQVKVSSPQSMDMIPRPFPPSDATFNSTWSSIMYQFLQFLKNTGSFYMLNANPYYGY  222

Query  691  VKSD  702
             K +
Sbjct  223  TKGN  226



>ref|XP_006488904.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X1 
[Citrus sinensis]
 ref|XP_006488905.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X2 
[Citrus sinensis]
 ref|XP_006488906.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X3 
[Citrus sinensis]
 gb|KDO63056.1| hypothetical protein CISIN_1g011131mg [Citrus sinensis]
 gb|KDO63057.1| hypothetical protein CISIN_1g011131mg [Citrus sinensis]
Length=493

 Score =   257 bits (657),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 133/184 (72%), Positives = 159/184 (86%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            VG+NIGTDVSN+PSA D+V +L+A QI HVRL+DAD+HML ALS +GIEVIVGV N EVL
Sbjct  26   VGVNIGTDVSNMPSASDIVAILRANQITHVRLYDADSHMLKALSKSGIEVIVGVLNEEVL  85

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIG+S+S AA W+NKNVAAY+P+TNITAIAVGS+VLTSIPNAA VLV AMN LHKALV++
Sbjct  86   GIGESASAAAGWINKNVAAYMPTTNITAIAVGSQVLTSIPNAASVLVSAMNNLHKALVAS  145

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            +LN QVK+STP S D+I + FPPSTATFN + NST++QILQFL+NT S+YMLNAYPYY Y
Sbjct  146  DLNFQVKISTPHSMDIIPRPFPPSTATFNSAWNSTIYQILQFLKNTKSFYMLNAYPYYGY  205

Query  691  VKSD  702
               +
Sbjct  206  TNGN  209



>ref|XP_003629715.1| Glucan endo-1,3-beta-glucosidase [Medicago truncatula]
 gb|AET04191.1| O-glycosyl hydrolase family 17 protein [Medicago truncatula]
Length=498

 Score =   257 bits (657),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 137/184 (74%), Positives = 160/184 (87%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            VG+NIGTDVS++PSA +VV +LKA QI HVRL+DA+AH+L ALS T I+V+VGVTN EVL
Sbjct  26   VGVNIGTDVSDMPSASNVVAILKANQITHVRLYDANAHLLQALSKTNIDVMVGVTNEEVL  85

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
             IG+S S AAAW+NKNV AY+PSTNITAIAVGSEVL++IPN APVLVPAMN LHKALV+A
Sbjct  86   RIGESPSAAAAWINKNVVAYVPSTNITAIAVGSEVLSTIPNVAPVLVPAMNSLHKALVAA  145

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NLN +VKVSTPQS D+I K FPPSTATFN S NST++Q+LQFL+NTNS +MLNAYPYY Y
Sbjct  146  NLNFRVKVSTPQSMDIIPKPFPPSTATFNSSWNSTIYQVLQFLRNTNSSFMLNAYPYYGY  205

Query  691  VKSD  702
             K D
Sbjct  206  TKGD  209



>ref|XP_010097806.1| Glucan endo-1,3-beta-glucosidase 4 [Morus notabilis]
 gb|EXB71433.1| Glucan endo-1,3-beta-glucosidase 4 [Morus notabilis]
Length=494

 Score =   256 bits (655),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 136/184 (74%), Positives = 156/184 (85%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            VGINIGTDVS LPS  D+V +LKA Q  HVRL+DA+  +L AL+ +GIEV+VGV N EVL
Sbjct  26   VGINIGTDVSTLPSEIDIVAILKAHQFTHVRLYDANTRLLKALAGSGIEVMVGVANEEVL  85

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIG+S S AAAWVNKNVAAY+P+TNIT IAVGSEVLTSIPNAA VLV AMNYLHKALV+A
Sbjct  86   GIGESPSVAAAWVNKNVAAYVPTTNITTIAVGSEVLTSIPNAASVLVSAMNYLHKALVAA  145

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NLN QVKVSTPQS D+I + FPPSTA FN S NST++Q+LQFL+NTNSYYMLNAYPYY Y
Sbjct  146  NLNFQVKVSTPQSMDIIPRSFPPSTANFNSSWNSTIYQLLQFLKNTNSYYMLNAYPYYGY  205

Query  691  VKSD  702
             + +
Sbjct  206  TRGN  209



>gb|KJB66066.1| hypothetical protein B456_010G126400 [Gossypium raimondii]
 gb|KJB66067.1| hypothetical protein B456_010G126400 [Gossypium raimondii]
 gb|KJB66069.1| hypothetical protein B456_010G126400 [Gossypium raimondii]
Length=494

 Score =   255 bits (652),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 132/184 (72%), Positives = 159/184 (86%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +GINIGTDVS++PSA +VV ++K  +I HVRL+DAD+HML AL+++GIEV VGVTN EVL
Sbjct  26   IGINIGTDVSSMPSASEVVSIIKTHRITHVRLYDADSHMLKALADSGIEVTVGVTNEEVL  85

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIG+S+S AAAWVNKNVA+Y+PSTNITAIAVGSEVLTSIP+AAP+LV AMN LHKALV++
Sbjct  86   GIGESASAAAAWVNKNVASYVPSTNITAIAVGSEVLTSIPHAAPILVTAMNNLHKALVAS  145

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NLN QVKVS+PQ  D+I + FPP TA FN S NSTV+Q+LQFL NTNSY+MLNAYPYY Y
Sbjct  146  NLNFQVKVSSPQPLDIIPEPFPPCTAAFNSSPNSTVYQLLQFLNNTNSYFMLNAYPYYGY  205

Query  691  VKSD  702
               +
Sbjct  206  TNGN  209



>ref|XP_011093510.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Sesamum indicum]
 ref|XP_011093511.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Sesamum indicum]
 ref|XP_011093512.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Sesamum indicum]
 ref|XP_011093513.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Sesamum indicum]
 ref|XP_011093514.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Sesamum indicum]
 ref|XP_011093515.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Sesamum indicum]
Length=502

 Score =   256 bits (653),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 135/184 (73%), Positives = 162/184 (88%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            VGINIGTDVSNLPSA ++V +L+A  I HVRLF+ADA ML+ALSNTGIEV++ VTN EV 
Sbjct  25   VGINIGTDVSNLPSAVEIVAILRAHSISHVRLFNADARMLNALSNTGIEVMISVTNEEVT  84

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
             IG+S S AA W+NKNVAAY+P+TNITAIAVGSEVLTS+PNA+ V+VPAMNYL+KALV++
Sbjct  85   TIGESPSAAADWINKNVAAYVPTTNITAIAVGSEVLTSLPNASAVIVPAMNYLNKALVAS  144

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NLN  VKVSTP S  +I++ FPPSTATFN + NST++QILQFL+NTNS+YMLNAYPYYEY
Sbjct  145  NLNYLVKVSTPHSMGIISRPFPPSTATFNATWNSTIYQILQFLKNTNSFYMLNAYPYYEY  204

Query  691  VKSD  702
            VKS+
Sbjct  205  VKSN  208



>gb|AFK37243.1| unknown [Medicago truncatula]
Length=498

 Score =   255 bits (652),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 136/184 (74%), Positives = 159/184 (86%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            VG+NIGTDVS++PSA +VV +LKA QI HVRL+DA+AH+L ALS T I+V+VGVTN EVL
Sbjct  26   VGVNIGTDVSDMPSASNVVAILKANQITHVRLYDANAHLLQALSKTNIDVMVGVTNEEVL  85

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
             IG+S S AAAW+NKNV AY+PSTNITAIAVGSEVL++IPN APVLVPAMN LHKALV+A
Sbjct  86   RIGESPSAAAAWINKNVVAYVPSTNITAIAVGSEVLSTIPNVAPVLVPAMNSLHKALVAA  145

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NLN +VKV TPQS D+I K FPPSTATFN S NST++Q+LQFL+NTNS +MLNAYPYY Y
Sbjct  146  NLNFRVKVPTPQSMDIIPKPFPPSTATFNSSWNSTIYQVLQFLRNTNSSFMLNAYPYYGY  205

Query  691  VKSD  702
             K D
Sbjct  206  TKGD  209



>ref|XP_010673492.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Beta vulgaris 
subsp. vulgaris]
Length=492

 Score =   255 bits (651),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 134/184 (73%), Positives = 157/184 (85%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +GI+IGT +S LP A DVV +L   +I HVRLFDADAHML AL+NT IEV+VGVTN EVL
Sbjct  25   IGIDIGTHLSKLPPASDVVAILTDNKITHVRLFDADAHMLRALANTSIEVMVGVTNEEVL  84

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIGQS S AAAWVNKNVAAY+P TNITAIAVGSEVLT+IP+AAP+LVPAMN LHKALV++
Sbjct  85   GIGQSPSVAAAWVNKNVAAYVPGTNITAIAVGSEVLTAIPHAAPILVPAMNNLHKALVAS  144

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NLN +VKVSTP S D+I++ FPPSTA FN S NST++Q+LQFL+NTNSY+MLNAYPY+ Y
Sbjct  145  NLNFKVKVSTPHSMDIISRPFPPSTAIFNSSWNSTMYQVLQFLKNTNSYFMLNAYPYHGY  204

Query  691  VKSD  702
               D
Sbjct  205  TTGD  208



>ref|XP_008354986.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X2 
[Malus domestica]
Length=475

 Score =   251 bits (640),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 130/168 (77%), Positives = 149/168 (89%), Gaps = 0/168 (0%)
 Frame = +1

Query  199  DVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVLGIGQSSSQAAAWVNKN  378
            D V LLKA QI HVRL++ADAHML ALSN+GIEV+VGVTN EVLGIG+S+S AAAW+NKN
Sbjct  23   DTVALLKAHQITHVRLYNADAHMLKALSNSGIEVMVGVTNEEVLGIGESASAAAAWINKN  82

Query  379  VAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSANLNSQVKVSTPQSTDL  558
            VAAYLPSTNITAIAVGSEV+T+IPNAAPVLV AMNYLHKALV++NLN Q+KVSTPQS D+
Sbjct  83   VAAYLPSTNITAIAVGSEVITTIPNAAPVLVSAMNYLHKALVASNLNFQIKVSTPQSMDI  142

Query  559  IAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEYVKSD  702
            I K FPPSTATFN+S   T+++ILQF++NTNSYYMLNAYPYY Y   D
Sbjct  143  IPKPFPPSTATFNYSWGPTIYRILQFIKNTNSYYMLNAYPYYGYTSGD  190



>ref|XP_004502208.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X2 
[Cicer arietinum]
Length=478

 Score =   250 bits (638),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 132/184 (72%), Positives = 157/184 (85%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            VG+NIG+DVS+LPSA +VV +LK+ QI HVRL+DA+ HML ALSNTGIEV+VGVT+ E+L
Sbjct  8    VGVNIGSDVSDLPSASNVVTILKSHQITHVRLYDANPHMLQALSNTGIEVLVGVTDEEIL  67

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
             IG S S AA+W+ KNVAAY+P TNIT+IAVGS+VLTSIPN APVLVPAMN+LH ALV++
Sbjct  68   TIGDSPSVAASWITKNVAAYMPHTNITSIAVGSQVLTSIPNVAPVLVPAMNHLHSALVAS  127

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL+ +VKVSTPQS DLI + FPPSTATFN S NST+ Q+LQFL+NTNS YMLNAYPYY Y
Sbjct  128  NLHFRVKVSTPQSMDLIPRPFPPSTATFNSSWNSTIHQLLQFLKNTNSSYMLNAYPYYGY  187

Query  691  VKSD  702
               D
Sbjct  188  TNGD  191



>ref|XP_004502207.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X1 
[Cicer arietinum]
Length=506

 Score =   250 bits (639),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 132/184 (72%), Positives = 157/184 (85%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            VG+NIG+DVS+LPSA +VV +LK+ QI HVRL+DA+ HML ALSNTGIEV+VGVT+ E+L
Sbjct  36   VGVNIGSDVSDLPSASNVVTILKSHQITHVRLYDANPHMLQALSNTGIEVLVGVTDEEIL  95

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
             IG S S AA+W+ KNVAAY+P TNIT+IAVGS+VLTSIPN APVLVPAMN+LH ALV++
Sbjct  96   TIGDSPSVAASWITKNVAAYMPHTNITSIAVGSQVLTSIPNVAPVLVPAMNHLHSALVAS  155

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL+ +VKVSTPQS DLI + FPPSTATFN S NST+ Q+LQFL+NTNS YMLNAYPYY Y
Sbjct  156  NLHFRVKVSTPQSMDLIPRPFPPSTATFNSSWNSTIHQLLQFLKNTNSSYMLNAYPYYGY  215

Query  691  VKSD  702
               D
Sbjct  216  TNGD  219



>ref|XP_003601614.1| Glucan endo-1,3-beta-glucosidase [Medicago truncatula]
 gb|AES71865.1| O-glycosyl hydrolase family 17 protein [Medicago truncatula]
Length=498

 Score =   248 bits (634),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 131/184 (71%), Positives = 157/184 (85%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            VG+NIGT V++LPSA ++V +LK+ QI HVRL+DA+AHML ALSNTGIE++VGVT+ E+L
Sbjct  26   VGVNIGTHVTDLPSASNIVAILKSHQITHVRLYDANAHMLQALSNTGIELLVGVTDEEIL  85

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
             IG+S S AA W++KNVAAY+P TNIT IAVGSEVLTSIPN A VLVPAMN+LH ALV++
Sbjct  86   RIGESPSVAATWISKNVAAYMPHTNITTIAVGSEVLTSIPNVARVLVPAMNHLHSALVAS  145

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL+ +VK+STPQS DLI K FPPSTATFN S NST+ QILQFL+NTNS YMLNA+PYY Y
Sbjct  146  NLHFRVKISTPQSMDLIPKPFPPSTATFNSSWNSTIHQILQFLKNTNSSYMLNAHPYYGY  205

Query  691  VKSD  702
             K D
Sbjct  206  TKGD  209



>ref|XP_010673491.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Beta vulgaris 
subsp. vulgaris]
Length=493

 Score =   247 bits (630),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 131/184 (71%), Positives = 155/184 (84%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +GI+IGT +S LP A DVV++L    I HVRLFDADAHML AL++T IEV+VGVTN EVL
Sbjct  25   IGIDIGTHLSKLPQASDVVDILTNNVITHVRLFDADAHMLRALASTSIEVMVGVTNEEVL  84

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIGQS S AAAWVNKNVAAY+P TNITAIAVGSEVLT+IP+AAP+LVPAMN LHKALV++
Sbjct  85   GIGQSQSVAAAWVNKNVAAYVPGTNITAIAVGSEVLTAIPHAAPILVPAMNNLHKALVAS  144

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
             LN +VKVSTP S D+I++ FPPSTA FN S NST++Q+LQFL+NTNS +MLNAYPY+ Y
Sbjct  145  KLNLKVKVSTPHSMDIISRPFPPSTAIFNSSWNSTMYQVLQFLKNTNSCFMLNAYPYHGY  204

Query  691  VKSD  702
               D
Sbjct  205  TTGD  208



>gb|KHG04722.1| hypothetical protein F383_29074 [Gossypium arboreum]
Length=495

 Score =   246 bits (629),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 133/184 (72%), Positives = 161/184 (88%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +GINIGTDVS++PSA +VV ++K  +I HVRL+DAD+HML AL+++GIEV VGVTN EVL
Sbjct  26   IGINIGTDVSSMPSASEVVSIIKTHRITHVRLYDADSHMLKALADSGIEVTVGVTNEEVL  85

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIG+S+S AAAWV+KNVA+Y+PSTNITAIAVGSEVLTSIP+AAP+LV AMN LHKALV++
Sbjct  86   GIGESASAAAAWVSKNVASYVPSTNITAIAVGSEVLTSIPHAAPILVTAMNNLHKALVAS  145

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NLN QVKVS+PQS D+I + FPPSTA FN S NSTV+Q+LQFL NTNSY+MLNAYPYY Y
Sbjct  146  NLNFQVKVSSPQSLDIIPEPFPPSTAAFNSSPNSTVYQLLQFLNNTNSYFMLNAYPYYGY  205

Query  691  VKSD  702
               +
Sbjct  206  TNGN  209



>ref|XP_004139073.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Cucumis sativus]
 gb|KGN66575.1| hypothetical protein Csa_1G630300 [Cucumis sativus]
Length=495

 Score =   243 bits (621),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 128/199 (64%), Positives = 160/199 (80%), Gaps = 6/199 (3%)
 Frame = +1

Query  124  VIVQFRRCV------VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSN  285
            +++ F  C+      VG+N+GT VSNLPSA D+V +LK+ QI H+RL++AD  +L AL+N
Sbjct  10   ILLLFGMCINALGAFVGVNLGTGVSNLPSASDIVAILKSHQITHLRLYNADFQLLKALTN  69

Query  286  TGIEVIVGVTNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPV  465
            + IEVIVGVTN EVL IG+S + AAAWVNKNVAA+LP TNITAIAVGSEVLT+IP+  PV
Sbjct  70   SSIEVIVGVTNEEVLRIGESPAAAAAWVNKNVAAHLPGTNITAIAVGSEVLTTIPHVGPV  129

Query  466  LVPAMNYLHKALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQN  645
            LVPAM  LHKALV+ANLN  +KVSTPQS D+I + FPPSTA+F+ S NST++Q+LQFL+N
Sbjct  130  LVPAMYSLHKALVAANLNYLIKVSTPQSMDIIPRAFPPSTASFDASWNSTIYQLLQFLKN  189

Query  646  TNSYYMLNAYPYYEYVKSD  702
            T S+YMLNAYPYY Y   +
Sbjct  190  TKSFYMLNAYPYYGYTSGN  208



>ref|XP_008450301.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Cucumis melo]
Length=495

 Score =   243 bits (620),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 129/199 (65%), Positives = 159/199 (80%), Gaps = 6/199 (3%)
 Frame = +1

Query  124  VIVQFRRCV------VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSN  285
            V++ F  C+      VG+N+GT VSNLPS  D+V +LK+ QI H+RL++AD  +L AL+N
Sbjct  10   VLLLFGMCINALGAFVGVNLGTSVSNLPSPSDIVAILKSHQITHLRLYNADPQLLKALAN  69

Query  286  TGIEVIVGVTNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPV  465
            + IEVIVGVTN EVL IG+S + AAAWVNKNVAA+LP TNITAIAVGSEVLT+IP+  PV
Sbjct  70   SSIEVIVGVTNEEVLRIGESPAAAAAWVNKNVAAHLPGTNITAIAVGSEVLTTIPHVGPV  129

Query  466  LVPAMNYLHKALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQN  645
            LVPAM  LHKALV+ANLN  +KVSTPQS D+I + FPPSTA+F+ S NST++Q+LQFL+N
Sbjct  130  LVPAMYSLHKALVAANLNYLIKVSTPQSMDIIPRPFPPSTASFDASWNSTIYQLLQFLKN  189

Query  646  TNSYYMLNAYPYYEYVKSD  702
            T SYYMLNAYPYY Y   +
Sbjct  190  TKSYYMLNAYPYYGYTSGN  208



>gb|EYU27069.1| hypothetical protein MIMGU_mgv1a004989mg [Erythranthe guttata]
Length=501

 Score =   243 bits (620),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 126/196 (64%), Positives = 162/196 (83%), Gaps = 0/196 (0%)
 Frame = +1

Query  115  YMRVIVQFRRCVVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGI  294
            ++ V+V      +G+NIGTDV+NLP   ++V +L+A QI HVRLFD+DA +L+ALS TGI
Sbjct  13   FVGVLVNSVGAYIGVNIGTDVTNLPPPVEIVAILRAHQITHVRLFDSDARILNALSATGI  72

Query  295  EVIVGVTNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVP  474
            +V V VTN EVLGIG+S+S AA W++KN+AAYLPSTNITAI+VGSEVLTS+PNAAP+L  
Sbjct  73   QVHVSVTNQEVLGIGESTSAAATWISKNIAAYLPSTNITAISVGSEVLTSLPNAAPILFS  132

Query  475  AMNYLHKALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNS  654
            AM+ LHKALV++NLN +VK+STP + D+I   FPPSTA FN + N+T+FQILQFL+NT S
Sbjct  133  AMSNLHKALVASNLNDRVKISTPFAMDVIPNPFPPSTANFNSTFNTTIFQILQFLKNTKS  192

Query  655  YYMLNAYPYYEYVKSD  702
            +Y +NAYPYYEYVKS+
Sbjct  193  FYTVNAYPYYEYVKSN  208



>gb|EPS57592.1| hypothetical protein M569_17225, partial [Genlisea aurea]
Length=237

 Score =   234 bits (596),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 119/183 (65%), Positives = 148/183 (81%), Gaps = 0/183 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            VGINIGTD+SN PS  D+V LL++  I HVRLFD+D H+L ALS TGIEV + V N E++
Sbjct  3    VGINIGTDISNPPSPADMVSLLRSHHITHVRLFDSDPHILRALSGTGIEVAITVKNEELV  62

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIG+  S+AA W+N+NV  +LPSTNITA+ VG+EVLTS P+ APVLVPAM  LH+ALVS+
Sbjct  63   GIGEIPSRAADWINRNVVPHLPSTNITAVCVGTEVLTSAPHVAPVLVPAMANLHRALVSS  122

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            +LN  VKVSTP S D++   FPPS+A FN + N+T+F+ILQFL+NT SY+MLNAYPYYEY
Sbjct  123  DLNFLVKVSTPHSMDVVPAPFPPSSAAFNATWNATMFRILQFLRNTESYFMLNAYPYYEY  182

Query  691  VKS  699
            VKS
Sbjct  183  VKS  185



>ref|XP_002884972.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61231.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=501

 Score =   241 bits (616),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 121/184 (66%), Positives = 158/184 (86%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+NIGTD++N+PS  D+V LLK++QI HVRL+DA++HML A +NT IEV+VGVTNNE+L
Sbjct  26   IGVNIGTDLTNMPSPSDIVTLLKSQQITHVRLYDANSHMLKAFANTSIEVMVGVTNNEIL  85

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
             IG+  S AAAWVNKNVAAY+PSTNITAIAVGSEVLT+IP+ AP+L  A+N +HKALV++
Sbjct  86   RIGRFPSAAAAWVNKNVAAYIPSTNITAIAVGSEVLTTIPHVAPILASALNNIHKALVAS  145

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NLN +VKVS+P S D++ K FPPST+TF+ S N+TV+Q+LQFL+NT S++MLNAYPYY Y
Sbjct  146  NLNFKVKVSSPMSMDIMPKPFPPSTSTFSPSWNTTVYQLLQFLKNTGSFFMLNAYPYYGY  205

Query  691  VKSD  702
              ++
Sbjct  206  TTAN  209



>ref|XP_010542461.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Tarenaya 
hassleriana]
 ref|XP_010542462.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Tarenaya 
hassleriana]
Length=509

 Score =   241 bits (615),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 127/205 (62%), Positives = 162/205 (79%), Gaps = 4/205 (2%)
 Frame = +1

Query  100  RNFPAYMRVIVQFRRCV----VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHM  267
            R FP  + +++    C     VG+NIGTD++N+PS  D V LLK+ QI H+RLFDA++HM
Sbjct  5    RWFPDMILLLISILACTNGAFVGVNIGTDITNMPSPSDAVVLLKSHQITHIRLFDANSHM  64

Query  268  LSALSNTGIEVIVGVTNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSI  447
            L AL+ +GIEV V VTN+E+LGIG+  S AA+WVNKNVA+Y+PSTNITAIAVGSEVLT+I
Sbjct  65   LKALAGSGIEVTVSVTNDELLGIGRYPSSAASWVNKNVASYVPSTNITAIAVGSEVLTTI  124

Query  448  PNAAPVLVPAMNYLHKALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQI  627
            P+ AP LV A+N +HKALV+ANLN +VKVS+P S D+I K FPPSTATFN S N+T +Q+
Sbjct  125  PHVAPALVSALNNIHKALVAANLNFRVKVSSPMSMDIIPKPFPPSTATFNASWNATFYQL  184

Query  628  LQFLQNTNSYYMLNAYPYYEYVKSD  702
            L+FL+NT SY+MLNAYPYY Y   +
Sbjct  185  LRFLKNTGSYFMLNAYPYYGYTTGN  209



>dbj|BAH57260.1| AT3G13560 [Arabidopsis thaliana]
Length=452

 Score =   238 bits (606),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 119/184 (65%), Positives = 156/184 (85%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+NIGTD++N+P   D+V LLK++QI HVRL+DA++HML A +NT IEV+VGVTN E+L
Sbjct  26   IGVNIGTDLTNMPPPSDIVTLLKSQQITHVRLYDANSHMLKAFANTSIEVMVGVTNEEIL  85

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
             IG+  S AAAWVNKNVAAY+PSTNITAIAVGSEVLT+IP+ AP+L  A+N +HKALV++
Sbjct  86   KIGRFPSAAAAWVNKNVAAYIPSTNITAIAVGSEVLTTIPHVAPILASALNNIHKALVAS  145

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NLN +VKVS+P S D++ K FPPST+TF+ S N+TV+Q+LQFL+NT S++MLNAYPYY Y
Sbjct  146  NLNFKVKVSSPMSMDIMPKPFPPSTSTFSPSWNTTVYQLLQFLKNTGSFFMLNAYPYYGY  205

Query  691  VKSD  702
              ++
Sbjct  206  TTAN  209



>gb|KGN54064.1| hypothetical protein Csa_4G280410 [Cucumis sativus]
Length=526

 Score =   239 bits (609),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 130/184 (71%), Positives = 151/184 (82%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            VGINIGT VS+LP A DVV +LK  +  HVRL+DA+A +L A +N+  EV+VGVTN EVL
Sbjct  49   VGINIGTHVSSLPPASDVVSMLKQFEFTHVRLYDANAQLLKAFANSSTEVMVGVTNEEVL  108

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
             IG+S S AAAWVNKNV  Y P+TNITAIAVGSEVLTSIPNAA VL+ AM YLHKALV+A
Sbjct  109  KIGKSPSAAAAWVNKNVVLYTPATNITAIAVGSEVLTSIPNAARVLLRAMKYLHKALVAA  168

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NLN Q+KVSTPQS D+I   FPPSTATFN S NST++Q+LQFL+NTNSYYMLN YPYY Y
Sbjct  169  NLNLQIKVSTPQSMDVILTSFPPSTATFNSSLNSTIYQLLQFLKNTNSYYMLNVYPYYGY  228

Query  691  VKSD  702
            +K +
Sbjct  229  IKGN  232



>gb|KJB66065.1| hypothetical protein B456_010G126400 [Gossypium raimondii]
 gb|KJB66068.1| hypothetical protein B456_010G126400 [Gossypium raimondii]
Length=458

 Score =   237 bits (604),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 123/173 (71%), Positives = 148/173 (86%), Gaps = 0/173 (0%)
 Frame = +1

Query  184  LPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVLGIGQSSSQAAA  363
            +PSA +VV ++K  +I HVRL+DAD+HML AL+++GIEV VGVTN EVLGIG+S+S AAA
Sbjct  1    MPSASEVVSIIKTHRITHVRLYDADSHMLKALADSGIEVTVGVTNEEVLGIGESASAAAA  60

Query  364  WVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSANLNSQVKVSTP  543
            WVNKNVA+Y+PSTNITAIAVGSEVLTSIP+AAP+LV AMN LHKALV++NLN QVKVS+P
Sbjct  61   WVNKNVASYVPSTNITAIAVGSEVLTSIPHAAPILVTAMNNLHKALVASNLNFQVKVSSP  120

Query  544  QSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEYVKSD  702
            Q  D+I + FPP TA FN S NSTV+Q+LQFL NTNSY+MLNAYPYY Y   +
Sbjct  121  QPLDIIPEPFPPCTAAFNSSPNSTVYQLLQFLNNTNSYFMLNAYPYYGYTNGN  173



>ref|XP_004142250.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Cucumis sativus]
Length=535

 Score =   239 bits (609),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 130/184 (71%), Positives = 151/184 (82%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            VGINIGT VS+LP A DVV +LK  +  HVRL+DA+A +L A +N+  EV+VGVTN EVL
Sbjct  49   VGINIGTHVSSLPPASDVVSMLKQFEFTHVRLYDANAQLLKAFANSSTEVMVGVTNEEVL  108

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
             IG+S S AAAWVNKNV  Y P+TNITAIAVGSEVLTSIPNAA VL+ AM YLHKALV+A
Sbjct  109  KIGKSPSAAAAWVNKNVVLYTPATNITAIAVGSEVLTSIPNAARVLLRAMKYLHKALVAA  168

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NLN Q+KVSTPQS D+I   FPPSTATFN S NST++Q+LQFL+NTNSYYMLN YPYY Y
Sbjct  169  NLNLQIKVSTPQSMDVILTSFPPSTATFNSSLNSTIYQLLQFLKNTNSYYMLNVYPYYGY  228

Query  691  VKSD  702
            +K +
Sbjct  229  IKGN  232



>ref|NP_187965.1| glucan endo-1,3-beta-glucosidase 4 [Arabidopsis thaliana]
 ref|NP_974302.1| glucan endo-1,3-beta-glucosidase 4 [Arabidopsis thaliana]
 ref|NP_974303.1| glucan endo-1,3-beta-glucosidase 4 [Arabidopsis thaliana]
 sp|Q94CD8.1|E134_ARATH RecName: Full=Glucan endo-1,3-beta-glucosidase 4; AltName: Full=(1->3)-beta-glucan 
endohydrolase 4; Short=(1->3)-beta-glucanase 
4; AltName: Full=Beta-1,3-endoglucanase 4; Short=Beta-1,3-glucanase 
4; Flags: Precursor [Arabidopsis thaliana]
 gb|AAK59446.1| putative glucan endo-1,3-beta-glucosidase precursor [Arabidopsis 
thaliana]
 gb|AAL34291.1| putative glucan endo-1,3-beta-glucosidase precursor [Arabidopsis 
thaliana]
 dbj|BAH19959.1| AT3G13560 [Arabidopsis thaliana]
 gb|AEE75372.1| glucan endo-1,3-beta-glucosidase 4 [Arabidopsis thaliana]
 gb|AEE75373.1| glucan endo-1,3-beta-glucosidase 4 [Arabidopsis thaliana]
 gb|AEE75374.1| glucan endo-1,3-beta-glucosidase 4 [Arabidopsis thaliana]
Length=505

 Score =   238 bits (606),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 119/184 (65%), Positives = 156/184 (85%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+NIGTD++N+P   D+V LLK++QI HVRL+DA++HML A +NT IEV+VGVTN E+L
Sbjct  26   IGVNIGTDLTNMPPPSDIVTLLKSQQITHVRLYDANSHMLKAFANTSIEVMVGVTNEEIL  85

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
             IG+  S AAAWVNKNVAAY+PSTNITAIAVGSEVLT+IP+ AP+L  A+N +HKALV++
Sbjct  86   KIGRFPSAAAAWVNKNVAAYIPSTNITAIAVGSEVLTTIPHVAPILASALNNIHKALVAS  145

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NLN +VKVS+P S D++ K FPPST+TF+ S N+TV+Q+LQFL+NT S++MLNAYPYY Y
Sbjct  146  NLNFKVKVSSPMSMDIMPKPFPPSTSTFSPSWNTTVYQLLQFLKNTGSFFMLNAYPYYGY  205

Query  691  VKSD  702
              ++
Sbjct  206  TTAN  209



>ref|XP_009413316.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Musa acuminata 
subsp. malaccensis]
Length=495

 Score =   237 bits (605),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 126/183 (69%), Positives = 153/183 (84%), Gaps = 0/183 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +GINIGT +S+LPSA ++V +LK +QIKHVRLFDAD  ML+ALSNTGIEV VGV N+++L
Sbjct  25   IGINIGTQMSSLPSAAEIVSILKTQQIKHVRLFDADHQMLNALSNTGIEVTVGVPNDQLL  84

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
             IG+S S+AA W+NKNVAA++P+TNIT IAVG+EVLT+IPNAA VLVPAM +L  ALV+A
Sbjct  85   RIGESRSEAANWINKNVAAFVPATNITCIAVGNEVLTTIPNAALVLVPAMQFLQSALVAA  144

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NLN QVKVS+PQS D+I K FPPSTATFN S NS ++Q LQFL+NT S +MLNA PYY Y
Sbjct  145  NLNFQVKVSSPQSMDMIPKHFPPSTATFNLSWNSVMYQYLQFLKNTGSSFMLNAQPYYAY  204

Query  691  VKS  699
             K 
Sbjct  205  AKG  207



>ref|XP_008449817.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X2 [Cucumis 
melo]
Length=522

 Score =   237 bits (605),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 129/188 (69%), Positives = 151/188 (80%), Gaps = 0/188 (0%)
 Frame = +1

Query  139  RRCVVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTN  318
            R   VGINIGT VS+LP A DVV +LK  +  HVRL+DA+A +L A +N+  EV+VGVTN
Sbjct  42   RGAFVGINIGTHVSSLPPASDVVSMLKQYEFTHVRLYDANAQLLKAFANSSTEVMVGVTN  101

Query  319  NEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKA  498
             EVL IG+S S AAAWVNKNV  Y P+TNITAIAVGSEVLTSIPNAA VL+ AM YLHKA
Sbjct  102  EEVLKIGKSPSAAAAWVNKNVVLYTPATNITAIAVGSEVLTSIPNAARVLIRAMKYLHKA  161

Query  499  LVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYP  678
            LV+ANLN Q+KVSTPQS D+I   FPPSTATFN S NST++Q+LQFL+ TNSYYMLN YP
Sbjct  162  LVAANLNLQIKVSTPQSMDVILTSFPPSTATFNSSLNSTIYQLLQFLKKTNSYYMLNVYP  221

Query  679  YYEYVKSD  702
            Y+ Y+K +
Sbjct  222  YHGYIKGN  229



>ref|XP_004162024.1| PREDICTED: LOW QUALITY PROTEIN: glucan endo-1,3-beta-glucosidase 
4-like [Cucumis sativus]
Length=623

 Score =   239 bits (609),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 130/184 (71%), Positives = 151/184 (82%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            VGINIGT VS+LP A DVV +LK  +  HVRL+DA+A +L A +N+  EV+VGVTN EVL
Sbjct  137  VGINIGTHVSSLPPASDVVSMLKQFEFTHVRLYDANAQLLKAFANSSTEVMVGVTNEEVL  196

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
             IG+S S AAAWVNKNV  Y P+TNITAIAVGSEVLTSIPNAA VL+ AM YLHKALV+A
Sbjct  197  KIGKSPSAAAAWVNKNVVLYTPATNITAIAVGSEVLTSIPNAARVLLRAMKYLHKALVAA  256

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NLN Q+KVSTPQS D+I   FPPSTATFN S NST++Q+LQFL+NTNSYYMLN YPYY Y
Sbjct  257  NLNLQIKVSTPQSMDVILTSFPPSTATFNSSLNSTIYQLLQFLKNTNSYYMLNVYPYYGY  316

Query  691  VKSD  702
            +K +
Sbjct  317  IKGN  320



>ref|XP_009146477.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Brassica rapa]
 ref|XP_009146478.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Brassica rapa]
Length=502

 Score =   235 bits (600),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 122/184 (66%), Positives = 151/184 (82%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+NIGTD++N+PS  D+V LLK+ QI HVRL+DA++HML ALSNT I+V VGVTN E+L
Sbjct  27   IGVNIGTDLTNMPSPSDIVSLLKSHQITHVRLYDANSHMLKALSNTTIQVTVGVTNQEIL  86

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
             IG+  S AA+WVNKNVAAY+PSTNITAIAVGSEVLT  P+ AP+L  A+N +HKALV+ 
Sbjct  87   KIGRFPSSAASWVNKNVAAYVPSTNITAIAVGSEVLTESPHVAPILASALNNIHKALVAT  146

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NLN QVKVSTP S D++ K FPPST+TF+ S N+TV QILQFL NT S++MLNAYPYY Y
Sbjct  147  NLNFQVKVSTPMSMDVMPKPFPPSTSTFSPSWNTTVHQILQFLDNTGSFFMLNAYPYYGY  206

Query  691  VKSD  702
              ++
Sbjct  207  TTAN  210



>ref|XP_009406533.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=500

 Score =   235 bits (599),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 123/183 (67%), Positives = 155/183 (85%), Gaps = 0/183 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +GINIGT +S+LPSA ++V +LK ++IKHVRLFDAD  ML+AL+NTGIEV+VGV N+++L
Sbjct  53   IGINIGTQMSSLPSAAEIVSILKTQRIKHVRLFDADHQMLNALANTGIEVLVGVPNDQLL  112

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
             IG+S S+AAAW+NKNVAA++P+TNIT IAVG+EVLT+IPNAA VL+PAM +LH AL++A
Sbjct  113  RIGESQSEAAAWINKNVAAFVPATNITYIAVGNEVLTTIPNAALVLIPAMQFLHSALLAA  172

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NLN QVKVS+PQS D+I K FPPSTA+FN S NS + Q LQFL+NT S +MLNA PYY Y
Sbjct  173  NLNFQVKVSSPQSMDMIPKHFPPSTASFNSSWNSIMNQYLQFLKNTGSSFMLNAQPYYVY  232

Query  691  VKS  699
             K 
Sbjct  233  TKG  235



>ref|XP_008449819.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X3 [Cucumis 
melo]
Length=498

 Score =   235 bits (599),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 128/184 (70%), Positives = 150/184 (82%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            VGINIGT VS+LP A DVV +LK  +  HVRL+DA+A +L A +N+  EV+VGVTN EVL
Sbjct  22   VGINIGTHVSSLPPASDVVSMLKQYEFTHVRLYDANAQLLKAFANSSTEVMVGVTNEEVL  81

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
             IG+S S AAAWVNKNV  Y P+TNITAIAVGSEVLTSIPNAA VL+ AM YLHKALV+A
Sbjct  82   KIGKSPSAAAAWVNKNVVLYTPATNITAIAVGSEVLTSIPNAARVLIRAMKYLHKALVAA  141

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NLN Q+KVSTPQS D+I   FPPSTATFN S NST++Q+LQFL+ TNSYYMLN YPY+ Y
Sbjct  142  NLNLQIKVSTPQSMDVILTSFPPSTATFNSSLNSTIYQLLQFLKKTNSYYMLNVYPYHGY  201

Query  691  VKSD  702
            +K +
Sbjct  202  IKGN  205



>ref|XP_010552278.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Tarenaya 
hassleriana]
Length=507

 Score =   235 bits (599),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 121/205 (59%), Positives = 163/205 (80%), Gaps = 4/205 (2%)
 Frame = +1

Query  100  RNFPAYMRVIVQFRRCV----VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHM  267
            R F   + ++     C     VG+N+GTD++ +PS  DVV LLK+ QI H+RL++AD+HM
Sbjct  5    RWFADTVSILFALLSCTNGAFVGVNLGTDITKMPSPSDVVSLLKSHQITHIRLYNADSHM  64

Query  268  LSALSNTGIEVIVGVTNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSI  447
            L AL+N+ IEV+VGVTN+E++ IG++ S AA+W+++NV +Y+PSTNITAI++GSEVLT+I
Sbjct  65   LKALANSNIEVMVGVTNDELISIGRNPSSAASWISENVVSYVPSTNITAISIGSEVLTTI  124

Query  448  PNAAPVLVPAMNYLHKALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQI  627
            P+ APVLV A+N +HKALV+ANLN +VKVSTP S D+I K FPPSTATF+ S N+TV+QI
Sbjct  125  PHVAPVLVLALNNVHKALVAANLNFKVKVSTPMSMDIIPKPFPPSTATFDSSWNTTVYQI  184

Query  628  LQFLQNTNSYYMLNAYPYYEYVKSD  702
            L+FL+NT SY+MLNAYPYY Y   D
Sbjct  185  LRFLKNTGSYFMLNAYPYYGYTTGD  209



>ref|XP_009406534.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X3 
[Musa acuminata subsp. malaccensis]
 ref|XP_009406535.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X3 
[Musa acuminata subsp. malaccensis]
 ref|XP_009406536.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X3 
[Musa acuminata subsp. malaccensis]
 ref|XP_009406537.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X3 
[Musa acuminata subsp. malaccensis]
Length=496

 Score =   234 bits (598),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 123/183 (67%), Positives = 155/183 (85%), Gaps = 0/183 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +GINIGT +S+LPSA ++V +LK ++IKHVRLFDAD  ML+AL+NTGIEV+VGV N+++L
Sbjct  25   IGINIGTQMSSLPSAAEIVSILKTQRIKHVRLFDADHQMLNALANTGIEVLVGVPNDQLL  84

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
             IG+S S+AAAW+NKNVAA++P+TNIT IAVG+EVLT+IPNAA VL+PAM +LH AL++A
Sbjct  85   RIGESQSEAAAWINKNVAAFVPATNITYIAVGNEVLTTIPNAALVLIPAMQFLHSALLAA  144

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NLN QVKVS+PQS D+I K FPPSTA+FN S NS + Q LQFL+NT S +MLNA PYY Y
Sbjct  145  NLNFQVKVSSPQSMDMIPKHFPPSTASFNSSWNSIMNQYLQFLKNTGSSFMLNAQPYYVY  204

Query  691  VKS  699
             K 
Sbjct  205  TKG  207



>ref|XP_008449814.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X1 [Cucumis 
melo]
 ref|XP_008449815.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X1 [Cucumis 
melo]
 ref|XP_008449816.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X1 [Cucumis 
melo]
Length=525

 Score =   235 bits (600),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 128/184 (70%), Positives = 150/184 (82%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            VGINIGT VS+LP A DVV +LK  +  HVRL+DA+A +L A +N+  EV+VGVTN EVL
Sbjct  49   VGINIGTHVSSLPPASDVVSMLKQYEFTHVRLYDANAQLLKAFANSSTEVMVGVTNEEVL  108

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
             IG+S S AAAWVNKNV  Y P+TNITAIAVGSEVLTSIPNAA VL+ AM YLHKALV+A
Sbjct  109  KIGKSPSAAAAWVNKNVVLYTPATNITAIAVGSEVLTSIPNAARVLIRAMKYLHKALVAA  168

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NLN Q+KVSTPQS D+I   FPPSTATFN S NST++Q+LQFL+ TNSYYMLN YPY+ Y
Sbjct  169  NLNLQIKVSTPQSMDVILTSFPPSTATFNSSLNSTIYQLLQFLKKTNSYYMLNVYPYHGY  228

Query  691  VKSD  702
            +K +
Sbjct  229  IKGN  232



>ref|NP_001060087.2| Os07g0577300 [Oryza sativa Japonica Group]
 dbj|BAH01358.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF22001.2| Os07g0577300 [Oryza sativa Japonica Group]
Length=498

 Score =   234 bits (598),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 121/193 (63%), Positives = 155/193 (80%), Gaps = 0/193 (0%)
 Frame = +1

Query  118  MRVIVQFRRCVVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIE  297
            M ++       VGIN+GTD+SN PSA D V +LK ++I+HVRL D+D  MLSAL+NTGIE
Sbjct  20   MLMVFNVSGAFVGINVGTDISNPPSASDTVSILKEKKIQHVRLLDSDHQMLSALANTGIE  79

Query  298  VIVGVTNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPA  477
            V+VGV N+++L +GQS S AA W+NKNVAAY+P+TNIT IAVG+EVLT+ PNAA VLVPA
Sbjct  80   VVVGVPNDQLLRVGQSRSTAADWINKNVAAYIPATNITHIAVGNEVLTTEPNAALVLVPA  139

Query  478  MNYLHKALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSY  657
            + +L  AL++ANLN+QVK+S+P STD+I+K FPPSTATFN + +S + Q LQFL NT S 
Sbjct  140  LQFLQSALLAANLNTQVKISSPHSTDMISKPFPPSTATFNSTWSSIMLQYLQFLNNTASP  199

Query  658  YMLNAYPYYEYVK  696
            +MLNA PYY+YVK
Sbjct  200  FMLNAQPYYDYVK  212



>ref|XP_006407197.1| hypothetical protein EUTSA_v10020572mg [Eutrema salsugineum]
 ref|XP_006407198.1| hypothetical protein EUTSA_v10020572mg [Eutrema salsugineum]
 ref|XP_006407199.1| hypothetical protein EUTSA_v10020572mg [Eutrema salsugineum]
 gb|ESQ48650.1| hypothetical protein EUTSA_v10020572mg [Eutrema salsugineum]
 gb|ESQ48651.1| hypothetical protein EUTSA_v10020572mg [Eutrema salsugineum]
 gb|ESQ48652.1| hypothetical protein EUTSA_v10020572mg [Eutrema salsugineum]
Length=500

 Score =   234 bits (598),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 118/195 (61%), Positives = 157/195 (81%), Gaps = 0/195 (0%)
 Frame = +1

Query  118  MRVIVQFRRCVVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIE  297
            + ++       +G+NIGT ++N+PS  D+V LLK+RQI HVRL+DA++HML A +NT IE
Sbjct  12   ISILATTNAAFIGVNIGTGLTNMPSPSDIVTLLKSRQITHVRLYDANSHMLKAFANTSIE  71

Query  298  VIVGVTNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPA  477
            V+VGVTN E+L IG+  S AA+WVNKNVAAY+PSTNITAIAVGSEVLT  P+ AP+L  A
Sbjct  72   VMVGVTNEEILKIGRYPSAAASWVNKNVAAYVPSTNITAIAVGSEVLTITPHVAPILASA  131

Query  478  MNYLHKALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSY  657
            +N +HKALV++NLN +VKVS+P S D++ K FPPST+TF+ S N+TV+Q+LQFL+NT S+
Sbjct  132  LNNIHKALVASNLNFKVKVSSPMSMDIMPKPFPPSTSTFSPSWNTTVYQLLQFLKNTGSF  191

Query  658  YMLNAYPYYEYVKSD  702
            +MLNAYPYY Y  ++
Sbjct  192  FMLNAYPYYGYTTAN  206



>ref|XP_009406531.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X1 
[Musa acuminata subsp. malaccensis]
 ref|XP_009406532.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=524

 Score =   235 bits (599),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 123/183 (67%), Positives = 155/183 (85%), Gaps = 0/183 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +GINIGT +S+LPSA ++V +LK ++IKHVRLFDAD  ML+AL+NTGIEV+VGV N+++L
Sbjct  53   IGINIGTQMSSLPSAAEIVSILKTQRIKHVRLFDADHQMLNALANTGIEVLVGVPNDQLL  112

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
             IG+S S+AAAW+NKNVAA++P+TNIT IAVG+EVLT+IPNAA VL+PAM +LH AL++A
Sbjct  113  RIGESQSEAAAWINKNVAAFVPATNITYIAVGNEVLTTIPNAALVLIPAMQFLHSALLAA  172

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NLN QVKVS+PQS D+I K FPPSTA+FN S NS + Q LQFL+NT S +MLNA PYY Y
Sbjct  173  NLNFQVKVSSPQSMDMIPKHFPPSTASFNSSWNSIMNQYLQFLKNTGSSFMLNAQPYYVY  232

Query  691  VKS  699
             K 
Sbjct  233  TKG  235



>gb|EEC82319.1| hypothetical protein OsI_26597 [Oryza sativa Indica Group]
Length=521

 Score =   234 bits (598),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 120/182 (66%), Positives = 153/182 (84%), Gaps = 0/182 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            VGIN+GTD+SN PSA D+V +LK ++I+HVRL D+D  MLSAL+NTGIEV+VGV N+++L
Sbjct  54   VGINVGTDISNPPSASDIVSILKEKKIQHVRLLDSDHQMLSALANTGIEVVVGVPNDQLL  113

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
             +GQS S AA W+NKNVAAY+P+TNIT IAVG+EVLT+ PNAA VLVPA+ +L  AL++A
Sbjct  114  RVGQSRSTAADWINKNVAAYIPATNITHIAVGNEVLTTEPNAALVLVPALQFLQSALLAA  173

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NLN+QVK+S+P STD+I+K FPPSTATFN + +S + Q LQFL NT S +MLNA PYY+Y
Sbjct  174  NLNTQVKISSPHSTDMISKPFPPSTATFNSTWSSIMLQYLQFLNNTASPFMLNAQPYYDY  233

Query  691  VK  696
            VK
Sbjct  234  VK  235



>ref|XP_010500722.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Camelina sativa]
 ref|XP_010500729.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Camelina sativa]
Length=507

 Score =   234 bits (596),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 120/205 (59%), Positives = 162/205 (79%), Gaps = 4/205 (2%)
 Frame = +1

Query  100  RNFPAYMRVIVQFRRC----VVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHM  267
            R F     +++    C     +G+NIGTDV+N+PS  D+V LL ++QI HVRL+DA++HM
Sbjct  5    RWFAEAFLLLISILACSNAAFIGVNIGTDVTNMPSPSDIVALLNSQQITHVRLYDANSHM  64

Query  268  LSALSNTGIEVIVGVTNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSI  447
            L A +NT IEV+VGVTN E+L IG+  S AAAWVNKNVAAY+PSTNITAIAVGSEVL++ 
Sbjct  65   LKAFANTSIEVMVGVTNGEILKIGRFPSAAAAWVNKNVAAYVPSTNITAIAVGSEVLSAA  124

Query  448  PNAAPVLVPAMNYLHKALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQI  627
            P+ AP+L  A++ +HKALV++NLN +VKVS+P S D++ K FPPST+TF+ S N+TV+Q+
Sbjct  125  PHVAPILASALHNIHKALVASNLNFKVKVSSPMSMDIMPKPFPPSTSTFSPSWNTTVYQL  184

Query  628  LQFLQNTNSYYMLNAYPYYEYVKSD  702
            LQFL+NT+S++MLNAYPYY Y  ++
Sbjct  185  LQFLKNTDSFFMLNAYPYYGYTAAN  209



>ref|XP_006658732.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Oryza brachyantha]
Length=457

 Score =   232 bits (592),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 117/182 (64%), Positives = 153/182 (84%), Gaps = 0/182 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            VGIN+GTD+S  PSA D+V +LK ++I+HVRL D+D  ML+AL+NTGIEV+VGV N+++L
Sbjct  35   VGINVGTDISKPPSASDIVSILKEKKIQHVRLLDSDHQMLTALANTGIEVMVGVPNDQLL  94

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
             +GQS S AA W+NKNVAAY+P+TNIT IAVG+EVLT++PNAA VL+PA+ +L  AL++A
Sbjct  95   RVGQSRSTAADWINKNVAAYIPATNITYIAVGNEVLTTVPNAALVLIPALQFLQSALLAA  154

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NLN+QVK+S+P STD+I+K FPPSTATFN + +S + Q LQFL NT S +MLNA PYY+Y
Sbjct  155  NLNTQVKISSPHSTDMISKPFPPSTATFNSTWSSIMSQYLQFLNNTGSSFMLNAQPYYDY  214

Query  691  VK  696
            VK
Sbjct  215  VK  216



>ref|XP_010465199.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Camelina sativa]
 ref|XP_010465200.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Camelina sativa]
Length=507

 Score =   233 bits (595),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 156/184 (85%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+NIGTDV+N+PS  D+V LL ++QI HVRL+DA++HML A +NT IEV+VGVTN E+L
Sbjct  26   IGVNIGTDVTNMPSPSDIVALLNSQQITHVRLYDANSHMLKAFANTSIEVMVGVTNGEIL  85

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
             IG+  S AAAWVNKNVAAY+PSTNITAIAVGSEVL++ P+ AP+L  A++ +HKALV++
Sbjct  86   KIGRFPSAAAAWVNKNVAAYVPSTNITAIAVGSEVLSAAPHVAPILASALHNIHKALVAS  145

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NLN +VKVS+P S D++ K FPPST+TF+ S N+TV+Q+LQFL+NT+S++MLNAYPYY Y
Sbjct  146  NLNFKVKVSSPMSMDIMPKPFPPSTSTFSPSWNTTVYQLLQFLKNTDSFFMLNAYPYYGY  205

Query  691  VKSD  702
              ++
Sbjct  206  TAAN  209



>gb|EEE67465.1| hypothetical protein OsJ_24859 [Oryza sativa Japonica Group]
Length=555

 Score =   234 bits (597),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 120/182 (66%), Positives = 152/182 (84%), Gaps = 0/182 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            VGIN+GTD+SN PSA D V +LK ++I+HVRL D+D  MLSAL+NTGIEV+VGV N+++L
Sbjct  88   VGINVGTDISNPPSASDTVSILKEKKIQHVRLLDSDHQMLSALANTGIEVVVGVPNDQLL  147

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
             +GQS S AA W+NKNVAAY+P+TNIT IAVG+EVLT+ PNAA VLVPA+ +L  AL++A
Sbjct  148  RVGQSRSTAADWINKNVAAYIPATNITHIAVGNEVLTTEPNAALVLVPALQFLQSALLAA  207

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NLN+QVK+S+P STD+I+K FPPSTATFN + +S + Q LQFL NT S +MLNA PYY+Y
Sbjct  208  NLNTQVKISSPHSTDMISKPFPPSTATFNSTWSSIMLQYLQFLNNTASPFMLNAQPYYDY  267

Query  691  VK  696
            VK
Sbjct  268  VK  269



>ref|XP_008789151.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X2 [Phoenix 
dactylifera]
Length=460

 Score =   231 bits (589),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 120/183 (66%), Positives = 151/183 (83%), Gaps = 0/183 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            VGI IGTD+SNLPSA D+V +LKA+ IKHVRLFD D  ML+AL+NTGIEV+VGV N+++L
Sbjct  20   VGITIGTDMSNLPSASDIVSILKAQHIKHVRLFDTDHQMLNALANTGIEVMVGVPNDQLL  79

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
             +GQS + AA W+NKNVA+++P+TNIT IAVG+EVL++IPNA+ VLVPAM +L  ALV+A
Sbjct  80   SVGQSRTVAADWINKNVASFVPATNITYIAVGNEVLSTIPNASLVLVPAMKFLQSALVAA  139

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NLN QVKVS+PQS D++ K FPP TATFN + NS ++Q LQFL+NT S +MLNA PYY Y
Sbjct  140  NLNFQVKVSSPQSMDVMPKSFPPFTATFNSTWNSVMYQYLQFLKNTGSSFMLNAQPYYGY  199

Query  691  VKS  699
             K 
Sbjct  200  TKG  202



>ref|XP_008789143.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X1 [Phoenix 
dactylifera]
Length=486

 Score =   231 bits (589),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 120/183 (66%), Positives = 151/183 (83%), Gaps = 0/183 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            VGI IGTD+SNLPSA D+V +LKA+ IKHVRLFD D  ML+AL+NTGIEV+VGV N+++L
Sbjct  20   VGITIGTDMSNLPSASDIVSILKAQHIKHVRLFDTDHQMLNALANTGIEVMVGVPNDQLL  79

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
             +GQS + AA W+NKNVA+++P+TNIT IAVG+EVL++IPNA+ VLVPAM +L  ALV+A
Sbjct  80   SVGQSRTVAADWINKNVASFVPATNITYIAVGNEVLSTIPNASLVLVPAMKFLQSALVAA  139

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NLN QVKVS+PQS D++ K FPP TATFN + NS ++Q LQFL+NT S +MLNA PYY Y
Sbjct  140  NLNFQVKVSSPQSMDVMPKSFPPFTATFNSTWNSVMYQYLQFLKNTGSSFMLNAQPYYGY  199

Query  691  VKS  699
             K 
Sbjct  200  TKG  202



>ref|XP_006297495.1| hypothetical protein CARUB_v10013514mg [Capsella rubella]
 gb|EOA30393.1| hypothetical protein CARUB_v10013514mg [Capsella rubella]
Length=499

 Score =   231 bits (588),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 116/195 (59%), Positives = 159/195 (82%), Gaps = 0/195 (0%)
 Frame = +1

Query  118  MRVIVQFRRCVVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIE  297
            + ++       +G+NIGTD++N+PS  +VVELL ++QI HVRL+DA++HML A +N+ IE
Sbjct  15   ITILASSDAAFIGVNIGTDLTNMPSPSEVVELLNSQQITHVRLYDANSHMLKAFANSSIE  74

Query  298  VIVGVTNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPA  477
            V+VGVTN E+L IG+  S AAAWVNKNVAAY+PSTNITAIAVGSEVLT+ P+ AP+L  A
Sbjct  75   VMVGVTNEEILKIGRFPSAAAAWVNKNVAAYIPSTNITAIAVGSEVLTTNPHVAPILASA  134

Query  478  MNYLHKALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSY  657
            ++ +HKALV++NLN +VKVS+P S  ++ K FPPST+TF+ S N+TV+Q+LQFL+NT+S+
Sbjct  135  LHNIHKALVASNLNFKVKVSSPMSMGIMPKPFPPSTSTFSPSWNTTVYQLLQFLENTDSF  194

Query  658  YMLNAYPYYEYVKSD  702
            +MLNAYPYY Y  ++
Sbjct  195  FMLNAYPYYGYTTAN  209



>dbj|BAC83070.1| putative elicitor inducible beta-1,3-glucanase [Oryza sativa 
Japonica Group]
Length=666

 Score =   234 bits (596),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 121/194 (62%), Positives = 155/194 (80%), Gaps = 0/194 (0%)
 Frame = +1

Query  118  MRVIVQFRRCVVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIE  297
            M ++       VGIN+GTD+SN PSA D V +LK ++I+HVRL D+D  MLSAL+NTGIE
Sbjct  14   MLMVFNVSGAFVGINVGTDISNPPSASDTVSILKEKKIQHVRLLDSDHQMLSALANTGIE  73

Query  298  VIVGVTNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPA  477
            V+VGV N+++L +GQS S AA W+NKNVAAY+P+TNIT IAVG+EVLT+ PNAA VLVPA
Sbjct  74   VVVGVPNDQLLRVGQSRSTAADWINKNVAAYIPATNITHIAVGNEVLTTEPNAALVLVPA  133

Query  478  MNYLHKALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSY  657
            + +L  AL++ANLN+QVK+S+P STD+I+K FPPSTATFN + +S + Q LQFL NT S 
Sbjct  134  LQFLQSALLAANLNTQVKISSPHSTDMISKPFPPSTATFNSTWSSIMLQYLQFLNNTASP  193

Query  658  YMLNAYPYYEYVKS  699
            +MLNA PYY+YVK 
Sbjct  194  FMLNAQPYYDYVKG  207



>gb|EMT26371.1| Glucan endo-1,3-beta-glucosidase 4 [Aegilops tauschii]
Length=390

 Score =   226 bits (576),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 117/183 (64%), Positives = 150/183 (82%), Gaps = 0/183 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            VGINIGT+VS+LPSA D+V +LKA++I+HVRL D++  ML AL+NTGIEV+VGV NNE+L
Sbjct  57   VGINIGTNVSDLPSASDIVSILKAKKIQHVRLVDSNHEMLVALANTGIEVMVGVPNNELL  116

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
             +GQS   AA W+NKNVAAY+P+TNIT IAVG E+LT++PNAA VLVPA+ +L  AL++A
Sbjct  117  RVGQSRPTAADWINKNVAAYIPATNITYIAVGDEILTTVPNAALVLVPALQFLQSALLAA  176

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NLN+QVK+S+P S D+I+K FPPSTATFN + +S + Q L FL+ T S +MLNA PYY Y
Sbjct  177  NLNTQVKLSSPHSMDMISKAFPPSTATFNSTWSSIMLQYLGFLKKTGSSFMLNAQPYYGY  236

Query  691  VKS  699
            VK 
Sbjct  237  VKG  239



>ref|XP_010934539.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Elaeis guineensis]
 ref|XP_010934546.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Elaeis guineensis]
 ref|XP_010934552.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Elaeis guineensis]
Length=492

 Score =   228 bits (582),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 120/183 (66%), Positives = 151/183 (83%), Gaps = 0/183 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            VGI IGTD+SNLPSA D+V +LKA++IKHVRLFD D  ML+AL+NTGIEV+VGV N+++L
Sbjct  26   VGITIGTDMSNLPSASDIVSILKAQRIKHVRLFDTDHQMLNALANTGIEVMVGVPNDQLL  85

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
             IGQS + AA W+NKNVAA++P+TNIT IAVG+EVL++IPNA+ VLVPAM +L  ALV+A
Sbjct  86   SIGQSRTVAADWINKNVAAFVPATNITYIAVGNEVLSTIPNASFVLVPAMKFLQSALVAA  145

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NLN  VKVS+PQS D++ K FPP TATFN + NS +++ LQFL+NT S +MLNA PYY Y
Sbjct  146  NLNFLVKVSSPQSMDVMPKSFPPFTATFNSTWNSVMYEYLQFLKNTGSSFMLNAQPYYGY  205

Query  691  VKS  699
             K 
Sbjct  206  TKG  208



>tpg|DAA63295.1| TPA: putative O-Glycosyl hydrolase superfamily protein isoform 
1 [Zea mays]
 tpg|DAA63296.1| TPA: putative O-Glycosyl hydrolase superfamily protein isoform 
2 [Zea mays]
Length=494

 Score =   226 bits (577),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 117/196 (60%), Positives = 153/196 (78%), Gaps = 0/196 (0%)
 Frame = +1

Query  106  FPAYMRVIVQFRRCVVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSN  285
            F   M ++       VGI IG D+SN+P A D+V +LKA++I+HVRL D+D  ML+AL+N
Sbjct  10   FTLLMLMVFNVSGAFVGITIGNDMSNIPPATDIVSILKAKKIQHVRLLDSDHQMLNALAN  69

Query  286  TGIEVIVGVTNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPV  465
            TGIEV+VGV N+++L +GQS S AA W+NKNV AY+P+TNIT IAVG+EVLT+IPNAA V
Sbjct  70   TGIEVMVGVPNDQLLRVGQSRSTAADWINKNVGAYIPATNITYIAVGNEVLTTIPNAALV  129

Query  466  LVPAMNYLHKALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQN  645
            LVPA+ +L  AL++ANLN+QVK+S+P S D+I+K FPPS ATFN + +S + Q LQFL+N
Sbjct  130  LVPALQFLQSALLAANLNTQVKISSPHSMDVISKAFPPSAATFNLTWSSIMSQYLQFLKN  189

Query  646  TNSYYMLNAYPYYEYV  693
            T S +MLNA PYY YV
Sbjct  190  TGSSFMLNAQPYYGYV  205



>ref|XP_009762818.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Nicotiana 
sylvestris]
Length=508

 Score =   227 bits (578),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 115/188 (61%), Positives = 149/188 (79%), Gaps = 0/188 (0%)
 Frame = +1

Query  139  RRCVVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTN  318
                VG+NIGTDVS++PS   VV LLKA+QI+HVRLFDAD  ML AL+NTGI V V V N
Sbjct  29   EEAFVGVNIGTDVSDMPSPAKVVALLKAQQIRHVRLFDADQAMLLALANTGIHVTVSVPN  88

Query  319  NEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKA  498
            +++LGIGQS+S AA WV++N+  + P+TNITAIA+GSEVLTS+PNAAPVLV AM ++H A
Sbjct  89   DQLLGIGQSNSTAANWVSRNILTHFPATNITAIAIGSEVLTSLPNAAPVLVSAMRFIHSA  148

Query  499  LVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYP  678
            LV+ANL+S++KVSTP S+ ++   FPPS A FN S +  +  +L+FLQ+T SY MLN YP
Sbjct  149  LVAANLDSKIKVSTPHSSSIVLDSFPPSQAFFNRSLDPVMVPLLKFLQSTGSYLMLNVYP  208

Query  679  YYEYVKSD  702
            YY+Y+KS+
Sbjct  209  YYDYMKSN  216



>ref|XP_010236492.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Brachypodium distachyon]
Length=501

 Score =   226 bits (576),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 117/182 (64%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            VG+++GT VS+LPS  D+V +LKA++I+HVRL D+D  ML AL+NTGIEV+VGV N+++L
Sbjct  34   VGVHVGTGVSDLPSPSDIVSILKAKRIQHVRLVDSDHKMLVALANTGIEVMVGVPNDQLL  93

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
             +GQS S AA W+NKNVAAY+P+TNIT IAVG EVLT+IPNAA VLVPA+ +L  AL++A
Sbjct  94   RVGQSRSTAADWINKNVAAYIPATNITYIAVGDEVLTTIPNAALVLVPALQFLQSALLAA  153

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NLN+QVK+S+P S D+I+K FPPSTATFN + +S + Q LQFL NT S +MLNA PYY Y
Sbjct  154  NLNTQVKISSPHSMDMISKAFPPSTATFNSTWSSIMSQYLQFLNNTGSSFMLNAQPYYGY  213

Query  691  VK  696
            VK
Sbjct  214  VK  215



>ref|XP_004958122.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Setaria italica]
Length=653

 Score =   229 bits (584),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 151/181 (83%), Gaps = 0/181 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            VGI IG D+SNLPSA D+V +LKA++I+HVRL D+D  ML+AL+NTGIEV+VGV N+++L
Sbjct  25   VGITIGNDMSNLPSATDIVAILKAKKIQHVRLIDSDHQMLTALANTGIEVMVGVPNDQLL  84

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
             +GQS S AA W+NKNVAAY+P+TNIT IAVG EVLT+IPNAA VL+PA+ +L  AL++A
Sbjct  85   RVGQSRSTAADWINKNVAAYVPATNITYIAVGDEVLTNIPNAALVLIPALQFLQSALLAA  144

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NLN+QVK+S+P S D+I+K FPPSTATFN + +S + Q LQFL+NT S +MLNA PYY Y
Sbjct  145  NLNTQVKISSPHSMDMISKAFPPSTATFNSTWSSIMSQYLQFLKNTGSSFMLNAQPYYSY  204

Query  691  V  693
            V
Sbjct  205  V  205



>ref|XP_002460914.1| hypothetical protein SORBIDRAFT_02g037380 [Sorghum bicolor]
 gb|EER97435.1| hypothetical protein SORBIDRAFT_02g037380 [Sorghum bicolor]
Length=494

 Score =   225 bits (574),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 116/196 (59%), Positives = 152/196 (78%), Gaps = 0/196 (0%)
 Frame = +1

Query  106  FPAYMRVIVQFRRCVVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSN  285
            F   M ++       VGI IG D+SN+P A D+V +LKA++ +HVRL D+D  ML+AL+N
Sbjct  10   FTLLMLMVFNVSGAFVGITIGNDMSNMPPATDIVSILKAKKTQHVRLLDSDHQMLTALAN  69

Query  286  TGIEVIVGVTNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPV  465
            TGIEV+VGV N+++L +GQS S AA W+NKNVAAY P+TNIT IAVG+EVLT+IPNAA V
Sbjct  70   TGIEVMVGVPNDQLLRVGQSRSTAADWINKNVAAYTPATNITYIAVGNEVLTTIPNAALV  129

Query  466  LVPAMNYLHKALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQN  645
            LVPA+ +L  AL++ANLN+QVK+S+P S D+I+K FPPS ATFN + +S + Q L+FL+N
Sbjct  130  LVPALQFLQSALLAANLNTQVKISSPHSMDVISKAFPPSAATFNSTWSSIMSQYLEFLKN  189

Query  646  TNSYYMLNAYPYYEYV  693
            T S +MLNA PYY YV
Sbjct  190  TGSSFMLNAQPYYGYV  205



>ref|XP_010527795.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 [Tarenaya hassleriana]
Length=499

 Score =   225 bits (574),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 148/184 (80%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            VG+NIGTD++++PS   VV LLK + I+HVRL+DAD  ML AL+NTGIEVIV V N+++L
Sbjct  23   VGVNIGTDLTDMPSPTQVVALLKTQNIRHVRLYDADRAMLLALANTGIEVIVSVPNDQLL  82

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIGQS++ AA WV +NVAAY+P+TNITA+AVGSEVLT++PNAAPVLV A+ YL  ALV+A
Sbjct  83   GIGQSNATAANWVTRNVAAYVPATNITAVAVGSEVLTTVPNAAPVLVSALKYLQSALVAA  142

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL+ Q+KVSTP S+ +I   FPPS A FN +    +  +L+FLQ+T SY MLN YPYY+Y
Sbjct  143  NLDRQIKVSTPHSSSIILDSFPPSQAFFNKTWEPVIVPLLKFLQSTGSYLMLNVYPYYDY  202

Query  691  VKSD  702
            V+S+
Sbjct  203  VQSN  206



>ref|NP_001131285.1| putative O-Glycosyl hydrolase superfamily protein isoform 1 precursor 
[Zea mays]
 gb|ACF79625.1| unknown [Zea mays]
 gb|ACL53366.1| unknown [Zea mays]
 tpg|DAA41198.1| TPA: putative O-Glycosyl hydrolase superfamily protein isoform 
1 [Zea mays]
 tpg|DAA41199.1| TPA: putative O-Glycosyl hydrolase superfamily protein isoform 
2 [Zea mays]
Length=492

 Score =   224 bits (571),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 115/196 (59%), Positives = 153/196 (78%), Gaps = 0/196 (0%)
 Frame = +1

Query  106  FPAYMRVIVQFRRCVVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSN  285
            F   M ++       VGI IG D+SN+P A D+V +LKA++I+HVRL D+D  ML+AL+N
Sbjct  10   FTLLMLMVFNVSGAFVGITIGNDMSNIPPATDIVSILKAKKIQHVRLLDSDHQMLTALAN  69

Query  286  TGIEVIVGVTNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPV  465
            TGIEV+VGV N+++L +GQS S AA W+NKNV AY+P+TNIT IAVG+EVLT+IPNAA V
Sbjct  70   TGIEVMVGVPNDQLLRVGQSRSTAADWINKNVNAYIPATNITYIAVGNEVLTTIPNAALV  129

Query  466  LVPAMNYLHKALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQN  645
            L+PA+ +L  AL++ANL++QVK+S+P S D+I+K FPPS ATFN + +S + Q LQFL+N
Sbjct  130  LIPALQFLQSALLAANLDTQVKISSPHSMDVISKAFPPSAATFNSTWSSIMSQYLQFLKN  189

Query  646  TNSYYMLNAYPYYEYV  693
            T S +MLNA PYY YV
Sbjct  190  TESSFMLNAQPYYGYV  205



>ref|NP_001149308.1| glucan endo-1,3-beta-glucosidase 4 precursor [Zea mays]
 gb|ACG34964.1| glucan endo-1,3-beta-glucosidase 4 precursor [Zea mays]
Length=494

 Score =   224 bits (571),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 116/196 (59%), Positives = 152/196 (78%), Gaps = 0/196 (0%)
 Frame = +1

Query  106  FPAYMRVIVQFRRCVVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSN  285
            F   M ++       VGI IG D+SN+P A  +V +LKA++I+HVRL D+D  ML+AL+N
Sbjct  10   FTLLMLMVFNVSGAFVGITIGNDMSNIPPATGIVSILKAKKIQHVRLLDSDHQMLNALAN  69

Query  286  TGIEVIVGVTNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPV  465
            TGIEV+VGV N+++L +GQS S AA W+NKNV AY+P+TNIT IAVG+EVLT+IPNAA V
Sbjct  70   TGIEVMVGVPNDQLLRVGQSRSTAADWINKNVGAYIPATNITYIAVGNEVLTTIPNAALV  129

Query  466  LVPAMNYLHKALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQN  645
            LVPA+ +L  AL++ANLN+QVK+S+P S D+I+K FPPS ATFN + +S + Q LQFL+N
Sbjct  130  LVPALQFLQSALLAANLNTQVKISSPHSMDVISKAFPPSAATFNLTWSSIMSQYLQFLKN  189

Query  646  TNSYYMLNAYPYYEYV  693
            T S +MLNA PYY YV
Sbjct  190  TGSSFMLNAQPYYGYV  205



>gb|EMS60322.1| Glucan endo-1,3-beta-glucosidase 4 [Triticum urartu]
Length=627

 Score =   226 bits (576),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 116/183 (63%), Positives = 149/183 (81%), Gaps = 0/183 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            VGINIGT+VS+LPSA D+V +LKA++I+HVRL D++  ML AL+NTGIEV+VGV NNE+L
Sbjct  101  VGINIGTNVSDLPSASDIVSILKAKKIQHVRLVDSNHEMLVALANTGIEVMVGVPNNELL  160

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
             +GQS   AA W+NKNVAAY+P+TNIT IAVG E+LT++PNAA VLVPA+ +L  AL++A
Sbjct  161  RVGQSRPTAADWINKNVAAYIPATNITYIAVGDEILTTVPNAALVLVPALQFLQSALLAA  220

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NLN+QVK+S+P S D+I+K FPPS ATFN + +S + Q L FL+ T S +MLNA PYY Y
Sbjct  221  NLNTQVKLSSPHSMDMISKAFPPSAATFNSTWSSIMLQYLGFLKRTGSSFMLNAQPYYGY  280

Query  691  VKS  699
            VK 
Sbjct  281  VKG  283



>gb|EMS53703.1| Glucan endo-1,3-beta-glucosidase 4 [Triticum urartu]
Length=477

 Score =   223 bits (567),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 119/193 (62%), Positives = 149/193 (77%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  YMRVIVQFRRCVVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGI  294
            +M ++       VGINIGT VS+LPSA D++  LKA +I+HVRL D+D  ML AL+NTGI
Sbjct  13   FMLMLFNASGAFVGINIGTGVSDLPSASDIISTLKAMKIQHVRLVDSDHQMLVALANTGI  72

Query  295  EVIVGVTNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVP  474
            EV+VGV N+++L +GQS   AA WVNKNVAAY P+TNIT IAVG EVLTSIPNAA VLVP
Sbjct  73   EVMVGVPNDQLLRVGQSRPAAADWVNKNVAAYTPATNITYIAVGDEVLTSIPNAALVLVP  132

Query  475  AMNYLHKALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNS  654
            A+ +L  AL++ANLN+QVK+S+P S D+I K FPPSTATFN + +S +   LQFL++T S
Sbjct  133  ALQFLQSALLAANLNTQVKLSSPHSMDMIPKAFPPSTATFNSTWSSVMLPYLQFLKSTGS  192

Query  655  YYMLNAYPYYEYV  693
             +MLNA PYY YV
Sbjct  193  SFMLNAQPYYSYV  205



>ref|XP_009602434.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Nicotiana 
tomentosiformis]
Length=512

 Score =   223 bits (568),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 113/188 (60%), Positives = 149/188 (79%), Gaps = 0/188 (0%)
 Frame = +1

Query  139  RRCVVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTN  318
                VG+NIGTDVS++PS   VV LLKA+QI+HVRLFDAD  ML AL+NTGI V V V N
Sbjct  29   EEAFVGVNIGTDVSDMPSPSKVVALLKAQQIRHVRLFDADQAMLLALANTGIRVTVSVPN  88

Query  319  NEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKA  498
            +++LGIGQS+S AA WV++N+  + P+TNITAIA+GSEVLT++PNAAPVLV AM +++ A
Sbjct  89   DQLLGIGQSNSTAANWVSRNILTHFPATNITAIAIGSEVLTTLPNAAPVLVSAMRFIYSA  148

Query  499  LVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYP  678
            LV+ANL+S++KVSTP S+ ++   FPPS A FN S +  +  +L+FLQ+T SY MLN YP
Sbjct  149  LVAANLDSKIKVSTPHSSSIVLDSFPPSQAFFNRSLDPVMVPLLKFLQSTGSYLMLNVYP  208

Query  679  YYEYVKSD  702
            YY+Y+KS+
Sbjct  209  YYDYMKSN  216



>ref|XP_004236940.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 [Solanum lycopersicum]
Length=505

 Score =   223 bits (568),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 112/184 (61%), Positives = 153/184 (83%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            VG+NIGTDVS++PS   VV LLKA+QI+HVRLFDAD  ML AL++T I VIV V N+++L
Sbjct  30   VGVNIGTDVSDMPSPAQVVALLKAQQIRHVRLFDADQAMLLALAHTEIRVIVSVPNDQLL  89

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIGQS+S AA WV++N+ +++P+TNITAIA+GSEVLT++PNAAP+LV AM ++H ALV+A
Sbjct  90   GIGQSNSTAANWVSRNILSHVPATNITAIAIGSEVLTTLPNAAPLLVSAMKFIHSALVAA  149

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL++++KVSTP S+ +I   FPPS A FN S +  +  +L+FLQ+T+SY+MLN YPYY+Y
Sbjct  150  NLDTKIKVSTPHSSFIILDSFPPSQAFFNRSLDPVMVPLLKFLQDTDSYFMLNVYPYYDY  209

Query  691  VKSD  702
            +KS+
Sbjct  210  MKSN  213



>ref|XP_006599426.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like isoform X3 
[Glycine max]
Length=445

 Score =   221 bits (564),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 116/199 (58%), Positives = 153/199 (77%), Gaps = 3/199 (2%)
 Frame = +1

Query  115  YMRVIVQF---RRCVVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSN  285
            YM VI+         +G+NIGTDV+N+PS  +VV LLKA+ I+HVRL+DAD  ML AL+N
Sbjct  8    YMLVIIALPAHGDAFIGVNIGTDVTNMPSPTEVVALLKAQGIQHVRLYDADRAMLRALAN  67

Query  286  TGIEVIVGVTNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPV  465
            TGI VIV V N+++LGIGQS++ AA WV +NV A++P+TNITAIAVGSEVLTS+PNAAPV
Sbjct  68   TGIRVIVSVPNDQILGIGQSNATAANWVARNVIAHVPATNITAIAVGSEVLTSLPNAAPV  127

Query  466  LVPAMNYLHKALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQN  645
            LV A+ ++  ALV+ANL+ Q+KVSTP S+ +I   FPPS A FN + +  +  +L FLQ+
Sbjct  128  LVSALKFIQAALVAANLDQQIKVSTPHSSSVILDSFPPSQAFFNKTWDPVMVPLLNFLQS  187

Query  646  TNSYYMLNAYPYYEYVKSD  702
            T SY MLN YPYY+Y++S+
Sbjct  188  TGSYLMLNVYPYYDYMQSN  206



>ref|XP_006828511.1| hypothetical protein AMTR_s00060p00188740 [Amborella trichopoda]
 gb|ERM95927.1| hypothetical protein AMTR_s00060p00188740 [Amborella trichopoda]
Length=526

 Score =   223 bits (567),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 116/189 (61%), Positives = 145/189 (77%), Gaps = 0/189 (0%)
 Frame = +1

Query  136  FRRCVVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVT  315
            F    VG+N+GTDV+N+PS   VV LLK +QI   RL+DAD  ML+AL+NTGI V+V V 
Sbjct  47   FAGAFVGVNVGTDVTNMPSPTQVVALLKKQQIHDARLYDADRAMLTALANTGIRVVVSVP  106

Query  316  NNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHK  495
            NN++L +GQS++ AA WV +NVAAYLP+TNIT IAVGSEVLTSIPNAA VLVPAMN+LH 
Sbjct  107  NNQLLAVGQSNATAANWVARNVAAYLPATNITGIAVGSEVLTSIPNAALVLVPAMNFLHS  166

Query  496  ALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAY  675
            ALV+ANL+ QVKVSTP S+D+I   FPPS A FN +    +  +L FLQ T + +MLN Y
Sbjct  167  ALVAANLDRQVKVSTPHSSDIILDSFPPSQAFFNRTWTPVLVPMLSFLQKTGAPFMLNVY  226

Query  676  PYYEYVKSD  702
            PYY Y++S+
Sbjct  227  PYYVYMQSN  235



>ref|XP_009388452.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=494

 Score =   222 bits (565),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 122/183 (67%), Positives = 148/183 (81%), Gaps = 0/183 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            VGINIG  VSNLPSA D+V +LK +QIKHVRLFDA+  ML AL+NTGI+V++GV N+++L
Sbjct  25   VGINIGNMVSNLPSAADIVSILKTQQIKHVRLFDANHQMLGALANTGIDVMLGVPNDQLL  84

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
             IG S S+AA W+NKNVAA++P TNIT IAVG+E+LTSIPNAA VLVPAM +L  ALV++
Sbjct  85   RIGNSRSEAADWINKNVAAFVPETNITYIAVGNEILTSIPNAALVLVPAMQFLQSALVAS  144

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NLNSQVKVS+P S D+I K FPPSTATFN S NS + Q L FL+NT S  M+NA PYY Y
Sbjct  145  NLNSQVKVSSPLSMDMIPKSFPPSTATFNSSWNSVMSQYLLFLKNTGSPLMVNAQPYYGY  204

Query  691  VKS  699
            +K 
Sbjct  205  IKG  207



>ref|XP_003548935.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like isoform X1 
[Glycine max]
Length=496

 Score =   222 bits (565),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 116/199 (58%), Positives = 153/199 (77%), Gaps = 3/199 (2%)
 Frame = +1

Query  115  YMRVIVQF---RRCVVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSN  285
            YM VI+         +G+NIGTDV+N+PS  +VV LLKA+ I+HVRL+DAD  ML AL+N
Sbjct  8    YMLVIIALPAHGDAFIGVNIGTDVTNMPSPTEVVALLKAQGIQHVRLYDADRAMLRALAN  67

Query  286  TGIEVIVGVTNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPV  465
            TGI VIV V N+++LGIGQS++ AA WV +NV A++P+TNITAIAVGSEVLTS+PNAAPV
Sbjct  68   TGIRVIVSVPNDQILGIGQSNATAANWVARNVIAHVPATNITAIAVGSEVLTSLPNAAPV  127

Query  466  LVPAMNYLHKALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQN  645
            LV A+ ++  ALV+ANL+ Q+KVSTP S+ +I   FPPS A FN + +  +  +L FLQ+
Sbjct  128  LVSALKFIQAALVAANLDQQIKVSTPHSSSVILDSFPPSQAFFNKTWDPVMVPLLNFLQS  187

Query  646  TNSYYMLNAYPYYEYVKSD  702
            T SY MLN YPYY+Y++S+
Sbjct  188  TGSYLMLNVYPYYDYMQSN  206



>emb|CDY23618.1| BnaC05g39760D [Brassica napus]
Length=421

 Score =   219 bits (559),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 114/174 (66%), Positives = 143/174 (82%), Gaps = 0/174 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+NIGTD++N+PS  D+V LLK+ QI HVRL+DA++HML A +NT I+V VGVTN E+L
Sbjct  40   IGVNIGTDLTNMPSPSDIVSLLKSHQITHVRLYDANSHMLKAFANTTIQVTVGVTNQEIL  99

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
             IG+  S AA+W+NKNVAAY+PSTNITAIAVGSEVLT  P+ AP+L  A+N +HKALV+ 
Sbjct  100  KIGRFPSSAASWINKNVAAYVPSTNITAIAVGSEVLTQSPHVAPILASALNNIHKALVAM  159

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNA  672
            NLN QVKVSTP S D++ K FPPST+TF+ S N+TV QILQFL NT S++MLNA
Sbjct  160  NLNFQVKVSTPMSMDVMPKPFPPSTSTFSPSWNTTVHQILQFLDNTGSFFMLNA  213



>gb|KEH40580.1| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=506

 Score =   221 bits (563),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 148/184 (80%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+NIGTDV+N+PS  + V LLKA+ I+HVRLFDAD  ML AL+ TGI+VIV V N+E+L
Sbjct  24   IGVNIGTDVTNMPSPTETVALLKAQNIQHVRLFDADKSMLLALAKTGIQVIVSVPNDELL  83

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIGQS++ AA WV +NV A++PSTNITAIAVGSEVLTS+PNAAPVLV A+ ++  ALV+A
Sbjct  84   GIGQSNATAANWVARNVIAHVPSTNITAIAVGSEVLTSLPNAAPVLVSALQFIQSALVAA  143

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL+ Q+KVSTP ST +I   FPPS A FN + +  +  +L+FLQ+T SY MLN YPYY+Y
Sbjct  144  NLDDQIKVSTPLSTSIILDSFPPSQAFFNRTWDPVMSPLLKFLQSTGSYLMLNVYPYYDY  203

Query  691  VKSD  702
            ++S+
Sbjct  204  MQSN  207



>gb|KEH40581.1| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=498

 Score =   221 bits (562),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 148/184 (80%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+NIGTDV+N+PS  + V LLKA+ I+HVRLFDAD  ML AL+ TGI+VIV V N+E+L
Sbjct  24   IGVNIGTDVTNMPSPTETVALLKAQNIQHVRLFDADKSMLLALAKTGIQVIVSVPNDELL  83

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIGQS++ AA WV +NV A++PSTNITAIAVGSEVLTS+PNAAPVLV A+ ++  ALV+A
Sbjct  84   GIGQSNATAANWVARNVIAHVPSTNITAIAVGSEVLTSLPNAAPVLVSALQFIQSALVAA  143

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL+ Q+KVSTP ST +I   FPPS A FN + +  +  +L+FLQ+T SY MLN YPYY+Y
Sbjct  144  NLDDQIKVSTPLSTSIILDSFPPSQAFFNRTWDPVMSPLLKFLQSTGSYLMLNVYPYYDY  203

Query  691  VKSD  702
            ++S+
Sbjct  204  MQSN  207



>ref|XP_010653417.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 isoform X2 [Vitis 
vinifera]
Length=480

 Score =   220 bits (560),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 111/184 (60%), Positives = 150/184 (82%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+NIGTD+SN+P+   VV LLK++QI+HVRL+DAD  ML AL+NTGI V V V N+++L
Sbjct  5    IGVNIGTDLSNMPNPTQVVALLKSQQIRHVRLYDADRAMLLALANTGIRVTVSVPNDQLL  64

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIGQS++ AA WV +NV A++P+TNITAIAVGSEVLT++PNAAPVLV A+ ++H ALV+A
Sbjct  65   GIGQSNATAANWVARNVLAHIPATNITAIAVGSEVLTTLPNAAPVLVSALKFIHSALVAA  124

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL+SQ+KVSTP S+ ++   FPPS A FN S    +  +L+FLQ+T+SY MLN YPYY+Y
Sbjct  125  NLDSQIKVSTPHSSSILLDSFPPSQAFFNRSWEPVMVPLLKFLQSTSSYLMLNVYPYYDY  184

Query  691  VKSD  702
            ++S+
Sbjct  185  MQSN  188



>dbj|BAJ89950.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=496

 Score =   220 bits (561),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 117/193 (61%), Positives = 151/193 (78%), Gaps = 0/193 (0%)
 Frame = +1

Query  118  MRVIVQFRRCVVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIE  297
            M ++       VGINIGT VS+L S  D+V +LKA++I+HVRL D++  ML AL+NTGIE
Sbjct  20   MFMVYNTSGAFVGINIGTRVSDLTSPSDIVSILKAKKIQHVRLVDSNHEMLVALANTGIE  79

Query  298  VIVGVTNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPA  477
            V+VGV NN +L +GQS S AA W+NKNVAAY+P+TNIT IAVG E+LT++PNAA VLVPA
Sbjct  80   VMVGVPNNHLLRVGQSRSTAADWINKNVAAYIPATNITYIAVGDEILTTVPNAALVLVPA  139

Query  478  MNYLHKALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSY  657
            + +L  AL++ANLN+QVK+S+P S D+I+K FPPSTATFN + N T+ Q L+FL+ T S 
Sbjct  140  LQFLQSALLAANLNTQVKISSPHSMDMISKAFPPSTATFNSTWNLTMSQYLEFLRTTGSS  199

Query  658  YMLNAYPYYEYVK  696
            +MLNA PYY YVK
Sbjct  200  FMLNAQPYYGYVK  212



>gb|AFU52641.1| beta-1,3-glucanase 6 [Solanum tuberosum]
Length=501

 Score =   220 bits (561),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 111/188 (59%), Positives = 151/188 (80%), Gaps = 0/188 (0%)
 Frame = +1

Query  139  RRCVVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTN  318
                VG+NIGTDVS++PS   VV LLKA+QI+HVRLFDAD  ML AL++T I V V V N
Sbjct  22   EEAFVGVNIGTDVSDMPSPAQVVALLKAQQIRHVRLFDADQAMLLALAHTEIRVTVSVPN  81

Query  319  NEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKA  498
            +++LGIGQS+S AA WV++N+ +++P+TNITAIA+GSEVLT++PNAAP+LV AM ++H A
Sbjct  82   DQLLGIGQSNSTAANWVSRNILSHVPATNITAIAIGSEVLTTLPNAAPLLVSAMKFIHSA  141

Query  499  LVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYP  678
            LV+ANL++++KVSTP S+ +I   FPPS A FN S +  +  +L+FLQ+T SY+MLN YP
Sbjct  142  LVAANLDTKIKVSTPHSSFIILDSFPPSQAFFNRSLDPVMVPLLKFLQDTGSYFMLNVYP  201

Query  679  YYEYVKSD  702
            YY+Y+KS+
Sbjct  202  YYDYMKSN  209



>dbj|BAB01763.1| beta-1,3-glucanase-like protein [Arabidopsis thaliana]
Length=469

 Score =   219 bits (559),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 112/173 (65%), Positives = 145/173 (84%), Gaps = 0/173 (0%)
 Frame = +1

Query  184  LPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVLGIGQSSSQAAA  363
            +P   D+V LLK++QI HVRL+DA++HML A +NT IEV+VGVTN E+L IG+  S AAA
Sbjct  1    MPPPSDIVTLLKSQQITHVRLYDANSHMLKAFANTSIEVMVGVTNEEILKIGRFPSAAAA  60

Query  364  WVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSANLNSQVKVSTP  543
            WVNKNVAAY+PSTNITAIAVGSEVLT+IP+ AP+L  A+N +HKALV++NLN +VKVS+P
Sbjct  61   WVNKNVAAYIPSTNITAIAVGSEVLTTIPHVAPILASALNNIHKALVASNLNFKVKVSSP  120

Query  544  QSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEYVKSD  702
             S D++ K FPPST+TF+ S N+TV+Q+LQFL+NT S++MLNAYPYY Y  ++
Sbjct  121  MSMDIMPKPFPPSTSTFSPSWNTTVYQLLQFLKNTGSFFMLNAYPYYGYTTAN  173



>ref|XP_010653375.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 isoform X1 [Vitis 
vinifera]
Length=512

 Score =   221 bits (562),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 111/184 (60%), Positives = 150/184 (82%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+NIGTD+SN+P+   VV LLK++QI+HVRL+DAD  ML AL+NTGI V V V N+++L
Sbjct  37   IGVNIGTDLSNMPNPTQVVALLKSQQIRHVRLYDADRAMLLALANTGIRVTVSVPNDQLL  96

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIGQS++ AA WV +NV A++P+TNITAIAVGSEVLT++PNAAPVLV A+ ++H ALV+A
Sbjct  97   GIGQSNATAANWVARNVLAHIPATNITAIAVGSEVLTTLPNAAPVLVSALKFIHSALVAA  156

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL+SQ+KVSTP S+ ++   FPPS A FN S    +  +L+FLQ+T+SY MLN YPYY+Y
Sbjct  157  NLDSQIKVSTPHSSSILLDSFPPSQAFFNRSWEPVMVPLLKFLQSTSSYLMLNVYPYYDY  216

Query  691  VKSD  702
            ++S+
Sbjct  217  MQSN  220



>emb|CBI26850.3| unnamed protein product [Vitis vinifera]
Length=498

 Score =   220 bits (560),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 111/184 (60%), Positives = 150/184 (82%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+NIGTD+SN+P+   VV LLK++QI+HVRL+DAD  ML AL+NTGI V V V N+++L
Sbjct  23   IGVNIGTDLSNMPNPTQVVALLKSQQIRHVRLYDADRAMLLALANTGIRVTVSVPNDQLL  82

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIGQS++ AA WV +NV A++P+TNITAIAVGSEVLT++PNAAPVLV A+ ++H ALV+A
Sbjct  83   GIGQSNATAANWVARNVLAHIPATNITAIAVGSEVLTTLPNAAPVLVSALKFIHSALVAA  142

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL+SQ+KVSTP S+ ++   FPPS A FN S    +  +L+FLQ+T+SY MLN YPYY+Y
Sbjct  143  NLDSQIKVSTPHSSSILLDSFPPSQAFFNRSWEPVMVPLLKFLQSTSSYLMLNVYPYYDY  202

Query  691  VKSD  702
            ++S+
Sbjct  203  MQSN  206



>ref|XP_006355069.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Solanum tuberosum]
Length=505

 Score =   220 bits (560),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 111/188 (59%), Positives = 151/188 (80%), Gaps = 0/188 (0%)
 Frame = +1

Query  139  RRCVVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTN  318
                VG+NIGTDVS++PS   VV LLKA+QI+HVRLFDAD  ML AL++T I V V V N
Sbjct  26   EEAFVGVNIGTDVSDMPSPVQVVALLKAQQIRHVRLFDADQAMLLALAHTEIRVTVSVPN  85

Query  319  NEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKA  498
            +++LGIGQS+S AA WV++N+ +++P+TNITAIA+GSEVLT++PNAAP+LV AM ++H A
Sbjct  86   DQLLGIGQSNSTAANWVSRNILSHVPATNITAIAIGSEVLTTLPNAAPLLVSAMKFIHSA  145

Query  499  LVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYP  678
            LV+ANL++++KVSTP S+ +I   FPPS A FN S +  +  +L+FLQ+T SY+MLN YP
Sbjct  146  LVAANLDTKIKVSTPHSSFIILDSFPPSQAFFNRSLDPVMVPLLKFLQDTGSYFMLNVYP  205

Query  679  YYEYVKSD  702
            YY+Y+KS+
Sbjct  206  YYDYMKSN  213



>emb|CDP00829.1| unnamed protein product [Coffea canephora]
Length=507

 Score =   219 bits (558),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 111/184 (60%), Positives = 148/184 (80%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+NIGTD+S++P    VV LLKA+QI+HVRL+DAD  ML AL+NTGI V V V N+++L
Sbjct  32   IGVNIGTDLSDMPDPTQVVALLKAQQIRHVRLYDADRAMLLALANTGIRVTVSVPNDQLL  91

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIGQS++ AA WV++NV A++P+TNITAIAVGSEVLT++PNAAPVLV AMN++  ALV++
Sbjct  92   GIGQSNATAANWVSRNVIAHIPATNITAIAVGSEVLTTLPNAAPVLVAAMNFIQSALVAS  151

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL SQ+KVSTP S+ +I   FPPS A FN +    +  +L+FLQ+T S+ MLN YPYY+Y
Sbjct  152  NLASQIKVSTPHSSSIILDSFPPSQAFFNRTLEPVMVPLLKFLQSTGSFLMLNVYPYYDY  211

Query  691  VKSD  702
            V+S+
Sbjct  212  VQSN  215



>ref|XP_010271297.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2 [Nelumbo nucifera]
Length=495

 Score =   218 bits (556),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 110/193 (57%), Positives = 152/193 (79%), Gaps = 0/193 (0%)
 Frame = +1

Query  124  VIVQFRRCVVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVI  303
            V+       +G+NIGT +S++P+   VV LLKA+QI+HVRL+DAD  ML AL+NTGI+V 
Sbjct  14   VVTADEDAFIGVNIGTALSDMPNPTQVVALLKAQQIRHVRLYDADRAMLLALANTGIQVT  73

Query  304  VGVTNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMN  483
            V V N E+LG+GQS++ AA WV +NV A++P+TNITAIAVGSEVLT++PNAAPVLV AM 
Sbjct  74   VSVPNEELLGVGQSNATAANWVARNVVAHVPATNITAIAVGSEVLTTLPNAAPVLVSAMK  133

Query  484  YLHKALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYM  663
            ++H ALV++NL+ Q+KVSTP S+  I   FPPS A FN S ++ +  +L+FLQ++ SY+M
Sbjct  134  FIHSALVASNLDDQIKVSTPHSSSFILDSFPPSQAFFNRSWDNVMVPMLKFLQSSGSYFM  193

Query  664  LNAYPYYEYVKSD  702
            LN+YPYY+Y++S+
Sbjct  194  LNSYPYYDYMQSN  206



>ref|XP_006378439.1| hypothetical protein POPTR_0010s11880g [Populus trichocarpa]
 gb|ERP56236.1| hypothetical protein POPTR_0010s11880g [Populus trichocarpa]
Length=424

 Score =   216 bits (551),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 109/184 (59%), Positives = 148/184 (80%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+NIGT +S++PS   VV LLKA+ I+HVRL+DAD  ML AL+NTGI V V V N ++L
Sbjct  6    IGVNIGTALSDMPSPTQVVALLKAQNIRHVRLYDADRAMLHALANTGIRVTVSVPNEQLL  65

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIGQS++ AA WV +NV A++P+TNITAIAVGSE+LT++PNAAPVLV A+ ++H ALV++
Sbjct  66   GIGQSNATAANWVARNVIAHVPATNITAIAVGSEILTTLPNAAPVLVSALKFIHSALVAS  125

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL+ Q+KVSTPQS+ +I   FPPS A FN S +  +  +L+FLQ+T SY+MLN YPYY+Y
Sbjct  126  NLDGQIKVSTPQSSSIILDSFPPSQAFFNRSWDPVMVPLLKFLQSTGSYFMLNVYPYYDY  185

Query  691  VKSD  702
            ++S+
Sbjct  186  MQSN  189



>ref|XP_006448191.1| hypothetical protein CICLE_v10014990mg [Citrus clementina]
 ref|XP_006469226.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Citrus sinensis]
 gb|ESR61431.1| hypothetical protein CICLE_v10014990mg [Citrus clementina]
Length=499

 Score =   218 bits (556),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 109/188 (58%), Positives = 149/188 (79%), Gaps = 0/188 (0%)
 Frame = +1

Query  139  RRCVVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTN  318
            +   +G+NIGTD+S++PS   VV LLKA+ I+H+RL+DAD  ML AL+NTGI+V + V N
Sbjct  20   KDAFIGVNIGTDLSDMPSPTQVVALLKAQNIRHIRLYDADRAMLLALANTGIQVTISVPN  79

Query  319  NEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKA  498
            +++LGIGQS++ AA WV +NVAA++P+TNITAIAVGSEVLT +PNA PVLV A+ ++H A
Sbjct  80   DQLLGIGQSNATAANWVARNVAAHVPTTNITAIAVGSEVLTVLPNAGPVLVSALKFIHSA  139

Query  499  LVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYP  678
            LV+ANL+ Q+KVSTP S+ +I   FPPS A FN S +  +  +L+FLQ+T SY MLN YP
Sbjct  140  LVAANLDDQIKVSTPHSSSIILDSFPPSQAFFNRSWDPVMVPLLKFLQSTGSYLMLNVYP  199

Query  679  YYEYVKSD  702
            YY+Y++S+
Sbjct  200  YYDYMQSN  207



>ref|XP_004297451.2| PREDICTED: glucan endo-1,3-beta-glucosidase 3 [Fragaria vesca 
subsp. vesca]
Length=505

 Score =   219 bits (557),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 109/184 (59%), Positives = 151/184 (82%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            VG+N+GTD+S++PS   VV LLKA+ I+H+RL+DAD  ML AL+NTGI+V V V N+++L
Sbjct  29   VGVNLGTDLSDMPSPTVVVALLKAQNIRHIRLYDADRAMLLALANTGIQVTVSVPNDQLL  88

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIGQS++ AA W+ +NV A++P+TNITAIAVGSEVLT++PNAAPVLV A+ ++H ALV++
Sbjct  89   GIGQSNATAANWITRNVIAHVPATNITAIAVGSEVLTALPNAAPVLVSALKFIHSALVAS  148

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL+ Q+KVSTP S+ +I   FPPS A FN S +  +  +L+FLQ+T+SY MLNAYPYY+Y
Sbjct  149  NLDRQIKVSTPHSSSIILDSFPPSQAFFNRSWDKVMVPVLKFLQSTDSYLMLNAYPYYDY  208

Query  691  VKSD  702
            ++S+
Sbjct  209  MQSN  212



>ref|XP_011021800.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like isoform X2 
[Populus euphratica]
Length=498

 Score =   218 bits (555),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 110/184 (60%), Positives = 148/184 (80%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+NIGT VS++PS   VV LLKA+ I+HVRL+DAD  ML AL+NTGI V V V N ++L
Sbjct  23   IGVNIGTAVSDMPSPTQVVALLKAQNIRHVRLYDADRAMLRALANTGIRVTVSVPNEQLL  82

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIGQS++ AA WV +NV A++P+TNITAIAVGSE+LT++PNAAPVLV A+ ++H ALV++
Sbjct  83   GIGQSNATAANWVARNVIAHVPATNITAIAVGSEILTTLPNAAPVLVSALKFIHSALVAS  142

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL+ Q+KVSTPQS+ +I   FPPS A FN S +  +  +L+FLQ+T SY+MLN YPYY+Y
Sbjct  143  NLDGQIKVSTPQSSSIILDSFPPSQAFFNRSWDPVMVPLLKFLQSTGSYFMLNVYPYYDY  202

Query  691  VKSD  702
            ++S+
Sbjct  203  MQSN  206



>ref|XP_011021799.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like isoform X1 
[Populus euphratica]
Length=499

 Score =   218 bits (555),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 110/184 (60%), Positives = 148/184 (80%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+NIGT VS++PS   VV LLKA+ I+HVRL+DAD  ML AL+NTGI V V V N ++L
Sbjct  24   IGVNIGTAVSDMPSPTQVVALLKAQNIRHVRLYDADRAMLRALANTGIRVTVSVPNEQLL  83

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIGQS++ AA WV +NV A++P+TNITAIAVGSE+LT++PNAAPVLV A+ ++H ALV++
Sbjct  84   GIGQSNATAANWVARNVIAHVPATNITAIAVGSEILTTLPNAAPVLVSALKFIHSALVAS  143

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL+ Q+KVSTPQS+ +I   FPPS A FN S +  +  +L+FLQ+T SY+MLN YPYY+Y
Sbjct  144  NLDGQIKVSTPQSSSIILDSFPPSQAFFNRSWDPVMVPLLKFLQSTGSYFMLNVYPYYDY  203

Query  691  VKSD  702
            ++S+
Sbjct  204  MQSN  207



>ref|XP_006378440.1| hypothetical protein POPTR_0010s11880g [Populus trichocarpa]
 gb|ERP56237.1| hypothetical protein POPTR_0010s11880g [Populus trichocarpa]
Length=481

 Score =   217 bits (552),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 109/184 (59%), Positives = 148/184 (80%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+NIGT +S++PS   VV LLKA+ I+HVRL+DAD  ML AL+NTGI V V V N ++L
Sbjct  6    IGVNIGTALSDMPSPTQVVALLKAQNIRHVRLYDADRAMLHALANTGIRVTVSVPNEQLL  65

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIGQS++ AA WV +NV A++P+TNITAIAVGSE+LT++PNAAPVLV A+ ++H ALV++
Sbjct  66   GIGQSNATAANWVARNVIAHVPATNITAIAVGSEILTTLPNAAPVLVSALKFIHSALVAS  125

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL+ Q+KVSTPQS+ +I   FPPS A FN S +  +  +L+FLQ+T SY+MLN YPYY+Y
Sbjct  126  NLDGQIKVSTPQSSSIILDSFPPSQAFFNRSWDPVMVPLLKFLQSTGSYFMLNVYPYYDY  185

Query  691  VKSD  702
            ++S+
Sbjct  186  MQSN  189



>ref|XP_002314794.2| hypothetical protein POPTR_0010s11880g [Populus trichocarpa]
 gb|EEF00965.2| hypothetical protein POPTR_0010s11880g [Populus trichocarpa]
Length=498

 Score =   217 bits (553),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 109/184 (59%), Positives = 148/184 (80%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+NIGT +S++PS   VV LLKA+ I+HVRL+DAD  ML AL+NTGI V V V N ++L
Sbjct  23   IGVNIGTALSDMPSPTQVVALLKAQNIRHVRLYDADRAMLHALANTGIRVTVSVPNEQLL  82

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIGQS++ AA WV +NV A++P+TNITAIAVGSE+LT++PNAAPVLV A+ ++H ALV++
Sbjct  83   GIGQSNATAANWVARNVIAHVPATNITAIAVGSEILTTLPNAAPVLVSALKFIHSALVAS  142

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL+ Q+KVSTPQS+ +I   FPPS A FN S +  +  +L+FLQ+T SY+MLN YPYY+Y
Sbjct  143  NLDGQIKVSTPQSSSIILDSFPPSQAFFNRSWDPVMVPLLKFLQSTGSYFMLNVYPYYDY  202

Query  691  VKSD  702
            ++S+
Sbjct  203  MQSN  206



>ref|XP_010528550.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2 [Tarenaya hassleriana]
Length=500

 Score =   217 bits (552),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 113/184 (61%), Positives = 148/184 (80%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+NIGTD+S++P    VV LLKA+QIKH+RL+D+D  ML ALSNTGI+V+V V N+++L
Sbjct  29   IGVNIGTDLSDMPHPTQVVALLKAQQIKHIRLYDSDPGMLIALSNTGIKVVVSVPNDQLL  88

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIGQS+S AA WV +NV A+ P+TNITAIAVGSEVLT++PNAAP+LV A+  +H AL+SA
Sbjct  89   GIGQSNSTAANWVKRNVIAHYPATNITAIAVGSEVLTTLPNAAPILVNAIKNIHSALLSA  148

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL+ ++KVSTP STDLI   FPPS A FN S N  +  +L FLQ+T+SY MLN YPY +Y
Sbjct  149  NLDGRIKVSTPLSTDLILDPFPPSQAFFNRSWNLVLVPLLSFLQSTDSYLMLNVYPYDDY  208

Query  691  VKSD  702
            ++S+
Sbjct  209  MRSN  212



>ref|XP_007045239.1| O-Glycosyl hydrolases family 17 protein [Theobroma cacao]
 gb|EOY01071.1| O-Glycosyl hydrolases family 17 protein [Theobroma cacao]
Length=498

 Score =   217 bits (552),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 111/184 (60%), Positives = 149/184 (81%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            VG+NIGTD+S++PS   VV LLKA+ IK+VRL+DAD  ML AL+NTGI+V V V N+++L
Sbjct  23   VGVNIGTDLSDMPSPTQVVALLKAQSIKYVRLYDADRAMLLALANTGIQVTVSVPNDQLL  82

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIGQS++ AA WV +NV A++P+TNITAIAVGSEVLT++PNAAPVLV A+ ++H ALV++
Sbjct  83   GIGQSNATAANWVARNVIAHVPATNITAIAVGSEVLTALPNAAPVLVSALKFIHSALVAS  142

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL+ Q+KVSTP S+ +I   FPPS A FN S +  +  +L+FLQ+T SY MLN YPYY+Y
Sbjct  143  NLDGQIKVSTPHSSSIILDSFPPSQAFFNRSWDPVMVPLLKFLQSTGSYLMLNVYPYYDY  202

Query  691  VKSD  702
            ++S+
Sbjct  203  MQSN  206



>ref|XP_004159096.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Cucumis sativus]
Length=299

 Score =   211 bits (536),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 105/186 (56%), Positives = 148/186 (80%), Gaps = 0/186 (0%)
 Frame = +1

Query  145  CVVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  324
              +G+N+GTD+S++PS   VV LLKA+ I+H+RL+DAD  ML AL+NTGI+V V V N++
Sbjct  21   AFIGVNLGTDLSDMPSPTQVVALLKAQNIEHIRLYDADRAMLFALANTGIQVTVSVPNDQ  80

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +L IG S++ AA WV++NV A++P+TNITAIAVGSEVLT++PNAAPVLV A+ ++  ALV
Sbjct  81   LLAIGMSNATAANWVSRNVIAHVPATNITAIAVGSEVLTTLPNAAPVLVSALKFIQSALV  140

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  684
            ++NL+ Q+KVSTP S+ +I   FPPS A FN S +  +  +L+FLQ+T+SY MLN YPYY
Sbjct  141  ASNLDRQIKVSTPHSSSIILDSFPPSQAFFNRSWDPVMVPLLKFLQSTDSYLMLNVYPYY  200

Query  685  EYVKSD  702
            +Y++S+
Sbjct  201  DYMQSN  206



>ref|XP_010651370.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X2 [Vitis 
vinifera]
Length=431

 Score =   214 bits (546),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = +1

Query  265  MLSALSNTGIEVIVGVTNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTS  444
            ML+AL+NTGIEV+VGVTN EVLGIGQS S AA W+N+NVAAY+PSTNITAIAVGSEVLTS
Sbjct  1    MLNALANTGIEVVVGVTNEEVLGIGQSPSTAATWINRNVAAYVPSTNITAIAVGSEVLTS  60

Query  445  IPNAAPVLVPAMNYLHKALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQ  624
            IP+AAPVLVPAMNYLHKALV++NLN Q+KVS PQS D+I + FPPSTATFN + NST++Q
Sbjct  61   IPHAAPVLVPAMNYLHKALVASNLNFQIKVSAPQSLDIIPRPFPPSTATFNSTWNSTIYQ  120

Query  625  ILQFLQNTNSYYMLNAYPYYEYVKSD  702
            +LQFL+NTNSY+MLNAYPYY Y   D
Sbjct  121  MLQFLKNTNSYFMLNAYPYYGYTNGD  146



>gb|KDO64566.1| hypothetical protein CISIN_1g0108331mg, partial [Citrus sinensis]
Length=478

 Score =   215 bits (548),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 108/184 (59%), Positives = 148/184 (80%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+NIGTD+S++PS   VV LLKA+ I+H+RL+DAD  ML AL+NTGI+V + V N+++L
Sbjct  3    IGVNIGTDLSDMPSPTQVVALLKAQNIRHIRLYDADRAMLLALANTGIQVTISVPNDQLL  62

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIGQS++ AA WV ++VAA++P+TNITAIAVGSEVLT +PNA PVLV A+ ++H ALV+A
Sbjct  63   GIGQSNATAANWVARHVAAHVPTTNITAIAVGSEVLTVLPNAGPVLVSALKFIHSALVAA  122

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL+ Q+KVSTP S+ +I   FPPS A FN S +  +  +L+FLQ+T SY MLN YPYY+Y
Sbjct  123  NLDDQIKVSTPHSSSIILDSFPPSQAFFNRSWDPVMVPLLKFLQSTGSYLMLNVYPYYDY  182

Query  691  VKSD  702
            ++S+
Sbjct  183  MQSN  186



>gb|KJB30775.1| hypothetical protein B456_005G159100 [Gossypium raimondii]
Length=465

 Score =   215 bits (547),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 106/184 (58%), Positives = 150/184 (82%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+NIGTD+S++P+  +VV LLKA++I+HVRL+DAD  ML AL+ TGI+V V V N+++L
Sbjct  23   IGVNIGTDLSDMPTPTEVVALLKAQRIRHVRLYDADQAMLLALAKTGIQVTVSVPNDQLL  82

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIGQS++ AA WV +N+ A++P+TNITAIAVGSEVLT++PNAAP+LV A+ ++H ALV++
Sbjct  83   GIGQSNATAANWVARNIVAHVPATNITAIAVGSEVLTALPNAAPILVSALKFIHSALVAS  142

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL+ Q+KVSTP S+ +I   FPPS A FN S +  +  +L+FLQ+T SY MLN YPYY+Y
Sbjct  143  NLDDQIKVSTPHSSSIILDSFPPSQAFFNRSWDPVMVPLLKFLQSTGSYLMLNVYPYYDY  202

Query  691  VKSD  702
            ++S+
Sbjct  203  MQSN  206



>gb|KJB15377.1| hypothetical protein B456_002G174100 [Gossypium raimondii]
Length=439

 Score =   214 bits (545),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 109/188 (58%), Positives = 148/188 (79%), Gaps = 0/188 (0%)
 Frame = +1

Query  139  RRCVVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTN  318
             +  +G+NIGTD+S++PS   VV LLKA+ + HVRL+DAD  ML AL+NTGI+V + V N
Sbjct  19   EKAFIGVNIGTDLSDMPSPTQVVALLKAQNVWHVRLYDADRAMLLALANTGIQVTISVPN  78

Query  319  NEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKA  498
             ++LGIGQS++ AA WV +NV A++P+TNITAIAVGSEVLT++PNAAPVLV A+  +H A
Sbjct  79   EQLLGIGQSNATAANWVARNVIAHVPATNITAIAVGSEVLTALPNAAPVLVSALKLIHSA  138

Query  499  LVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYP  678
            LV++NL+SQ+KVSTP S+ +I   FPPS A FN S +  +  +L+FLQ+T SY MLN YP
Sbjct  139  LVASNLDSQIKVSTPHSSSIILDSFPPSQAFFNRSWDPVMVPLLKFLQSTGSYLMLNVYP  198

Query  679  YYEYVKSD  702
            YY+Y++S+
Sbjct  199  YYDYMQSN  206



>ref|XP_011070588.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 [Sesamum indicum]
Length=499

 Score =   216 bits (549),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 107/184 (58%), Positives = 149/184 (81%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            VG+NIGT +S++P    VV LLKA+QI+HVRL+D D  ML AL+N+GI VIV V N+++L
Sbjct  24   VGVNIGTALSDMPDPTQVVALLKAQQIRHVRLYDTDQAMLRALANSGIRVIVSVPNDQLL  83

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIGQS++ AA WV++N+ A++P+TNI+AIAVGSEVLT++PNAAPVLV AMN++H ALV+A
Sbjct  84   GIGQSNATAANWVSRNILAHVPATNISAIAVGSEVLTTLPNAAPVLVSAMNFIHSALVAA  143

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL+S +KVSTP S+ +I   FPPS A FN + +  +  +L+FLQ+T S+ MLN YPYY+Y
Sbjct  144  NLDSHIKVSTPHSSSIILDSFPPSQAFFNRTWDPVMVPLLKFLQSTGSFLMLNVYPYYDY  203

Query  691  VKSD  702
            ++++
Sbjct  204  MQAN  207



>gb|KHN00662.1| Glucan endo-1,3-beta-glucosidase 3 [Glycine soja]
Length=483

 Score =   215 bits (548),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 109/184 (59%), Positives = 146/184 (79%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+NIGTD +N+PS  +VV LLKA+ I+HVRL+DAD  ML  L+NTGI VIV V N+++L
Sbjct  10   IGVNIGTDATNMPSPTEVVALLKAQGIQHVRLYDADRAMLRTLANTGIRVIVSVPNDQIL  69

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIGQS++ AA WV +NV A++P+TNITAIAVGSEVLTS+PNAAPVLV A+ ++  ALV+A
Sbjct  70   GIGQSNATAANWVARNVIAHVPATNITAIAVGSEVLTSLPNAAPVLVSALKFIQAALVAA  129

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL+ Q+KVSTP S+ +I   FPPS A FN + +  +  +L FLQ+T SY MLN YPYY+Y
Sbjct  130  NLDQQIKVSTPHSSSVILDSFPPSQAFFNKTWDPVMVPLLNFLQSTGSYLMLNVYPYYDY  189

Query  691  VKSD  702
            ++++
Sbjct  190  MQTN  193



>ref|XP_003518194.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Glycine max]
Length=496

 Score =   215 bits (548),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 109/189 (58%), Positives = 147/189 (78%), Gaps = 0/189 (0%)
 Frame = +1

Query  136  FRRCVVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVT  315
            +    +G+NIGTD +N+PS  +VV LLKA+ I+HVRL+DAD  ML  L+NTGI VIV V 
Sbjct  18   YGDAFIGVNIGTDATNMPSPTEVVALLKAQGIQHVRLYDADRAMLRTLANTGIRVIVSVP  77

Query  316  NNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHK  495
            N+++LGIGQS++ AA WV +NV A++P+TNITAIAVGSEVLTS+PNAAPVLV A+ ++  
Sbjct  78   NDQILGIGQSNATAANWVARNVIAHVPATNITAIAVGSEVLTSLPNAAPVLVSALKFIQA  137

Query  496  ALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAY  675
            ALV+ANL+ Q+KVSTP S+ +I   FPPS A FN + +  +  +L FLQ+T SY MLN Y
Sbjct  138  ALVAANLDQQIKVSTPHSSSVILDSFPPSQAFFNKTWDPVMVPLLNFLQSTGSYLMLNVY  197

Query  676  PYYEYVKSD  702
            PYY+Y++++
Sbjct  198  PYYDYMQTN  206



>gb|EMT28432.1| Glucan endo-1,3-beta-glucosidase 4 [Aegilops tauschii]
Length=695

 Score =   219 bits (558),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 117/193 (61%), Positives = 148/193 (77%), Gaps = 0/193 (0%)
 Frame = +1

Query  115  YMRVIVQFRRCVVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGI  294
            +M ++       VGINIGT VS+LPSA D+V  LK  +I+HVRL D+D  ML AL+NTGI
Sbjct  13   FMLMLFNASGAFVGINIGTGVSDLPSASDIVSTLKTMKIQHVRLVDSDHQMLVALANTGI  72

Query  295  EVIVGVTNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVP  474
            EV+VGV N+++L +GQS   A  WVNKNVAAY+P+TNIT IAVG EVLTS+PNAA VLVP
Sbjct  73   EVMVGVPNDQLLRVGQSRPAAVDWVNKNVAAYIPATNITYIAVGDEVLTSLPNAALVLVP  132

Query  475  AMNYLHKALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNS  654
            A+ +L  AL++ANLN+QVK+S+P S D+I K FPPSTATFN + +S +   LQFL++T S
Sbjct  133  ALQFLQSALLAANLNTQVKLSSPHSMDMIPKAFPPSTATFNSTWSSVMLPYLQFLKSTGS  192

Query  655  YYMLNAYPYYEYV  693
             +MLNA PYY YV
Sbjct  193  SFMLNAQPYYSYV  205



>ref|XP_004498268.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Cicer arietinum]
Length=496

 Score =   215 bits (547),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 110/184 (60%), Positives = 146/184 (79%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+NIGTDV+N+PS  + V LLKA+ I+HVRL+DAD  ML AL+ TGI+VIV V N+E+L
Sbjct  22   IGVNIGTDVTNMPSPTETVSLLKAQSIQHVRLYDADRSMLLALAKTGIQVIVSVPNDELL  81

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIGQS++ AA WV +NV A++PSTNITAIAVGSEVLTS+PN APVLV A+ ++H ALV+A
Sbjct  82   GIGQSNATAANWVTRNVIAHVPSTNITAIAVGSEVLTSLPNVAPVLVSALQFIHSALVAA  141

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL+ Q+KVSTP ++ +I    PPS A FN + +  +  +L+FLQ+T SY MLN YPYY+Y
Sbjct  142  NLDQQIKVSTPLASSIILDXXPPSQAFFNRTWDPVMTPLLKFLQSTGSYLMLNVYPYYDY  201

Query  691  VKSD  702
             +S+
Sbjct  202  RQSN  205



>gb|KJB30776.1| hypothetical protein B456_005G159100 [Gossypium raimondii]
Length=497

 Score =   215 bits (547),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 106/184 (58%), Positives = 150/184 (82%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+NIGTD+S++P+  +VV LLKA++I+HVRL+DAD  ML AL+ TGI+V V V N+++L
Sbjct  23   IGVNIGTDLSDMPTPTEVVALLKAQRIRHVRLYDADQAMLLALAKTGIQVTVSVPNDQLL  82

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIGQS++ AA WV +N+ A++P+TNITAIAVGSEVLT++PNAAP+LV A+ ++H ALV++
Sbjct  83   GIGQSNATAANWVARNIVAHVPATNITAIAVGSEVLTALPNAAPILVSALKFIHSALVAS  142

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL+ Q+KVSTP S+ +I   FPPS A FN S +  +  +L+FLQ+T SY MLN YPYY+Y
Sbjct  143  NLDDQIKVSTPHSSSIILDSFPPSQAFFNRSWDPVMVPLLKFLQSTGSYLMLNVYPYYDY  202

Query  691  VKSD  702
            ++S+
Sbjct  203  MQSN  206



>gb|KHG06295.1| hypothetical protein F383_32557 [Gossypium arboreum]
Length=497

 Score =   215 bits (547),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 106/184 (58%), Positives = 150/184 (82%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+NIGTD+S++P+  +VV LLKA++I+HVRL+DAD  ML AL+ TGI+V V V N+++L
Sbjct  23   IGVNIGTDLSDMPTPTEVVALLKAQRIRHVRLYDADQAMLLALAKTGIQVTVSVPNDQLL  82

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIGQS++ AA WV +N+ A++P+TNITAIAVGSEVLT++PNAAP+LV A+ ++H ALV++
Sbjct  83   GIGQSNATAANWVARNIVAHVPATNITAIAVGSEVLTALPNAAPILVSALKFIHSALVAS  142

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL+ Q+KVSTP S+ +I   FPPS A FN S +  +  +L+FLQ+T SY MLN YPYY+Y
Sbjct  143  NLDDQIKVSTPHSSSIILDSFPPSQAFFNRSWDPVMVPLLKFLQSTGSYLMLNVYPYYDY  202

Query  691  VKSD  702
            ++S+
Sbjct  203  MQSN  206



>ref|XP_009351539.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 [Pyrus x bretschneideri]
Length=498

 Score =   215 bits (547),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 106/188 (56%), Positives = 150/188 (80%), Gaps = 0/188 (0%)
 Frame = +1

Query  139  RRCVVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTN  318
            +  V+G+N+GTDVS++PS   V  LLKA+ I+H+RL+DAD  ML AL+NTGI+V + V N
Sbjct  19   KDAVIGVNLGTDVSDMPSPTQVAALLKAQNIRHIRLYDADRAMLLALANTGIQVTISVPN  78

Query  319  NEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKA  498
             ++LGIGQS++ AA WV +NV A++P+TNITAIAVGSEVL+++PNAAPVLV A+ ++H A
Sbjct  79   EQLLGIGQSNATAANWVARNVIAHVPATNITAIAVGSEVLSALPNAAPVLVSALKFIHSA  138

Query  499  LVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYP  678
            LV++NL+ Q+KVSTP S+ +I   FPPS A FN S +  +  +L+FLQ+T+SY MLN YP
Sbjct  139  LVASNLDRQIKVSTPHSSSIILDSFPPSQAFFNRSWDPVMVPLLKFLQSTDSYLMLNVYP  198

Query  679  YYEYVKSD  702
            Y++Y++S+
Sbjct  199  YFDYMRSN  206



>gb|KHG27056.1| hypothetical protein F383_08405 [Gossypium arboreum]
Length=509

 Score =   214 bits (546),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 109/188 (58%), Positives = 148/188 (79%), Gaps = 0/188 (0%)
 Frame = +1

Query  139  RRCVVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTN  318
             +  +G+NIGTD+S++PS   VV LLKA+ + HVRL+DAD  ML AL+NTGI+V + V N
Sbjct  19   EKAFIGVNIGTDLSDMPSPTQVVALLKAQNVWHVRLYDADRAMLLALANTGIQVTISVPN  78

Query  319  NEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKA  498
             ++LGIGQS++ AA WV +NV A++P+TNITAIAVGSEVLT++PNAAPVLV A+  +H A
Sbjct  79   EQLLGIGQSNATAANWVARNVIAHVPATNITAIAVGSEVLTALPNAAPVLVSALKLIHSA  138

Query  499  LVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYP  678
            LV++NL+SQ+KVSTP S+ +I   FPPS A FN S +  +  +L+FLQ+T SY MLN YP
Sbjct  139  LVASNLDSQIKVSTPHSSSIILDSFPPSQAFFNRSWDPVMVPLLKFLQSTGSYLMLNVYP  198

Query  679  YYEYVKSD  702
            YY+Y++S+
Sbjct  199  YYDYMQSN  206



>ref|XP_007151812.1| hypothetical protein PHAVU_004G077000g [Phaseolus vulgaris]
 gb|ESW23806.1| hypothetical protein PHAVU_004G077000g [Phaseolus vulgaris]
Length=495

 Score =   214 bits (545),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 111/182 (61%), Positives = 146/182 (80%), Gaps = 0/182 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+NIGTDV+N+PS  +VV LLKA+ I+HVRL+DAD  ML AL+NTGI VIV V N+++L
Sbjct  22   IGVNIGTDVTNMPSPTEVVTLLKAQGIQHVRLYDADRAMLRALANTGIRVIVSVPNDQLL  81

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIGQS++ AA WV +NV A++P+TNITAIAVGSEVLTS+ NAAPVLV A+ +L  ALV+A
Sbjct  82   GIGQSNATAANWVARNVIAHVPATNITAIAVGSEVLTSLTNAAPVLVSALKFLQAALVAA  141

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL+ Q+KVSTP S+ ++   FPPS A FN S +  +  +L+FLQ+T SY MLN YPYY++
Sbjct  142  NLDQQIKVSTPHSSSVMVNSFPPSQAFFNKSWDPVMVPLLKFLQSTGSYLMLNVYPYYDF  201

Query  691  VK  696
            +K
Sbjct  202  MK  203



>gb|KJB15376.1| hypothetical protein B456_002G174100 [Gossypium raimondii]
Length=498

 Score =   214 bits (546),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 109/188 (58%), Positives = 148/188 (79%), Gaps = 0/188 (0%)
 Frame = +1

Query  139  RRCVVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTN  318
             +  +G+NIGTD+S++PS   VV LLKA+ + HVRL+DAD  ML AL+NTGI+V + V N
Sbjct  19   EKAFIGVNIGTDLSDMPSPTQVVALLKAQNVWHVRLYDADRAMLLALANTGIQVTISVPN  78

Query  319  NEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKA  498
             ++LGIGQS++ AA WV +NV A++P+TNITAIAVGSEVLT++PNAAPVLV A+  +H A
Sbjct  79   EQLLGIGQSNATAANWVARNVIAHVPATNITAIAVGSEVLTALPNAAPVLVSALKLIHSA  138

Query  499  LVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYP  678
            LV++NL+SQ+KVSTP S+ +I   FPPS A FN S +  +  +L+FLQ+T SY MLN YP
Sbjct  139  LVASNLDSQIKVSTPHSSSIILDSFPPSQAFFNRSWDPVMVPLLKFLQSTGSYLMLNVYP  198

Query  679  YYEYVKSD  702
            YY+Y++S+
Sbjct  199  YYDYMQSN  206



>ref|XP_008366987.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Malus domestica]
Length=498

 Score =   213 bits (543),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 106/184 (58%), Positives = 150/184 (82%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+N+GTD+S +PS   VV LLKA+ I+H+RL+DAD  ML AL+NTGI+V+V V N++++
Sbjct  23   IGVNLGTDLSAMPSPTQVVALLKAQNIRHIRLYDADRTMLLALANTGIQVMVSVPNDQLI  82

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIGQS++ AA WV +NV A++P+TNITAIAVGSEVL+++PNAAPVLV A+ ++H ALV++
Sbjct  83   GIGQSNATAANWVARNVIAHVPATNITAIAVGSEVLSALPNAAPVLVSALKFIHSALVAS  142

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL+ Q++VSTP S+ +I   FPPS A FN S +  +  +L+FLQ+T+SY MLN YPYY+Y
Sbjct  143  NLDRQIRVSTPHSSSIILDSFPPSQAFFNRSWDPVMVPLLKFLQSTDSYLMLNVYPYYDY  202

Query  691  VKSD  702
            V+S+
Sbjct  203  VQSN  206



>ref|XP_010267790.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Nelumbo nucifera]
Length=495

 Score =   213 bits (543),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 109/192 (57%), Positives = 150/192 (78%), Gaps = 0/192 (0%)
 Frame = +1

Query  127  IVQFRRCVVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIV  306
            +V      +G+NIGT +S++P    VV LL+A+QI+HVRL+DAD  ML AL+NTGI V V
Sbjct  14   LVTAEDAFIGVNIGTALSDMPDPTQVVALLRAQQIRHVRLYDADRAMLLALANTGIRVTV  73

Query  307  GVTNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNY  486
             V N+++LG+GQS++ AA WV +NV A++P+TNITAIAVGSEVLT++PNAAPVLV A+ +
Sbjct  74   SVPNDQLLGVGQSNATAANWVARNVVAHVPATNITAIAVGSEVLTTLPNAAPVLVSALKF  133

Query  487  LHKALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYML  666
            +H ALV++NL++Q+KVSTP S+ +I   FPPS A FN S N  +  +L+FLQ+T SY ML
Sbjct  134  IHSALVASNLDNQIKVSTPHSSSIILDSFPPSQAFFNHSWNPVMVPLLKFLQSTGSYLML  193

Query  667  NAYPYYEYVKSD  702
            N YPYY+Y++S+
Sbjct  194  NVYPYYDYMQSN  205



>ref|XP_004140301.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like [Cucumis sativus]
 ref|XP_004155734.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like [Cucumis sativus]
 gb|KGN51058.1| Glucan endo-1,3-beta-glucosidase [Cucumis sativus]
Length=503

 Score =   213 bits (543),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 108/184 (59%), Positives = 146/184 (79%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            VG+NIGT++S +P    V  LLKA+QI+HVRL+DAD  ML AL+NTGI+V+V + N ++L
Sbjct  30   VGVNIGTELSVMPHPTQVAALLKAQQIRHVRLYDADGGMLMALANTGIQVMVTIPNEQIL  89

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIGQS+S AA WVN+NV A+ P+TNITAI+VGS+VLT++PNAA +LV A+ Y+H ALV++
Sbjct  90   GIGQSNSTAANWVNRNVLAHYPATNITAISVGSDVLTTLPNAAKILVNALKYIHSALVAS  149

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL+ Q+KVSTP S+ +I   FPPS A FN S +  +  +L FLQ+TNS+ MLN YPYY+Y
Sbjct  150  NLDHQIKVSTPLSSSIILDSFPPSQAFFNASLDPVIVPLLGFLQSTNSFLMLNVYPYYDY  209

Query  691  VKSD  702
            ++SD
Sbjct  210  MQSD  213



>ref|XP_008460531.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2 isoform X2 [Cucumis 
melo]
Length=481

 Score =   213 bits (541),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 109/189 (58%), Positives = 147/189 (78%), Gaps = 0/189 (0%)
 Frame = +1

Query  136  FRRCVVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVT  315
            F    VG+NIGT++S +P    V  LLKA+QI+HVRL+DAD  ML AL+NTGI+V+V + 
Sbjct  3    FADVFVGVNIGTELSVMPHPTQVAALLKAQQIRHVRLYDADGGMLMALANTGIQVMVTIP  62

Query  316  NNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHK  495
            N ++LGIGQS+S AA WVN+NV A+ P+TNITAI+VG +VLT++PNAA +LV A+ Y+H 
Sbjct  63   NEQILGIGQSNSTAANWVNRNVLAHYPATNITAISVGFDVLTTLPNAAKILVNALKYVHS  122

Query  496  ALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAY  675
            ALV++NL+ Q+KVSTP S+ +I   FPPS A FN S +S +  +L FLQ+TNS+ MLN Y
Sbjct  123  ALVASNLDHQIKVSTPLSSSIILDSFPPSQAFFNASLDSVIVPLLGFLQSTNSFLMLNVY  182

Query  676  PYYEYVKSD  702
            PYY+Y++SD
Sbjct  183  PYYDYMQSD  191



>ref|XP_007160410.1| hypothetical protein PHAVU_002G319500g [Phaseolus vulgaris]
 gb|ESW32404.1| hypothetical protein PHAVU_002G319500g [Phaseolus vulgaris]
Length=352

 Score =   209 bits (532),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 104/186 (56%), Positives = 145/186 (78%), Gaps = 0/186 (0%)
 Frame = +1

Query  145  CVVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  324
              +G+NIG D+S++P   ++V LLKA+ I+HVRL+DAD  +L AL+ TGI V V V N++
Sbjct  23   AFIGVNIGLDISDIPGPTEIVALLKAQSIQHVRLYDADRALLRALAKTGIRVTVSVPNDQ  82

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +LGIGQS++ AA WV +NV A++PSTNITAI VGSEVLT++PNAAP+LV A+N++H ALV
Sbjct  83   LLGIGQSNATAANWVTRNVIAHIPSTNITAICVGSEVLTTLPNAAPILVSAINFIHSALV  142

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  684
            +ANL+ Q+KVS+P S+ +I   FPPS A FN + N  +  +L+FLQ+T SY MLN YPYY
Sbjct  143  AANLDQQIKVSSPHSSSIILDSFPPSQAFFNRTWNPVMVPMLKFLQSTGSYLMLNVYPYY  202

Query  685  EYVKSD  702
            +Y +++
Sbjct  203  DYQQAN  208



>gb|KFK41053.1| hypothetical protein AALP_AA2G079300 [Arabis alpina]
Length=498

 Score =   213 bits (542),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 110/184 (60%), Positives = 146/184 (79%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+NIGTD+S++P    VV LLKA+QI+H+RL+DAD  ML AL+NTGI+VI+ + N+++L
Sbjct  27   IGVNIGTDLSDMPHPTQVVALLKAQQIRHIRLYDADPGMLIALANTGIKVIISIPNDQLL  86

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIGQS+S AA WV +NV A+ P+T ITAI+VGSEVLTS+PNAAPVLV A+  +H AL+S+
Sbjct  87   GIGQSNSTAANWVKRNVIAHYPATTITAISVGSEVLTSLPNAAPVLVSAIKNIHSALLSS  146

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL+  +KVSTP ST LI   FPPS A FN S N  +  +L FLQ+TNSY M+N YPYY+Y
Sbjct  147  NLDRLIKVSTPLSTSLILDPFPPSQAFFNRSLNPVIVPLLSFLQSTNSYLMINVYPYYDY  206

Query  691  VKSD  702
            ++S+
Sbjct  207  MQSN  210



>ref|XP_008221445.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 [Prunus mume]
Length=513

 Score =   213 bits (542),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 105/184 (57%), Positives = 150/184 (82%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+N+GTD+S++PS   VV LLKA+ I+H+RL+DAD  ML AL+NTGI+V V V N+++L
Sbjct  38   IGVNLGTDLSDMPSPTQVVALLKAQNIRHIRLYDADRAMLLALANTGIQVTVSVPNDQLL  97

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIGQS++ AA W+ +NV A++P+TNIT+IAVGSEVL+++PNAAPVLV A+ ++H ALV++
Sbjct  98   GIGQSNATAANWIARNVIAHVPATNITSIAVGSEVLSALPNAAPVLVSALKFIHSALVAS  157

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL+ Q+KVSTP S+ +I   FPPS A FN S +  +  +L+FLQ+T+SY MLN YPYY+Y
Sbjct  158  NLDRQIKVSTPHSSAIILDSFPPSQAFFNRSWDPVMVPLLKFLQSTDSYLMLNVYPYYDY  217

Query  691  VKSD  702
            ++S+
Sbjct  218  MQSN  221



>gb|EYU41109.1| hypothetical protein MIMGU_mgv1a005128mg [Erythranthe guttata]
Length=496

 Score =   213 bits (541),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 104/184 (57%), Positives = 148/184 (80%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+NIGT +S++PS   VV LLK++QI+HVRL+D+D  ML AL+NTGI V V V N+++L
Sbjct  23   IGVNIGTSLSDMPSPTQVVSLLKSQQIRHVRLYDSDRAMLLALANTGIRVTVSVPNDQLL  82

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
             IGQS+  AA WV++N+ ++ P+TNIT+I+VG+EVL+++PNAAPVL+PAM +LH ALV+A
Sbjct  83   AIGQSNLTAANWVSRNILSHYPATNITSISVGTEVLSTLPNAAPVLLPAMKFLHSALVAA  142

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL SQ+K+STP S+ +I   FPPS A FN + +  +  +LQFLQ+TNS+ MLN YPYY+Y
Sbjct  143  NLQSQIKLSTPHSSSIILDSFPPSQAFFNRTWDPLMVPLLQFLQSTNSFLMLNVYPYYDY  202

Query  691  VKSD  702
            ++S+
Sbjct  203  MQSN  206



>gb|KHG27055.1| hypothetical protein F383_08405 [Gossypium arboreum]
Length=556

 Score =   214 bits (544),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 109/189 (58%), Positives = 148/189 (78%), Gaps = 0/189 (0%)
 Frame = +1

Query  136  FRRCVVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVT  315
            +    +G+NIGTD+S++PS   VV LLKA+ + HVRL+DAD  ML AL+NTGI+V + V 
Sbjct  65   YAEAFIGVNIGTDLSDMPSPTQVVALLKAQNVWHVRLYDADRAMLLALANTGIQVTISVP  124

Query  316  NNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHK  495
            N ++LGIGQS++ AA WV +NV A++P+TNITAIAVGSEVLT++PNAAPVLV A+  +H 
Sbjct  125  NEQLLGIGQSNATAANWVARNVIAHVPATNITAIAVGSEVLTALPNAAPVLVSALKLIHS  184

Query  496  ALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAY  675
            ALV++NL+SQ+KVSTP S+ +I   FPPS A FN S +  +  +L+FLQ+T SY MLN Y
Sbjct  185  ALVASNLDSQIKVSTPHSSSIILDSFPPSQAFFNRSWDPVMVPLLKFLQSTGSYLMLNVY  244

Query  676  PYYEYVKSD  702
            PYY+Y++S+
Sbjct  245  PYYDYMQSN  253



>ref|XP_007141916.1| hypothetical protein PHAVU_008G236700g [Phaseolus vulgaris]
 gb|ESW13910.1| hypothetical protein PHAVU_008G236700g [Phaseolus vulgaris]
Length=498

 Score =   212 bits (540),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 113/195 (58%), Positives = 148/195 (76%), Gaps = 0/195 (0%)
 Frame = +1

Query  118  MRVIVQFRRCVVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIE  297
            + ++V      +G+NIGTD+S++P    VV LLKA+QI+HVRL+DAD  ML AL+ TGIE
Sbjct  12   VSLVVADDEAFIGVNIGTDLSDMPHPTQVVALLKAQQIRHVRLYDADQAMLLALAKTGIE  71

Query  298  VIVGVTNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPA  477
            V+V V N E+L IGQS+S AA WV++NV A+ P+TNITAI VGS+VLTS+PNAA VLV A
Sbjct  72   VVVTVPNEELLAIGQSNSTAANWVSRNVVAHYPATNITAICVGSDVLTSLPNAAKVLVSA  131

Query  478  MNYLHKALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSY  657
            + Y+H ALV++NL+ QVKVSTP S+ +I   FPPS A FN S N  +  +L FLQ+T SY
Sbjct  132  IKYIHSALVASNLDRQVKVSTPLSSSIILDSFPPSQAFFNRSLNPVLDPLLDFLQSTGSY  191

Query  658  YMLNAYPYYEYVKSD  702
             MLN YPYY+Y++S+
Sbjct  192  LMLNIYPYYDYMRSN  206



>ref|XP_009388453.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=463

 Score =   211 bits (538),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 116/174 (67%), Positives = 142/174 (82%), Gaps = 0/174 (0%)
 Frame = +1

Query  175  VSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVLGIGQSSSQ  354
            VSNLPSA D+V +LK +QIKHVRLFDA+  ML AL+NTGI+V++GV N+++L IG S S+
Sbjct  2    VSNLPSAADIVSILKTQQIKHVRLFDANHQMLGALANTGIDVMLGVPNDQLLRIGNSRSE  61

Query  355  AAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSANLNSQVKV  534
            AA W+NKNVAA++P TNIT IAVG+E+LTSIPNAA VLVPAM +L  ALV++NLNSQVKV
Sbjct  62   AADWINKNVAAFVPETNITYIAVGNEILTSIPNAALVLVPAMQFLQSALVASNLNSQVKV  121

Query  535  STPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEYVK  696
            S+P S D+I K FPPSTATFN S NS + Q L FL+NT S  M+NA PYY Y+K
Sbjct  122  SSPLSMDMIPKSFPPSTATFNSSWNSVMSQYLLFLKNTGSPLMVNAQPYYGYIK  175



>ref|XP_008775310.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like isoform X2 
[Phoenix dactylifera]
Length=445

 Score =   211 bits (536),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 103/184 (56%), Positives = 148/184 (80%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+N+GT +S++PS   VV LLK++QI+HVRL+DAD  +L+AL+NTGI V V V N+++L
Sbjct  22   IGVNLGTALSDMPSPTQVVALLKSQQIRHVRLYDADPAILAALANTGIRVTVSVPNDQLL  81

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
             +GQS++ AA WV++NV  ++P+ NITA+AVGSEVLT++PNAAP++VPA+ Y+H ALV+A
Sbjct  82   AVGQSNATAANWVSRNVVGHVPAVNITAVAVGSEVLTALPNAAPLVVPALRYVHSALVAA  141

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL+ Q+KVSTP S+ +I   FPPS A FN S +  +  +L+FLQ+T SY MLN YPYY+Y
Sbjct  142  NLDRQIKVSTPHSSSIILDSFPPSQAFFNRSLDPVIVPMLKFLQSTGSYLMLNVYPYYDY  201

Query  691  VKSD  702
            ++S+
Sbjct  202  MQSN  205



>ref|XP_006575486.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like isoform X2 
[Glycine max]
Length=505

 Score =   212 bits (540),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 111/191 (58%), Positives = 147/191 (77%), Gaps = 0/191 (0%)
 Frame = +1

Query  130  VQFRRCVVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVG  309
            + ++   +G+NIGTD+S++P    VV LLKA+QI+HVRL+DAD  ML AL+ TGI+V+V 
Sbjct  24   LSYQEPFIGVNIGTDLSDMPHPTQVVALLKAQQIRHVRLYDADQAMLLALAKTGIQVVVT  83

Query  310  VTNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYL  489
            V N E+L IGQS+S AA WV++NV A+ P+TNITAI VGSEVLT++PNAA VLV A+ Y+
Sbjct  84   VPNEEILAIGQSNSTAANWVSRNVVAHYPATNITAICVGSEVLTTLPNAAKVLVSAIKYI  143

Query  490  HKALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLN  669
            H ALV++NL+ QVKVSTP S+ +I   FPPS A FN S N  +  +L FLQ+T SY MLN
Sbjct  144  HSALVASNLDRQVKVSTPLSSSIILDSFPPSQAFFNRSLNPVLVPLLDFLQSTGSYLMLN  203

Query  670  AYPYYEYVKSD  702
             YPYY+Y++S+
Sbjct  204  IYPYYDYMQSN  214



>ref|XP_002527772.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
 gb|EEF34582.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
Length=533

 Score =   213 bits (541),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 106/184 (58%), Positives = 147/184 (80%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+N+GT +S++PS   VV LLKA+ I+HVRL+DAD  ML AL+NTGI V V V N ++L
Sbjct  23   IGVNVGTALSDMPSPTQVVALLKAQNIRHVRLYDADRAMLLALANTGIRVTVSVPNEQLL  82

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIGQS++ AA WV +NV A++P+TNITAIAVGSEVLT++PNAAPVLV A+ ++H ALV++
Sbjct  83   GIGQSNATAANWVARNVIAHVPATNITAIAVGSEVLTTLPNAAPVLVSALKFIHSALVAS  142

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL+ Q+KVSTP S+ +I   FPPS A FN + +  +  +L+FLQ+T SY+M+N YPYY+Y
Sbjct  143  NLDGQIKVSTPHSSSIILDSFPPSQAFFNRTWDPVMVPLLKFLQSTGSYFMINVYPYYDY  202

Query  691  VKSD  702
            ++S+
Sbjct  203  MQSN  206



>ref|XP_004288596.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2 [Fragaria vesca 
subsp. vesca]
Length=504

 Score =   212 bits (539),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 108/184 (59%), Positives = 147/184 (80%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+NIGT +S++P    VV LLKA+QI+HVRL+DAD  ML AL+NTGI+VI+ V N+++L
Sbjct  32   IGVNIGTSLSDMPHPTQVVALLKAQQIRHVRLYDADRAMLVALANTGIQVIISVPNDQIL  91

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIGQS+S AA WV++NV A+ P+TNITAI+VGSEVLT++PN A +LV A+ Y+H ALV++
Sbjct  92   GIGQSNSTAANWVSQNVVAHYPATNITAISVGSEVLTAVPNTAKILVSALKYIHSALVAS  151

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL+SQ+KVSTP S+ +I   FPPS A FN S N  +  +L FLQ+T S+ MLN YPYY+Y
Sbjct  152  NLDSQIKVSTPLSSSIILDSFPPSQAFFNRSLNPVLVPMLSFLQSTGSFLMLNVYPYYDY  211

Query  691  VKSD  702
            ++S+
Sbjct  212  MQSN  215



>ref|XP_006372566.1| glycosyl hydrolase family 17 family protein [Populus trichocarpa]
 gb|ERP50363.1| glycosyl hydrolase family 17 family protein [Populus trichocarpa]
Length=481

 Score =   211 bits (537),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 110/192 (57%), Positives = 147/192 (77%), Gaps = 0/192 (0%)
 Frame = +1

Query  127  IVQFRRCVVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIV  306
            + + +   +G+NIGTD+S++P    VV LLKA+QI HVRL+DAD  ML AL+NTGI+V+V
Sbjct  1    MAKSQEAFIGVNIGTDLSDMPHPTQVVALLKAQQIWHVRLYDADRGMLVALANTGIQVMV  60

Query  307  GVTNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNY  486
             V N+++LGIGQS+S AA WV+ N+ A+ P+TNITAI VGSEV T+IPNAAPVLV AM Y
Sbjct  61   SVPNDQLLGIGQSNSTAANWVSHNIVAHYPATNITAICVGSEVFTTIPNAAPVLVNAMKY  120

Query  487  LHKALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYML  666
            +  ALV++NL+ Q+KVSTP S+ +I   FPPS A FN S N  +  +L FLQ+T S+ ML
Sbjct  121  IQSALVASNLDRQIKVSTPLSSSIILDSFPPSQAFFNRSWNPVLIPMLNFLQSTGSHLML  180

Query  667  NAYPYYEYVKSD  702
            N YPYY+Y++S+
Sbjct  181  NIYPYYDYMQSN  192



>ref|XP_008775304.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like isoform X1 
[Phoenix dactylifera]
Length=497

 Score =   211 bits (537),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 103/184 (56%), Positives = 148/184 (80%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+N+GT +S++PS   VV LLK++QI+HVRL+DAD  +L+AL+NTGI V V V N+++L
Sbjct  22   IGVNLGTALSDMPSPTQVVALLKSQQIRHVRLYDADPAILAALANTGIRVTVSVPNDQLL  81

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
             +GQS++ AA WV++NV  ++P+ NITA+AVGSEVLT++PNAAP++VPA+ Y+H ALV+A
Sbjct  82   AVGQSNATAANWVSRNVVGHVPAVNITAVAVGSEVLTALPNAAPLVVPALRYVHSALVAA  141

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL+ Q+KVSTP S+ +I   FPPS A FN S +  +  +L+FLQ+T SY MLN YPYY+Y
Sbjct  142  NLDRQIKVSTPHSSSIILDSFPPSQAFFNRSLDPVIVPMLKFLQSTGSYLMLNVYPYYDY  201

Query  691  VKSD  702
            ++S+
Sbjct  202  MQSN  205



>ref|XP_002531922.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
 gb|EEF30466.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
Length=508

 Score =   211 bits (537),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 107/184 (58%), Positives = 147/184 (80%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+NIGTD+S++P    VV LLKA+QI+H+RL++AD  ML AL+N+GI+V+V V N ++L
Sbjct  34   IGVNIGTDLSDMPHPTQVVALLKAQQIRHIRLYNADRGMLVALANSGIQVMVSVPNEQLL  93

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIGQS+S AA WV++NV A+ P+TNITAI+VGSE+L ++PNAAPVLV AM ++H ALV++
Sbjct  94   GIGQSNSTAANWVSRNVVAHYPATNITAISVGSEILNTLPNAAPVLVNAMKFIHSALVAS  153

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL+ Q+KVSTP S+ +I   FPPS A FN S N  +  +L FLQ+T SY MLN YPYY+Y
Sbjct  154  NLDRQIKVSTPLSSSIILDSFPPSQAFFNRSWNPVLVPMLNFLQSTGSYLMLNVYPYYDY  213

Query  691  VKSD  702
            ++S+
Sbjct  214  MQSN  217



>ref|XP_010926119.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Elaeis guineensis]
Length=501

 Score =   211 bits (537),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 104/184 (57%), Positives = 147/184 (80%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+N+GT +S++PS   VV LLK+++I+HVRL+DAD  ML+AL+N+GI V V V N ++L
Sbjct  25   IGVNVGTALSDMPSPTQVVALLKSQEIRHVRLYDADPAMLAALANSGIRVTVSVPNEQLL  84

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
             +GQS++ AA WV++NV A++P+ NITA+AVGSEVLT++PNAAP+LVPA+ Y+H ALV+A
Sbjct  85   AVGQSNATAANWVSRNVVAHVPAVNITAVAVGSEVLTALPNAAPLLVPAVRYVHSALVAA  144

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL+ Q+KVSTP S+ +I   FPPS A FN S    +  +L+FLQ+T SY MLN YPYY+Y
Sbjct  145  NLDRQIKVSTPHSSSIILDSFPPSQAFFNRSLEPVMVPMLKFLQSTGSYLMLNVYPYYDY  204

Query  691  VKSD  702
            ++S+
Sbjct  205  MQSN  208



>ref|XP_010066584.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Eucalyptus 
grandis]
 gb|KCW64517.1| hypothetical protein EUGRSUZ_G02118 [Eucalyptus grandis]
Length=499

 Score =   211 bits (537),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 106/184 (58%), Positives = 146/184 (79%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+NIGTD+SN+PS   VV LLKA+ I+HVRL+D D  ML AL+N+GI V V V N+++L
Sbjct  24   IGVNIGTDLSNMPSPTQVVALLKAQNIRHVRLYDTDHAMLLALANSGIRVTVSVPNDQLL  83

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIGQS++ AA WV +N+ A++P+TNIT IAVGSEVLT++ NAAPVLV AM ++H ALV++
Sbjct  84   GIGQSNATAAYWVARNIVAHVPATNITVIAVGSEVLTTLQNAAPVLVSAMKFIHSALVAS  143

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL+S++KVSTP S+ +I   FPPS A FN + +  +  +L+FLQ+T SY MLN YPYY+Y
Sbjct  144  NLDSRIKVSTPHSSSIIIDSFPPSQAFFNRTWDPVMVPLLKFLQSTGSYLMLNVYPYYDY  203

Query  691  VKSD  702
            ++S+
Sbjct  204  MQSN  207



>ref|XP_003519328.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like isoform X1 
[Glycine max]
 gb|KHN41067.1| Glucan endo-1,3-beta-glucosidase 2 [Glycine soja]
Length=498

 Score =   211 bits (536),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 111/184 (60%), Positives = 144/184 (78%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+NIGTD+S++P    VV LLKA+QI+HVRL+DAD  ML AL+ TGI+V+V V N E+L
Sbjct  24   IGVNIGTDLSDMPHPTQVVALLKAQQIRHVRLYDADQAMLLALAKTGIQVVVTVPNEEIL  83

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
             IGQS+S AA WV++NV A+ P+TNITAI VGSEVLT++PNAA VLV A+ Y+H ALV++
Sbjct  84   AIGQSNSTAANWVSRNVVAHYPATNITAICVGSEVLTTLPNAAKVLVSAIKYIHSALVAS  143

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL+ QVKVSTP S+ +I   FPPS A FN S N  +  +L FLQ+T SY MLN YPYY+Y
Sbjct  144  NLDRQVKVSTPLSSSIILDSFPPSQAFFNRSLNPVLVPLLDFLQSTGSYLMLNIYPYYDY  203

Query  691  VKSD  702
            ++S+
Sbjct  204  MQSN  207



>ref|XP_006596503.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like isoform X2 
[Glycine max]
Length=448

 Score =   209 bits (533),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 112/195 (57%), Positives = 146/195 (75%), Gaps = 0/195 (0%)
 Frame = +1

Query  118  MRVIVQFRRCVVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIE  297
            + V+       +G+NIGTD+S++P    VV LLKA+QI+HVRL+DAD  ML AL+ TGI+
Sbjct  13   VSVVAADEEPFIGVNIGTDLSDMPHPTQVVALLKAQQIRHVRLYDADQAMLLALAKTGIQ  72

Query  298  VIVGVTNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPA  477
            V V V N E+L IGQS+S AA WV++NV A+ P+TNITAI VGSEVLT++PNAA VLV A
Sbjct  73   VAVTVPNEEILAIGQSNSTAANWVSRNVVAHYPATNITAICVGSEVLTTLPNAAKVLVSA  132

Query  478  MNYLHKALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSY  657
            + Y+H ALV++NL+ QVKVSTP S+ +I   FPPS A FN S N  +  +L FLQ+T SY
Sbjct  133  IKYIHSALVASNLDRQVKVSTPLSSSIILDSFPPSQAFFNRSLNPVLVPLLDFLQSTGSY  192

Query  658  YMLNAYPYYEYVKSD  702
             MLN YPYY+Y++S+
Sbjct  193  LMLNIYPYYDYMQSN  207



>ref|XP_010553889.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like [Tarenaya 
hassleriana]
Length=500

 Score =   211 bits (536),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 107/184 (58%), Positives = 147/184 (80%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+NIGTD+S++P    VV LLKA+QI+H+RL+D D  ML+AL+NTGI+V+V V N+++L
Sbjct  29   IGVNIGTDLSDMPHPTQVVALLKAQQIRHIRLYDTDPGMLTALANTGIKVVVSVPNDQLL  88

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIGQS+S AA WV +N+ A+ P+TNITAIAVGS+VLT++PN +PVLV A+  +H AL+S+
Sbjct  89   GIGQSNSTAANWVKRNIIAHYPATNITAIAVGSDVLTTLPNVSPVLVNAIKNIHSALLSS  148

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL+ ++KVSTP ST LI   FPPS A FN S N  +  +L FLQ+T+SY MLN YPYY+Y
Sbjct  149  NLDGRIKVSTPLSTSLILDPFPPSQAFFNRSWNPVLVPLLSFLQSTDSYLMLNVYPYYDY  208

Query  691  VKSD  702
            ++S+
Sbjct  209  MQSN  212



>gb|KDP38099.1| hypothetical protein JCGZ_04742 [Jatropha curcas]
Length=498

 Score =   211 bits (536),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 104/184 (57%), Positives = 147/184 (80%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+NIGT +S++P+   VV LLKA+ I+HVRL+DAD  ML AL+NTGI V V V N ++L
Sbjct  23   IGVNIGTALSDMPNPTQVVALLKAQNIRHVRLYDADRAMLLALANTGIRVTVSVPNEQLL  82

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIGQS++ AA WV++NV A++P+TNIT IAVGSEVLT++PNAAPVL+ A+ ++H ALV++
Sbjct  83   GIGQSNATAANWVSRNVIAHVPATNITGIAVGSEVLTTLPNAAPVLLSALKFIHSALVAS  142

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL+ Q+KVSTP S+ +I   FPPS A FN + +  +  +++FLQ+T SY+MLN YPYY+Y
Sbjct  143  NLDDQIKVSTPHSSSIILDSFPPSQAFFNRTWDPVMVPLIKFLQSTGSYFMLNVYPYYDY  202

Query  691  VKSD  702
            ++S+
Sbjct  203  MQSN  206



>ref|XP_004503127.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like [Cicer arietinum]
Length=498

 Score =   210 bits (534),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 107/184 (58%), Positives = 144/184 (78%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+NIGTD+S++P    VV LLK++QI+H+RL++AD  ML+ALS +GI+V++ V N+E+L
Sbjct  23   IGVNIGTDLSDMPHPTQVVALLKSQQIRHIRLYNADLAMLTALSKSGIQVVISVPNDELL  82

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
             IGQS+S A  WV+ NV AY PSTNITAI VGSEVLT++PNAA +LV A+NY+H ALV+ 
Sbjct  83   SIGQSNSTATKWVHNNVLAYYPSTNITAICVGSEVLTTLPNAAKLLVNALNYIHSALVAL  142

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
             L+ Q+KVSTP  + +I   FPPS A FN S N  +  IL+FLQ+TNSY MLN YPYY+Y
Sbjct  143  KLDRQIKVSTPLPSTVILDSFPPSQAFFNSSLNQVIIPILEFLQSTNSYLMLNIYPYYDY  202

Query  691  VKSD  702
            ++S+
Sbjct  203  MESN  206



>ref|XP_003544983.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like isoform X1 
[Glycine max]
 gb|KHN39465.1| Glucan endo-1,3-beta-glucosidase 2 [Glycine soja]
Length=498

 Score =   209 bits (533),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 112/195 (57%), Positives = 146/195 (75%), Gaps = 0/195 (0%)
 Frame = +1

Query  118  MRVIVQFRRCVVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIE  297
            + V+       +G+NIGTD+S++P    VV LLKA+QI+HVRL+DAD  ML AL+ TGI+
Sbjct  13   VSVVAADEEPFIGVNIGTDLSDMPHPTQVVALLKAQQIRHVRLYDADQAMLLALAKTGIQ  72

Query  298  VIVGVTNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPA  477
            V V V N E+L IGQS+S AA WV++NV A+ P+TNITAI VGSEVLT++PNAA VLV A
Sbjct  73   VAVTVPNEEILAIGQSNSTAANWVSRNVVAHYPATNITAICVGSEVLTTLPNAAKVLVSA  132

Query  478  MNYLHKALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSY  657
            + Y+H ALV++NL+ QVKVSTP S+ +I   FPPS A FN S N  +  +L FLQ+T SY
Sbjct  133  IKYIHSALVASNLDRQVKVSTPLSSSIILDSFPPSQAFFNRSLNPVLVPLLDFLQSTGSY  192

Query  658  YMLNAYPYYEYVKSD  702
             MLN YPYY+Y++S+
Sbjct  193  LMLNIYPYYDYMQSN  207



>ref|XP_002532062.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
 gb|EEF30317.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
Length=436

 Score =   208 bits (529),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 101/127 (80%), Positives = 115/127 (91%), Gaps = 0/127 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +GINIGTDVSN+P A DVV +LK  QI HVRL+DADAHML AL+N+GIEV+VG+TN EVL
Sbjct  26   IGINIGTDVSNMPPASDVVAILKTNQITHVRLYDADAHMLKALANSGIEVMVGITNEEVL  85

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIG+S + AAAW+NKNVA+YLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV++
Sbjct  86   GIGESPAAAAAWINKNVASYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVAS  145

Query  511  NLNSQVK  531
            NLN Q K
Sbjct  146  NLNFQSK  152



>ref|XP_011001568.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2 [Populus euphratica]
Length=503

 Score =   209 bits (533),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 110/184 (60%), Positives = 143/184 (78%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+NIGTD+S++P    VV LLKA+QI HVRL+DAD  ML AL+NTGI+V+V V N ++L
Sbjct  31   IGVNIGTDLSDMPHPTQVVALLKAQQIWHVRLYDADRGMLVALANTGIQVMVSVPNEQLL  90

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIGQS+S AA WV+ N+ A+ P+TNITAI VGSEV T+IPNAAPVLV AM Y+  ALV++
Sbjct  91   GIGQSNSTAANWVSHNIVAHYPATNITAICVGSEVFTTIPNAAPVLVNAMKYIQSALVAS  150

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL+ Q+KVSTP S+ +I   FPPS A FN S N  +  +L FLQ+T S+ MLN YPYY+Y
Sbjct  151  NLDRQIKVSTPLSSSIILDSFPPSQAFFNRSWNPVLIPMLNFLQSTGSHLMLNIYPYYDY  210

Query  691  VKSD  702
            ++S+
Sbjct  211  MQSN  214



>ref|XP_002887020.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63279.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=503

 Score =   209 bits (533),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 110/184 (60%), Positives = 146/184 (79%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+NIGTD+S++P    VV LLKA+QI+H+RL+DAD  ML AL+NTGI+VI+ + N+++L
Sbjct  29   IGVNIGTDLSDMPHPTQVVSLLKAQQIRHIRLYDADPGMLIALANTGIKVIISIPNDQLL  88

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIGQS+S AA WV +NV A+ P+T ITAI+VGSEVLTS+ NAAPVLV A+  +H AL+S+
Sbjct  89   GIGQSNSTAANWVKRNVIAHYPATTITAISVGSEVLTSLSNAAPVLVSAIKNVHAALLSS  148

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL+  +KVSTP ST LI   FPPS A FN S NS +  +L FLQ+TNSY M+N YPYY+Y
Sbjct  149  NLDRLIKVSTPLSTSLILDPFPPSQAFFNRSLNSVIVPLLSFLQSTNSYLMMNVYPYYDY  208

Query  691  VKSD  702
            ++S+
Sbjct  209  MQSN  212



>gb|EPS61988.1| hypothetical protein M569_12804, partial [Genlisea aurea]
Length=418

 Score =   207 bits (528),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 105/184 (57%), Positives = 146/184 (79%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+NIGTD+S++P    VV LLK++QI+HVRL++AD  ML AL+ TGI+V V V N+E+L
Sbjct  3    IGVNIGTDLSDMPHPTQVVALLKSQQIRHVRLYNADRGMLVALAGTGIKVAVSVPNDELL  62

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            G+GQS+S AA WV++NV A+ P+TNITA+ VGSEVLTS+PN APVLV A+ ++H ALV++
Sbjct  63   GVGQSNSTAANWVSQNVVAHYPATNITAVCVGSEVLTSLPNLAPVLVDALKFIHSALVAS  122

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL+ Q+KVS+P ++ +I   FPPS A FN S N  +  +L FLQ+T SY+MLN YPY++Y
Sbjct  123  NLDGQIKVSSPLASSVILDSFPPSQAFFNRSWNHVLVPMLGFLQSTGSYFMLNVYPYFDY  182

Query  691  VKSD  702
            V+S+
Sbjct  183  VRSN  186



>ref|XP_004142367.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Cucumis sativus]
 gb|KGN52361.1| hypothetical protein Csa_5G628660 [Cucumis sativus]
Length=500

 Score =   209 bits (533),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 106/195 (54%), Positives = 151/195 (77%), Gaps = 0/195 (0%)
 Frame = +1

Query  118  MRVIVQFRRCVVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIE  297
            + V+       +G+N+GTD+S++PS   VV LLKA+ I+H+RL+DAD  ML AL+NTGI+
Sbjct  12   VSVVSSGEAAFIGVNLGTDLSDMPSPTQVVALLKAQNIEHIRLYDADRAMLLALANTGIQ  71

Query  298  VIVGVTNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPA  477
            V V V N+++L IG S++ AA WV++NV A++P+TNITAIAVGSEVLT++PNAAPVLV A
Sbjct  72   VTVSVPNDQLLAIGMSNATAANWVSRNVIAHVPATNITAIAVGSEVLTTLPNAAPVLVSA  131

Query  478  MNYLHKALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSY  657
            + ++  ALV++NL+ Q+KVSTP S+ +I   FPPS A FN S +  +  +L+FLQ+T+SY
Sbjct  132  LKFIQSALVASNLDRQIKVSTPHSSSIILDSFPPSQAFFNRSWDPVMVPLLKFLQSTDSY  191

Query  658  YMLNAYPYYEYVKSD  702
             MLN YPYY+Y++S+
Sbjct  192  LMLNVYPYYDYMQSN  206



>ref|XP_007160409.1| hypothetical protein PHAVU_002G319500g [Phaseolus vulgaris]
 gb|ESW32403.1| hypothetical protein PHAVU_002G319500g [Phaseolus vulgaris]
Length=498

 Score =   209 bits (532),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 104/184 (57%), Positives = 145/184 (79%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+NIG D+S++P   ++V LLKA+ I+HVRL+DAD  +L AL+ TGI V V V N+++L
Sbjct  25   IGVNIGLDISDIPGPTEIVALLKAQSIQHVRLYDADRALLRALAKTGIRVTVSVPNDQLL  84

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIGQS++ AA WV +NV A++PSTNITAI VGSEVLT++PNAAP+LV A+N++H ALV+A
Sbjct  85   GIGQSNATAANWVTRNVIAHIPSTNITAICVGSEVLTTLPNAAPILVSAINFIHSALVAA  144

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL+ Q+KVS+P S+ +I   FPPS A FN + N  +  +L+FLQ+T SY MLN YPYY+Y
Sbjct  145  NLDQQIKVSSPHSSSIILDSFPPSQAFFNRTWNPVMVPMLKFLQSTGSYLMLNVYPYYDY  204

Query  691  VKSD  702
             +++
Sbjct  205  QQAN  208



>ref|XP_002265396.3| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like [Vitis vinifera]
 emb|CBI33479.3| unnamed protein product [Vitis vinifera]
Length=494

 Score =   209 bits (531),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 105/184 (57%), Positives = 146/184 (79%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+NIGTD+S++P    VV LLKA+QI+HVRLF+A+  ML+AL+NTGI V V + N +VL
Sbjct  22   IGVNIGTDLSDMPHPTQVVALLKAQQIRHVRLFNAEPAMLTALANTGIRVTVAIPNEQVL  81

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            G+GQS+S AA WV++N+ A+ P+TNIT IA+GSEVLT++PNAAPVLV A+ ++H AL+++
Sbjct  82   GVGQSNSTAANWVSRNIVAHYPATNITTIAIGSEVLTTLPNAAPVLVNALKFIHSALLAS  141

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL+ Q+KVSTP S+ +I   FPPS A FN S N  +  +L FLQ+T S+ MLN YPYY+Y
Sbjct  142  NLDRQIKVSTPLSSSIILDSFPPSQAFFNRSWNPVMVPMLNFLQSTGSFLMLNIYPYYDY  201

Query  691  VKSD  702
            ++S+
Sbjct  202  MQSN  205



>gb|KDP25782.1| hypothetical protein JCGZ_22504 [Jatropha curcas]
Length=500

 Score =   209 bits (532),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 107/184 (58%), Positives = 146/184 (79%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+NIGT++S++P    +V LLKA+QI+HVRL+DAD  ML AL+N+GI+V+V V N ++L
Sbjct  26   IGVNIGTELSDMPHPTQIVALLKAQQIRHVRLYDADRGMLIALANSGIQVMVSVPNEQLL  85

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIGQS+S AA WV+ NV A+ P+TNITAI+VGSE+LT++PNAAPVLV A+ Y+H ALV++
Sbjct  86   GIGQSNSTAANWVSHNVVAHYPATNITAISVGSEILTTLPNAAPVLVNALKYIHSALVAS  145

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL+ Q+KVSTP S+ +I   FPPS A FN S N  +  +L FLQ+T SY  LN YPYY+Y
Sbjct  146  NLDRQIKVSTPLSSSIILDSFPPSQAFFNRSWNPVLVPMLNFLQSTGSYLTLNVYPYYDY  205

Query  691  VKSD  702
            ++S+
Sbjct  206  MQSN  209



>ref|XP_002305879.1| glycosyl hydrolase family 17 family protein [Populus trichocarpa]
 gb|EEE86390.1| glycosyl hydrolase family 17 family protein [Populus trichocarpa]
Length=491

 Score =   208 bits (530),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 110/198 (56%), Positives = 148/198 (75%), Gaps = 1/198 (1%)
 Frame = +1

Query  112  AYMRVIVQF-RRCVVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNT  288
            AY  + + F     +G+NIGTD+S++P    VV LLKA+QI+HVRL+DAD  ML AL+NT
Sbjct  3    AYYNICIIFLAEAFIGVNIGTDLSDMPHPTQVVALLKAQQIRHVRLYDADRGMLVALANT  62

Query  289  GIEVIVGVTNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVL  468
            GI+V+V V N ++LGIGQS+S AA WV+ NV A+ P+TNITAI VGSEV T++PNAA VL
Sbjct  63   GIQVMVSVPNEQLLGIGQSNSTAANWVSHNVVAHYPATNITAICVGSEVFTAVPNAASVL  122

Query  469  VPAMNYLHKALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNT  648
            V AM ++  ALV++NL+ Q+KVSTP S+ +I   FPPS A FN + N  +  +L FLQ+T
Sbjct  123  VNAMKFIQSALVASNLDRQIKVSTPLSSSIILDSFPPSQAFFNKTWNPVLIPMLNFLQST  182

Query  649  NSYYMLNAYPYYEYVKSD  702
             S+ MLN YPYY+Y++S+
Sbjct  183  GSHLMLNIYPYYDYMQSN  200



>ref|XP_006391369.1| hypothetical protein EUTSA_v10018427mg [Eutrema salsugineum]
 gb|ESQ28655.1| hypothetical protein EUTSA_v10018427mg [Eutrema salsugineum]
Length=506

 Score =   209 bits (531),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 109/184 (59%), Positives = 145/184 (79%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+NIGTD+S++P    VV LLKA+QI+HVRL+DAD  ML AL+NT I+VI+ + N+++L
Sbjct  35   IGVNIGTDLSDMPHPTQVVALLKAQQIRHVRLYDADPGMLIALANTKIKVIISIPNDQLL  94

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIGQS+S AA WV +NV A+ P+T ITAI+VGSEVLTS+PNAAP+LV A+  +H AL+S+
Sbjct  95   GIGQSNSTAANWVKRNVIAHYPATTITAISVGSEVLTSLPNAAPILVNAIKNVHSALLSS  154

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL+  +KVSTP ST LI   FPPS A FN S N  +  +L FLQ+TNSY M+N YPYY+Y
Sbjct  155  NLDRLIKVSTPLSTSLILDPFPPSQAFFNRSLNPVIVPLLSFLQSTNSYLMINVYPYYDY  214

Query  691  VKSD  702
            ++S+
Sbjct  215  MQSN  218



>ref|XP_006364623.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like isoform X1 
[Solanum tuberosum]
Length=499

 Score =   208 bits (530),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 101/184 (55%), Positives = 146/184 (79%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+NIGT++S++P    VV LLKA+QI+HVRLF+AD  ML AL+NTGI+V V V N ++L
Sbjct  26   IGVNIGTELSDMPHPTQVVALLKAQQIRHVRLFNADRGMLLALANTGIKVAVSVPNEQIL  85

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            G+GQS++ AA WV +NV ++ P+TNIT I VGSEVL+++PNAAP+LV A+ ++H AL+++
Sbjct  86   GVGQSNTTAANWVTQNVISHYPATNITTICVGSEVLSALPNAAPILVNALKFIHSALLAS  145

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL+ Q+KVSTP ++ +I   FPPS A FN +    +  +L+FLQ+TNSY+MLN YPYY+Y
Sbjct  146  NLDRQIKVSTPLASTIILDSFPPSQAFFNHTVKPVLIPLLKFLQSTNSYFMLNVYPYYDY  205

Query  691  VKSD  702
            ++S+
Sbjct  206  MQSN  209



>ref|NP_001275288.1| glucan endo-1,3-beta-glucosidase 2-like precursor [Solanum tuberosum]
 gb|AFU52636.1| beta-1,3-glucanase 1 [Solanum tuberosum]
Length=498

 Score =   208 bits (530),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 101/184 (55%), Positives = 146/184 (79%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+NIGT++S++P    VV LLKA+QI+HVRLF+AD  ML AL+NTGI+V V V N ++L
Sbjct  26   IGVNIGTELSDMPHPTQVVALLKAQQIRHVRLFNADRGMLLALANTGIKVAVSVPNEQIL  85

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            G+GQS++ AA WV +NV ++ P+TNIT I VGSEVL+++PNAAP+LV A+ ++H AL+++
Sbjct  86   GVGQSNTTAANWVTQNVISHYPATNITTICVGSEVLSALPNAAPILVNALKFIHSALLAS  145

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL+ Q+KVSTP ++ +I   FPPS A FN +    +  +L+FLQ+TNSY+MLN YPYY+Y
Sbjct  146  NLDRQIKVSTPLASTIILDSFPPSQAFFNHTVKPVLIPLLKFLQSTNSYFMLNVYPYYDY  205

Query  691  VKSD  702
            ++S+
Sbjct  206  MQSN  209



>ref|XP_006858991.1| hypothetical protein AMTR_s00068p00134210 [Amborella trichopoda]
 gb|ERN20458.1| hypothetical protein AMTR_s00068p00134210 [Amborella trichopoda]
Length=506

 Score =   208 bits (530),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 141/180 (78%), Gaps = 0/180 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            VG+NIG D+S+ PSA+D+  LL++  + HVRLFDAD  +L+AL+ TGI+V VG+ N E+L
Sbjct  26   VGVNIGMDLSSSPSAEDIAALLRSEGVTHVRLFDADRKLLAALAGTGIQVTVGIPNTELL  85

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
             IGQS S AAAWVN NVAA LP TNITAIAVGSEVLTS+PNAA +LVPA+  +H ALV++
Sbjct  86   RIGQSPSAAAAWVNLNVAAQLPDTNITAIAVGSEVLTSLPNAALILVPALTNIHAALVAS  145

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
             L+SQ+KVS+PQ+ D++ + FPPSTA+FN S    +  +L FL+ T + +MLNAYPYY Y
Sbjct  146  ALDSQIKVSSPQAMDIVVQFFPPSTASFNRSILPVLSLLLNFLEKTEAPFMLNAYPYYAY  205



>ref|XP_010681923.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=503

 Score =   208 bits (530),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 103/188 (55%), Positives = 147/188 (78%), Gaps = 0/188 (0%)
 Frame = +1

Query  139  RRCVVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTN  318
             +  +G+NIG D+S+ PS   VV LL+A+ I+ +RLFDAD  ML AL+NTGI+VIV V N
Sbjct  24   EKASLGVNIGLDLSDAPSPTQVVSLLRAQSIQQIRLFDADRAMLRALANTGIQVIVSVPN  83

Query  319  NEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKA  498
             ++LGIGQS++ AA WV +N+ +++P+TNITAIAVGSEVLT +PNA P+LV AM Y+H A
Sbjct  84   EQLLGIGQSNTTAANWVARNIVSHVPATNITAIAVGSEVLTVLPNAGPILVSAMQYIHSA  143

Query  499  LVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYP  678
            LV++NL+S++KVSTP ++ +I   FPPS A FN + +  +  +L+FLQ+T+S+ MLN YP
Sbjct  144  LVASNLDSKIKVSTPHASSIILDSFPPSQAFFNRTWDPVMVPLLKFLQSTSSFLMLNVYP  203

Query  679  YYEYVKSD  702
            YY+Y++S+
Sbjct  204  YYDYMQSN  211



>ref|XP_011097437.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like [Sesamum indicum]
Length=496

 Score =   208 bits (529),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 105/184 (57%), Positives = 145/184 (79%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+NIGTD+S++P    VV LLK +QI+H+RL++AD  ML AL+NTGI V + V N ++L
Sbjct  25   IGVNIGTDLSDMPHPTQVVALLKTQQIRHIRLYNADRGMLLALANTGIRVTISVPNEQLL  84

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIGQS+S AA WV++NV A+ P+TNIT I VGSEVLTS+PN APVLV A+ Y+H ALV++
Sbjct  85   GIGQSNSTAANWVSQNVVAHYPATNITTICVGSEVLTSLPNVAPVLVNALKYIHSALVAS  144

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL+ Q+KVSTP ++ +I   FPPS A FN S N  +  +L+FLQ+T+SY+MLN YPY++Y
Sbjct  145  NLDRQIKVSTPLASSIILDSFPPSQAFFNRSWNPVLVPMLKFLQSTDSYFMLNIYPYFDY  204

Query  691  VKSD  702
            ++S+
Sbjct  205  MQSN  208



>ref|XP_007215258.1| hypothetical protein PRUPE_ppa004534mg [Prunus persica]
 ref|XP_008227924.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like [Prunus mume]
 gb|EMJ16457.1| hypothetical protein PRUPE_ppa004534mg [Prunus persica]
Length=504

 Score =   208 bits (529),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 107/184 (58%), Positives = 146/184 (79%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+NIGTD+S++P    VV LLKA+QI+HVRL+DAD  ML AL+NTGI+V++ V N ++L
Sbjct  31   IGVNIGTDLSDMPHPTQVVALLKAQQIRHVRLYDADRAMLVALANTGIQVMISVPNEQIL  90

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIGQS+S AA WV++NV A+ P+TNITAIAVGS+VLT++PNAA +LV A+ Y+  ALV++
Sbjct  91   GIGQSNSTAANWVSQNVVAHYPATNITAIAVGSDVLTTLPNAAKILVNALKYIQSALVAS  150

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL+ Q+KVSTP S+ +I   FPPS A FN S N  +  +L FLQ+T S+ MLN YPYY+Y
Sbjct  151  NLDRQIKVSTPLSSSIILDSFPPSQAFFNRSLNPVLVPMLTFLQSTGSFLMLNIYPYYDY  210

Query  691  VKSD  702
            ++S+
Sbjct  211  MQSN  214



>ref|XP_008452393.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 isoform X1 [Cucumis 
melo]
Length=500

 Score =   207 bits (528),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 105/195 (54%), Positives = 151/195 (77%), Gaps = 0/195 (0%)
 Frame = +1

Query  118  MRVIVQFRRCVVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIE  297
            + V+       +G+N+GTD+S++PS   VV LLKA+ I+H+RL+DAD  ML AL+NTGI+
Sbjct  12   VSVVSSGEAAFIGVNLGTDLSDMPSPTQVVALLKAQNIEHIRLYDADRAMLLALANTGIQ  71

Query  298  VIVGVTNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPA  477
            V V V N+++L IG S++ AA WV++NV A++P+TNITAIAVGS+VLT++PNAAPVLV A
Sbjct  72   VTVSVPNDQLLAIGMSNATAANWVSRNVIAHVPATNITAIAVGSDVLTTLPNAAPVLVSA  131

Query  478  MNYLHKALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSY  657
            + ++  ALV++NL+ Q+KVSTP S+ +I   FPPS A FN S +  +  +L+FLQ+T+SY
Sbjct  132  LKFIQSALVASNLDRQIKVSTPHSSSIILDSFPPSQAFFNRSWDPVMVPLLKFLQSTDSY  191

Query  658  YMLNAYPYYEYVKSD  702
             MLN YPYY+Y++S+
Sbjct  192  LMLNVYPYYDYMQSN  206



>ref|XP_008361481.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like [Malus domestica]
Length=504

 Score =   207 bits (528),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 106/184 (58%), Positives = 145/184 (79%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+NIGTD+S++P    VV LLKA+Q +HVRL+DAD  ML AL+NTGI+V++ V N ++L
Sbjct  31   IGVNIGTDLSDMPHPTQVVALLKAQQJRHVRLYDADRAMLVALANTGIKVMISVPNEQIL  90

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIGQS++ AA WV++NV A+ P+TNITAIAVGSEVLT++PNAA +LV A+ Y+  ALV++
Sbjct  91   GIGQSNATAANWVSQNVVAHYPATNITAIAVGSEVLTTLPNAAKILVNALKYIQSALVAS  150

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL+ Q+KVSTP S+ +I   FPPS A FN S N  +  +L FLQ+T S+ MLN YPYY+Y
Sbjct  151  NLDRQIKVSTPLSSSIILDSFPPSQAFFNRSLNPVLVPMLSFLQSTGSFLMLNIYPYYDY  210

Query  691  VKSD  702
            ++S+
Sbjct  211  MQSN  214



>ref|XP_007163382.1| hypothetical protein PHAVU_001G230000g [Phaseolus vulgaris]
 gb|ESW35376.1| hypothetical protein PHAVU_001G230000g [Phaseolus vulgaris]
Length=498

 Score =   207 bits (527),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 106/184 (58%), Positives = 143/184 (78%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+NIG D+S++P    VV LLKA+QI+HVRL+DAD  ML AL+NTGI+V V V N E+L
Sbjct  23   IGVNIGRDLSDMPHPTQVVALLKAQQIRHVRLYDADQAMLIALANTGIKVAVSVPNEEIL  82

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
             IGQS++ AA WV++NV A+ P+TNIT+I VGSEVLT++PNAA VLV A+ ++H AL+++
Sbjct  83   AIGQSNTTAAKWVSRNVVAHYPATNITSICVGSEVLTALPNAAKVLVSALKFIHSALLAS  142

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL+ Q+K+STP S+ +I   FPPS A FN S N  +  +L+FLQ T SY MLN YPYY+Y
Sbjct  143  NLDHQIKISTPLSSSMIFDSFPPSQAFFNRSLNPVLVPMLEFLQTTGSYLMLNTYPYYDY  202

Query  691  VKSD  702
            +KS+
Sbjct  203  MKSN  206



>emb|CDY58676.1| BnaCnng33550D [Brassica napus]
Length=504

 Score =   207 bits (527),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 109/184 (59%), Positives = 144/184 (78%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+NIGTD+S++P    VV LLKA+QI+H+RL+DAD  ML AL+N+GI+VI+ + N+++L
Sbjct  32   IGVNIGTDLSDMPHPTQVVALLKAQQIRHIRLYDADPGMLIALANSGIKVIITIPNDQLL  91

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIGQS+S AA WV +NV A+ P+T ITAI+VGSEVLTS+ NAAPVLV A+  +H AL+SA
Sbjct  92   GIGQSNSTAANWVKRNVIAHYPATTITAISVGSEVLTSLSNAAPVLVSAIKNVHSALLSA  151

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL   +KVSTP ST LI   FPPS A FN S N  +  +L FLQ+TNSY M+N YPYY+Y
Sbjct  152  NLERLIKVSTPLSTSLILDPFPPSQAFFNRSLNPVIVPLLSFLQSTNSYLMINVYPYYDY  211

Query  691  VKSD  702
            ++S+
Sbjct  212  MQSN  215



>ref|XP_010415170.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like [Camelina 
sativa]
Length=512

 Score =   207 bits (527),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 110/184 (60%), Positives = 144/184 (78%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+NIGTD+S++P    VV LLKA+QI+H+RL+DAD  ML AL+NT I+VI+ V N+++L
Sbjct  38   IGVNIGTDLSDMPHPTQVVALLKAQQIRHIRLYDADPGMLIALANTKIKVIISVPNDQLL  97

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIGQS+S AA WV +NV A+ P+T ITAI+VGSEVLTS+ NAAPVLV A+  +H AL+SA
Sbjct  98   GIGQSNSTAANWVKRNVIAHYPATTITAISVGSEVLTSLSNAAPVLVSAIKNVHAALLSA  157

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL+  +KVSTP ST LI   FPPS A FN S N  +  +L FLQ+TNSY M+N YPYY+Y
Sbjct  158  NLDRLIKVSTPLSTSLILDPFPPSQAFFNRSLNPVIVPLLSFLQSTNSYLMMNVYPYYDY  217

Query  691  VKSD  702
            ++S+
Sbjct  218  MQSN  221



>ref|XP_010511554.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2 isoform X1 [Camelina 
sativa]
 ref|XP_010511555.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2 isoform X2 [Camelina 
sativa]
Length=512

 Score =   207 bits (527),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 110/184 (60%), Positives = 145/184 (79%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+NIGTD+S++P    VV LLKA+QI+H+RL+DAD  ML AL+NT I+VI+ V N+++L
Sbjct  38   IGVNIGTDLSDMPHPTQVVALLKAQQIRHIRLYDADPGMLIALANTKIKVIISVPNDQLL  97

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIGQS+S AA WV +NV A+ P+T ITAI+VGSEVLTS+ NAAP+LV A+  +H AL+SA
Sbjct  98   GIGQSNSTAANWVKRNVIAHYPATTITAISVGSEVLTSLSNAAPILVSAIKNVHAALLSA  157

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL+  +KVSTP ST LI   FPPS A FN S NS +  +L FLQ+TNSY M+N YPYY+Y
Sbjct  158  NLDRLIKVSTPLSTSLILDPFPPSQAFFNRSLNSVIVPLLSFLQSTNSYLMMNVYPYYDY  217

Query  691  VKSD  702
            ++S+
Sbjct  218  MQSN  221



>ref|XP_004244387.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like isoform X2 
[Solanum lycopersicum]
Length=500

 Score =   207 bits (526),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 101/184 (55%), Positives = 146/184 (79%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+NIGT++S++P    VV LLKA+QI+HVRLF+AD  ML AL+NTGI+V V V N ++L
Sbjct  26   IGVNIGTELSDMPHPTQVVALLKAQQIRHVRLFNADRGMLLALANTGIKVAVSVPNEQIL  85

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            G+GQS++ AA WV +N+ ++ P+TNIT I VGSEVL+++PNAAP+LV A+ ++H AL+++
Sbjct  86   GVGQSNTTAANWVTQNIISHYPATNITTICVGSEVLSALPNAAPILVNALKFVHSALLAS  145

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL+ Q+KVSTP ++ +I   FPPS A FN S    +  +L+FLQ+TNSY+MLN YPYY+Y
Sbjct  146  NLDRQIKVSTPLASTIILDSFPPSQAFFNHSVKPVLIPLLKFLQSTNSYFMLNVYPYYDY  205

Query  691  VKSD  702
            ++S+
Sbjct  206  MQSN  209



>ref|XP_010324460.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like isoform X1 
[Solanum lycopersicum]
Length=501

 Score =   207 bits (526),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 101/184 (55%), Positives = 146/184 (79%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+NIGT++S++P    VV LLKA+QI+HVRLF+AD  ML AL+NTGI+V V V N ++L
Sbjct  26   IGVNIGTELSDMPHPTQVVALLKAQQIRHVRLFNADRGMLLALANTGIKVAVSVPNEQIL  85

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            G+GQS++ AA WV +N+ ++ P+TNIT I VGSEVL+++PNAAP+LV A+ ++H AL+++
Sbjct  86   GVGQSNTTAANWVTQNIISHYPATNITTICVGSEVLSALPNAAPILVNALKFVHSALLAS  145

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL+ Q+KVSTP ++ +I   FPPS A FN S    +  +L+FLQ+TNSY+MLN YPYY+Y
Sbjct  146  NLDRQIKVSTPLASTIILDSFPPSQAFFNHSVKPVLIPLLKFLQSTNSYFMLNVYPYYDY  205

Query  691  VKSD  702
            ++S+
Sbjct  206  MQSN  209



>ref|XP_007032976.1| Glucan endo-1,3-beta-glucosidase, putative isoform 2, partial 
[Theobroma cacao]
 gb|EOY03902.1| Glucan endo-1,3-beta-glucosidase, putative isoform 2, partial 
[Theobroma cacao]
Length=481

 Score =   206 bits (525),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 104/184 (57%), Positives = 147/184 (80%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+NIGTD+S++P    VV LLKA+QI+HVRL++AD  ML AL+N+GI V+V + N ++L
Sbjct  24   IGVNIGTDLSDMPHPTQVVALLKAQQIRHVRLYNADKGMLVALANSGIRVMVSIPNEQLL  83

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIGQS+S AA WV++N+ A+ P+TNITAI VGSEVLT++PNAAP+LV A+ ++H ALV++
Sbjct  84   GIGQSNSTAANWVSRNIVAHYPATNITAICVGSEVLTTLPNAAPLLVNAIKFVHSALVAS  143

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL++Q+KVSTP S+ +I   FPPS A FN S N  +  +L FLQ++ S+ MLN YPYY+Y
Sbjct  144  NLDNQIKVSTPLSSSIILDSFPPSQAFFNRSWNQVLVPMLNFLQSSGSFLMLNIYPYYDY  203

Query  691  VKSD  702
            ++S+
Sbjct  204  MQSN  207



>ref|XP_009382992.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Musa acuminata 
subsp. malaccensis]
Length=580

 Score =   208 bits (530),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 105/184 (57%), Positives = 143/184 (78%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+N+GT +SN+PS   V  LLK++QI++VRL+DAD  ML+AL+NTGI V V V N ++L
Sbjct  105  IGVNVGTALSNMPSPTMVAALLKSQQIRNVRLYDADPAMLAALTNTGIRVTVSVPNEQLL  164

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
             +GQS++ AA WV +NV A++P+ NITAIAVGSEVLT++PNAAP+LVPA+ Y+H ALV+A
Sbjct  165  AVGQSNATAANWVARNVVAHVPAVNITAIAVGSEVLTALPNAAPLLVPALRYIHSALVAA  224

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL+  +KVSTP S+ LI   FPPS A FN +       +L+FLQ+T SY MLN YPYY+Y
Sbjct  225  NLDGVIKVSTPHSSSLILDSFPPSQAFFNRTLEPVFVPMLKFLQSTGSYLMLNVYPYYDY  284

Query  691  VKSD  702
            ++S+
Sbjct  285  LQSN  288



>ref|XP_010470501.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like isoform X2 
[Camelina sativa]
Length=510

 Score =   207 bits (526),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 110/184 (60%), Positives = 144/184 (78%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+NIGTD+S++P    VV LLKA+QI+H+RL+DAD  ML AL+NT I+VI+ V N+++L
Sbjct  38   IGVNIGTDLSDMPHPTQVVALLKAQQIRHIRLYDADPGMLIALANTKIKVIISVPNDQLL  97

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIGQS+S AA WV +NV A+ P+T ITAI+VGSEVLTS+ NAAPVLV A+  +H AL+SA
Sbjct  98   GIGQSNSTAANWVKRNVIAHSPATTITAISVGSEVLTSLSNAAPVLVSAIKNVHAALLSA  157

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL+  +KVSTP ST LI   FPPS A FN S N  +  +L FLQ+TNSY M+N YPYY+Y
Sbjct  158  NLDRLIKVSTPLSTSLILDPFPPSQAFFNRSLNPVIVPLLSFLQSTNSYLMMNVYPYYDY  217

Query  691  VKSD  702
            ++S+
Sbjct  218  MQSN  221



>ref|XP_010470500.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like isoform X1 
[Camelina sativa]
Length=512

 Score =   207 bits (526),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 110/184 (60%), Positives = 144/184 (78%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+NIGTD+S++P    VV LLKA+QI+H+RL+DAD  ML AL+NT I+VI+ V N+++L
Sbjct  38   IGVNIGTDLSDMPHPTQVVALLKAQQIRHIRLYDADPGMLIALANTKIKVIISVPNDQLL  97

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIGQS+S AA WV +NV A+ P+T ITAI+VGSEVLTS+ NAAPVLV A+  +H AL+SA
Sbjct  98   GIGQSNSTAANWVKRNVIAHSPATTITAISVGSEVLTSLSNAAPVLVSAIKNVHAALLSA  157

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL+  +KVSTP ST LI   FPPS A FN S N  +  +L FLQ+TNSY M+N YPYY+Y
Sbjct  158  NLDRLIKVSTPLSTSLILDPFPPSQAFFNRSLNPVIVPLLSFLQSTNSYLMMNVYPYYDY  217

Query  691  VKSD  702
            ++S+
Sbjct  218  MQSN  221



>gb|AES70967.2| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=491

 Score =   206 bits (524),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 106/195 (54%), Positives = 147/195 (75%), Gaps = 0/195 (0%)
 Frame = +1

Query  118  MRVIVQFRRCVVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIE  297
            +  +V      +G+NIGTD+S++P    VV LLKA+QI+H+RL++AD  ML+ALS +GI+
Sbjct  13   VSTVVADEEPFIGVNIGTDLSDMPHPTQVVALLKAQQIRHIRLYNADQAMLTALSKSGIQ  72

Query  298  VIVGVTNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPA  477
            V++ V N E+L IGQS+S A+ WV++NV AY P+TNITAI VGSEVLT++PN A VLV A
Sbjct  73   VVISVPNEELLAIGQSNSTASNWVSRNVLAYYPATNITAICVGSEVLTTLPNVAKVLVNA  132

Query  478  MNYLHKALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSY  657
            +NY+H ALV++NL+ Q+KVSTP  + +I   FPPS A FN S N  +  +L FLQ+T SY
Sbjct  133  LNYIHSALVASNLDRQIKVSTPLPSTMILDSFPPSQAFFNTSMNQVLKPMLDFLQSTQSY  192

Query  658  YMLNAYPYYEYVKSD  702
             MLN YPY++Y++S+
Sbjct  193  LMLNVYPYHDYMESN  207



>ref|XP_004490818.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like isoform X2 
[Cicer arietinum]
Length=448

 Score =   205 bits (521),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 108/184 (59%), Positives = 145/184 (79%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+NIGT++S++P    VV LLKA+QI+HVRL+DAD  ML AL+ +GI+V++ V N E+L
Sbjct  24   IGVNIGTELSDMPHPTQVVALLKAQQIRHVRLYDADQAMLIALAKSGIQVVITVPNEELL  83

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
             IGQS++ AA WV++NV A+ P+TNITAI VGSEVLT++PN A VLV A+ Y+H ALV++
Sbjct  84   AIGQSNASAANWVSRNVVAHYPATNITAICVGSEVLTTLPNVAKVLVNAIKYIHSALVAS  143

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL+ QVKVSTP S+ +I   FPPS A FN S NS +  IL FLQ+T+SY MLN YPYY+Y
Sbjct  144  NLDRQVKVSTPLSSSIILDSFPPSQAFFNRSLNSVLVPILDFLQSTDSYLMLNIYPYYDY  203

Query  691  VKSD  702
            ++S+
Sbjct  204  MQSN  207



>gb|EYU45799.1| hypothetical protein MIMGU_mgv1a004953mg [Erythranthe guttata]
Length=503

 Score =   206 bits (524),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 105/188 (56%), Positives = 143/188 (76%), Gaps = 0/188 (0%)
 Frame = +1

Query  139  RRCVVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTN  318
                +G+NIGTD+S++P    VV LLKA+QI+HVRL++AD  ML AL+NTGI V + + N
Sbjct  27   EEAFIGVNIGTDLSDMPHPTQVVALLKAQQIRHVRLYNADRGMLLALANTGIRVAISIPN  86

Query  319  NEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKA  498
            +++LGIGQS+S AA WV++NVAA+ P+TNIT I VGSEV TS+PN  PVLV A+ Y+  A
Sbjct  87   DQILGIGQSNSTAANWVSQNVAAHYPATNITTICVGSEVPTSLPNVGPVLVAALKYIQSA  146

Query  499  LVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYP  678
            LV++NL+ ++KVSTP  + +I   FPPS A FN + N  +  +L+FLQ+TNSY MLN YP
Sbjct  147  LVASNLDRRIKVSTPLPSLMILDSFPPSQAFFNRTWNPVLIPLLKFLQSTNSYLMLNVYP  206

Query  679  YYEYVKSD  702
            YY+Y+KS+
Sbjct  207  YYDYMKSN  214



>ref|XP_003600716.1| Glucan endo-1,3-beta-glucosidase [Medicago truncatula]
Length=504

 Score =   206 bits (524),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 106/195 (54%), Positives = 147/195 (75%), Gaps = 0/195 (0%)
 Frame = +1

Query  118  MRVIVQFRRCVVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIE  297
            +  +V      +G+NIGTD+S++P    VV LLKA+QI+H+RL++AD  ML+ALS +GI+
Sbjct  13   VSTVVADEEPFIGVNIGTDLSDMPHPTQVVALLKAQQIRHIRLYNADQAMLTALSKSGIQ  72

Query  298  VIVGVTNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPA  477
            V++ V N E+L IGQS+S A+ WV++NV AY P+TNITAI VGSEVLT++PN A VLV A
Sbjct  73   VVISVPNEELLAIGQSNSTASNWVSRNVLAYYPATNITAICVGSEVLTTLPNVAKVLVNA  132

Query  478  MNYLHKALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSY  657
            +NY+H ALV++NL+ Q+KVSTP  + +I   FPPS A FN S N  +  +L FLQ+T SY
Sbjct  133  LNYIHSALVASNLDRQIKVSTPLPSTMILDSFPPSQAFFNTSMNQVLKPMLDFLQSTQSY  192

Query  658  YMLNAYPYYEYVKSD  702
             MLN YPY++Y++S+
Sbjct  193  LMLNVYPYHDYMESN  207



>ref|XP_010108988.1| Glucan endo-1,3-beta-glucosidase 2 [Morus notabilis]
 gb|EXC20628.1| Glucan endo-1,3-beta-glucosidase 2 [Morus notabilis]
Length=497

 Score =   206 bits (524),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 106/184 (58%), Positives = 148/184 (80%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+NIGT++S++P    VV LLKA+QI+HVRL+DAD  ML AL+N+GI+VIV + N ++L
Sbjct  23   IGVNIGTELSDMPHPTQVVALLKAQQIRHVRLYDADRGMLIALANSGIQVIVSIPNEQLL  82

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIGQS+S AA WV++N+ A+ P+TNITAI VGSEVLT++PNAA VLV A+ Y++ ALV++
Sbjct  83   GIGQSNSTAANWVSQNIVAHYPATNITAICVGSEVLTTLPNAAKVLVNALKYINSALVAS  142

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL+ Q+KVSTP S+ +I   FPPS A FN S NS +  +L+FLQ++ SY MLN YPYY+Y
Sbjct  143  NLDRQIKVSTPLSSSIILDSFPPSQAFFNSSWNSVLVPMLEFLQSSGSYLMLNIYPYYDY  202

Query  691  VKSD  702
            ++++
Sbjct  203  MQAN  206



>ref|XP_007032975.1| Glucan endo-1,3-beta-glucosidase, putative isoform 1 [Theobroma 
cacao]
 gb|EOY03901.1| Glucan endo-1,3-beta-glucosidase, putative isoform 1 [Theobroma 
cacao]
Length=498

 Score =   206 bits (524),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 104/184 (57%), Positives = 147/184 (80%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+NIGTD+S++P    VV LLKA+QI+HVRL++AD  ML AL+N+GI V+V + N ++L
Sbjct  24   IGVNIGTDLSDMPHPTQVVALLKAQQIRHVRLYNADKGMLVALANSGIRVMVSIPNEQLL  83

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIGQS+S AA WV++N+ A+ P+TNITAI VGSEVLT++PNAAP+LV A+ ++H ALV++
Sbjct  84   GIGQSNSTAANWVSRNIVAHYPATNITAICVGSEVLTTLPNAAPLLVNAIKFVHSALVAS  143

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL++Q+KVSTP S+ +I   FPPS A FN S N  +  +L FLQ++ S+ MLN YPYY+Y
Sbjct  144  NLDNQIKVSTPLSSSIILDSFPPSQAFFNRSWNQVLVPMLNFLQSSGSFLMLNIYPYYDY  203

Query  691  VKSD  702
            ++S+
Sbjct  204  MQSN  207



>ref|XP_009127476.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2 isoform X1 [Brassica 
rapa]
Length=505

 Score =   206 bits (524),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 108/184 (59%), Positives = 144/184 (78%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+NIGTD+S++P    VV LLK +QI+H+RL+DAD  ML AL+N+GI+VI+ + N+++L
Sbjct  32   IGVNIGTDLSDMPHPTQVVALLKVQQIRHIRLYDADPGMLIALANSGIKVIITIPNDQLL  91

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIGQS+S AA WV +NV A+ P+T ITAI+VGSEVLTS+ NAAPVLV A+  +H AL+SA
Sbjct  92   GIGQSNSTAANWVKRNVIAHYPATTITAISVGSEVLTSLSNAAPVLVSAIKNVHSALLSA  151

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL+  +KVSTP ST LI   FPPS A FN S N  +  +L FLQ+TNSY M+N YPYY+Y
Sbjct  152  NLDRLIKVSTPLSTSLILDPFPPSQAFFNRSLNPVIVPLLSFLQSTNSYLMINVYPYYDY  211

Query  691  VKSD  702
            ++S+
Sbjct  212  MQSN  215



>emb|CDY16440.1| BnaA02g12440D [Brassica napus]
Length=504

 Score =   206 bits (524),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 108/184 (59%), Positives = 144/184 (78%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+NIGTD+S++P    VV LLK +QI+H+RL+DAD  ML AL+N+GI+VI+ + N+++L
Sbjct  31   IGVNIGTDLSDMPHPTQVVALLKVQQIRHIRLYDADPGMLIALANSGIKVIITIPNDQLL  90

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIGQS+S AA WV +NV A+ P+T ITAI+VGSEVLTS+ NAAPVLV A+  +H AL+SA
Sbjct  91   GIGQSNSTAANWVKRNVIAHYPATTITAISVGSEVLTSLSNAAPVLVSAIKNVHSALLSA  150

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL+  +KVSTP ST LI   FPPS A FN S N  +  +L FLQ+TNSY M+N YPYY+Y
Sbjct  151  NLDRLIKVSTPLSTSLILDPFPPSQAFFNRSLNPVIVPLLSFLQSTNSYLMINVYPYYDY  210

Query  691  VKSD  702
            ++S+
Sbjct  211  MQSN  214



>ref|XP_006430586.1| hypothetical protein CICLE_v10011549mg [Citrus clementina]
 gb|ESR43826.1| hypothetical protein CICLE_v10011549mg [Citrus clementina]
Length=497

 Score =   206 bits (524),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 108/184 (59%), Positives = 143/184 (78%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G NIGT++S++P    VV LLKA+QI+HVRL+DAD  ML AL+NTGI+V V V N ++L
Sbjct  23   IGANIGTELSDMPHPTQVVALLKAQQIRHVRLYDADRGMLVALANTGIKVAVSVPNEQLL  82

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIGQS+S AA WV++N+ A+ P+TNIT I VGSEVLT++PNAAPVLV A+ ++H ALV++
Sbjct  83   GIGQSNSTAANWVSRNIVAHYPATNITTICVGSEVLTTLPNAAPVLVNALKFIHSALVAS  142

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL+ Q+KVSTP S+ LI   FPPS A FN S N  +  +L FLQ+T S  MLN YPYY+Y
Sbjct  143  NLDHQIKVSTPLSSSLILDSFPPSQAFFNRSWNPVLVPMLNFLQSTGSSLMLNIYPYYDY  202

Query  691  VKSD  702
            ++S+
Sbjct  203  MQSN  206



>ref|XP_006482110.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like [Citrus sinensis]
 gb|KDO50803.1| hypothetical protein CISIN_1g010931mg [Citrus sinensis]
Length=497

 Score =   206 bits (524),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 108/184 (59%), Positives = 143/184 (78%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G NIGT++S++P    VV LLKA+QI+HVRL+DAD  ML AL+NTGI+V V V N ++L
Sbjct  23   IGANIGTELSDMPHPTQVVALLKAQQIRHVRLYDADRGMLVALANTGIKVAVSVPNEQLL  82

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIGQS+S AA WV++N+ A+ P+TNIT I VGSEVLT++PNAAPVLV A+ ++H ALV++
Sbjct  83   GIGQSNSTAANWVSRNIVAHYPATNITTICVGSEVLTTLPNAAPVLVNALKFIHSALVAS  142

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL+ Q+KVSTP S+ LI   FPPS A FN S N  +  +L FLQ+T S  MLN YPYY+Y
Sbjct  143  NLDHQIKVSTPLSSSLILDSFPPSQAFFNRSWNPVLVPMLNFLQSTGSSLMLNIYPYYDY  202

Query  691  VKSD  702
            ++S+
Sbjct  203  MQSN  206



>ref|XP_004490817.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like isoform X1 
[Cicer arietinum]
Length=498

 Score =   206 bits (523),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 108/184 (59%), Positives = 145/184 (79%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+NIGT++S++P    VV LLKA+QI+HVRL+DAD  ML AL+ +GI+V++ V N E+L
Sbjct  24   IGVNIGTELSDMPHPTQVVALLKAQQIRHVRLYDADQAMLIALAKSGIQVVITVPNEELL  83

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
             IGQS++ AA WV++NV A+ P+TNITAI VGSEVLT++PN A VLV A+ Y+H ALV++
Sbjct  84   AIGQSNASAANWVSRNVVAHYPATNITAICVGSEVLTTLPNVAKVLVNAIKYIHSALVAS  143

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL+ QVKVSTP S+ +I   FPPS A FN S NS +  IL FLQ+T+SY MLN YPYY+Y
Sbjct  144  NLDRQVKVSTPLSSSIILDSFPPSQAFFNRSLNSVLVPILDFLQSTDSYLMLNIYPYYDY  203

Query  691  VKSD  702
            ++S+
Sbjct  204  MQSN  207



>ref|XP_009129217.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 [Brassica rapa]
 emb|CDY09427.1| BnaA02g25830D [Brassica napus]
Length=497

 Score =   205 bits (521),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 104/188 (55%), Positives = 146/188 (78%), Gaps = 0/188 (0%)
 Frame = +1

Query  139  RRCVVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTN  318
            +  ++G+NIGT+V+++PS   VV LLK++ I  VRL+DAD  ML A ++TGI++I+ V N
Sbjct  19   QDSLIGVNIGTEVTDMPSPTQVVTLLKSQNINRVRLYDADRSMLLAFAHTGIQLIISVPN  78

Query  319  NEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKA  498
            +++LGI QS++ AA WV +NVAAY P+TNITAIAVGSEVLTS+PNAAPVLV A+ Y+  A
Sbjct  79   DQLLGISQSNATAANWVTRNVAAYYPATNITAIAVGSEVLTSLPNAAPVLVSALKYIQAA  138

Query  499  LVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYP  678
            LV+ANL+ Q+KVSTP ++ +I   FPPS A FN + +  +  +L+FLQ+T S  MLN YP
Sbjct  139  LVTANLDRQIKVSTPHASTIILDSFPPSQAFFNKTWDPVIVPLLEFLQSTGSPLMLNVYP  198

Query  679  YYEYVKSD  702
            Y++YV+S+
Sbjct  199  YFDYVQSN  206



>ref|XP_006395868.1| hypothetical protein EUTSA_v10004013mg [Eutrema salsugineum]
 gb|ESQ33154.1| hypothetical protein EUTSA_v10004013mg [Eutrema salsugineum]
Length=422

 Score =   202 bits (514),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 103/185 (56%), Positives = 143/185 (77%), Gaps = 0/185 (0%)
 Frame = +1

Query  148  VVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEV  327
            ++G+NIGT+V+N+PS   VV LLK++ I  VRL+DAD  ML A ++TGI+VI+ V N+++
Sbjct  5    LIGVNIGTEVTNMPSPTQVVTLLKSQNINRVRLYDADRSMLLAFAHTGIQVIISVPNDQL  64

Query  328  LGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVS  507
            LGI QS++ AA WV +NVAAY P+TNIT IAVGSEVLT++PNAA VLV A+ Y+  AL++
Sbjct  65   LGISQSNATAANWVTRNVAAYYPATNITTIAVGSEVLTTLPNAASVLVSALKYIQSALIT  124

Query  508  ANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYE  687
            ANL+ Q+KVSTP S+ +I   FPPS A FN + +  +  +L+FLQ+T S  MLN YPY++
Sbjct  125  ANLDRQIKVSTPHSSTIILDSFPPSQAFFNKTWDPVIVPLLKFLQSTGSPLMLNVYPYFD  184

Query  688  YVKSD  702
            YV+S+
Sbjct  185  YVQSN  189



>ref|XP_010670126.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like [Beta vulgaris 
subsp. vulgaris]
Length=502

 Score =   204 bits (519),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 106/192 (55%), Positives = 142/192 (74%), Gaps = 0/192 (0%)
 Frame = +1

Query  127  IVQFRRCVVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIV  306
            IV      +G+NIGTD+S++P    VV LLK++ I+HVRL+DAD  ML AL+NTGI+V +
Sbjct  17   IVSAEDAFLGVNIGTDLSDMPHPTQVVALLKSQHIRHVRLYDADKGMLVALANTGIQVAI  76

Query  307  GVTNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNY  486
             V N ++LGIGQS+S AA WV++ V A+ P+TNIT I VGSEVL++IPNAAP+LV A+ +
Sbjct  77   TVPNEQLLGIGQSNSTAAKWVSQYVVAHYPATNITTICVGSEVLSTIPNAAPILVNALRF  136

Query  487  LHKALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYML  666
            +  ALV++NL  Q+KVSTP ST +I   FPPS A FN S    +  + +FLQ+TNSY ML
Sbjct  137  IQSALVASNLERQIKVSTPLSTSVILDSFPPSQAFFNHSLLPVLVPMFKFLQSTNSYLML  196

Query  667  NAYPYYEYVKSD  702
            N YPYY+Y+ S+
Sbjct  197  NIYPYYDYMNSN  208



>gb|KJB10513.1| hypothetical protein B456_001G204900 [Gossypium raimondii]
Length=550

 Score =   205 bits (521),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 104/184 (57%), Positives = 145/184 (79%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+NIGTD+S +P    VV LLKA+QI+H+RL+DAD  ML AL+N+GI V+V + N ++L
Sbjct  125  IGVNIGTDLSIMPHPTQVVALLKAQQIRHIRLYDADRGMLVALANSGIRVMVSIPNEQLL  184

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIGQS+S AA WV++N+ A+ P+TNITAI VGSEVLT++PNAA +LV AM ++H ALV++
Sbjct  185  GIGQSNSTAANWVSRNIVAHYPATNITAICVGSEVLTTLPNAARILVNAMKFIHSALVAS  244

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL++Q+KVS+P ++ +I   FPPS A FN S N  +  +L FLQ+T SY MLN YPYY+Y
Sbjct  245  NLDNQIKVSSPLASSIILDSFPPSQAFFNRSWNPVLVPMLNFLQSTGSYLMLNIYPYYDY  304

Query  691  VKSD  702
            ++S+
Sbjct  305  MQSN  308



>gb|KCW69377.1| hypothetical protein EUGRSUZ_F02860 [Eucalyptus grandis]
Length=451

 Score =   203 bits (516),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 102/184 (55%), Positives = 145/184 (79%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+NIGTD+S++P    VV LLKA+ I+H+RL++ D  +L+AL+NTGI+VIV V N ++L
Sbjct  27   IGVNIGTDLSDMPHPTQVVALLKAQNIRHIRLYNTDRGILAALANTGIQVIVSVPNEQLL  86

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIGQS+S AA WV++N+  + P+TNIT I+VGSEVLT++PNAAP+LV A+ ++H ALV++
Sbjct  87   GIGQSNSTAANWVSQNIIVHYPATNITGISVGSEVLTALPNAAPILVNALKFIHSALVAS  146

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL+ Q+KVSTP S+ +I   FPPS A FN S N  +  +L FLQ++ SY MLN YPYY+Y
Sbjct  147  NLDRQIKVSTPLSSSVILDSFPPSQAFFNKSLNPVLVPMLNFLQSSGSYLMLNVYPYYDY  206

Query  691  VKSD  702
            ++S+
Sbjct  207  MQSN  210



>emb|CDY48807.1| BnaC02g34070D [Brassica napus]
Length=497

 Score =   204 bits (518),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 105/188 (56%), Positives = 145/188 (77%), Gaps = 0/188 (0%)
 Frame = +1

Query  139  RRCVVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTN  318
            +  +VG+NIGT+V+++PS   VV LLK++ I  VRL+DAD  ML A ++TGI++I+ V N
Sbjct  19   QDSLVGVNIGTEVTDMPSPTQVVTLLKSQNINRVRLYDADRSMLLAFAHTGIQLIISVPN  78

Query  319  NEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKA  498
            +++LGI QS++ AA WV +NVAAY P+TNITAIAVGSEVLTS+PNAAPVLV A+ Y+  A
Sbjct  79   DQLLGISQSNATAANWVTRNVAAYYPATNITAIAVGSEVLTSLPNAAPVLVSALKYIQAA  138

Query  499  LVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYP  678
            LV+ANL+ Q+KVSTP ++ +I   FPPS A FN + +  +  +L+FLQ+T S  MLN YP
Sbjct  139  LVTANLDRQIKVSTPHASTIILDSFPPSQAFFNKTWDPVIVPLLEFLQSTGSPLMLNVYP  198

Query  679  YYEYVKSD  702
            Y++YV S+
Sbjct  199  YFDYVLSN  206



>ref|XP_011021801.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like isoform X3 
[Populus euphratica]
Length=465

 Score =   203 bits (516),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 103/173 (60%), Positives = 138/173 (80%), Gaps = 0/173 (0%)
 Frame = +1

Query  184  LPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVLGIGQSSSQAAA  363
            +PS   VV LLKA+ I+HVRL+DAD  ML AL+NTGI V V V N ++LGIGQS++ AA 
Sbjct  1    MPSPTQVVALLKAQNIRHVRLYDADRAMLRALANTGIRVTVSVPNEQLLGIGQSNATAAN  60

Query  364  WVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSANLNSQVKVSTP  543
            WV +NV A++P+TNITAIAVGSE+LT++PNAAPVLV A+ ++H ALV++NL+ Q+KVSTP
Sbjct  61   WVARNVIAHVPATNITAIAVGSEILTTLPNAAPVLVSALKFIHSALVASNLDGQIKVSTP  120

Query  544  QSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEYVKSD  702
            QS+ +I   FPPS A FN S +  +  +L+FLQ+T SY+MLN YPYY+Y++S+
Sbjct  121  QSSSIILDSFPPSQAFFNRSWDPVMVPLLKFLQSTGSYFMLNVYPYYDYMQSN  173



>gb|KHG17836.1| hypothetical protein F383_07126 [Gossypium arboreum]
Length=519

 Score =   204 bits (519),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 104/184 (57%), Positives = 145/184 (79%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+NIGTD+S +P    VV LLKA+QI+H+RL+DAD  ML AL+N+GI V+V + N ++L
Sbjct  12   IGVNIGTDLSIMPHPTQVVALLKAQQIRHIRLYDADRGMLVALANSGIRVMVSIPNEQLL  71

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIGQS+S AA WV++N+ A+ P+TNITAI VGSEVLT++PNAA +LV AM ++H ALV++
Sbjct  72   GIGQSNSTAANWVSRNIVAHYPATNITAICVGSEVLTTLPNAARILVNAMKFVHSALVAS  131

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL++Q+KVS+P ++ +I   FPPS A FN S N  +  +L FLQ+T SY MLN YPYY+Y
Sbjct  132  NLDNQIKVSSPLASSIILDSFPPSQAFFNRSWNPVLVPMLNFLQSTGSYLMLNIYPYYDY  191

Query  691  VKSD  702
            ++S+
Sbjct  192  MQSN  195



>ref|XP_008802448.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Phoenix dactylifera]
Length=500

 Score =   204 bits (518),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 102/184 (55%), Positives = 145/184 (79%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+NIGT +S++PS   VV LLK+++I+HVR++DAD  ML+AL+N+GI V V V N ++L
Sbjct  25   IGVNIGTALSDMPSPTQVVALLKSQKIQHVRMYDADPAMLAALANSGIRVTVSVPNEQLL  84

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
             +GQS++ AA WV++NV A++P+ NITA+AVGSEVLT++PNAA +LV A+ Y+H ALV+A
Sbjct  85   AVGQSNATAANWVSRNVVAHVPAVNITAVAVGSEVLTALPNAATLLVSALRYVHSALVAA  144

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL+ Q+KVSTP S+ +I   FPPS A FN S    +  +L+FLQ+T+SY MLN YPYY+Y
Sbjct  145  NLDRQIKVSTPHSSSIILDSFPPSQAFFNRSLEPIMVPMLKFLQSTDSYLMLNVYPYYDY  204

Query  691  VKSD  702
            + S+
Sbjct  205  MHSN  208



>gb|KJB10512.1| hypothetical protein B456_001G204900 [Gossypium raimondii]
Length=599

 Score =   205 bits (522),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 104/184 (57%), Positives = 145/184 (79%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+NIGTD+S +P    VV LLKA+QI+H+RL+DAD  ML AL+N+GI V+V + N ++L
Sbjct  125  IGVNIGTDLSIMPHPTQVVALLKAQQIRHIRLYDADRGMLVALANSGIRVMVSIPNEQLL  184

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIGQS+S AA WV++N+ A+ P+TNITAI VGSEVLT++PNAA +LV AM ++H ALV++
Sbjct  185  GIGQSNSTAANWVSRNIVAHYPATNITAICVGSEVLTTLPNAARILVNAMKFIHSALVAS  244

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL++Q+KVS+P ++ +I   FPPS A FN S N  +  +L FLQ+T SY MLN YPYY+Y
Sbjct  245  NLDNQIKVSSPLASSIILDSFPPSQAFFNRSWNPVLVPMLNFLQSTGSYLMLNIYPYYDY  304

Query  691  VKSD  702
            ++S+
Sbjct  305  MQSN  308



>ref|XP_010062264.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2 [Eucalyptus grandis]
 gb|KCW69376.1| hypothetical protein EUGRSUZ_F02860 [Eucalyptus grandis]
Length=499

 Score =   203 bits (516),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 102/184 (55%), Positives = 145/184 (79%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+NIGTD+S++P    VV LLKA+ I+H+RL++ D  +L+AL+NTGI+VIV V N ++L
Sbjct  27   IGVNIGTDLSDMPHPTQVVALLKAQNIRHIRLYNTDRGILAALANTGIQVIVSVPNEQLL  86

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIGQS+S AA WV++N+  + P+TNIT I+VGSEVLT++PNAAP+LV A+ ++H ALV++
Sbjct  87   GIGQSNSTAANWVSQNIIVHYPATNITGISVGSEVLTALPNAAPILVNALKFIHSALVAS  146

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL+ Q+KVSTP S+ +I   FPPS A FN S N  +  +L FLQ++ SY MLN YPYY+Y
Sbjct  147  NLDRQIKVSTPLSSSVILDSFPPSQAFFNKSLNPVLVPMLNFLQSSGSYLMLNVYPYYDY  206

Query  691  VKSD  702
            ++S+
Sbjct  207  MQSN  210



>ref|XP_011007238.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like isoform X1 
[Populus euphratica]
 ref|XP_011007239.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like isoform X2 
[Populus euphratica]
Length=505

 Score =   203 bits (516),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 105/184 (57%), Positives = 142/184 (77%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+NIGTD+S++P    VV LLKA+QI HVRL+DAD  ML AL+NTGI+V+V V N ++L
Sbjct  31   IGVNIGTDLSDMPHPTQVVALLKAQQIWHVRLYDADRGMLVALANTGIQVMVSVPNEQLL  90

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIGQS+S AA WV+ N+ A+ P+TNITAI VGSEV T++PNAA VLV AM ++  ALV++
Sbjct  91   GIGQSNSTAANWVSHNIVAHYPATNITAICVGSEVFTAVPNAASVLVNAMKFIQSALVAS  150

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL+ Q+KVSTP S+ +I   FPPS A FN + N  +  ++ FLQ+T S+ MLN YPYY+Y
Sbjct  151  NLDRQIKVSTPLSSSIILDSFPPSQAFFNKTWNPVLIPMVNFLQSTGSHLMLNIYPYYDY  210

Query  691  VKSD  702
            ++S+
Sbjct  211  MQSN  214



>gb|EPS65983.1| hypothetical protein M569_08793, partial [Genlisea aurea]
Length=459

 Score =   202 bits (513),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 103/184 (56%), Positives = 144/184 (78%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+NIGT++S +P    VV LLKA+ ++HVR++ AD  ML AL+ TGI V+V V N+E+L
Sbjct  3    LGVNIGTELSEMPDPTQVVALLKAQHLQHVRIYGADRGMLMALAKTGIRVVVSVPNDELL  62

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIGQS+S AA WV+KNV AY P+TNITAIAVGSEVLT++PNAAP+LV A++++  AL +A
Sbjct  63   GIGQSNSTAANWVSKNVLAYYPATNITAIAVGSEVLTALPNAAPILVSAVSFISSALRAA  122

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL+S++KVSTP S+ +I   FPPS A FN S +  +  +L+ LQ+T S+ MLN YPYY+Y
Sbjct  123  NLDSRIKVSTPHSSSVILDSFPPSQAFFNRSLDPVMVPLLELLQSTGSFLMLNVYPYYDY  182

Query  691  VKSD  702
            ++++
Sbjct  183  MQAN  186



>ref|XP_006395869.1| hypothetical protein EUTSA_v10004013mg [Eutrema salsugineum]
 gb|ESQ33155.1| hypothetical protein EUTSA_v10004013mg [Eutrema salsugineum]
Length=483

 Score =   202 bits (514),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 103/185 (56%), Positives = 143/185 (77%), Gaps = 0/185 (0%)
 Frame = +1

Query  148  VVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEV  327
            ++G+NIGT+V+N+PS   VV LLK++ I  VRL+DAD  ML A ++TGI+VI+ V N+++
Sbjct  5    LIGVNIGTEVTNMPSPTQVVTLLKSQNINRVRLYDADRSMLLAFAHTGIQVIISVPNDQL  64

Query  328  LGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVS  507
            LGI QS++ AA WV +NVAAY P+TNIT IAVGSEVLT++PNAA VLV A+ Y+  AL++
Sbjct  65   LGISQSNATAANWVTRNVAAYYPATNITTIAVGSEVLTTLPNAASVLVSALKYIQSALIT  124

Query  508  ANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYE  687
            ANL+ Q+KVSTP S+ +I   FPPS A FN + +  +  +L+FLQ+T S  MLN YPY++
Sbjct  125  ANLDRQIKVSTPHSSTIILDSFPPSQAFFNKTWDPVIVPLLKFLQSTGSPLMLNVYPYFD  184

Query  688  YVKSD  702
            YV+S+
Sbjct  185  YVQSN  189



>ref|XP_011023920.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 isoform X2 [Populus 
euphratica]
Length=488

 Score =   202 bits (514),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 108/184 (59%), Positives = 149/184 (81%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+NIGT +S++PS   VV LLKA+ I+HVRL+DAD  +L AL+NTGI V V V N+++L
Sbjct  23   IGVNIGTALSDMPSPTQVVALLKAQNIRHVRLYDADRALLLALANTGIRVTVSVPNDQIL  82

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIGQS++ AA WV +NV A++P+TNITAIA+GSE+LT+IPNAAPVLV A+ ++H ALV++
Sbjct  83   GIGQSNATAANWVARNVIAHVPATNITAIAIGSEILTTIPNAAPVLVSALKFIHSALVAS  142

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL+ Q+KVSTP S+ +I   FPPS A FN S +  +  +L+FLQ+T SY+MLNAYPYY+Y
Sbjct  143  NLDGQIKVSTPHSSSIILDSFPPSQAFFNRSWDPVMVPLLKFLQSTGSYFMLNAYPYYDY  202

Query  691  VKSD  702
            ++S+
Sbjct  203  MQSN  206



>ref|XP_011023912.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 isoform X1 [Populus 
euphratica]
Length=498

 Score =   202 bits (514),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 108/184 (59%), Positives = 149/184 (81%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+NIGT +S++PS   VV LLKA+ I+HVRL+DAD  +L AL+NTGI V V V N+++L
Sbjct  23   IGVNIGTALSDMPSPTQVVALLKAQNIRHVRLYDADRALLLALANTGIRVTVSVPNDQIL  82

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIGQS++ AA WV +NV A++P+TNITAIA+GSE+LT+IPNAAPVLV A+ ++H ALV++
Sbjct  83   GIGQSNATAANWVARNVIAHVPATNITAIAIGSEILTTIPNAAPVLVSALKFIHSALVAS  142

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL+ Q+KVSTP S+ +I   FPPS A FN S +  +  +L+FLQ+T SY+MLNAYPYY+Y
Sbjct  143  NLDGQIKVSTPHSSSIILDSFPPSQAFFNRSWDPVMVPLLKFLQSTGSYFMLNAYPYYDY  202

Query  691  VKSD  702
            ++S+
Sbjct  203  MQSN  206



>ref|XP_006395867.1| hypothetical protein EUTSA_v10004013mg [Eutrema salsugineum]
 gb|ESQ33153.1| hypothetical protein EUTSA_v10004013mg [Eutrema salsugineum]
Length=516

 Score =   202 bits (514),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 103/188 (55%), Positives = 144/188 (77%), Gaps = 0/188 (0%)
 Frame = +1

Query  139  RRCVVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTN  318
            +  ++G+NIGT+V+N+PS   VV LLK++ I  VRL+DAD  ML A ++TGI+VI+ V N
Sbjct  35   QDSLIGVNIGTEVTNMPSPTQVVTLLKSQNINRVRLYDADRSMLLAFAHTGIQVIISVPN  94

Query  319  NEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKA  498
            +++LGI QS++ AA WV +NVAAY P+TNIT IAVGSEVLT++PNAA VLV A+ Y+  A
Sbjct  95   DQLLGISQSNATAANWVTRNVAAYYPATNITTIAVGSEVLTTLPNAASVLVSALKYIQSA  154

Query  499  LVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYP  678
            L++ANL+ Q+KVSTP S+ +I   FPPS A FN + +  +  +L+FLQ+T S  MLN YP
Sbjct  155  LITANLDRQIKVSTPHSSTIILDSFPPSQAFFNKTWDPVIVPLLKFLQSTGSPLMLNVYP  214

Query  679  YYEYVKSD  702
            Y++YV+S+
Sbjct  215  YFDYVQSN  222



>emb|CAN82488.1| hypothetical protein VITISV_006804 [Vitis vinifera]
Length=466

 Score =   201 bits (510),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 103/173 (60%), Positives = 139/173 (80%), Gaps = 0/173 (0%)
 Frame = +1

Query  184  LPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVLGIGQSSSQAAA  363
            +P+   VV LLK++QI+HVRL+DAD  ML AL+NTGI V V V N+++LGIGQS++ AA 
Sbjct  1    MPNPTQVVALLKSQQIRHVRLYDADRAMLLALANTGIRVTVSVPNDQLLGIGQSNATAAN  60

Query  364  WVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSANLNSQVKVSTP  543
            WV +NV A++P+TNITAIAVGSEVLT++PNAAPVLV A+ ++H ALV+ANL+SQ+KVSTP
Sbjct  61   WVARNVLAHIPATNITAIAVGSEVLTTLPNAAPVLVSALKFIHSALVAANLDSQIKVSTP  120

Query  544  QSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEYVKSD  702
             S+ ++   FPPS A FN S    +  +L+FLQ+T+SY MLN YPYY+Y++S+
Sbjct  121  HSSSILLDSFPPSQAFFNRSWEPVMVPLLKFLQSTSSYLMLNVYPYYDYMQSN  173



>gb|KHN32747.1| Glucan endo-1,3-beta-glucosidase 3 [Glycine soja]
Length=463

 Score =   200 bits (509),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 104/173 (60%), Positives = 137/173 (79%), Gaps = 0/173 (0%)
 Frame = +1

Query  184  LPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVLGIGQSSSQAAA  363
            +PS  +VV LLKA+ I+HVRL+DAD  ML AL+NTGI VIV V N+++LGIGQS++ AA 
Sbjct  1    MPSPTEVVALLKAQGIQHVRLYDADRAMLRALANTGIRVIVSVPNDQILGIGQSNATAAN  60

Query  364  WVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSANLNSQVKVSTP  543
            WV +NV A++P+TNITAIAVGSEVLTS+PNAAPVLV A+ ++  ALV+ANL+ Q+KVSTP
Sbjct  61   WVARNVIAHVPATNITAIAVGSEVLTSLPNAAPVLVSALKFIQAALVAANLDQQIKVSTP  120

Query  544  QSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEYVKSD  702
             S+ +I   FPPS A FN + +  +  +L FLQ+T SY MLN YPYY+Y++S+
Sbjct  121  HSSSVILDSFPPSQAFFNKTWDPVMVPLLNFLQSTGSYLMLNVYPYYDYMQSN  173



>ref|XP_006293165.1| hypothetical protein CARUB_v10019481mg [Capsella rubella]
 gb|EOA26063.1| hypothetical protein CARUB_v10019481mg [Capsella rubella]
Length=500

 Score =   201 bits (511),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 103/188 (55%), Positives = 144/188 (77%), Gaps = 0/188 (0%)
 Frame = +1

Query  139  RRCVVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTN  318
            +  ++G+NIGT+V+N+PS   VV LLK++ I  VRL+DAD  ML A ++TG++VI+ V N
Sbjct  19   QDSLIGVNIGTEVTNMPSPTQVVALLKSQNINRVRLYDADRSMLLAFAHTGVQVIISVPN  78

Query  319  NEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKA  498
            +++LGI QS++ AA WV +NVAAY P+TNIT IAVGSEVLTS+PNAA VLV A+ Y+  A
Sbjct  79   DQLLGISQSNATAANWVTRNVAAYYPATNITTIAVGSEVLTSLPNAASVLVSALKYIQAA  138

Query  499  LVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYP  678
            LV+ANL+ Q+KVSTP S+ +I   FPPS A FN + +  +  +L+FLQ+T S  +LN YP
Sbjct  139  LVTANLDRQIKVSTPHSSTIILDSFPPSQAFFNKTWDPVIVPLLKFLQSTGSPLLLNVYP  198

Query  679  YYEYVKSD  702
            Y++YV+S+
Sbjct  199  YFDYVQSN  206



>ref|XP_009390355.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Musa acuminata 
subsp. malaccensis]
Length=501

 Score =   201 bits (510),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/184 (54%), Positives = 141/184 (77%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+N+GT +S++PS   V  LLK ++I HVRL+DAD  ML+AL+NTGI V V V N ++L
Sbjct  24   IGVNVGTALSDMPSPTQVAALLKTQKIDHVRLYDADPAMLAALANTGIRVTVSVPNEQLL  83

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
             +GQS++ AA WV +NV A++P+ NITAIAVGSEVLT++PNAA +LVPA+ Y+H ALV+A
Sbjct  84   AVGQSNATAANWVARNVVAHVPAVNITAIAVGSEVLTALPNAATLLVPALRYIHSALVAA  143

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL+  +KVSTP ++ +I   FPPS A FN +    +  +L+FLQ++ SY MLN YPYY+Y
Sbjct  144  NLDGLIKVSTPHASSVILDSFPPSQAFFNRTFEPVIVPMLKFLQSSGSYLMLNVYPYYDY  203

Query  691  VKSD  702
            ++S+
Sbjct  204  LQSN  207



>ref|XP_002876767.1| hypothetical protein ARALYDRAFT_484077 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53026.1| hypothetical protein ARALYDRAFT_484077 [Arabidopsis lyrata subsp. 
lyrata]
Length=500

 Score =   201 bits (510),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 102/188 (54%), Positives = 144/188 (77%), Gaps = 0/188 (0%)
 Frame = +1

Query  139  RRCVVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTN  318
            +  ++G+NIGT+V+N+PS   VV LLK++ I  VRL+DAD  ML A ++TG++VI+ V N
Sbjct  19   QDSLIGVNIGTEVTNMPSPTQVVALLKSQNINRVRLYDADRSMLLAFAHTGVQVIISVPN  78

Query  319  NEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKA  498
            +++LGI QS++ AA WV +NVAAY P+TNIT IAVGSEVLTS+PNAA VLV A+ Y+  A
Sbjct  79   DQLLGISQSNATAANWVTRNVAAYYPATNITTIAVGSEVLTSLPNAASVLVSALKYIQAA  138

Query  499  LVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYP  678
            L++ANL+ Q+KVSTP S+ +I   FPPS A FN + +  +  +L+FLQ+T S  +LN YP
Sbjct  139  LITANLDRQIKVSTPHSSTIILDSFPPSQAFFNKTWDPVIVPLLKFLQSTGSPLLLNVYP  198

Query  679  YYEYVKSD  702
            Y++YV+S+
Sbjct  199  YFDYVQSN  206



>ref|NP_001077866.1| glucan endo-1,3-beta-glucosidase 3 [Arabidopsis thaliana]
 gb|AEC05476.1| glucan endo-1,3-beta-glucosidase 3 [Arabidopsis thaliana]
Length=391

 Score =   198 bits (503),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 102/188 (54%), Positives = 143/188 (76%), Gaps = 0/188 (0%)
 Frame = +1

Query  139  RRCVVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTN  318
            +  ++G+NIGT+V+N+PS   VV LLK++ I  VRL+DAD  ML A ++TG++VI+ V N
Sbjct  19   QDSLIGVNIGTEVTNMPSPTQVVALLKSQNINRVRLYDADRSMLLAFAHTGVQVIISVPN  78

Query  319  NEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKA  498
            +++LGI QS++ AA WV +NVAAY P+TNIT IAVGSEVLTS+ NAA VLV A+ Y+  A
Sbjct  79   DQLLGISQSNATAANWVTRNVAAYYPATNITTIAVGSEVLTSLTNAASVLVSALKYIQAA  138

Query  499  LVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYP  678
            LV+ANL+ Q+KVSTP S+ +I   FPPS A FN + +  +  +L+FLQ+T S  +LN YP
Sbjct  139  LVTANLDRQIKVSTPHSSTIILDSFPPSQAFFNKTWDPVIVPLLKFLQSTGSPLLLNVYP  198

Query  679  YYEYVKSD  702
            Y++YV+S+
Sbjct  199  YFDYVQSN  206



>gb|KHN17951.1| Glucan endo-1,3-beta-glucosidase 2 [Glycine soja]
Length=498

 Score =   200 bits (509),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 110/201 (55%), Positives = 145/201 (72%), Gaps = 8/201 (4%)
 Frame = +1

Query  124  VIVQFRRCVV--------GINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSAL  279
            +++ F  CVV        G+NIG D+S++P    VV LLKA+QI+HVRL+DAD  ML AL
Sbjct  6    LLLLFAVCVVAIDEEPFIGVNIGRDLSDMPHPTQVVALLKAQQIRHVRLYDADQAMLIAL  65

Query  280  SNTGIEVIVGVTNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAA  459
            +NT I+V V V N E+L IGQS++ AA WV+ NV A+ P+TNIT I VGSEVLT++P AA
Sbjct  66   ANTRIQVAVSVPNQEILAIGQSNTTAAKWVSHNVIAHYPATNITTICVGSEVLTTLPYAA  125

Query  460  PVLVPAMNYLHKALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFL  639
             VLV A+ +LH ALV++NL+ Q+KVSTP S+ +I   FPPS A FN S N  +  +L FL
Sbjct  126  KVLVSALKFLHSALVASNLDHQIKVSTPLSSSMILDSFPPSQAFFNRSLNPVLVPMLDFL  185

Query  640  QNTNSYYMLNAYPYYEYVKSD  702
            Q T+SY MLN YPYY+Y++S+
Sbjct  186  QTTDSYLMLNIYPYYDYMQSN  206



>ref|XP_006300850.1| hypothetical protein CARUB_v10019942mg, partial [Capsella rubella]
 gb|EOA33748.1| hypothetical protein CARUB_v10019942mg, partial [Capsella rubella]
Length=641

 Score =   202 bits (515),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 106/184 (58%), Positives = 144/184 (78%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+NIGTD+S++P    VV LLKA+QI+H+RL+DAD  ML AL+N+ I+VI+ + N+++L
Sbjct  166  IGVNIGTDLSDMPHPTQVVALLKAQQIRHIRLYDADPGMLVALANSAIKVIISIPNDQLL  225

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIGQS+S AA WV +NV A+ P+T I AI+VGS+VLTS+ NAAPVLV A+  +H AL+SA
Sbjct  226  GIGQSNSTAANWVKRNVIAHYPATTIIAISVGSDVLTSLSNAAPVLVSAIKNVHAALLSA  285

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL+  +KVSTP ST LI   FPPS A FN S N+ +  +L FLQ+TNSY M+N YPYY+Y
Sbjct  286  NLDRLIKVSTPLSTALILDPFPPSQAFFNRSLNAVIVPLLSFLQSTNSYLMMNVYPYYDY  345

Query  691  VKSD  702
            ++S+
Sbjct  346  MESN  349



>ref|XP_003538392.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like [Glycine max]
Length=498

 Score =   200 bits (509),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 109/201 (54%), Positives = 145/201 (72%), Gaps = 8/201 (4%)
 Frame = +1

Query  124  VIVQFRRCV--------VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSAL  279
            +++ F  CV        +G+NIG D+S++P    VV LLKA+QI+HVRL+DAD  ML AL
Sbjct  6    LLLLFAVCVAAIDEEPFIGVNIGRDLSDMPHPTQVVALLKAQQIRHVRLYDADQAMLIAL  65

Query  280  SNTGIEVIVGVTNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAA  459
            +NT I+V V V N E+L IGQS++ AA WV+ NV A+ P+TNIT I VGSEVLT++P AA
Sbjct  66   ANTRIQVAVSVPNQEILAIGQSNTTAAKWVSHNVIAHYPATNITTICVGSEVLTTLPYAA  125

Query  460  PVLVPAMNYLHKALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFL  639
             VLV A+ +LH ALV++NL+ Q+KVSTP S+ +I   FPPS A FN S N  +  +L FL
Sbjct  126  KVLVSALKFLHSALVASNLDHQIKVSTPLSSSMILDSFPPSQAFFNRSLNPVLVPMLDFL  185

Query  640  QNTNSYYMLNAYPYYEYVKSD  702
            Q T+SY MLN YPYY+Y++S+
Sbjct  186  QTTDSYLMLNIYPYYDYMQSN  206



>ref|XP_010100650.1| Glucan endo-1,3-beta-glucosidase 3 [Morus notabilis]
 gb|EXC44994.1| Glucan endo-1,3-beta-glucosidase 3 [Morus notabilis]
Length=467

 Score =   199 bits (506),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 101/173 (58%), Positives = 136/173 (79%), Gaps = 0/173 (0%)
 Frame = +1

Query  184  LPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVLGIGQSSSQAAA  363
            +PS   VV LLK + I+HVRLFDAD  ML AL+NTGI+VIV V N ++LGIGQS++ AA 
Sbjct  1    MPSPTQVVALLKTQNIRHVRLFDADRAMLLALANTGIQVIVSVPNEQLLGIGQSNATAAN  60

Query  364  WVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSANLNSQVKVSTP  543
            WV +NV A++P+TNITAIAVGSEVL+++PNA P+LV A+ ++H ALV+ANL+ Q+KVSTP
Sbjct  61   WVARNVVAHVPATNITAIAVGSEVLSALPNAGPILVSALKFIHSALVAANLDRQIKVSTP  120

Query  544  QSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEYVKSD  702
             S+ +I   FPPS A FN + +  +  +L+FLQ+T SY MLN YPYY+Y++S+
Sbjct  121  HSSSIILDSFPPSQAFFNRTWDPVMVPLLKFLQSTGSYLMLNVYPYYDYMQSN  173



>ref|NP_176799.2| glucan endo-1,3-beta-glucosidase 2 [Arabidopsis thaliana]
 sp|Q9C7U5.2|E132_ARATH RecName: Full=Glucan endo-1,3-beta-glucosidase 2; AltName: Full=(1->3)-beta-glucan 
endohydrolase 2; Short=(1->3)-beta-glucanase 
2; AltName: Full=Beta-1,3-endoglucanase 2; Short=Beta-1,3-glucanase 
2; Flags: Precursor [Arabidopsis thaliana]
 gb|AEE34485.1| glucan endo-1,3-beta-glucosidase 2 [Arabidopsis thaliana]
Length=505

 Score =   200 bits (509),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 105/184 (57%), Positives = 145/184 (79%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+NIGTD+S++P    VV LLKA++I+H+RL++AD  +L AL+NTGI+VI+ + N+++L
Sbjct  32   IGVNIGTDLSDMPHPTQVVALLKAQEIRHIRLYNADPGLLIALANTGIKVIISIPNDQLL  91

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIGQS+S AA WV +NV A+ P+T ITA++VGSEVLTS+ NAAPVLV A+  +H AL+SA
Sbjct  92   GIGQSNSTAANWVKRNVIAHYPATMITAVSVGSEVLTSLSNAAPVLVSAIKNVHAALLSA  151

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL+  +KVSTP ST LI   FPPS A FN S N+ +  +L FLQ+TNSY M+N YPY +Y
Sbjct  152  NLDKLIKVSTPLSTSLILDPFPPSQAFFNRSLNAVIVPLLSFLQSTNSYLMVNVYPYIDY  211

Query  691  VKSD  702
            ++S+
Sbjct  212  MQSN  215



>gb|ABI93926.1| At1g66250 [Arabidopsis thaliana]
Length=505

 Score =   200 bits (508),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 105/184 (57%), Positives = 145/184 (79%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+NIGTD+S++P    VV LLKA++I+H+RL++AD  +L AL+NTGI+VI+ + N+++L
Sbjct  32   IGVNIGTDLSDMPHPTQVVALLKAQEIRHIRLYNADPGLLIALANTGIKVIISIPNDQLL  91

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIGQS+S AA WV +NV A+ P+T ITA++VGSEVLTS+ NAAPVLV A+  +H AL+SA
Sbjct  92   GIGQSNSTAANWVKRNVIAHYPATMITAVSVGSEVLTSLSNAAPVLVSAIKNVHAALLSA  151

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL+  +KVSTP ST LI   FPPS A FN S N+ +  +L FLQ+TNSY M+N YPY +Y
Sbjct  152  NLDKLIKVSTPLSTSLILDPFPPSQAFFNRSLNAVIVPLLSFLQSTNSYLMVNVYPYIDY  211

Query  691  VKSD  702
            ++S+
Sbjct  212  MQSN  215



>emb|CDY59252.1| BnaA05g36990D [Brassica napus]
Length=408

 Score =   197 bits (502),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 118/143 (83%), Gaps = 0/143 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+NIGTD++N+PS  D+V LLK+ QI HVRL+DA++HML ALSNT I+V VGVTN E+L
Sbjct  26   IGVNIGTDLTNMPSPSDIVSLLKSHQITHVRLYDANSHMLKALSNTTIQVTVGVTNQEIL  85

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
             IG+  S AA+WVNKNVAAY+PSTNITAIAVGSEVLT  P+ AP+L  A+N +HKALV+ 
Sbjct  86   KIGRFPSSAASWVNKNVAAYVPSTNITAIAVGSEVLTESPHVAPILASALNNIHKALVAT  145

Query  511  NLNSQVKVSTPQSTDLIAKIFPP  579
            NLN QVKVSTP S D++ K FPP
Sbjct  146  NLNFQVKVSTPMSMDVMPKPFPP  168



>ref|XP_008777063.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X3 
[Phoenix dactylifera]
Length=504

 Score =   199 bits (507),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 106/184 (58%), Positives = 145/184 (79%), Gaps = 1/184 (1%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            VG+NI TDV NL SA+ +V +L+A+QIKHVRLFDAD  ML+AL+NTGIEV++G+ N+++ 
Sbjct  25   VGVNIRTDVFNLQSAEGIVSVLQAQQIKHVRLFDADHQMLNALANTGIEVMIGIPNDQLP  84

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
             IG S   AA W+NKN+A +LP+T+IT IAVG+EVLT+ P+AA +L+PAM +LH AL++A
Sbjct  85   VIGNSQEAAADWINKNIADFLPATDITCIAVGNEVLTTTPDAA-LLLPAMQFLHSALLAA  143

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            +L+ QVKVS+P S  +I K FPPSTATFN   NS + Q L FL+NT+S ++ NA+PYY +
Sbjct  144  DLHYQVKVSSPHSMLMIPKSFPPSTATFNLKWNSLMHQFLLFLKNTDSSFLFNAHPYYGH  203

Query  691  VKSD  702
             K +
Sbjct  204  TKGE  207



>ref|XP_008777061.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X1 
[Phoenix dactylifera]
Length=507

 Score =   199 bits (507),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 106/184 (58%), Positives = 145/184 (79%), Gaps = 1/184 (1%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            VG+NI TDV NL SA+ +V +L+A+QIKHVRLFDAD  ML+AL+NTGIEV++G+ N+++ 
Sbjct  28   VGVNIRTDVFNLQSAEGIVSVLQAQQIKHVRLFDADHQMLNALANTGIEVMIGIPNDQLP  87

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
             IG S   AA W+NKN+A +LP+T+IT IAVG+EVLT+ P+AA +L+PAM +LH AL++A
Sbjct  88   VIGNSQEAAADWINKNIADFLPATDITCIAVGNEVLTTTPDAA-LLLPAMQFLHSALLAA  146

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            +L+ QVKVS+P S  +I K FPPSTATFN   NS + Q L FL+NT+S ++ NA+PYY +
Sbjct  147  DLHYQVKVSSPHSMLMIPKSFPPSTATFNLKWNSLMHQFLLFLKNTDSSFLFNAHPYYGH  206

Query  691  VKSD  702
             K +
Sbjct  207  TKGE  210



>ref|XP_008777062.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X2 
[Phoenix dactylifera]
Length=505

 Score =   199 bits (507),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 106/184 (58%), Positives = 145/184 (79%), Gaps = 1/184 (1%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            VG+NI TDV NL SA+ +V +L+A+QIKHVRLFDAD  ML+AL+NTGIEV++G+ N+++ 
Sbjct  28   VGVNIRTDVFNLQSAEGIVSVLQAQQIKHVRLFDADHQMLNALANTGIEVMIGIPNDQLP  87

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
             IG S   AA W+NKN+A +LP+T+IT IAVG+EVLT+ P+AA +L+PAM +LH AL++A
Sbjct  88   VIGNSQEAAADWINKNIADFLPATDITCIAVGNEVLTTTPDAA-LLLPAMQFLHSALLAA  146

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            +L+ QVKVS+P S  +I K FPPSTATFN   NS + Q L FL+NT+S ++ NA+PYY +
Sbjct  147  DLHYQVKVSSPHSMLMIPKSFPPSTATFNLKWNSLMHQFLLFLKNTDSSFLFNAHPYYGH  206

Query  691  VKSD  702
             K +
Sbjct  207  TKGE  210



>emb|CBI16509.3| unnamed protein product [Vitis vinifera]
Length=528

 Score =   200 bits (508),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 124/175 (71%), Gaps = 42/175 (24%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            VG+NIGTDVSNLPSA  +V +LKA QI HVRL+DADAHML+AL+NTGIEV+VGVTN EVL
Sbjct  26   VGVNIGTDVSNLPSASVLVGILKAHQITHVRLYDADAHMLNALANTGIEVVVGVTNEEVL  85

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIGQS S AA W+N+NVAAY+PSTNITAIAVGSEVLTSIP+AAPVLVPAMNYLHKAL   
Sbjct  86   GIGQSPSTAATWINRNVAAYVPSTNITAIAVGSEVLTSIPHAAPVLVPAMNYLHKAL---  142

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYY-MLNA  672
                                                  +LQFL+NTNSY+ ML+A
Sbjct  143  --------------------------------------MLQFLKNTNSYFIMLDA  159



>gb|EMS47617.1| Glucan endo-1,3-beta-glucosidase 3 [Triticum urartu]
Length=529

 Score =   199 bits (506),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 100/189 (53%), Positives = 143/189 (76%), Gaps = 0/189 (0%)
 Frame = +1

Query  136  FRRCVVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVT  315
            F    +G+NIGT +S++P+A  +  LL+++ I+H+RL+DAD  MLSAL+NTGI VI+ V 
Sbjct  50   FDWAYIGVNIGTAMSSVPAATQITTLLRSQNIRHIRLYDADPGMLSALANTGIRVIISVP  109

Query  316  NNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHK  495
            N ++L IG S++ AA WV +NVAA+ PS NITAIAVGSEVL+++PNAAP+++PAM YL  
Sbjct  110  NEQLLAIGNSNATAAKWVARNVAAHYPSVNITAIAVGSEVLSTLPNAAPLIMPAMRYLQN  169

Query  496  ALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAY  675
            ALV+A L+  +K+STP S+ +I   FPPS A FN S +  +  +L+FLQ+T +  MLN Y
Sbjct  170  ALVAAALDKYIKISTPHSSSIILDSFPPSQAFFNRSLDPVLVPMLKFLQSTGAPLMLNVY  229

Query  676  PYYEYVKSD  702
            PYY+Y++S+
Sbjct  230  PYYDYMRSN  238



>ref|XP_006602009.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like isoform X2 
[Glycine max]
Length=438

 Score =   197 bits (500),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 104/184 (57%), Positives = 138/184 (75%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+NIG D+S++P    VV LLKA+QI+HVRL+DAD  ML AL+NT I+V V V N E+L
Sbjct  23   IGVNIGRDLSDMPHPTQVVALLKAQQIRHVRLYDADQAMLIALANTRIQVAVSVPNQEIL  82

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
             IGQS++ AA WV+ NV A+ P+TNIT I VGS+VLT++P AA VLV A+ ++H ALV++
Sbjct  83   AIGQSNTTAAKWVSHNVIAHYPATNITTICVGSDVLTTLPYAAKVLVSALKFIHSALVAS  142

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL+ Q+KVSTP S+ +I   FPPS A FN S N  +  +L FLQ T SY MLN YPYY+Y
Sbjct  143  NLDHQIKVSTPLSSSMILDSFPPSQAFFNRSLNPVLVPMLDFLQTTGSYLMLNIYPYYDY  202

Query  691  VKSD  702
            ++S+
Sbjct  203  MQSN  206



>ref|XP_008460530.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2 isoform X1 [Cucumis 
melo]
Length=463

 Score =   197 bits (501),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 101/173 (58%), Positives = 136/173 (79%), Gaps = 0/173 (0%)
 Frame = +1

Query  184  LPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVLGIGQSSSQAAA  363
            +P    V  LLKA+QI+HVRL+DAD  ML AL+NTGI+V+V + N ++LGIGQS+S AA 
Sbjct  1    MPHPTQVAALLKAQQIRHVRLYDADGGMLMALANTGIQVMVTIPNEQILGIGQSNSTAAN  60

Query  364  WVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSANLNSQVKVSTP  543
            WVN+NV A+ P+TNITAI+VG +VLT++PNAA +LV A+ Y+H ALV++NL+ Q+KVSTP
Sbjct  61   WVNRNVLAHYPATNITAISVGFDVLTTLPNAAKILVNALKYVHSALVASNLDHQIKVSTP  120

Query  544  QSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEYVKSD  702
             S+ +I   FPPS A FN S +S +  +L FLQ+TNS+ MLN YPYY+Y++SD
Sbjct  121  LSSSIILDSFPPSQAFFNASLDSVIVPLLGFLQSTNSFLMLNVYPYYDYMQSD  173



>gb|EMT05308.1| Glucan endo-1,3-beta-glucosidase 3 [Aegilops tauschii]
Length=500

 Score =   197 bits (502),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 99/184 (54%), Positives = 142/184 (77%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+NIGT +S++P+A  +  LL+++ I+H+RL+DAD  MLSAL+NTGI VI+ V N ++L
Sbjct  26   IGVNIGTAMSSVPAATQITTLLRSQNIRHIRLYDADPGMLSALANTGIRVIISVPNEQLL  85

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
             IG S++ AA WV +NVAA+ PS NITAIAVGSEVL+++PNAAP+++PAM YL  ALV+A
Sbjct  86   AIGNSNATAAKWVARNVAAHYPSVNITAIAVGSEVLSTLPNAAPLIMPAMRYLQNALVAA  145

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
             L+  +K+STP S+ +I   FPPS A FN S +  +  +L+FLQ+T +  MLN YPYY+Y
Sbjct  146  ALDKYIKISTPHSSSIILDSFPPSQAFFNRSLDPVLVPMLKFLQSTGAPLMLNVYPYYDY  205

Query  691  VKSD  702
            ++S+
Sbjct  206  MRSN  209



>ref|XP_010513892.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Camelina 
sativa]
Length=497

 Score =   197 bits (502),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 103/188 (55%), Positives = 142/188 (76%), Gaps = 0/188 (0%)
 Frame = +1

Query  139  RRCVVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTN  318
            +  ++G+NIGT+V+N+PS   VV LLK++ I  VRL+DAD  ML A ++TGI+VI+ V N
Sbjct  19   QDSLIGVNIGTEVTNMPSPTQVVALLKSQNINRVRLYDADRSMLLAFAHTGIQVIISVPN  78

Query  319  NEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKA  498
             ++LGI QS++ AA WV +NVAAY P+TNIT IAVGSEVLTS+ NAA VLV A+ Y+  A
Sbjct  79   EQLLGISQSNATAANWVTRNVAAYYPATNITTIAVGSEVLTSLSNAASVLVSALKYIQAA  138

Query  499  LVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYP  678
            LV+ANL+ Q+KVSTP S+ +I   FPPS A FN + +  +  +L+FLQ+T S  +LN YP
Sbjct  139  LVTANLDRQIKVSTPHSSAIILDSFPPSQAFFNKTWDPVIVPLLKFLQSTGSPLLLNVYP  198

Query  679  YYEYVKSD  702
            Y++YV+S+
Sbjct  199  YFDYVQSN  206



>emb|CDP01635.1| unnamed protein product [Coffea canephora]
Length=495

 Score =   197 bits (502),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 101/188 (54%), Positives = 141/188 (75%), Gaps = 0/188 (0%)
 Frame = +1

Query  139  RRCVVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTN  318
                +G+NIGTD+S++P    VV LLK +QI++VRL++AD  ML AL+NTGI+V V V N
Sbjct  19   EEAFIGVNIGTDLSDMPDPTQVVALLKKQQIRYVRLYNADRGMLLALANTGIKVAVSVPN  78

Query  319  NEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKA  498
             ++L IGQS+S AA WV++NV ++ P+TNIT + VGSEV TS+PNAAP+LV A+ ++  A
Sbjct  79   EQLLAIGQSNSTAANWVSQNVVSHYPATNITTVCVGSEVFTSLPNAAPILVNALRFIQSA  138

Query  499  LVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYP  678
            LV++NL+ Q+KVSTP  + +I   FPPS A FN S N  +  +L FLQ+T SY+MLN YP
Sbjct  139  LVASNLDRQIKVSTPLPSSIILDPFPPSQAFFNHSLNRVLVPMLSFLQSTGSYFMLNVYP  198

Query  679  YYEYVKSD  702
            YY+Y++S+
Sbjct  199  YYDYMQSN  206



>ref|NP_565269.1| glucan endo-1,3-beta-glucosidase 3 [Arabidopsis thaliana]
 sp|Q9ZU91.2|E133_ARATH RecName: Full=Glucan endo-1,3-beta-glucosidase 3; AltName: Full=(1->3)-beta-glucan 
endohydrolase 3; Short=(1->3)-beta-glucanase 
3; AltName: Full=Beta-1,3-endoglucanase 3; Short=Beta-1,3-glucanase 
3; Flags: Precursor [Arabidopsis thaliana]
 gb|AAD12708.2| putative beta-1,3-glucanase [Arabidopsis thaliana]
 gb|AAM62724.1| putative beta-1,3-glucanase [Arabidopsis thaliana]
 gb|AEC05475.1| glucan endo-1,3-beta-glucosidase 3 [Arabidopsis thaliana]
Length=501

 Score =   197 bits (502),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 102/188 (54%), Positives = 143/188 (76%), Gaps = 0/188 (0%)
 Frame = +1

Query  139  RRCVVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTN  318
            +  ++G+NIGT+V+N+PS   VV LLK++ I  VRL+DAD  ML A ++TG++VI+ V N
Sbjct  19   QDSLIGVNIGTEVTNMPSPTQVVALLKSQNINRVRLYDADRSMLLAFAHTGVQVIISVPN  78

Query  319  NEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKA  498
            +++LGI QS++ AA WV +NVAAY P+TNIT IAVGSEVLTS+ NAA VLV A+ Y+  A
Sbjct  79   DQLLGISQSNATAANWVTRNVAAYYPATNITTIAVGSEVLTSLTNAASVLVSALKYIQAA  138

Query  499  LVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYP  678
            LV+ANL+ Q+KVSTP S+ +I   FPPS A FN + +  +  +L+FLQ+T S  +LN YP
Sbjct  139  LVTANLDRQIKVSTPHSSTIILDSFPPSQAFFNKTWDPVIVPLLKFLQSTGSPLLLNVYP  198

Query  679  YYEYVKSD  702
            Y++YV+S+
Sbjct  199  YFDYVQSN  206



>ref|XP_010424935.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 [Camelina sativa]
Length=501

 Score =   197 bits (502),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 103/188 (55%), Positives = 142/188 (76%), Gaps = 0/188 (0%)
 Frame = +1

Query  139  RRCVVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTN  318
            +  ++G+NIGT+V+N+PS   VV LLK++ I  VRL+DAD  ML A ++TGI+VI+ V N
Sbjct  19   QDSLIGVNIGTEVTNMPSPTQVVALLKSQNINRVRLYDADRSMLLAFAHTGIQVIISVPN  78

Query  319  NEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKA  498
             ++LGI QS++ AA WV +NVAAY P+TNIT IAVGSEVLTS+ NAA VLV A+ Y+  A
Sbjct  79   EQLLGISQSNATAANWVTRNVAAYYPATNITTIAVGSEVLTSLSNAASVLVSALKYIQAA  138

Query  499  LVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYP  678
            LV+ANL+ Q+KVSTP S+ +I   FPPS A FN + +  +  +L+FLQ+T S  +LN YP
Sbjct  139  LVTANLDRQIKVSTPHSSTIILDSFPPSQAFFNKTWDPVIVPLLKFLQSTGSPLLLNVYP  198

Query  679  YYEYVKSD  702
            Y++YV+S+
Sbjct  199  YFDYVQSN  206



>ref|XP_010502143.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Camelina 
sativa]
Length=501

 Score =   197 bits (501),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 103/188 (55%), Positives = 142/188 (76%), Gaps = 0/188 (0%)
 Frame = +1

Query  139  RRCVVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTN  318
            +  ++G+NIGT+V+N+PS   VV LLK++ I  VRL+DAD  ML A ++TGI+VI+ V N
Sbjct  19   QDSLIGVNIGTEVTNMPSPTQVVALLKSQNINRVRLYDADRSMLLAFAHTGIQVIISVPN  78

Query  319  NEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKA  498
             ++LGI QS++ AA WV +NVAAY P+TNIT IAVGSEVLTS+ NAA VLV A+ Y+  A
Sbjct  79   EQLLGISQSNATAANWVTRNVAAYYPATNITTIAVGSEVLTSLSNAASVLVSALKYIQAA  138

Query  499  LVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYP  678
            LV+ANL+ Q+KVSTP S+ +I   FPPS A FN + +  +  +L+FLQ+T S  +LN YP
Sbjct  139  LVTANLDRQIKVSTPHSSAIILDSFPPSQAFFNKTWDPVIVPLLKFLQSTGSPLLLNVYP  198

Query  679  YYEYVKSD  702
            Y++YV+S+
Sbjct  199  YFDYVQSN  206



>gb|AIR93909.1| glucanase [Cicer arietinum]
Length=454

 Score =   196 bits (498),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 105/184 (57%), Positives = 145/184 (79%), Gaps = 0/184 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G+NIGTD+S++P+  + V LLKA+ I+HVRLFDAD  +L AL+NTGI V + V N+++L
Sbjct  27   IGVNIGTDLSDMPTPTETVALLKAQSIQHVRLFDADRALLLALANTGIRVTISVPNDQIL  86

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIGQS++ AA WV++NV A++P+TNIT+IAVGSEVLT++ NAAP+LV AM ++H ALV+A
Sbjct  87   GIGQSNATAANWVSRNVIAHVPATNITSIAVGSEVLTTLSNAAPILVSAMKFIHSALVAA  146

Query  511  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  690
            NL+ Q+KVSTP S+ +I   FPPS A FN + N  +  +L FLQ+T SY M N YPYY+Y
Sbjct  147  NLDGQIKVSTPHSSSIILDSFPPSQAFFNRTWNPVMVPLLNFLQSTGSYLMFNVYPYYDY  206

Query  691  VKSD  702
             +S+
Sbjct  207  QQSN  210



>ref|XP_006599427.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like isoform X4 
[Glycine max]
Length=424

 Score =   195 bits (496),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 105/181 (58%), Positives = 138/181 (76%), Gaps = 3/181 (2%)
 Frame = +1

Query  115  YMRVIVQF---RRCVVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSN  285
            YM VI+         +G+NIGTDV+N+PS  +VV LLKA+ I+HVRL+DAD  ML AL+N
Sbjct  8    YMLVIIALPAHGDAFIGVNIGTDVTNMPSPTEVVALLKAQGIQHVRLYDADRAMLRALAN  67

Query  286  TGIEVIVGVTNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPV  465
            TGI VIV V N+++LGIGQS++ AA WV +NV A++P+TNITAIAVGSEVLTS+PNAAPV
Sbjct  68   TGIRVIVSVPNDQILGIGQSNATAANWVARNVIAHVPATNITAIAVGSEVLTSLPNAAPV  127

Query  466  LVPAMNYLHKALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQN  645
            LV A+ ++  ALV+ANL+ Q+KVSTP S+ +I   FPPS A FN + +  +  +L FLQ+
Sbjct  128  LVSALKFIQAALVAANLDQQIKVSTPHSSSVILDSFPPSQAFFNKTWDPVMVPLLNFLQS  187

Query  646  T  648
            T
Sbjct  188  T  188



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1193157586335