BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF052C15

Length=672
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP13052.1|  unnamed protein product                                192   4e-52   Coffea canephora [robusta coffee]
ref|XP_004512509.1|  PREDICTED: ABC transporter B family member 2...    189   3e-51   Cicer arietinum [garbanzo]
ref|XP_003628784.1|  ABC transporter B family member                    184   3e-51   
gb|KDO53158.1|  hypothetical protein CISIN_1g0008302mg                  175   5e-51   Citrus sinensis [apfelsine]
ref|XP_003612850.1|  ABC transporter B family member                    189   6e-51   Medicago truncatula
ref|XP_006432794.1|  hypothetical protein CICLE_v100000601mg            175   6e-51   
ref|XP_008373592.1|  PREDICTED: ABC transporter B family member 2...    189   7e-51   
gb|KHN04865.1|  ABC transporter B family member 2                       187   2e-50   Glycine soja [wild soybean]
ref|XP_003517674.1|  PREDICTED: ABC transporter B family member 2...    187   2e-50   Glycine max [soybeans]
ref|XP_011082358.1|  PREDICTED: ABC transporter B family member 2...    187   2e-50   Sesamum indicum [beniseed]
ref|XP_003533440.1|  PREDICTED: ABC transporter B family member 2...    187   3e-50   Glycine max [soybeans]
ref|XP_009371200.1|  PREDICTED: ABC transporter B family member 2...    187   3e-50   Pyrus x bretschneideri [bai li]
ref|XP_007210429.1|  hypothetical protein PRUPE_ppa000340mg             187   3e-50   Prunus persica
ref|XP_008238211.1|  PREDICTED: ABC transporter B family member 2...    186   9e-50   Prunus mume [ume]
ref|XP_010096959.1|  ABC transporter B family member 2                  183   2e-49   
ref|XP_010055294.1|  PREDICTED: ABC transporter B family member 2...    184   3e-49   Eucalyptus grandis [rose gum]
ref|XP_007158282.1|  hypothetical protein PHAVU_002G139400g             184   3e-49   Phaseolus vulgaris [French bean]
gb|KHN30010.1|  ABC transporter B family member 2                       184   4e-49   Glycine soja [wild soybean]
ref|XP_006585887.1|  PREDICTED: ABC transporter B family member 2...    183   5e-49   Glycine max [soybeans]
ref|XP_009764894.1|  PREDICTED: ABC transporter B family member 2...    183   5e-49   Nicotiana sylvestris
ref|XP_004301784.1|  PREDICTED: ABC transporter B family member 2...    183   6e-49   Fragaria vesca subsp. vesca
ref|XP_007156412.1|  hypothetical protein PHAVU_003G283900g             183   6e-49   Phaseolus vulgaris [French bean]
gb|EYU34148.1|  hypothetical protein MIMGU_mgv1a000301mg                183   6e-49   Erythranthe guttata [common monkey flower]
gb|KJB51627.1|  hypothetical protein B456_008G225400                    183   8e-49   Gossypium raimondii
gb|KJB21122.1|  hypothetical protein B456_003G183800                    181   1e-48   Gossypium raimondii
ref|XP_007040641.1|  Multidrug/pheromone exporter, MDR family, AB...    182   1e-48   
gb|KJB21124.1|  hypothetical protein B456_003G183800                    182   1e-48   Gossypium raimondii
gb|AAF23176.1|AF216497_1  P-glycoprotein                                182   1e-48   Gossypium hirsutum [American cotton]
ref|XP_007040642.1|  Multidrug/pheromone exporter, MDR family, AB...    181   2e-48   
gb|KJB21121.1|  hypothetical protein B456_003G183800                    182   2e-48   Gossypium raimondii
ref|XP_009595706.1|  PREDICTED: ABC transporter B family member 2...    182   2e-48   Nicotiana tomentosiformis
ref|XP_004245909.2|  PREDICTED: ABC transporter B family member 2...    181   2e-48   Solanum lycopersicum
ref|XP_006352948.1|  PREDICTED: ABC transporter B family member 2...    181   3e-48   Solanum tuberosum [potatoes]
gb|KJB21123.1|  hypothetical protein B456_003G183800                    181   3e-48   Gossypium raimondii
ref|XP_002892589.1|  P-glycoprotein 10                                  181   3e-48   Arabidopsis lyrata subsp. lyrata
gb|EPS64351.1|  hypothetical protein M569_10429                         181   3e-48   Genlisea aurea
ref|XP_010458427.1|  PREDICTED: ABC transporter B family member 1...    181   3e-48   Camelina sativa [gold-of-pleasure]
ref|XP_010491749.1|  PREDICTED: ABC transporter B family member 10      181   4e-48   Camelina sativa [gold-of-pleasure]
ref|XP_002277547.1|  PREDICTED: ABC transporter B family member 2       181   5e-48   Vitis vinifera
ref|XP_006417431.1|  hypothetical protein EUTSA_v10009914mg             180   9e-48   Eutrema salsugineum [saltwater cress]
ref|XP_006303653.1|  hypothetical protein CARUB_v10011664mg             179   1e-47   Capsella rubella
ref|XP_010540773.1|  PREDICTED: ABC transporter B family member 2...    179   1e-47   Tarenaya hassleriana [spider flower]
ref|NP_172538.1|  ABC transporter B family member 10                    179   1e-47   Arabidopsis thaliana [mouse-ear cress]
gb|AFW63453.1|  hypothetical protein ZEAMMB73_169648                    167   1e-47   
ref|XP_002869639.1|  multidrug resistance protein 2                     179   2e-47   
ref|XP_011028150.1|  PREDICTED: ABC transporter B family member 2...    179   2e-47   Populus euphratica
gb|AAM20507.1|  P-glycoprotein-2                                        179   2e-47   Arabidopsis thaliana [mouse-ear cress]
emb|CAA71277.1|  P-glycoprotein-2                                       179   2e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006282856.1|  hypothetical protein CARUB_v10006816mg             178   3e-47   
ref|XP_010436379.1|  PREDICTED: ABC transporter B family member 2       178   3e-47   
gb|KFK43347.1|  hypothetical protein AALP_AA1G113900                    178   3e-47   Arabis alpina [alpine rockcress]
ref|XP_010538383.1|  PREDICTED: ABC transporter B family member 2...    178   4e-47   Tarenaya hassleriana [spider flower]
gb|AAF17668.1|AC009398_17  F20B24.12                                    178   4e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003572841.1|  PREDICTED: ABC transporter B family member 2...    178   4e-47   Brachypodium distachyon [annual false brome]
ref|NP_194326.2|  P-glycoprotein 2                                      178   4e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006385671.1|  hypothetical protein POPTR_0003s09320g             177   4e-47   
ref|XP_002304346.1|  P-glycoprotein                                     177   5e-47   Populus trichocarpa [western balsam poplar]
emb|CDY37953.1|  BnaC05g08210D                                          177   6e-47   Brassica napus [oilseed rape]
ref|XP_006413247.1|  hypothetical protein EUTSA_v10024237mg             177   6e-47   Eutrema salsugineum [saltwater cress]
ref|XP_008800115.1|  PREDICTED: ABC transporter B family member 2...    177   8e-47   Phoenix dactylifera
emb|CDX93393.1|  BnaA06g06550D                                          177   8e-47   
ref|XP_010677330.1|  PREDICTED: ABC transporter B family member 2...    177   9e-47   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009148411.1|  PREDICTED: ABC transporter B family member 10      176   1e-46   Brassica rapa
ref|XP_009139729.1|  PREDICTED: ABC transporter B family member 2       176   1e-46   Brassica rapa
gb|KFK29108.1|  hypothetical protein AALP_AA7G090300                    176   1e-46   Arabis alpina [alpine rockcress]
ref|XP_010475946.1|  PREDICTED: ABC transporter B family member 1...    176   1e-46   Camelina sativa [gold-of-pleasure]
ref|XP_006471591.1|  PREDICTED: ABC transporter B family member 2...    176   2e-46   Citrus sinensis [apfelsine]
ref|XP_011018529.1|  PREDICTED: ABC transporter B family member 2...    176   2e-46   Populus euphratica
ref|XP_011018530.1|  PREDICTED: ABC transporter B family member 2...    176   2e-46   Populus euphratica
emb|CDX89380.1|  BnaA01g15130D                                          176   2e-46   
emb|CDX94395.1|  BnaC01g17890D                                          176   2e-46   
ref|NP_001047803.1|  Os02g0693700                                       176   2e-46   
gb|EEC73824.1|  hypothetical protein OsI_08549                          176   3e-46   Oryza sativa Indica Group [Indian rice]
ref|XP_009396844.1|  PREDICTED: ABC transporter B family member 2...    176   3e-46   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002527657.1|  multidrug resistance protein 1, 2, putative        175   4e-46   
gb|EMS51604.1|  ABC transporter B family member 2                       175   5e-46   Triticum urartu
ref|XP_010908483.1|  PREDICTED: ABC transporter B family member 2...    174   6e-46   Elaeis guineensis
ref|XP_010240898.1|  PREDICTED: ABC transporter B family member 2...    174   9e-46   Nelumbo nucifera [Indian lotus]
ref|XP_011018527.1|  PREDICTED: ABC transporter B family member 2...    174   1e-45   Populus euphratica
ref|XP_006647720.1|  PREDICTED: ABC transporter B family member 2...    174   1e-45   Oryza brachyantha
ref|XP_011018526.1|  PREDICTED: ABC transporter B family member 2...    174   1e-45   Populus euphratica
ref|XP_002299180.2|  P-glycoprotein                                     173   2e-45   
gb|KGN60362.1|  hypothetical protein Csa_3G901080                       172   3e-45   Cucumis sativus [cucumbers]
gb|EMT33461.1|  ABC transporter B family member 2                       172   4e-45   
ref|XP_004953524.1|  PREDICTED: ABC transporter B family member 2...    172   6e-45   Setaria italica
ref|XP_008465999.1|  PREDICTED: ABC transporter B family member 2...    171   1e-44   Cucumis melo [Oriental melon]
emb|CDX92739.1|  BnaC07g39970D                                          171   1e-44   
ref|XP_002452712.1|  hypothetical protein SORBIDRAFT_04g031170          170   3e-44   Sorghum bicolor [broomcorn]
ref|XP_008676453.1|  PREDICTED: uncharacterized protein LOC100191...    169   5e-44   
ref|XP_010274279.1|  PREDICTED: ABC transporter B family member 2...    167   2e-43   Nelumbo nucifera [Indian lotus]
emb|CDY42770.1|  BnaA03g47690D                                          166   8e-43   Brassica napus [oilseed rape]
ref|XP_009137566.1|  PREDICTED: ABC transporter B family member 2...    165   1e-42   Brassica rapa
ref|XP_006854029.1|  hypothetical protein AMTR_s00048p00046670          164   3e-42   Amborella trichopoda
gb|KHN38940.1|  ABC transporter B family member 2                       163   6e-42   Glycine soja [wild soybean]
gb|ABG75919.1|  MDR-like ABC transporter                                161   3e-41   Ginkgo biloba [ginkgo]
ref|XP_004509740.1|  PREDICTED: ABC transporter B family member 2...    160   5e-41   
ref|XP_004509738.1|  PREDICTED: ABC transporter B family member 2...    159   2e-40   Cicer arietinum [garbanzo]
ref|XP_010906448.1|  PREDICTED: ABC transporter B family member 2...    149   4e-37   Elaeis guineensis
ref|XP_008777170.1|  PREDICTED: ABC transporter B family member 2...    145   7e-36   Phoenix dactylifera
ref|XP_004136398.1|  PREDICTED: ABC transporter B family member 2...    144   2e-35   
ref|XP_002976764.1|  hypothetical protein SELMODRAFT_105467             137   9e-33   
ref|XP_002983053.1|  hypothetical protein SELMODRAFT_117529             136   2e-32   
ref|XP_002965566.1|  ATP-binding cassette transporter                   135   4e-32   
ref|XP_001757525.1|  ATP-binding cassette transporter, subfamily ...    131   6e-31   
ref|XP_006368377.1|  P-glycoprotein                                     128   6e-30   
ref|XP_001774240.1|  ATP-binding cassette transporter, subfamily ...    127   2e-29   
ref|XP_002973102.1|  ATP-binding cassette transporter                   125   1e-28   
ref|XP_006415715.1|  hypothetical protein EUTSA_v10006582mg             124   2e-28   Eutrema salsugineum [saltwater cress]
ref|XP_002510564.1|  multidrug resistance protein 1, 2, putative        124   3e-28   Ricinus communis
ref|XP_011083466.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    123   3e-28   
ref|XP_002893495.1|  P-glycoprotein 13                                  122   7e-28   Arabidopsis lyrata subsp. lyrata
ref|XP_009113714.1|  PREDICTED: ABC transporter B family member 14      122   1e-27   Brassica rapa
ref|NP_174122.1|  ABC transporter B family member 14                    121   2e-27   Arabidopsis thaliana [mouse-ear cress]
ref|NP_174115.1|  ABC transporter B family member 13                    120   3e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001779184.1|  ATP-binding cassette transporter, subfamily ...    120   4e-27   
gb|EPS72310.1|  hypothetical protein M569_02448                         112   5e-27   Genlisea aurea
ref|XP_010460561.1|  PREDICTED: ABC transporter B family member 1...    120   5e-27   Camelina sativa [gold-of-pleasure]
gb|KFK44669.1|  hypothetical protein AALP_AA1G288400                    120   6e-27   Arabis alpina [alpine rockcress]
ref|XP_002877137.1|  P-glycoprotein 19                                  119   7e-27   Arabidopsis lyrata subsp. lyrata
emb|CDP07374.1|  unnamed protein product                                119   9e-27   Coffea canephora [robusta coffee]
ref|XP_002981381.1|  hypothetical protein SELMODRAFT_114581             119   1e-26   
gb|KDP36900.1|  hypothetical protein JCGZ_08191                         119   1e-26   Jatropha curcas
gb|AAN28720.2|  MDR-like p-glycoprotein                                 119   1e-26   Arabidopsis thaliana [mouse-ear cress]
ref|NP_189528.1|  ABC transporter B family member 19                    119   2e-26   Arabidopsis thaliana [mouse-ear cress]
dbj|BAC41846.1|  putative P-glycoprotein                                119   2e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002969904.1|  ATP-binding cassette transporter                   118   2e-26   
ref|XP_010527726.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    118   2e-26   Tarenaya hassleriana [spider flower]
ref|XP_007225446.1|  hypothetical protein PRUPE_ppa000363mg             118   2e-26   Prunus persica
ref|XP_001751653.1|  ATP-binding cassette transporter, subfamily ...    118   2e-26   
ref|XP_010502886.1|  PREDICTED: ABC transporter B family member 1...    118   2e-26   Camelina sativa [gold-of-pleasure]
ref|XP_010514603.1|  PREDICTED: ABC transporter B family member 1...    118   2e-26   Camelina sativa [gold-of-pleasure]
ref|XP_010425667.1|  PREDICTED: ABC transporter B family member 19      118   3e-26   Camelina sativa [gold-of-pleasure]
ref|XP_006290510.1|  hypothetical protein CARUB_v10016588mg             118   3e-26   Capsella rubella
ref|XP_008221400.1|  PREDICTED: ABC transporter B family member 1...    118   3e-26   Prunus mume [ume]
ref|XP_010499285.1|  PREDICTED: ABC transporter B family member 1...    118   3e-26   Camelina sativa [gold-of-pleasure]
ref|XP_011459839.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    117   4e-26   Fragaria vesca subsp. vesca
ref|XP_002890755.1|  P-glycoprotein 14                                  117   4e-26   Arabidopsis lyrata subsp. lyrata
ref|XP_006415706.1|  hypothetical protein EUTSA_v10006583mg             117   5e-26   Eutrema salsugineum [saltwater cress]
ref|XP_009151836.1|  PREDICTED: ABC transporter B family member 19      117   5e-26   Brassica rapa
emb|CDX86408.1|  BnaA06g31250D                                          117   5e-26   
gb|KFK33112.1|  hypothetical protein AALP_AA6G332600                    117   6e-26   Arabis alpina [alpine rockcress]
ref|XP_010478144.1|  PREDICTED: ABC transporter B family member 1...    116   9e-26   
gb|KFK33760.1|  hypothetical protein AALP_AA5G056700                    116   9e-26   Arabis alpina [alpine rockcress]
ref|XP_006395333.1|  hypothetical protein EUTSA_v10003528mg             116   9e-26   Eutrema salsugineum [saltwater cress]
ref|XP_007017851.1|  P-glycoprotein 13                                  116   1e-25   
ref|XP_008348224.1|  PREDICTED: ABC transporter B family member 1...    108   1e-25   
emb|CDY65012.1|  BnaCnng45670D                                          116   1e-25   Brassica napus [oilseed rape]
ref|XP_002301961.1|  multidrug resistance P-glycoprotein                115   2e-25   
ref|XP_009113724.1|  PREDICTED: ABC transporter B family member 1...    115   2e-25   Brassica rapa
ref|XP_011034997.1|  PREDICTED: ABC transporter B family member 1...    115   3e-25   Populus euphratica
ref|XP_009113722.1|  PREDICTED: ABC transporter B family member 1...    115   3e-25   Brassica rapa
ref|XP_011085762.1|  PREDICTED: ABC transporter B family member 1...    114   4e-25   Sesamum indicum [beniseed]
emb|CDY27639.1|  BnaA09g27680D                                          114   4e-25   Brassica napus [oilseed rape]
ref|XP_010528330.1|  PREDICTED: ABC transporter B family member 19      114   5e-25   Tarenaya hassleriana [spider flower]
emb|CDX84896.1|  BnaC05g21590D                                          114   5e-25   
emb|CDP02220.1|  unnamed protein product                                114   6e-25   Coffea canephora [robusta coffee]
ref|XP_006306603.1|  hypothetical protein CARUB_v10008108mg             114   7e-25   Capsella rubella
ref|XP_006856780.1|  hypothetical protein AMTR_s00055p00102180          114   7e-25   
ref|XP_003544389.1|  PREDICTED: ABC transporter B family member 1...    113   1e-24   Glycine max [soybeans]
ref|XP_010501626.1|  PREDICTED: ABC transporter B family member 1...    113   1e-24   
ref|XP_010439790.1|  PREDICTED: ABC transporter B family member 1...    113   1e-24   Camelina sativa [gold-of-pleasure]
ref|XP_010480688.1|  PREDICTED: ABC transporter B family member 14      112   2e-24   Camelina sativa [gold-of-pleasure]
ref|XP_007160658.1|  hypothetical protein PHAVU_001G005900g             112   2e-24   Phaseolus vulgaris [French bean]
ref|XP_003549468.1|  PREDICTED: ABC transporter B family member 1...    112   2e-24   Glycine max [soybeans]
emb|CDY00109.1|  BnaC09g01920D                                          112   2e-24   
gb|KHG20565.1|  ABC transporter B family member 19                      112   3e-24   Gossypium arboreum [tree cotton]
gb|KJB33609.1|  hypothetical protein B456_006G021600                    112   3e-24   Gossypium raimondii
ref|XP_007032497.1|  ATP binding cassette subfamily B19 isoform 1       112   3e-24   
ref|XP_011098607.1|  PREDICTED: ABC transporter B family member 19      112   3e-24   Sesamum indicum [beniseed]
ref|XP_006435210.1|  hypothetical protein CICLE_v10000054mg             111   4e-24   Citrus clementina [clementine]
gb|KDO84908.1|  hypothetical protein CISIN_1g000851mg                   111   4e-24   Citrus sinensis [apfelsine]
ref|XP_007032498.1|  ATP binding cassette subfamily B19 isoform 2       111   4e-24   
ref|XP_006473687.1|  PREDICTED: ABC transporter B family member 1...    111   5e-24   Citrus sinensis [apfelsine]
ref|XP_009111610.1|  PREDICTED: ABC transporter B family member 1...    111   5e-24   Brassica rapa
emb|CDY20012.1|  BnaA09g02390D                                          111   5e-24   Brassica napus [oilseed rape]
emb|CAN71068.1|  hypothetical protein VITISV_031708                     111   7e-24   Vitis vinifera
ref|XP_008230752.1|  PREDICTED: ABC transporter B family member 19      110   7e-24   Prunus mume [ume]
ref|XP_007217651.1|  hypothetical protein PRUPE_ppa000359mg             110   7e-24   Prunus persica
gb|KJB11390.1|  hypothetical protein B456_001G256100                    110   7e-24   Gossypium raimondii
gb|KHG22495.1|  ABC transporter B family member 19                      110   8e-24   Gossypium arboreum [tree cotton]
ref|XP_002962569.1|  ATP-binding cassette transporter                   110   8e-24   
ref|XP_006431131.1|  hypothetical protein CICLE_v10010931mg             110   8e-24   Citrus clementina [clementine]
ref|XP_006482578.1|  PREDICTED: ABC transporter B family member 1...    110   8e-24   Citrus sinensis [apfelsine]
gb|KDO72551.1|  hypothetical protein CISIN_1g000856mg                   110   8e-24   Citrus sinensis [apfelsine]
ref|XP_002283051.2|  PREDICTED: ABC transporter B family member 19      110   9e-24   Vitis vinifera
gb|KJB63497.1|  hypothetical protein B456_010G002700                    110   1e-23   Gossypium raimondii
ref|XP_010552950.1|  PREDICTED: ABC transporter B family member 1...    110   1e-23   Tarenaya hassleriana [spider flower]
ref|XP_008379345.1|  PREDICTED: ABC transporter B family member 19      110   1e-23   
emb|CBI22189.3|  unnamed protein product                                110   1e-23   Vitis vinifera
ref|XP_002517493.1|  multidrug resistance protein 1, 2, putative        110   1e-23   Ricinus communis
ref|XP_003543769.1|  PREDICTED: ABC transporter B family member 1...    110   1e-23   Glycine max [soybeans]
ref|XP_002279471.2|  PREDICTED: ABC transporter B family member 1...    110   1e-23   Vitis vinifera
ref|XP_003554410.1|  PREDICTED: ABC transporter B family member 1...    110   1e-23   Glycine max [soybeans]
gb|KDO84910.1|  hypothetical protein CISIN_1g000851mg                   109   2e-23   Citrus sinensis [apfelsine]
ref|XP_006338462.1|  PREDICTED: ABC transporter B family member 1...    109   2e-23   Solanum tuberosum [potatoes]
ref|XP_007151220.1|  hypothetical protein PHAVU_004G027800g             109   2e-23   Phaseolus vulgaris [French bean]
ref|NP_001234209.1|  L04                                                109   2e-23   Solanum lycopersicum
ref|XP_011008935.1|  PREDICTED: ABC transporter B family member 19      109   2e-23   Populus euphratica
gb|ABX82929.1|  LO4                                                     109   2e-23   Solanum pennellii
ref|XP_002323847.1|  multidrug resistance P-glycoprotein                109   2e-23   Populus trichocarpa [western balsam poplar]
ref|XP_006827168.1|  hypothetical protein AMTR_s00010p00254310          109   2e-23   Amborella trichopoda
ref|XP_010439800.1|  PREDICTED: ABC transporter B family member 1...    109   3e-23   
ref|XP_001759716.1|  ATP-binding cassette transporter, subfamily ...    109   3e-23   
ref|XP_006306598.1|  hypothetical protein CARUB_v10008102mg             108   4e-23   
ref|XP_010108971.1|  ABC transporter B family member 19                 108   4e-23   Morus notabilis
ref|XP_009758464.1|  PREDICTED: ABC transporter B family member 19      108   4e-23   Nicotiana sylvestris
ref|XP_009591470.1|  PREDICTED: ABC transporter B family member 19      108   4e-23   Nicotiana tomentosiformis
gb|KEH24996.1|  ABC transporter B family protein                        108   4e-23   Medicago truncatula
gb|AAP72956.1|  putative MDR-like P-glycoprotein                        108   4e-23   Lactuca sativa [cultivated lettuce]
ref|XP_004489384.1|  PREDICTED: ABC transporter B family member 1...    108   5e-23   Cicer arietinum [garbanzo]
gb|KCW51753.1|  hypothetical protein EUGRSUZ_J01214                     108   6e-23   Eucalyptus grandis [rose gum]
ref|XP_010032346.1|  PREDICTED: ABC transporter B family member 19      108   6e-23   Eucalyptus grandis [rose gum]
ref|XP_004136487.1|  PREDICTED: ABC transporter B family member 1...    108   6e-23   
ref|XP_010693227.1|  PREDICTED: ABC transporter B family member 19      108   7e-23   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010266821.1|  PREDICTED: ABC transporter B family member 1...    107   8e-23   Nelumbo nucifera [Indian lotus]
gb|KGN60047.1|  hypothetical protein Csa_3G873270                       107   8e-23   Cucumis sativus [cucumbers]
gb|AIU41631.1|  ABC transporter family protein                          107   1e-22   Hevea brasiliensis [jebe]
ref|XP_004164800.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    107   1e-22   
ref|XP_010069803.1|  PREDICTED: ABC transporter B family member 1...    107   1e-22   Eucalyptus grandis [rose gum]
ref|XP_009415585.1|  PREDICTED: ABC transporter B family member 19      107   1e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008459308.1|  PREDICTED: ABC transporter B family member 19      107   2e-22   Cucumis melo [Oriental melon]
ref|XP_004148691.1|  PREDICTED: ABC transporter B family member 1...    107   2e-22   
ref|XP_009395922.1|  PREDICTED: ABC transporter B family member 1...    107   2e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008788471.1|  PREDICTED: ABC transporter B family member 1...    107   2e-22   
ref|XP_010256924.1|  PREDICTED: ABC transporter B family member 19      106   2e-22   Nelumbo nucifera [Indian lotus]
ref|XP_008341564.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    106   2e-22   
ref|XP_009347047.1|  PREDICTED: ABC transporter B family member 19      106   2e-22   Pyrus x bretschneideri [bai li]
gb|KGN52452.1|  Multidrug resistance protein 1, 2                       106   3e-22   Cucumis sativus [cucumbers]
ref|XP_010554005.1|  PREDICTED: ABC transporter B family member 1...    106   3e-22   Tarenaya hassleriana [spider flower]
ref|XP_004304313.1|  PREDICTED: ABC transporter B family member 19      106   3e-22   Fragaria vesca subsp. vesca
ref|XP_011094609.1|  PREDICTED: ABC transporter B family member 1...    105   6e-22   Sesamum indicum [beniseed]
ref|XP_009334844.1|  PREDICTED: ABC transporter B family member 1...    105   6e-22   
ref|XP_010939542.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    105   7e-22   Elaeis guineensis
dbj|BAK05967.1|  predicted protein                                      105   8e-22   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KDP45498.1|  hypothetical protein JCGZ_09747                         105   8e-22   Jatropha curcas
ref|XP_008387923.1|  PREDICTED: ABC transporter B family member 1...    104   1e-21   Malus domestica [apple tree]
ref|XP_009339152.1|  PREDICTED: ABC transporter B family member 1...    104   1e-21   Pyrus x bretschneideri [bai li]
ref|XP_004304461.2|  PREDICTED: ABC transporter B family member 1       104   1e-21   Fragaria vesca subsp. vesca
ref|XP_004173028.1|  PREDICTED: ABC transporter B family member 1...    103   1e-21   
ref|XP_004494063.1|  PREDICTED: ABC transporter B family member 1...    104   1e-21   
gb|KEH42187.1|  ABC transporter B family protein                        104   1e-21   Medicago truncatula
gb|AFP44695.1|  hypothetical protein                                    104   1e-21   Eragrostis tef [tef]
gb|KHG13479.1|  ABC transporter B family member 13                      104   1e-21   Gossypium arboreum [tree cotton]
ref|XP_008369562.1|  PREDICTED: ABC transporter B family member 1...    103   2e-21   
ref|NP_001052982.1|  Os04g0459000                                       103   2e-21   
ref|XP_010234205.1|  PREDICTED: ABC transporter B family member 1       103   2e-21   Brachypodium distachyon [annual false brome]
ref|XP_006652374.1|  PREDICTED: ABC transporter B family member 1...    103   2e-21   Oryza brachyantha
ref|XP_009339155.1|  PREDICTED: ABC transporter B family member 1       103   3e-21   Pyrus x bretschneideri [bai li]
ref|XP_006843046.1|  hypothetical protein AMTR_s00076p00195870          103   3e-21   Amborella trichopoda
ref|NP_001169660.1|  uncharacterized protein LOC100383541               103   3e-21   Zea mays [maize]
ref|XP_009376834.1|  PREDICTED: ABC transporter B family member 1...    103   4e-21   Pyrus x bretschneideri [bai li]
ref|XP_009377013.1|  PREDICTED: ABC transporter B family member 1       102   4e-21   Pyrus x bretschneideri [bai li]
ref|XP_002447959.1|  hypothetical protein SORBIDRAFT_06g018860          102   4e-21   Sorghum bicolor [broomcorn]
gb|AES71643.2|  transporter ABC domain protein                          102   4e-21   Medicago truncatula
ref|XP_004975845.1|  PREDICTED: ABC transporter B family member 1...    102   5e-21   Setaria italica
ref|XP_008442711.1|  PREDICTED: ABC transporter B family member 1...  98.2    5e-21   Cucumis melo [Oriental melon]
dbj|BAD12940.1|  putative P-glycoprotein 1                              102   5e-21   Oryza sativa Japonica Group [Japonica rice]
gb|EEE69159.1|  hypothetical protein OsJ_28307                          102   5e-21   Oryza sativa Japonica Group [Japonica rice]
gb|EEC84043.1|  hypothetical protein OsI_30303                          102   5e-21   Oryza sativa Indica Group [Indian rice]
ref|NP_001288986.1|  ABC transporter B family member 1                  102   6e-21   Brassica rapa
emb|CDY46744.1|  BnaA03g16880D                                          102   6e-21   Brassica napus [oilseed rape]
ref|XP_003579896.1|  PREDICTED: ABC transporter B family member 1...    102   6e-21   Brachypodium distachyon [annual false brome]
ref|XP_010937072.1|  PREDICTED: ABC transporter B family member 19      102   6e-21   Elaeis guineensis
ref|XP_008804465.1|  PREDICTED: ABC transporter B family member 1...    102   7e-21   Phoenix dactylifera
ref|XP_009133103.1|  PREDICTED: ABC transporter B family member 1       102   7e-21   Brassica rapa
ref|XP_004977001.1|  PREDICTED: ABC transporter B family member 1...    102   7e-21   Setaria italica
gb|AFP44681.1|  hypothetical protein                                    102   7e-21   Eragrostis tef [tef]
ref|XP_006410867.1|  hypothetical protein EUTSA_v10016150mg             102   8e-21   
emb|CDX79704.1|  BnaC03g20400D                                          102   8e-21   
gb|KHN02316.1|  ABC transporter B family member 1                       102   8e-21   Glycine soja [wild soybean]
ref|XP_011077318.1|  PREDICTED: ABC transporter B family member 1       102   9e-21   Sesamum indicum [beniseed]
ref|XP_008442707.1|  PREDICTED: ABC transporter B family member 1...  97.8    9e-21   Cucumis melo [Oriental melon]
ref|XP_003625677.1|  ABC transporter-like protein                       100   1e-20   
ref|XP_004499289.1|  PREDICTED: ABC transporter B family member 1...    101   1e-20   Cicer arietinum [garbanzo]
ref|XP_010101619.1|  ABC transporter B family member 1                  101   1e-20   
ref|XP_008789538.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    101   1e-20   
gb|KFK36572.1|  hypothetical protein AALP_AA4G140900                    101   1e-20   Arabis alpina [alpine rockcress]
dbj|BAJ96840.1|  predicted protein                                      101   1e-20   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003554389.1|  PREDICTED: ABC transporter B family member 1...    101   1e-20   Glycine max [soybeans]
gb|EYU29874.1|  hypothetical protein MIMGU_mgv1a000299mg                101   1e-20   
ref|XP_008663648.1|  PREDICTED: ABC transporter B family member 1...    100   2e-20   
ref|XP_002448624.1|  hypothetical protein SORBIDRAFT_06g030350          100   2e-20   
ref|XP_008668793.1|  PREDICTED: ABC transporter B family member 1...    100   2e-20   
gb|AES81895.2|  ABC transporter B family protein                        100   2e-20   
gb|KJB16771.1|  hypothetical protein B456_002G246800                    100   2e-20   
ref|XP_004137839.1|  PREDICTED: ABC transporter B family member 1...    100   2e-20   
ref|XP_007204682.1|  hypothetical protein PRUPE_ppa000269mg             100   2e-20   
ref|XP_006660395.1|  PREDICTED: ABC transporter B family member 1...    100   2e-20   
emb|CAD59582.1|  MDR-like ABC transporter                               100   2e-20   
emb|CDY18472.1|  BnaA04g21150D                                          100   2e-20   
ref|XP_004173771.1|  PREDICTED: ABC transporter B family member 1...  97.4    2e-20   
emb|CAC09461.2|  H0423H10.7                                             100   2e-20   
emb|CDY27649.1|  BnaA09g27580D                                          100   2e-20   
ref|XP_008241411.1|  PREDICTED: ABC transporter B family member 1       100   2e-20   
emb|CAD59580.1|  MDR-like ABC transporter                               100   2e-20   
ref|NP_001054045.1|  Os04g0642000                                     99.4    3e-20   
ref|XP_010940643.1|  PREDICTED: ABC transporter B family member 1...    100   3e-20   
ref|XP_003541417.1|  PREDICTED: ABC transporter B family member 1...    100   3e-20   
ref|XP_002445666.1|  hypothetical protein SORBIDRAFT_07g023730          100   3e-20   
ref|XP_010505240.1|  PREDICTED: ABC transporter B family member 1       100   3e-20   
ref|XP_008387548.1|  PREDICTED: ABC transporter B family member 1       100   3e-20   
gb|KHN39417.1|  ABC transporter B family member 13                      100   3e-20   
ref|XP_010516925.1|  PREDICTED: ABC transporter B family member 1...    100   3e-20   
gb|KDP29159.1|  hypothetical protein JCGZ_16548                         100   4e-20   
ref|XP_009141619.1|  PREDICTED: ABC transporter B family member 1       100   4e-20   
ref|XP_002266505.1|  PREDICTED: ABC transporter B family member 1       100   4e-20   
dbj|BAG91391.1|  unnamed protein product                              99.0    4e-20   
ref|XP_002879630.1|  ATPGP1                                           99.8    4e-20   
ref|XP_010935700.1|  PREDICTED: ABC transporter B family member 1...  99.8    4e-20   
ref|XP_009396182.1|  PREDICTED: ABC transporter B family member 1...  99.8    4e-20   
ref|XP_003579371.1|  PREDICTED: ABC transporter B family member 1...  99.8    4e-20   
gb|KHG30028.1|  ABC transporter B family member 1                     99.8    5e-20   
gb|EMT07148.1|  ABC transporter B family member 19                    99.8    5e-20   
ref|XP_010509416.1|  PREDICTED: ABC transporter B family member 1...  99.8    5e-20   
ref|XP_008784383.1|  PREDICTED: ABC transporter B family member 19    99.8    5e-20   
ref|XP_008800555.1|  PREDICTED: ABC transporter B family member 1...  99.4    6e-20   
gb|AIU41628.1|  ABC transporter family protein                        99.4    6e-20   
emb|CBI19899.3|  unnamed protein product                              99.0    7e-20   
ref|XP_011018746.1|  PREDICTED: ABC transporter B family member 1     99.4    7e-20   
ref|XP_006293439.1|  hypothetical protein CARUB_v10022511mg           99.4    7e-20   
dbj|BAJ99824.1|  predicted protein                                    99.4    7e-20   
ref|XP_010530473.1|  PREDICTED: ABC transporter B family member 1     99.0    8e-20   
gb|KHN12634.1|  ABC transporter B family member 13                    99.0    8e-20   
ref|XP_003535149.1|  PREDICTED: ABC transporter B family member 1...  99.0    9e-20   
ref|XP_011013349.1|  PREDICTED: ABC transporter B family member 1...  99.0    9e-20   
ref|XP_010666235.1|  PREDICTED: ABC transporter B family member 1...  98.6    1e-19   
gb|KHN09525.1|  ABC transporter B family member 1                     99.0    1e-19   
ref|XP_004497537.1|  PREDICTED: ABC transporter B family member 1...  99.0    1e-19   
ref|XP_003520656.1|  PREDICTED: ABC transporter B family member 1...  98.6    1e-19   
ref|XP_010460562.1|  PREDICTED: ABC transporter B family member 1...  98.6    1e-19   
gb|AAW56857.1|  unknown protein                                       95.1    1e-19   
ref|XP_002323485.2|  P glycoprotein1                                  98.6    1e-19   
ref|XP_010271028.1|  PREDICTED: ABC transporter B family member 2...  98.6    1e-19   
ref|XP_002519488.1|  multidrug resistance protein 1, 2, putative      98.2    1e-19   
ref|XP_007162774.1|  hypothetical protein PHAVU_001G179300g           98.2    2e-19   
ref|XP_006381407.1|  P glycoprotein1                                  98.2    2e-19   
gb|KJB36510.1|  hypothetical protein B456_006G163000                  97.8    2e-19   
ref|XP_002314333.2|  hypothetical protein POPTR_0010s00540g           98.2    2e-19   
ref|XP_004974253.1|  PREDICTED: ABC transporter B family member 1...  98.2    2e-19   
gb|KGN58982.1|  Multidrug resistance protein 1, 2                     97.8    2e-19   
ref|NP_181228.1|  ABC transporter B family member 1                   97.8    2e-19   
gb|AAM98246.1|  putative ABC transporter                              97.8    2e-19   
gb|KHG25987.1|  ABC transporter B family member 1                     97.8    2e-19   
gb|KJB36509.1|  hypothetical protein B456_006G163000                  97.4    2e-19   
ref|XP_010499286.1|  PREDICTED: ABC transporter B family member 1...  97.4    3e-19   
ref|XP_010095132.1|  ABC transporter B family member 9                97.4    3e-19   
tpg|DAA48547.1|  TPA: hypothetical protein ZEAMMB73_189648            96.3    3e-19   
ref|XP_007154480.1|  hypothetical protein PHAVU_003G122400g           97.4    3e-19   
gb|AAR10387.1|  P-glycoprotein 1                                      97.4    3e-19   
ref|XP_007144334.1|  hypothetical protein PHAVU_007G147400g           97.1    4e-19   
ref|XP_010037650.1|  PREDICTED: ABC transporter B family member 1...  97.1    4e-19   
ref|XP_003601392.1|  ABC transporter B family member                  97.1    4e-19   
ref|XP_010037649.1|  PREDICTED: ABC transporter B family member 1...  97.1    4e-19   
ref|XP_009395305.1|  PREDICTED: ABC transporter B family member 1...  97.1    4e-19   
ref|XP_001775250.1|  ATP-binding cassette transporter, subfamily ...  97.1    4e-19   
gb|EYU38561.1|  hypothetical protein MIMGU_mgv1a000268mg              96.7    5e-19   
gb|EMT32511.1|  ABC transporter B family member 19                    96.7    5e-19   
ref|XP_004508078.1|  PREDICTED: ABC transporter B family member 2...  96.7    5e-19   
gb|KHN45005.1|  ABC transporter B family member 11                    96.7    5e-19   
ref|XP_006594002.1|  PREDICTED: ABC transporter B family member 1...  96.7    6e-19   
ref|XP_009609959.1|  PREDICTED: ABC transporter B family member 1     96.7    6e-19   
gb|AAR00316.1|  PGP1                                                  96.3    6e-19   
ref|XP_008645880.1|  PREDICTED: uncharacterized protein LOC100384...  96.3    6e-19   
ref|XP_008673955.1|  PREDICTED: ABC transporter B family member 2...  96.3    7e-19   
ref|XP_010478145.1|  PREDICTED: ABC transporter B family member 1...  96.3    7e-19   
ref|XP_010684039.1|  PREDICTED: ABC transporter B family member 1     95.9    9e-19   
gb|KHN45006.1|  ABC transporter B family member 11                    95.9    9e-19   
ref|XP_006594001.1|  PREDICTED: ABC transporter B family member 2...  95.9    9e-19   
ref|XP_004246624.1|  PREDICTED: ABC transporter B family member 1     95.9    1e-18   
ref|XP_007027419.1|  ATP binding cassette subfamily B1 isoform 1      95.9    1e-18   
emb|CAD59581.1|  MDR-like ABC transporter                             95.5    1e-18   
emb|CDP05476.1|  unnamed protein product                              95.5    1e-18   
ref|XP_002519337.1|  multidrug resistance protein 1, 2, putative      95.5    1e-18   
ref|NP_001062529.2|  Os08g0564300                                     94.7    2e-18   
ref|XP_003550577.1|  PREDICTED: ABC transporter B family member 1...  94.7    2e-18   
gb|KHN45492.1|  ABC transporter B family member 19                    94.7    2e-18   
ref|XP_007032499.1|  ATP binding cassette subfamily B19 isoform 3     94.7    2e-18   
emb|CAD59590.1|  MDR-like ABC transporter                             94.0    3e-18   
gb|EAY96476.1|  hypothetical protein OsI_18374                        94.0    4e-18   
ref|XP_010241797.1|  PREDICTED: ABC transporter B family member 1     94.0    4e-18   
emb|CDP20011.1|  unnamed protein product                              94.0    4e-18   
ref|XP_002457701.1|  hypothetical protein SORBIDRAFT_03g011860        94.0    4e-18   
ref|XP_009789853.1|  PREDICTED: ABC transporter B family member 1...  94.0    4e-18   
ref|XP_010999324.1|  PREDICTED: ABC transporter B family member 4...  93.6    5e-18   
ref|XP_002986365.1|  ATP-binding cassette transporter                 93.6    5e-18   
ref|XP_006354367.1|  PREDICTED: ABC transporter B family member 1     93.6    5e-18   
ref|NP_001275319.1|  P-glycoprotein                                   93.6    5e-18   
ref|XP_006428358.1|  hypothetical protein CICLE_v10010916mg           93.6    6e-18   
gb|KDO51694.1|  hypothetical protein CISIN_1g000687mg                 93.6    6e-18   
ref|XP_010690905.1|  PREDICTED: ABC transporter B family member 1...  93.6    6e-18   
gb|KDO51692.1|  hypothetical protein CISIN_1g000687mg                 93.6    6e-18   
ref|XP_007154481.1|  hypothetical protein PHAVU_003G122500g           93.2    9e-18   
ref|XP_010267196.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...  92.8    9e-18   
ref|XP_010938901.1|  PREDICTED: ABC transporter B family member 4...  92.8    1e-17   
ref|XP_003609885.1|  ABC transporter B family member                  92.8    1e-17   
gb|KEH32389.1|  ABC transporter B family protein                      92.8    1e-17   
ref|XP_004963620.1|  PREDICTED: ABC transporter B family member 4...  92.4    1e-17   
ref|XP_010688391.1|  PREDICTED: ABC transporter B family member 1...  92.4    1e-17   
ref|XP_003567552.1|  PREDICTED: ABC transporter B family member 2...  92.4    1e-17   
ref|XP_003566602.1|  PREDICTED: ABC transporter B family member 4     92.4    1e-17   
ref|XP_002992781.1|  hypothetical protein SELMODRAFT_236608           92.0    2e-17   
ref|XP_002988703.1|  hypothetical protein SELMODRAFT_184079           92.0    2e-17   
ref|XP_011079475.1|  PREDICTED: ABC transporter B family member 4...  92.0    2e-17   
ref|XP_008654439.1|  PREDICTED: uncharacterized protein LOC100194...  92.0    2e-17   
emb|CAD59586.1|  MDR-like ABC transporter                             92.0    2e-17   
ref|XP_004969643.1|  PREDICTED: ABC transporter B family member 4...  92.0    2e-17   
ref|XP_002872874.1|  P-glycoprotein 5                                 92.0    2e-17   
ref|XP_008778177.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...  91.7    2e-17   
ref|XP_011040252.1|  PREDICTED: ABC transporter B family member 1...  92.0    2e-17   
gb|EAY75483.1|  hypothetical protein OsI_03383                        91.7    2e-17   
ref|XP_004967616.1|  PREDICTED: ABC transporter B family member 2...  91.7    2e-17   
ref|XP_008439691.1|  PREDICTED: ABC transporter B family member 9     91.7    2e-17   
ref|XP_004134559.1|  PREDICTED: ABC transporter B family member 9...  91.7    2e-17   
gb|AES73698.2|  transporter ABC domain protein                        91.7    2e-17   
ref|XP_004155533.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...  91.7    2e-17   
ref|XP_010938828.1|  PREDICTED: ABC transporter B family member 2...  91.7    3e-17   
ref|XP_003603447.1|  ABC transporter B family member                  91.3    3e-17   
ref|XP_002519336.1|  multidrug resistance protein 1, 2, putative      91.3    3e-17   
dbj|BAA96612.1|  putative CjMDR1                                      91.3    3e-17   
ref|XP_010938829.1|  PREDICTED: ABC transporter B family member 4...  91.3    3e-17   
ref|XP_008676311.1|  PREDICTED: ABC transporter B family member 4...  90.9    4e-17   
gb|ABG56413.1|  MDR-like ABC transporter                              91.3    4e-17   
ref|XP_009121075.1|  PREDICTED: ABC transporter B family member 5...  90.9    4e-17   
ref|XP_002994484.1|  hypothetical protein SELMODRAFT_138662           90.9    4e-17   
gb|AES64094.2|  ABC transporter B family protein                      90.9    4e-17   
ref|XP_003593843.1|  ABC transporter B family member                  90.5    4e-17   
ref|XP_004166183.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...  90.9    5e-17   
ref|XP_010522857.1|  PREDICTED: ABC transporter B family member 1...  90.5    5e-17   
emb|CAA75922.1|  P-glycoprotein-like protein                          90.5    6e-17   
ref|XP_010667802.1|  PREDICTED: ABC transporter B family member 9     90.5    6e-17   
ref|XP_008445963.1|  PREDICTED: ABC transporter B family member 4...  90.1    7e-17   
gb|KEH30666.1|  ABC transporter B family protein                      90.1    7e-17   
ref|XP_009385386.1|  PREDICTED: ABC transporter B family member 4...  90.1    7e-17   
gb|EPS68527.1|  hypothetical protein M569_06241                       87.4    7e-17   
emb|CDP17032.1|  unnamed protein product                              90.1    8e-17   
ref|XP_003607429.1|  ABC transporter B family member                  90.1    8e-17   
ref|XP_009385385.1|  PREDICTED: ABC transporter B family member 4...  90.1    8e-17   
ref|XP_010091424.1|  ABC transporter B family member 11               90.1    9e-17   
ref|XP_002320939.2|  hypothetical protein POPTR_0014s10870g           89.7    9e-17   
dbj|BAD07905.1|  putative MDR-like ABC transporter                    89.4    9e-17   
gb|AES59767.2|  ABC transporter B family protein                      89.7    9e-17   
ref|XP_004135527.1|  PREDICTED: ABC transporter B family member 4...  89.7    9e-17   
ref|XP_006844278.1|  hypothetical protein AMTR_s00145p00075460        89.7    1e-16   
ref|XP_006847022.1|  hypothetical protein AMTR_s00017p00164980        89.7    1e-16   
ref|XP_006375419.1|  multidrug resistant ABC transporter family p...  89.7    1e-16   
ref|XP_010098744.1|  ABC transporter B family member 11               89.7    1e-16   
ref|XP_004508079.1|  PREDICTED: ABC transporter B family member 2...  89.7    1e-16   
ref|XP_004508080.1|  PREDICTED: ABC transporter B family member 2...  89.7    1e-16   
ref|XP_002519759.1|  multidrug resistance protein 1, 2, putative      89.7    1e-16   
ref|XP_010045610.1|  PREDICTED: ABC transporter B family member 1...  89.7    1e-16   
ref|XP_003591310.1|  ABC transporter B family member                  89.7    1e-16   
ref|XP_003589516.1|  ABC transporter B family member                  89.7    1e-16   
ref|XP_011016204.1|  PREDICTED: ABC transporter B family member 2...  89.4    1e-16   
ref|XP_006355579.1|  PREDICTED: ABC transporter B family member 9...  89.4    1e-16   
ref|XP_007214562.1|  hypothetical protein PRUPE_ppa000338mg           89.4    2e-16   
gb|AES64104.2|  ABC transporter B family-like protein                 89.4    2e-16   
ref|XP_002515186.1|  multidrug resistance protein 1, 2, putative      89.0    2e-16   
ref|NP_192091.1|  ABC transporter B family member 3                   89.0    2e-16   
ref|XP_004495861.1|  PREDICTED: ABC transporter B family member 2...  89.0    2e-16   
gb|EYU46880.1|  hypothetical protein MIMGU_mgv1a000319mg              89.0    2e-16   
ref|XP_011005962.1|  PREDICTED: ABC transporter B family member 1...  88.6    2e-16   
ref|XP_004165322.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...  88.6    2e-16   
ref|XP_002988424.1|  hypothetical protein SELMODRAFT_235518           88.6    2e-16   
emb|CDX67881.1|  BnaA07g19210D                                        88.6    3e-16   
ref|XP_002519757.1|  multidrug resistance protein 1, 2, putative      88.6    3e-16   
ref|XP_009104372.1|  PREDICTED: ABC transporter B family member 21    88.6    3e-16   
ref|XP_006396374.1|  hypothetical protein EUTSA_v10029333mg           87.4    3e-16   
ref|XP_002301550.2|  hypothetical protein POPTR_0002s18850g           88.2    3e-16   
ref|XP_010241454.1|  PREDICTED: ABC transporter B family member 1...  88.2    3e-16   
ref|XP_009414924.1|  PREDICTED: ABC transporter B family member 1...  88.2    3e-16   
ref|XP_011005954.1|  PREDICTED: ABC transporter B family member 4...  88.2    3e-16   
ref|XP_007221461.1|  hypothetical protein PRUPE_ppa000313mg           88.2    3e-16   
ref|XP_008227785.1|  PREDICTED: ABC transporter B family member 1...  88.2    3e-16   
ref|XP_002979718.1|  ATP-binding cassette transporter                 87.8    3e-16   
ref|XP_009417523.1|  PREDICTED: ABC transporter B family member 4...  88.2    3e-16   
gb|KCW87514.1|  hypothetical protein EUGRSUZ_B03963                   88.2    3e-16   
ref|XP_011040312.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...  88.2    3e-16   
ref|XP_002979856.1|  ATP-binding cassette transporter                 87.8    4e-16   
emb|CDP05479.1|  unnamed protein product                              87.8    4e-16   
emb|CDY25095.1|  BnaC06g18370D                                        87.8    4e-16   
ref|XP_008225385.1|  PREDICTED: ABC transporter B family member 9     87.8    4e-16   
ref|XP_007159375.1|  hypothetical protein PHAVU_002G233000g           87.8    4e-16   
emb|CDY51560.1|  BnaCnng20890D                                        87.8    5e-16   
ref|XP_006840349.1|  hypothetical protein AMTR_s00045p00108620        87.8    5e-16   
ref|XP_010905014.1|  PREDICTED: ABC transporter B family member 1...  87.4    5e-16   
ref|XP_010045640.1|  PREDICTED: ABC transporter B family member 1...  87.4    5e-16   
ref|XP_002456200.1|  hypothetical protein SORBIDRAFT_03g032030        87.4    5e-16   
ref|XP_004297068.1|  PREDICTED: ABC transporter B family member 4...  87.4    5e-16   
ref|XP_004304810.1|  PREDICTED: ABC transporter B family member 4...  87.4    6e-16   
ref|XP_011467146.1|  PREDICTED: ABC transporter B family member 1...  87.4    6e-16   
ref|XP_010045629.1|  PREDICTED: ABC transporter B family member 1...  87.4    6e-16   
ref|XP_008798883.1|  PREDICTED: ABC transporter B family member 2...  87.0    7e-16   
ref|XP_010905016.1|  PREDICTED: ABC transporter B family member 2...  87.0    7e-16   
gb|EMS57842.1|  ABC transporter B family member 19                    87.0    8e-16   
ref|XP_004253158.1|  PREDICTED: ABC transporter B family member 1...  87.0    8e-16   
ref|XP_006597506.1|  PREDICTED: ABC transporter B family member 9...  87.0    8e-16   
gb|KCW88641.1|  hypothetical protein EUGRSUZ_A01006                   87.0    8e-16   
ref|XP_003547192.1|  PREDICTED: ABC transporter B family member 9...  87.0    8e-16   
ref|XP_006597505.1|  PREDICTED: ABC transporter B family member 9...  87.0    8e-16   
ref|XP_006597507.1|  PREDICTED: ABC transporter B family member 9...  87.0    8e-16   



>emb|CDP13052.1| unnamed protein product [Coffea canephora]
Length=1261

 Score =   192 bits (488),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 88/103 (85%), Positives = 96/103 (93%), Gaps = 0/103 (0%)
 Frame = +2

Query  362  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  541
            L+KLF FAD  DY LMFVG +GACVHGASVPVFF+FFGK+ID+IG A+LFPAEASHKV K
Sbjct  34   LIKLFKFADAYDYFLMFVGAIGACVHGASVPVFFIFFGKMIDIIGLAYLFPAEASHKVGK  93

Query  542  YSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            YSLDFVYLS+VILFSSWTEVACWMHTGERQAAKMRMAYLR+ML
Sbjct  94   YSLDFVYLSVVILFSSWTEVACWMHTGERQAAKMRMAYLRAML  136



>ref|XP_004512509.1| PREDICTED: ABC transporter B family member 2-like [Cicer arietinum]
Length=1237

 Score =   189 bits (481),  Expect = 3e-51, Method: Composition-based stats.
 Identities = 85/103 (83%), Positives = 97/103 (94%), Gaps = 0/103 (0%)
 Frame = +2

Query  362  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  541
            L+KLF+FAD  DYVLMF+G +GAC+HGASVPVFF+FFGK+I+VIG A+LFP EASH+VAK
Sbjct  18   LLKLFTFADSYDYVLMFIGSIGACIHGASVPVFFIFFGKLINVIGLAYLFPKEASHEVAK  77

Query  542  YSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            YS+DFVYLSI ILFSSWTEVACWMHTGERQAAKMRMAYL+SML
Sbjct  78   YSMDFVYLSIAILFSSWTEVACWMHTGERQAAKMRMAYLKSML  120



>ref|XP_003628784.1| ABC transporter B family member [Medicago truncatula]
 gb|AET03260.1| ABC transporter transmembrane region protein [Medicago truncatula]
Length=488

 Score =   184 bits (466),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 86/103 (83%), Positives = 95/103 (92%), Gaps = 0/103 (0%)
 Frame = +2

Query  362  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  541
            L+KLFSFAD  DYVLM VG VGAC+HGASVPVFF+FFGKII+V+G A+LFP EASH+VAK
Sbjct  13   LLKLFSFADFYDYVLMAVGSVGACIHGASVPVFFIFFGKIINVVGLAYLFPKEASHQVAK  72

Query  542  YSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            Y+LDFVYLSI+ILFSSW EVACWMHTGERQ AKMRMAYLRSML
Sbjct  73   YALDFVYLSIIILFSSWAEVACWMHTGERQVAKMRMAYLRSML  115



>gb|KDO53158.1| hypothetical protein CISIN_1g0008302mg, partial [Citrus sinensis]
 gb|KDO53159.1| hypothetical protein CISIN_1g0008302mg, partial [Citrus sinensis]
 gb|KDO53160.1| hypothetical protein CISIN_1g0008302mg, partial [Citrus sinensis]
Length=179

 Score =   175 bits (443),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            SL KLF+FAD  DY+LM +G +GACVHG SVPVFF+FFGK+I++IG A+LFP  ASHKVA
Sbjct  42   SLFKLFAFADFYDYILMSLGSIGACVHGVSVPVFFIFFGKLINIIGLAYLFPKTASHKVA  101

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            KYSLDFVYLS+ ILFSSW EV+CWM+TGERQAAKMRMAYLRSML
Sbjct  102  KYSLDFVYLSVAILFSSWIEVSCWMYTGERQAAKMRMAYLRSML  145



>ref|XP_003612850.1| ABC transporter B family member [Medicago truncatula]
 gb|AES95808.1| ABC transporter B family-like protein [Medicago truncatula]
Length=1234

 Score =   189 bits (480),  Expect = 6e-51, Method: Composition-based stats.
 Identities = 86/104 (83%), Positives = 97/104 (93%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            S++KLFSFAD  DYVLMF+G +GA VHGASVP+FF+FFGK+I+VIG A+LFP EASHKVA
Sbjct  16   SMLKLFSFADSYDYVLMFIGSIGAIVHGASVPIFFIFFGKLINVIGLAYLFPKEASHKVA  75

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            KYSLDFVYLS+ ILFSSWTEVACWMHTGERQAAKMRMAYL+SML
Sbjct  76   KYSLDFVYLSVAILFSSWTEVACWMHTGERQAAKMRMAYLKSML  119



>ref|XP_006432794.1| hypothetical protein CICLE_v100000601mg, partial [Citrus clementina]
 gb|ESR46034.1| hypothetical protein CICLE_v100000601mg, partial [Citrus clementina]
Length=179

 Score =   175 bits (443),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            SL KLF+FAD  DY+LM +G +GACVHG SVPVFF+FFGK+I++IG A+LFP  ASHKVA
Sbjct  42   SLFKLFAFADFYDYILMSLGSIGACVHGVSVPVFFIFFGKLINIIGLAYLFPKTASHKVA  101

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            KYSLDFVYLS+ ILFSSW EV+CWM+TGERQAAKMRMAYLRSML
Sbjct  102  KYSLDFVYLSVAILFSSWIEVSCWMYTGERQAAKMRMAYLRSML  145



>ref|XP_008373592.1| PREDICTED: ABC transporter B family member 2-like [Malus domestica]
Length=1261

 Score =   189 bits (479),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 86/104 (83%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            SL+KLFSFAD  DY+LM VG VGACVHGASVP+FF+FFGK+I++IG A+LFP EAS KVA
Sbjct  42   SLLKLFSFADSYDYLLMAVGSVGACVHGASVPIFFIFFGKLINIIGXAYLFPKEASSKVA  101

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            KYSLDFVYLS+ ILFSSWTEVACWMHTGERQAAKMRMAYLR+ML
Sbjct  102  KYSLDFVYLSVAILFSSWTEVACWMHTGERQAAKMRMAYLRAML  145



>gb|KHN04865.1| ABC transporter B family member 2 [Glycine soja]
Length=1246

 Score =   187 bits (475),  Expect = 2e-50, Method: Composition-based stats.
 Identities = 90/104 (87%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            SL+KLFSFAD  DYVLM VG VGA VHGASVPVFF+FFGK+I+VIG A+LFP EASHKVA
Sbjct  26   SLLKLFSFADFYDYVLMGVGSVGAIVHGASVPVFFIFFGKLINVIGLAYLFPKEASHKVA  85

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            KYSLDFVYLSI ILFSSWTEVACWMHTGERQAAKMRMAYL+SML
Sbjct  86   KYSLDFVYLSIAILFSSWTEVACWMHTGERQAAKMRMAYLKSML  129



>ref|XP_003517674.1| PREDICTED: ABC transporter B family member 2-like [Glycine max]
Length=1246

 Score =   187 bits (475),  Expect = 2e-50, Method: Composition-based stats.
 Identities = 90/104 (87%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            SL+KLFSFAD  DYVLM VG VGA VHGASVPVFF+FFGK+I+VIG A+LFP EASHKVA
Sbjct  26   SLLKLFSFADFYDYVLMGVGSVGAIVHGASVPVFFIFFGKLINVIGLAYLFPKEASHKVA  85

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            KYSLDFVYLSI ILFSSWTEVACWMHTGERQAAKMRMAYL+SML
Sbjct  86   KYSLDFVYLSIAILFSSWTEVACWMHTGERQAAKMRMAYLKSML  129



>ref|XP_011082358.1| PREDICTED: ABC transporter B family member 2-like [Sesamum indicum]
Length=1260

 Score =   187 bits (475),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/103 (83%), Positives = 96/103 (93%), Gaps = 0/103 (0%)
 Frame = +2

Query  362  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  541
            L KLF+FADG DY LMFVG VGACVHGASVPVFF+FFG++I++IG A+LFP EASHKVA 
Sbjct  42   LRKLFAFADGYDYFLMFVGSVGACVHGASVPVFFIFFGQLINIIGLAYLFPKEASHKVAM  101

Query  542  YSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            YSLDFVYLSIVI+FSSWTEVACWMH+GERQAAKMRMAYL+SML
Sbjct  102  YSLDFVYLSIVIMFSSWTEVACWMHSGERQAAKMRMAYLKSML  144



>ref|XP_003533440.1| PREDICTED: ABC transporter B family member 2-like [Glycine max]
Length=1245

 Score =   187 bits (475),  Expect = 3e-50, Method: Composition-based stats.
 Identities = 90/104 (87%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            SL+KLFSFAD  DYVLM VG VGA VHGASVPVFF+FFGK+I+VIG A+LFP EASHKVA
Sbjct  26   SLLKLFSFADFYDYVLMGVGSVGAIVHGASVPVFFIFFGKLINVIGLAYLFPKEASHKVA  85

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            KYSLDFVYLSI ILFSSWTEVACWMHTGERQAAKMRMAYL+SML
Sbjct  86   KYSLDFVYLSIAILFSSWTEVACWMHTGERQAAKMRMAYLKSML  129



>ref|XP_009371200.1| PREDICTED: ABC transporter B family member 2-like [Pyrus x bretschneideri]
Length=1261

 Score =   187 bits (474),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 86/103 (83%), Positives = 95/103 (92%), Gaps = 0/103 (0%)
 Frame = +2

Query  362  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  541
            L+KLFSFAD  DY+LM VG VGACVHGASVPVFF+FFGK+I++IG A+LFP EAS KVAK
Sbjct  43   LLKLFSFADSYDYLLMAVGSVGACVHGASVPVFFIFFGKLINIIGMAYLFPKEASSKVAK  102

Query  542  YSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            YSLDFVYLS+ ILFSSWTEVACWMHTGERQAAKMRMAYLR+ML
Sbjct  103  YSLDFVYLSVAILFSSWTEVACWMHTGERQAAKMRMAYLRAML  145



>ref|XP_007210429.1| hypothetical protein PRUPE_ppa000340mg [Prunus persica]
 gb|EMJ11628.1| hypothetical protein PRUPE_ppa000340mg [Prunus persica]
Length=1267

 Score =   187 bits (474),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 86/104 (83%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            SL+KLFSFAD  DY LM +G VGACVHGASVPVFF+FFGK+I++IG A+LFP EAS KVA
Sbjct  48   SLLKLFSFADSYDYFLMAIGSVGACVHGASVPVFFIFFGKLINIIGMAYLFPKEASSKVA  107

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            KYSLDFVYLS+ ILFSSWTEVACWMHTGERQAAKMRMAYLR+ML
Sbjct  108  KYSLDFVYLSVAILFSSWTEVACWMHTGERQAAKMRMAYLRAML  151



>ref|XP_008238211.1| PREDICTED: ABC transporter B family member 2-like [Prunus mume]
Length=1271

 Score =   186 bits (471),  Expect = 9e-50, Method: Composition-based stats.
 Identities = 86/104 (83%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            SL+KLFSFAD  DY LM +G VGACVHGASVPVFF+FFGK+I++IG A+LFP EAS KVA
Sbjct  49   SLLKLFSFADSYDYFLMAIGSVGACVHGASVPVFFIFFGKLINIIGMAYLFPKEASSKVA  108

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            KYSLDFVYLS+ ILFSSWTEVACWMHTGERQAAKMRMAYLR+ML
Sbjct  109  KYSLDFVYLSVAILFSSWTEVACWMHTGERQAAKMRMAYLRAML  152



>ref|XP_010096959.1| ABC transporter B family member 2 [Morus notabilis]
 gb|EXB66536.1| ABC transporter B family member 2 [Morus notabilis]
Length=945

 Score =   183 bits (465),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/104 (81%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            SL+KLF+FAD  D VLM +G +GAC+HGASVP+FF+FFG++I+VIG A+LFP EASHKVA
Sbjct  33   SLLKLFTFADFYDCVLMAIGSIGACIHGASVPIFFIFFGQLINVIGMAYLFPKEASHKVA  92

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            KYSLDFVYLSI ILFSSWTEVACWMHTGERQAAKMRMAYLR+ML
Sbjct  93   KYSLDFVYLSIAILFSSWTEVACWMHTGERQAAKMRMAYLRAML  136



>ref|XP_010055294.1| PREDICTED: ABC transporter B family member 2-like isoform X1 
[Eucalyptus grandis]
 gb|KCW71762.1| hypothetical protein EUGRSUZ_E00260 [Eucalyptus grandis]
Length=1255

 Score =   184 bits (467),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            SL+KLFSFAD  D VLM VG VGACVHG SVPVFF+FFGK+I+VIG A+LFP EASHKVA
Sbjct  38   SLLKLFSFADFYDCVLMAVGSVGACVHGVSVPVFFIFFGKLINVIGMAYLFPKEASHKVA  97

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            KYSLDFVYLS+ ILFSSW EVACWMHTGERQAAKMRMAYLRSML
Sbjct  98   KYSLDFVYLSVAILFSSWIEVACWMHTGERQAAKMRMAYLRSML  141



>ref|XP_007158282.1| hypothetical protein PHAVU_002G139400g [Phaseolus vulgaris]
 gb|ESW30276.1| hypothetical protein PHAVU_002G139400g [Phaseolus vulgaris]
Length=1245

 Score =   184 bits (467),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 86/104 (83%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            S++KLFSFAD  D VLM +G VGAC+HGASVPVFF+FFGK+I+VIG A+LFP EASHKVA
Sbjct  24   SILKLFSFADFYDCVLMTIGSVGACIHGASVPVFFIFFGKLINVIGLAYLFPKEASHKVA  83

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            KYSLDFVYLSI ILFSSW EVACWMHTGERQAAKMRMAYL+SML
Sbjct  84   KYSLDFVYLSIAILFSSWAEVACWMHTGERQAAKMRMAYLKSML  127



>gb|KHN30010.1| ABC transporter B family member 2 [Glycine soja]
Length=1253

 Score =   184 bits (466),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 87/102 (85%), Positives = 94/102 (92%), Gaps = 0/102 (0%)
 Frame = +2

Query  365  MKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKY  544
            +KLFSFAD  D VLM +G VGACVHGASVPVFFVFFGKII+VIG A+LFP EASH+V+KY
Sbjct  23   LKLFSFADFYDCVLMAIGTVGACVHGASVPVFFVFFGKIINVIGLAYLFPKEASHEVSKY  82

Query  545  SLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            +LDFVYLSI ILFSSWTEVACWMHTGERQAAKMRMAYLRSML
Sbjct  83   ALDFVYLSIAILFSSWTEVACWMHTGERQAAKMRMAYLRSML  124



>ref|XP_006585887.1| PREDICTED: ABC transporter B family member 2-like [Glycine max]
Length=1254

 Score =   183 bits (465),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 87/102 (85%), Positives = 94/102 (92%), Gaps = 0/102 (0%)
 Frame = +2

Query  365  MKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKY  544
            +KLFSFAD  D VLM +G VGACVHGASVPVFFVFFGKII+VIG A+LFP EASH+V+KY
Sbjct  23   LKLFSFADFYDCVLMAIGTVGACVHGASVPVFFVFFGKIINVIGLAYLFPKEASHEVSKY  82

Query  545  SLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            +LDFVYLSI ILFSSWTEVACWMHTGERQAAKMRMAYLRSML
Sbjct  83   ALDFVYLSIAILFSSWTEVACWMHTGERQAAKMRMAYLRSML  124



>ref|XP_009764894.1| PREDICTED: ABC transporter B family member 2-like [Nicotiana 
sylvestris]
Length=1260

 Score =   183 bits (465),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 84/104 (81%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            SL+KLFSFAD  DY LMF G +GACVHGASVPVFF+FFGK+I++IG A+LFPAE SHKVA
Sbjct  32   SLLKLFSFADVYDYFLMFFGSIGACVHGASVPVFFIFFGKLINIIGLAYLFPAETSHKVA  91

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            KY+LDFVYLS+V+LFSSW EVACWMH+GERQAAKMRMAYL+SML
Sbjct  92   KYALDFVYLSVVVLFSSWIEVACWMHSGERQAAKMRMAYLKSML  135



>ref|XP_004301784.1| PREDICTED: ABC transporter B family member 2-like [Fragaria vesca 
subsp. vesca]
Length=1261

 Score =   183 bits (465),  Expect = 6e-49, Method: Composition-based stats.
 Identities = 86/103 (83%), Positives = 94/103 (91%), Gaps = 0/103 (0%)
 Frame = +2

Query  362  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  541
            L+KLFSFAD  D VLM +G VGACVHGASVPVFF+FFGK+I++IG A+LFP EAS KVAK
Sbjct  47   LLKLFSFADSYDCVLMAIGSVGACVHGASVPVFFIFFGKLINIIGLAYLFPKEASSKVAK  106

Query  542  YSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            YSLDFVYLSI ILFSSWTEVACWMHTGERQAAKMRMAYLR+ML
Sbjct  107  YSLDFVYLSIAILFSSWTEVACWMHTGERQAAKMRMAYLRAML  149



>ref|XP_007156412.1| hypothetical protein PHAVU_003G283900g [Phaseolus vulgaris]
 gb|ESW28406.1| hypothetical protein PHAVU_003G283900g [Phaseolus vulgaris]
Length=1235

 Score =   183 bits (465),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 89/103 (86%), Positives = 95/103 (92%), Gaps = 0/103 (0%)
 Frame = +2

Query  362  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  541
            L+KLFSFAD  D VLM VG VGACVHGASVPVFFVFFGKII+VIG A+L P EASH+VAK
Sbjct  13   LLKLFSFADWYDCVLMGVGSVGACVHGASVPVFFVFFGKIINVIGFAYLSPKEASHEVAK  72

Query  542  YSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            Y+LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSM+
Sbjct  73   YALDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSMM  115



>gb|EYU34148.1| hypothetical protein MIMGU_mgv1a000301mg [Erythranthe guttata]
Length=1278

 Score =   183 bits (465),  Expect = 6e-49, Method: Composition-based stats.
 Identities = 84/104 (81%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            SL KLF+FAD  DY+LMFVG +GACVHGASVP+FF+FFGK+I++IG A+LFP EAS KVA
Sbjct  46   SLGKLFAFADSYDYLLMFVGSIGACVHGASVPIFFIFFGKLINIIGLAYLFPKEASSKVA  105

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
             YSLDFVYLSIVI+FSSWTEVACWMH+GERQAAKMRMAY+RSML
Sbjct  106  MYSLDFVYLSIVIMFSSWTEVACWMHSGERQAAKMRMAYVRSML  149



>gb|KJB51627.1| hypothetical protein B456_008G225400 [Gossypium raimondii]
Length=1248

 Score =   183 bits (464),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 85/103 (83%), Positives = 94/103 (91%), Gaps = 0/103 (0%)
 Frame = +2

Query  362  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  541
            L+KLFSFAD  DYVLM +G +GACVHGASVPVFF+FFGK+I+V G A+LFP EASHKVAK
Sbjct  31   LLKLFSFADIYDYVLMGLGSIGACVHGASVPVFFIFFGKLINVAGMAYLFPKEASHKVAK  90

Query  542  YSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            YSLDFVYLS+ ILFSSW EVACWMHTGERQAAKMRMAYL+SML
Sbjct  91   YSLDFVYLSVAILFSSWIEVACWMHTGERQAAKMRMAYLKSML  133



>gb|KJB21122.1| hypothetical protein B456_003G183800 [Gossypium raimondii]
Length=938

 Score =   181 bits (459),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 84/103 (82%), Positives = 95/103 (92%), Gaps = 0/103 (0%)
 Frame = +2

Query  362  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  541
            L+KLFSFAD  D+VLM +G +GACVHGASVPVFF+FFGK+I++IG A+LFP EASHKVAK
Sbjct  30   LLKLFSFADFYDHVLMGLGSLGACVHGASVPVFFIFFGKLINIIGMAYLFPKEASHKVAK  89

Query  542  YSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            YSLDFVYLS+ ILFSSW EVACWMHTGERQAAKMRMAYL+SML
Sbjct  90   YSLDFVYLSVAILFSSWIEVACWMHTGERQAAKMRMAYLKSML  132



>ref|XP_007040641.1| Multidrug/pheromone exporter, MDR family, ABC transporter family 
isoform 1 [Theobroma cacao]
 gb|EOY25142.1| Multidrug/pheromone exporter, MDR family, ABC transporter family 
isoform 1 [Theobroma cacao]
Length=1251

 Score =   182 bits (462),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 84/103 (82%), Positives = 95/103 (92%), Gaps = 0/103 (0%)
 Frame = +2

Query  362  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  541
            L+KLFSFAD  DYVLM +G +GACVHGASVPVFF+FFGK+I++IG A+LFP EASHKVAK
Sbjct  30   LLKLFSFADFYDYVLMALGSLGACVHGASVPVFFIFFGKLINIIGMAYLFPKEASHKVAK  89

Query  542  YSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            YSLDFVYLS+ ILFSSW EVACWMHTGERQAAK+RMAYL+SML
Sbjct  90   YSLDFVYLSVAILFSSWIEVACWMHTGERQAAKIRMAYLKSML  132



>gb|KJB21124.1| hypothetical protein B456_003G183800 [Gossypium raimondii]
Length=1249

 Score =   182 bits (462),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 84/103 (82%), Positives = 95/103 (92%), Gaps = 0/103 (0%)
 Frame = +2

Query  362  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  541
            L+KLFSFAD  D+VLM +G +GACVHGASVPVFF+FFGK+I++IG A+LFP EASHKVAK
Sbjct  30   LLKLFSFADFYDHVLMGLGSLGACVHGASVPVFFIFFGKLINIIGMAYLFPKEASHKVAK  89

Query  542  YSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            YSLDFVYLS+ ILFSSW EVACWMHTGERQAAKMRMAYL+SML
Sbjct  90   YSLDFVYLSVAILFSSWIEVACWMHTGERQAAKMRMAYLKSML  132



>gb|AAF23176.1|AF216497_1 P-glycoprotein [Gossypium hirsutum]
Length=1249

 Score =   182 bits (462),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 84/103 (82%), Positives = 95/103 (92%), Gaps = 0/103 (0%)
 Frame = +2

Query  362  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  541
            L+KLFSFAD  D+VLM +G +GACVHGASVPVFF+FFGK+I++IG A+LFP EASHKVAK
Sbjct  30   LLKLFSFADFYDHVLMGLGSLGACVHGASVPVFFIFFGKLINIIGMAYLFPKEASHKVAK  89

Query  542  YSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            YSLDFVYLS+ ILFSSW EVACWMHTGERQAAKMRMAYL+SML
Sbjct  90   YSLDFVYLSVAILFSSWIEVACWMHTGERQAAKMRMAYLKSML  132



>ref|XP_007040642.1| Multidrug/pheromone exporter, MDR family, ABC transporter family 
isoform 2, partial [Theobroma cacao]
 gb|EOY25143.1| Multidrug/pheromone exporter, MDR family, ABC transporter family 
isoform 2, partial [Theobroma cacao]
Length=1075

 Score =   181 bits (460),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/103 (82%), Positives = 95/103 (92%), Gaps = 0/103 (0%)
 Frame = +2

Query  362  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  541
            L+KLFSFAD  DYVLM +G +GACVHGASVPVFF+FFGK+I++IG A+LFP EASHKVAK
Sbjct  30   LLKLFSFADFYDYVLMALGSLGACVHGASVPVFFIFFGKLINIIGMAYLFPKEASHKVAK  89

Query  542  YSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            YSLDFVYLS+ ILFSSW EVACWMHTGERQAAK+RMAYL+SML
Sbjct  90   YSLDFVYLSVAILFSSWIEVACWMHTGERQAAKIRMAYLKSML  132



>gb|KJB21121.1| hypothetical protein B456_003G183800 [Gossypium raimondii]
Length=1281

 Score =   182 bits (461),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/103 (82%), Positives = 95/103 (92%), Gaps = 0/103 (0%)
 Frame = +2

Query  362  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  541
            L+KLFSFAD  D+VLM +G +GACVHGASVPVFF+FFGK+I++IG A+LFP EASHKVAK
Sbjct  62   LLKLFSFADFYDHVLMGLGSLGACVHGASVPVFFIFFGKLINIIGMAYLFPKEASHKVAK  121

Query  542  YSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            YSLDFVYLS+ ILFSSW EVACWMHTGERQAAKMRMAYL+SML
Sbjct  122  YSLDFVYLSVAILFSSWIEVACWMHTGERQAAKMRMAYLKSML  164



>ref|XP_009595706.1| PREDICTED: ABC transporter B family member 2-like [Nicotiana 
tomentosiformis]
Length=1256

 Score =   182 bits (461),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            SL+KLFSFAD  DY LMF G +GACVHGASVPVFF+FFGK+I++IG A+LFPAE SHKVA
Sbjct  28   SLLKLFSFADVYDYFLMFFGSIGACVHGASVPVFFIFFGKLINIIGLAYLFPAETSHKVA  87

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            KY+LDFVYLS+V+LFSSW EVACWMH+GERQAAKMRMAYL+S+L
Sbjct  88   KYALDFVYLSVVVLFSSWIEVACWMHSGERQAAKMRMAYLKSIL  131



>ref|XP_004245909.2| PREDICTED: ABC transporter B family member 2-like [Solanum lycopersicum]
Length=1257

 Score =   181 bits (460),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 97/104 (93%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            SL+KLFSFAD  DY+LMF+G +GAC+HGASVPVFF+FFGK+I++ G A+LFPA+ SHK+A
Sbjct  39   SLLKLFSFADSYDYLLMFLGSIGACLHGASVPVFFIFFGKMINIAGLAYLFPAQTSHKIA  98

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            KYSLDFVYLS+VILF+SW EVACWMH+GERQAAK+RMAYL+SML
Sbjct  99   KYSLDFVYLSVVILFASWIEVACWMHSGERQAAKIRMAYLKSML  142



>ref|XP_006352948.1| PREDICTED: ABC transporter B family member 2-like [Solanum tuberosum]
Length=1257

 Score =   181 bits (460),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            SL+KLFSFAD  DY+LM +G +GAC+HGASVPVFF+FFGK+I++ G A+LFPA+ SHKVA
Sbjct  39   SLLKLFSFADSYDYLLMILGSIGACLHGASVPVFFIFFGKMINIAGLAYLFPAQTSHKVA  98

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            KYSLDFVYLS+VILFSSW EVACWMH+GERQAAK+RMAYL+SML
Sbjct  99   KYSLDFVYLSVVILFSSWIEVACWMHSGERQAAKIRMAYLKSML  142



>gb|KJB21123.1| hypothetical protein B456_003G183800 [Gossypium raimondii]
Length=1219

 Score =   181 bits (459),  Expect = 3e-48, Method: Composition-based stats.
 Identities = 84/103 (82%), Positives = 95/103 (92%), Gaps = 0/103 (0%)
 Frame = +2

Query  362  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  541
            L+KLFSFAD  D+VLM +G +GACVHGASVPVFF+FFGK+I++IG A+LFP EASHKVAK
Sbjct  30   LLKLFSFADFYDHVLMGLGSLGACVHGASVPVFFIFFGKLINIIGMAYLFPKEASHKVAK  89

Query  542  YSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            YSLDFVYLS+ ILFSSW EVACWMHTGERQAAKMRMAYL+SML
Sbjct  90   YSLDFVYLSVAILFSSWIEVACWMHTGERQAAKMRMAYLKSML  132



>ref|XP_002892589.1| P-glycoprotein 10 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68848.1| P-glycoprotein 10 [Arabidopsis lyrata subsp. lyrata]
Length=1229

 Score =   181 bits (459),  Expect = 3e-48, Method: Composition-based stats.
 Identities = 84/104 (81%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            S +KLFSFAD  D VLM +G +GAC+HGASVPVFF+FFGK+I++IG A+LFP EASHKVA
Sbjct  26   SFLKLFSFADFYDCVLMALGSIGACIHGASVPVFFIFFGKLINIIGLAYLFPQEASHKVA  85

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            KYSLDFVYLS+VILFSSW EVACWMHTGERQAAKMR AYLRSML
Sbjct  86   KYSLDFVYLSVVILFSSWLEVACWMHTGERQAAKMRKAYLRSML  129



>gb|EPS64351.1| hypothetical protein M569_10429, partial [Genlisea aurea]
Length=1241

 Score =   181 bits (459),  Expect = 3e-48, Method: Composition-based stats.
 Identities = 84/104 (81%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            S++KLFSFADG D +LMF+G +GACVHGASVPVFFVFFGKII++IG A+LFP EA+ +VA
Sbjct  16   SILKLFSFADGYDCLLMFLGSIGACVHGASVPVFFVFFGKIINIIGLAYLFPKEAAPQVA  75

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            KYS+DFVYLS VIL SSWTEVACWMH+GERQAAKMRMAYLRSML
Sbjct  76   KYSIDFVYLSAVILLSSWTEVACWMHSGERQAAKMRMAYLRSML  119



>ref|XP_010458427.1| PREDICTED: ABC transporter B family member 10-like [Camelina 
sativa]
Length=1226

 Score =   181 bits (459),  Expect = 3e-48, Method: Composition-based stats.
 Identities = 84/104 (81%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            S +KLFSFAD  D VLM +G +GAC+HGASVPVFF+FFGK+I++IG A+LFP EASHKVA
Sbjct  25   SFLKLFSFADFYDCVLMALGSIGACIHGASVPVFFIFFGKLINIIGLAYLFPREASHKVA  84

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            KYSLDFVYLS+VILFSSW EVACWMHTGERQAAKMR AYLRSML
Sbjct  85   KYSLDFVYLSVVILFSSWIEVACWMHTGERQAAKMRKAYLRSML  128



>ref|XP_010491749.1| PREDICTED: ABC transporter B family member 10 [Camelina sativa]
Length=1226

 Score =   181 bits (458),  Expect = 4e-48, Method: Composition-based stats.
 Identities = 84/104 (81%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            S +KLFSFAD  D VLM +G +GAC+HGASVPVFF+FFGK+I++IG A+LFP EASHKVA
Sbjct  25   SFLKLFSFADFYDCVLMALGSIGACIHGASVPVFFIFFGKLINIIGLAYLFPREASHKVA  84

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            KYSLDFVYLS+VILFSSW EVACWMHTGERQAAKMR AYLRSML
Sbjct  85   KYSLDFVYLSVVILFSSWIEVACWMHTGERQAAKMRKAYLRSML  128



>ref|XP_002277547.1| PREDICTED: ABC transporter B family member 2 [Vitis vinifera]
 emb|CBI33860.3| unnamed protein product [Vitis vinifera]
Length=1243

 Score =   181 bits (458),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 85/103 (83%), Positives = 94/103 (91%), Gaps = 0/103 (0%)
 Frame = +2

Query  362  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  541
            L+KLF+FAD  D  LM VG VGAC+HGASVPVFF+FFGK+ID+IG A+LFPA ASHKVAK
Sbjct  25   LLKLFAFADLYDCFLMAVGSVGACIHGASVPVFFIFFGKLIDIIGLAYLFPAAASHKVAK  84

Query  542  YSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            YSLDFVYLS+VILFSSW EVACWMHTGERQAAKMRMAY+RSML
Sbjct  85   YSLDFVYLSLVILFSSWAEVACWMHTGERQAAKMRMAYVRSML  127



>ref|XP_006417431.1| hypothetical protein EUTSA_v10009914mg [Eutrema salsugineum]
 gb|ESQ35784.1| hypothetical protein EUTSA_v10009914mg [Eutrema salsugineum]
Length=1226

 Score =   180 bits (456),  Expect = 9e-48, Method: Composition-based stats.
 Identities = 83/104 (80%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            S+ KLFSFAD  D VLM +G +GAC+HGASVPVFF+FFGK+I++IG A+LFP +ASHKVA
Sbjct  21   SVFKLFSFADFYDCVLMVLGSIGACIHGASVPVFFIFFGKLINIIGLAYLFPQQASHKVA  80

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            KYSLDFVYLS+VILFSSW EVACWMHTGERQAAKMR AYLRSML
Sbjct  81   KYSLDFVYLSVVILFSSWLEVACWMHTGERQAAKMRKAYLRSML  124



>ref|XP_006303653.1| hypothetical protein CARUB_v10011664mg [Capsella rubella]
 gb|EOA36551.1| hypothetical protein CARUB_v10011664mg [Capsella rubella]
Length=1229

 Score =   179 bits (455),  Expect = 1e-47, Method: Composition-based stats.
 Identities = 83/104 (80%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            S +KLFSFAD  D VLM +G + AC+HGASVPVFF+FFGK+I++IG A+LFP EASHKVA
Sbjct  26   SFLKLFSFADLYDCVLMALGSIAACIHGASVPVFFIFFGKLINIIGLAYLFPQEASHKVA  85

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            KYSLDFVYLS+VILFSSW EVACWMHTGERQAAKMR AYLRSML
Sbjct  86   KYSLDFVYLSVVILFSSWIEVACWMHTGERQAAKMRKAYLRSML  129



>ref|XP_010540773.1| PREDICTED: ABC transporter B family member 2-like [Tarenaya hassleriana]
Length=1250

 Score =   179 bits (455),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/104 (81%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            SL+KLFSFAD  DYVLM +G +GACVHGASVPVFF+FFGK+I++IG A+LFP EAS +VA
Sbjct  30   SLVKLFSFADFYDYVLMAIGSIGACVHGASVPVFFIFFGKLINIIGIAYLFPKEASPQVA  89

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            KYSLDFVYLS+ ILFSSW EVACWMHTGERQAAKMRMAYL SML
Sbjct  90   KYSLDFVYLSVAILFSSWIEVACWMHTGERQAAKMRMAYLSSML  133



>ref|NP_172538.1| ABC transporter B family member 10 [Arabidopsis thaliana]
 sp|Q9SGY1.2|AB10B_ARATH RecName: Full=ABC transporter B family member 10; Short=ABC transporter 
ABCB.10; Short=AtABCB10; AltName: Full=Multidrug 
resistance protein 10; AltName: Full=P-glycoprotein 10 [Arabidopsis 
thaliana]
 gb|AEE28628.1| ABC transporter B family member 10 [Arabidopsis thaliana]
Length=1227

 Score =   179 bits (454),  Expect = 1e-47, Method: Composition-based stats.
 Identities = 83/104 (80%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            S +KLFSFAD  D VLM +G +GAC+HGASVPVFF+FFGK+I++IG A+LFP EASHKVA
Sbjct  25   SFLKLFSFADFYDCVLMALGSIGACIHGASVPVFFIFFGKLINIIGLAYLFPQEASHKVA  84

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            KYSLDFVYLS+VILFSSW EVACWMHTGERQAAK+R AYLRSML
Sbjct  85   KYSLDFVYLSVVILFSSWLEVACWMHTGERQAAKIRKAYLRSML  128



>gb|AFW63453.1| hypothetical protein ZEAMMB73_169648 [Zea mays]
Length=208

 Score =   167 bits (423),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 89/102 (87%), Gaps = 0/102 (0%)
 Frame = +2

Query  365  MKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKY  544
            +KLFSFAD  D VLM VG +GAC HGASVPVFF+FFGK+I++IG A+LFP   S +VAKY
Sbjct  32   LKLFSFADRWDCVLMAVGSLGACAHGASVPVFFIFFGKLINIIGLAYLFPTTVSGRVAKY  91

Query  545  SLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            SLDFVYL IVI FSSWTEVACWMHTGERQAAKMR+AYLR+ML
Sbjct  92   SLDFVYLGIVIFFSSWTEVACWMHTGERQAAKMRLAYLRAML  133



>ref|XP_002869639.1| multidrug resistance protein 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45898.1| multidrug resistance protein 2 [Arabidopsis lyrata subsp. lyrata]
Length=1233

 Score =   179 bits (454),  Expect = 2e-47, Method: Composition-based stats.
 Identities = 82/104 (79%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            SL+KLFSFAD  D VLM +G VGAC+HGASVP+FF+FFGK+I++IG A+LFP +ASH+VA
Sbjct  21   SLLKLFSFADFYDCVLMTLGSVGACIHGASVPIFFIFFGKLINIIGLAYLFPKQASHRVA  80

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            KYSLDFVYLS+ ILFSSW EVACWMHTGERQAAKMR AYLRSML
Sbjct  81   KYSLDFVYLSVAILFSSWLEVACWMHTGERQAAKMRRAYLRSML  124



>ref|XP_011028150.1| PREDICTED: ABC transporter B family member 2-like isoform X1 
[Populus euphratica]
Length=1250

 Score =   179 bits (453),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            KLF+FAD  DYVLM +G +GACVHGASVPVFF+FFGK+I++IG A+LFP EASH+VAKYS
Sbjct  31   KLFAFADFYDYVLMGLGSLGACVHGASVPVFFIFFGKLINIIGLAYLFPKEASHRVAKYS  90

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            LDFVYLS+VILF+SW EVACWMHTGERQAAKMRMAYL+SML
Sbjct  91   LDFVYLSVVILFASWIEVACWMHTGERQAAKMRMAYLKSML  131



>gb|AAM20507.1| P-glycoprotein-2 [Arabidopsis thaliana]
Length=1233

 Score =   179 bits (453),  Expect = 2e-47, Method: Composition-based stats.
 Identities = 82/104 (79%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            SL+KLFSFAD  D VLM +G VGAC+HGASVP+FF+FFGK+I++IG A+LFP +ASH+VA
Sbjct  21   SLLKLFSFADFYDCVLMTLGSVGACIHGASVPIFFIFFGKLINIIGLAYLFPKQASHRVA  80

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            KYSLDFVYLS+ ILFSSW EVACWMHTGERQAAKMR AYLRSML
Sbjct  81   KYSLDFVYLSVAILFSSWLEVACWMHTGERQAAKMRRAYLRSML  124



>emb|CAA71277.1| P-glycoprotein-2 [Arabidopsis thaliana]
 emb|CAA71276.1| P-glycoprotein-2 [Arabidopsis thaliana]
 emb|CAB39661.1| P-glycoprotein-2 (pgp2) [Arabidopsis thaliana]
 emb|CAB79451.1| P-glycoprotein-2 (pgp2) [Arabidopsis thaliana]
Length=1233

 Score =   179 bits (453),  Expect = 2e-47, Method: Composition-based stats.
 Identities = 82/104 (79%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            SL+KLFSFAD  D VLM +G VGAC+HGASVP+FF+FFGK+I++IG A+LFP +ASH+VA
Sbjct  21   SLLKLFSFADFYDCVLMTLGSVGACIHGASVPIFFIFFGKLINIIGLAYLFPKQASHRVA  80

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            KYSLDFVYLS+ ILFSSW EVACWMHTGERQAAKMR AYLRSML
Sbjct  81   KYSLDFVYLSVAILFSSWLEVACWMHTGERQAAKMRRAYLRSML  124



>ref|XP_006282856.1| hypothetical protein CARUB_v10006816mg, partial [Capsella rubella]
 gb|EOA15754.1| hypothetical protein CARUB_v10006816mg, partial [Capsella rubella]
Length=1239

 Score =   178 bits (452),  Expect = 3e-47, Method: Composition-based stats.
 Identities = 81/104 (78%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            SL+KLFSFAD  D VLM +G +GAC+HGASVP+FF+FFGK+I++IG A+LFP +ASH+VA
Sbjct  29   SLLKLFSFADFYDCVLMTLGSIGACIHGASVPIFFIFFGKLINIIGLAYLFPKQASHRVA  88

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            KYSLDFVYLS+ ILFSSW EVACWMHTGERQAAKMR AYLRSML
Sbjct  89   KYSLDFVYLSVAILFSSWLEVACWMHTGERQAAKMRRAYLRSML  132



>ref|XP_010436379.1| PREDICTED: ABC transporter B family member 2 [Camelina sativa]
Length=1222

 Score =   178 bits (452),  Expect = 3e-47, Method: Composition-based stats.
 Identities = 81/104 (78%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            SL+KLFSFAD  D VLM +G +GAC+HGASVP+FF+FFGK+I++IG A+LFP +ASH+VA
Sbjct  19   SLLKLFSFADFYDCVLMTLGSIGACIHGASVPIFFIFFGKLINIIGLAYLFPKQASHRVA  78

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            KYSLDFVYLS+ ILFSSW EVACWMHTGERQAAKMR AYLRSML
Sbjct  79   KYSLDFVYLSVAILFSSWLEVACWMHTGERQAAKMRRAYLRSML  122



>gb|KFK43347.1| hypothetical protein AALP_AA1G113900 [Arabis alpina]
Length=1230

 Score =   178 bits (451),  Expect = 3e-47, Method: Composition-based stats.
 Identities = 80/104 (77%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            S+ KLFSFAD  D +LM +G +GAC+HGASVPVFF+FFGK+I++IG A+ FP EASHKVA
Sbjct  24   SMFKLFSFADFYDCILMALGSIGACIHGASVPVFFIFFGKLINIIGLAYFFPQEASHKVA  83

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            KYSLDFVYLS+V+LFSSW EVACWMHTGERQAAKMR AY+RSML
Sbjct  84   KYSLDFVYLSVVVLFSSWIEVACWMHTGERQAAKMRKAYIRSML  127



>ref|XP_010538383.1| PREDICTED: ABC transporter B family member 2-like [Tarenaya hassleriana]
Length=1256

 Score =   178 bits (451),  Expect = 4e-47, Method: Composition-based stats.
 Identities = 84/104 (81%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            SL+KLFSFAD  DYVLM VG +GACVHGASVPVFF+FFGK+I++IG A+LFP +AS +VA
Sbjct  32   SLVKLFSFADFYDYVLMAVGSMGACVHGASVPVFFIFFGKLINIIGIAYLFPKQASPQVA  91

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            KYSLDFVYLS+ ILFSSW EVACWMHTGERQAAKMR AYLRSML
Sbjct  92   KYSLDFVYLSVAILFSSWIEVACWMHTGERQAAKMRRAYLRSML  135



>gb|AAF17668.1|AC009398_17 F20B24.12 [Arabidopsis thaliana]
Length=1316

 Score =   178 bits (451),  Expect = 4e-47, Method: Composition-based stats.
 Identities = 83/104 (80%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            S +KLFSFAD  D VLM +G +GAC+HGASVPVFF+FFGK+I++IG A+LFP EASHKVA
Sbjct  25   SFLKLFSFADFYDCVLMALGSIGACIHGASVPVFFIFFGKLINIIGLAYLFPQEASHKVA  84

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            KYSLDFVYLS+VILFSSW EVACWMHTGERQAAK+R AYLRSML
Sbjct  85   KYSLDFVYLSVVILFSSWLEVACWMHTGERQAAKIRKAYLRSML  128



>ref|XP_003572841.1| PREDICTED: ABC transporter B family member 2-like [Brachypodium 
distachyon]
Length=1256

 Score =   178 bits (451),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = +2

Query  365  MKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKY  544
            +KLFSFAD  DYVLM VG +GAC HGASVPVFF+FFGK+I++IG A+LFP E S +VAKY
Sbjct  27   LKLFSFADRWDYVLMAVGSLGACAHGASVPVFFIFFGKLINIIGIAYLFPTEVSGRVAKY  86

Query  545  SLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            SLDFVYL +VILFSSWTEVACWMHTGERQAAKMR+AYLRSML
Sbjct  87   SLDFVYLGVVILFSSWTEVACWMHTGERQAAKMRLAYLRSML  128



>ref|NP_194326.2| P-glycoprotein 2 [Arabidopsis thaliana]
 sp|Q8LPK2.3|AB2B_ARATH RecName: Full=ABC transporter B family member 2; Short=ABC transporter 
ABCB.2; Short=AtABCB2; AltName: Full=Multidrug resistance 
protein 2; AltName: Full=P-glycoprotein 2; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAE99138.1| P-glycoprotein-2 [Arabidopsis thaliana]
 gb|AEE85137.1| P-glycoprotein 2 [Arabidopsis thaliana]
Length=1273

 Score =   178 bits (451),  Expect = 4e-47, Method: Composition-based stats.
 Identities = 82/104 (79%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            SL+KLFSFAD  D VLM +G VGAC+HGASVP+FF+FFGK+I++IG A+LFP +ASH+VA
Sbjct  61   SLLKLFSFADFYDCVLMTLGSVGACIHGASVPIFFIFFGKLINIIGLAYLFPKQASHRVA  120

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            KYSLDFVYLS+ ILFSSW EVACWMHTGERQAAKMR AYLRSML
Sbjct  121  KYSLDFVYLSVAILFSSWLEVACWMHTGERQAAKMRRAYLRSML  164



>ref|XP_006385671.1| hypothetical protein POPTR_0003s09320g [Populus trichocarpa]
 gb|ERP63468.1| hypothetical protein POPTR_0003s09320g [Populus trichocarpa]
Length=922

 Score =   177 bits (448),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            KLF+FAD  DYVLM +G +GACVHGASVPVFF+FFGK+I++IG A+LFP EASH+V KYS
Sbjct  31   KLFAFADFYDYVLMGLGSLGACVHGASVPVFFIFFGKLINIIGLAYLFPKEASHRVGKYS  90

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            LDFVYLS+VILF+SW EVACWMHTGERQAAKMRMAYL+SML
Sbjct  91   LDFVYLSVVILFASWIEVACWMHTGERQAAKMRMAYLKSML  131



>ref|XP_002304346.1| P-glycoprotein [Populus trichocarpa]
 gb|EEE79325.1| P-glycoprotein [Populus trichocarpa]
Length=1250

 Score =   177 bits (450),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            KLF+FAD  DYVLM +G +GACVHGASVPVFF+FFGK+I++IG A+LFP EASH+V KYS
Sbjct  31   KLFAFADFYDYVLMGLGSLGACVHGASVPVFFIFFGKLINIIGLAYLFPKEASHRVGKYS  90

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            LDFVYLS+VILF+SW EVACWMHTGERQAAKMRMAYL+SML
Sbjct  91   LDFVYLSVVILFASWIEVACWMHTGERQAAKMRMAYLKSML  131



>emb|CDY37953.1| BnaC05g08210D [Brassica napus]
Length=1225

 Score =   177 bits (450),  Expect = 6e-47, Method: Composition-based stats.
 Identities = 82/104 (79%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            S+ KLFSFAD  D VLM +G +GAC+HGASVPVFF+FFGK+I++IG A+LFP EASHKVA
Sbjct  24   SVFKLFSFADFYDCVLMTLGSIGACIHGASVPVFFIFFGKLINIIGLAYLFPQEASHKVA  83

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            KYSLDFVYLS+ ILFSSW EVACWMHTGERQAAK+R AYLRSML
Sbjct  84   KYSLDFVYLSVAILFSSWLEVACWMHTGERQAAKIRKAYLRSML  127



>ref|XP_006413247.1| hypothetical protein EUTSA_v10024237mg [Eutrema salsugineum]
 gb|ESQ54700.1| hypothetical protein EUTSA_v10024237mg [Eutrema salsugineum]
Length=1239

 Score =   177 bits (449),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 82/103 (80%), Positives = 93/103 (90%), Gaps = 0/103 (0%)
 Frame = +2

Query  362  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  541
            L+KLFSFAD  D VLM +G +GAC+HGASVPVFF+FFGK+I++IG A+LFP +ASHKVAK
Sbjct  26   LLKLFSFADFYDCVLMALGSIGACIHGASVPVFFIFFGKLINIIGLAYLFPHQASHKVAK  85

Query  542  YSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            YSLDFVYLS+ ILFSSW EVACWMHTGERQAAKMR AYLRSML
Sbjct  86   YSLDFVYLSVAILFSSWLEVACWMHTGERQAAKMRRAYLRSML  128



>ref|XP_008800115.1| PREDICTED: ABC transporter B family member 2-like [Phoenix dactylifera]
Length=1250

 Score =   177 bits (449),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = +2

Query  365  MKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKY  544
            +KLF+FAD  DY LM +G +GACVHGASVPVFF+FFGK+I++IG A+LFP   +H+VAKY
Sbjct  31   LKLFAFADAWDYFLMALGSIGACVHGASVPVFFIFFGKLINIIGIAYLFPTSVTHRVAKY  90

Query  545  SLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            SLDFVYL IVILFSSWTEVACWMHTGERQAAKMR+AYLRSML
Sbjct  91   SLDFVYLGIVILFSSWTEVACWMHTGERQAAKMRLAYLRSML  132



>emb|CDX93393.1| BnaA06g06550D [Brassica napus]
Length=1225

 Score =   177 bits (449),  Expect = 8e-47, Method: Composition-based stats.
 Identities = 82/104 (79%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            S+ KLFSFAD  D VLM +G +GAC+HGASVPVFF+FFGK+I++IG A+LFP EASHKVA
Sbjct  24   SVFKLFSFADFYDCVLMTLGSIGACIHGASVPVFFIFFGKLINIIGLAYLFPQEASHKVA  83

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            KYSLDFVYLS+ ILFSSW EVACWMHTGERQAAK+R AYLRSML
Sbjct  84   KYSLDFVYLSVAILFSSWLEVACWMHTGERQAAKIRKAYLRSML  127



>ref|XP_010677330.1| PREDICTED: ABC transporter B family member 2-like [Beta vulgaris 
subsp. vulgaris]
Length=1256

 Score =   177 bits (448),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 92/104 (88%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            S +KLF+FAD +DY+LMF G +GA  HGASVPVFF+FFGK+I++IG A+LFP E SH VA
Sbjct  40   SFLKLFTFADSLDYLLMFFGTIGAIAHGASVPVFFIFFGKLINLIGVAYLFPRETSHDVA  99

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            KYSLDFVYLS+VILFSSW EVACWM TGERQAAKMRMAYLRSML
Sbjct  100  KYSLDFVYLSVVILFSSWVEVACWMQTGERQAAKMRMAYLRSML  143



>ref|XP_009148411.1| PREDICTED: ABC transporter B family member 10 [Brassica rapa]
Length=1225

 Score =   176 bits (447),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 82/104 (79%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            S+ KLFSFAD  D VLM +G +GAC+HGASVPVFF+FFGK+I++IG A+LFP EASHKVA
Sbjct  24   SVFKLFSFADFYDCVLMTLGSIGACIHGASVPVFFIFFGKLINIIGLAYLFPQEASHKVA  83

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            KYSLDFVYLS+ ILFSSW EVACWMHTGERQAAK+R AYLRSML
Sbjct  84   KYSLDFVYLSVAILFSSWLEVACWMHTGERQAAKIRKAYLRSML  127



>ref|XP_009139729.1| PREDICTED: ABC transporter B family member 2 [Brassica rapa]
Length=1234

 Score =   176 bits (447),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 82/104 (79%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            SL+KLFSFAD  D VLM +G +GAC+HGASVPVFF+FFGK+I++IG A+L+P  ASHKVA
Sbjct  21   SLLKLFSFADFYDCVLMTLGSIGACIHGASVPVFFIFFGKLINIIGLAYLYPHLASHKVA  80

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            KYSLDFVYLS+ ILFSSW EVACWMHTGERQAAKMR AYLRSML
Sbjct  81   KYSLDFVYLSVAILFSSWLEVACWMHTGERQAAKMRRAYLRSML  124



>gb|KFK29108.1| hypothetical protein AALP_AA7G090300 [Arabis alpina]
Length=1235

 Score =   176 bits (447),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 80/104 (77%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            SL+KLFSFAD  D VLM +G +GAC+HGASVP+FF+FFGK+I++IG A+LFP E SH+VA
Sbjct  22   SLLKLFSFADFYDCVLMALGSIGACIHGASVPIFFIFFGKLINIIGVAYLFPKETSHQVA  81

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            KYSLDFVYLS+ ILFSSW EV+CWMHTGERQAAKMR AYLRSML
Sbjct  82   KYSLDFVYLSVAILFSSWLEVSCWMHTGERQAAKMRRAYLRSML  125



>ref|XP_010475946.1| PREDICTED: ABC transporter B family member 10-like [Camelina 
sativa]
Length=1224

 Score =   176 bits (447),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 83/104 (80%), Positives = 92/104 (88%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            S +KLFSFAD  D VLM +G  GAC+HGASVPVFF+FFGK+I++IG A+LFP EAS KVA
Sbjct  24   SFLKLFSFADFYDCVLMALGSTGACIHGASVPVFFIFFGKLINIIGLAYLFPQEASPKVA  83

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            KYSLDFVYLS+VILFSSW EVACWMHTGERQAAKMR AYLRSML
Sbjct  84   KYSLDFVYLSVVILFSSWIEVACWMHTGERQAAKMRKAYLRSML  127



>ref|XP_006471591.1| PREDICTED: ABC transporter B family member 2-like isoform X1 
[Citrus sinensis]
 ref|XP_006471592.1| PREDICTED: ABC transporter B family member 2-like isoform X2 
[Citrus sinensis]
Length=1265

 Score =   176 bits (447),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            SL KLF+FAD  DY+LM +G +GACVHG SVPVFF+FFGK+I++IG A+LFP  ASHKVA
Sbjct  42   SLFKLFAFADFYDYILMSLGSIGACVHGVSVPVFFIFFGKLINIIGLAYLFPKTASHKVA  101

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            KYSLDFVYLS+ ILFSSW EV+CWM+TGERQAAKMRMAYLRSML
Sbjct  102  KYSLDFVYLSVAILFSSWIEVSCWMYTGERQAAKMRMAYLRSML  145



>ref|XP_011018529.1| PREDICTED: ABC transporter B family member 2-like isoform X1 
[Populus euphratica]
Length=1249

 Score =   176 bits (447),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/103 (76%), Positives = 94/103 (91%), Gaps = 0/103 (0%)
 Frame = +2

Query  362  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  541
            L+KLF+FAD  D+VLM +G +GAC+HGASVPVFF++FGK+I++IG A+LFP + SHKVAK
Sbjct  35   LLKLFAFADFYDFVLMGLGSIGACIHGASVPVFFIYFGKLINIIGSAYLFPQQTSHKVAK  94

Query  542  YSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            YSLDF+YLS+ +LFSSWTEVACWMHTGERQAAKMRMAYL SML
Sbjct  95   YSLDFLYLSVAMLFSSWTEVACWMHTGERQAAKMRMAYLDSML  137



>ref|XP_011018530.1| PREDICTED: ABC transporter B family member 2-like isoform X2 
[Populus euphratica]
Length=1182

 Score =   176 bits (446),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 78/103 (76%), Positives = 94/103 (91%), Gaps = 0/103 (0%)
 Frame = +2

Query  362  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  541
            L+KLF+FAD  D+VLM +G +GAC+HGASVPVFF++FGK+I++IG A+LFP + SHKVAK
Sbjct  35   LLKLFAFADFYDFVLMGLGSIGACIHGASVPVFFIYFGKLINIIGSAYLFPQQTSHKVAK  94

Query  542  YSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            YSLDF+YLS+ +LFSSWTEVACWMHTGERQAAKMRMAYL SML
Sbjct  95   YSLDFLYLSVAMLFSSWTEVACWMHTGERQAAKMRMAYLDSML  137



>emb|CDX89380.1| BnaA01g15130D [Brassica napus]
Length=1275

 Score =   176 bits (446),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 82/104 (79%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            SL+KLFSFAD  D VLM +G +GAC+HGASVPVFF+FFGK+I++IG A+L+P  ASHKVA
Sbjct  62   SLLKLFSFADFYDCVLMTLGSIGACIHGASVPVFFIFFGKLINIIGLAYLYPHLASHKVA  121

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            KYSLDFVYLS+ ILFSSW EVACWMHTGERQAAKMR AYLRSML
Sbjct  122  KYSLDFVYLSVAILFSSWLEVACWMHTGERQAAKMRRAYLRSML  165



>emb|CDX94395.1| BnaC01g17890D [Brassica napus]
Length=1234

 Score =   176 bits (445),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 81/104 (78%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            SL+KLFSFAD  D VLM +G +GAC+HGASVP+FF+FFGK+I++IG A+L+P  ASHKVA
Sbjct  21   SLLKLFSFADFYDCVLMTLGSIGACIHGASVPIFFIFFGKLINIIGLAYLYPHLASHKVA  80

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            KYSLDFVYLS+ ILFSSW EVACWMHTGERQAAKMR AYLRSML
Sbjct  81   KYSLDFVYLSVAILFSSWLEVACWMHTGERQAAKMRRAYLRSML  124



>ref|NP_001047803.1| Os02g0693700 [Oryza sativa Japonica Group]
 emb|CAD59583.1| MDR-like ABC transporter [Oryza sativa Japonica Group]
 dbj|BAD07906.1| MDR-like ABC transporter [Oryza sativa Japonica Group]
 dbj|BAD07706.1| MDR-like ABC transporter [Oryza sativa Japonica Group]
 dbj|BAF09717.1| Os02g0693700 [Oryza sativa Japonica Group]
 gb|EEE57613.1| hypothetical protein OsJ_08005 [Oryza sativa Japonica Group]
Length=1264

 Score =   176 bits (445),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = +2

Query  365  MKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKY  544
            +KLFSFAD  DYVLM VG +GAC HGASVPVFF+FFGK+I++IG A+LFP   S +VAKY
Sbjct  38   LKLFSFADRWDYVLMAVGSLGACAHGASVPVFFIFFGKLINIIGLAYLFPTTVSGRVAKY  97

Query  545  SLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            SLDFVYL IVILFSSWTEVACWMHTGERQAAKMR AYLRSML
Sbjct  98   SLDFVYLGIVILFSSWTEVACWMHTGERQAAKMRQAYLRSML  139



>gb|EEC73824.1| hypothetical protein OsI_08549 [Oryza sativa Indica Group]
Length=1264

 Score =   176 bits (445),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = +2

Query  365  MKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKY  544
            +KLFSFAD  DYVLM VG +GAC HGASVPVFF+FFGK+I++IG A+LFP   S +VAKY
Sbjct  38   LKLFSFADRWDYVLMAVGSLGACAHGASVPVFFIFFGKLINIIGLAYLFPTTVSGRVAKY  97

Query  545  SLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            SLDFVYL IVILFSSWTEVACWMHTGERQAAKMR AYLRSML
Sbjct  98   SLDFVYLGIVILFSSWTEVACWMHTGERQAAKMRQAYLRSML  139



>ref|XP_009396844.1| PREDICTED: ABC transporter B family member 2-like [Musa acuminata 
subsp. malaccensis]
Length=1241

 Score =   176 bits (445),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = +2

Query  365  MKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKY  544
            +KLF+FAD  DY LM +G +GAC HGASVPVFF+FFGK+I++IG AFLFP   SH+VAKY
Sbjct  26   LKLFAFADTWDYFLMALGSIGACAHGASVPVFFIFFGKLINIIGVAFLFPTTVSHRVAKY  85

Query  545  SLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            SLDFVYL I ILFSSWTEVACWMHTGERQAAKMR+AYLRSML
Sbjct  86   SLDFVYLGIAILFSSWTEVACWMHTGERQAAKMRLAYLRSML  127



>ref|XP_002527657.1| multidrug resistance protein 1, 2, putative [Ricinus communis]
 gb|EEF34728.1| multidrug resistance protein 1, 2, putative [Ricinus communis]
Length=1156

 Score =   175 bits (443),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 92/104 (88%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            SL+KLF+FAD  DYVLM +G V A  HGASVPVFF+FFGK+I++IG A+LFP +ASH+VA
Sbjct  37   SLLKLFAFADLYDYVLMGLGSVAAIAHGASVPVFFIFFGKMINIIGLAYLFPQQASHRVA  96

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            KYSLDFVYLS+ ILFSSW EVACWMHTGERQA KMRMAYLRSML
Sbjct  97   KYSLDFVYLSVAILFSSWIEVACWMHTGERQATKMRMAYLRSML  140



>gb|EMS51604.1| ABC transporter B family member 2 [Triticum urartu]
Length=1214

 Score =   175 bits (443),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 83/102 (81%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = +2

Query  365  MKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKY  544
            MKLFSFAD  DYVLM VG VGAC HGASVPVFF+FFGK+I++IG A  FPA  S +VAKY
Sbjct  201  MKLFSFADRWDYVLMAVGSVGACAHGASVPVFFIFFGKLINIIGIASFFPAMVSGRVAKY  260

Query  545  SLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            SLDFVYL +VILFSSWTEVACWMHTGERQAAKMR+AYLRSML
Sbjct  261  SLDFVYLGVVILFSSWTEVACWMHTGERQAAKMRLAYLRSML  302



>ref|XP_010908483.1| PREDICTED: ABC transporter B family member 2-like [Elaeis guineensis]
Length=1249

 Score =   174 bits (442),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            S  KLF+FAD  DY LM +G +GACVHGASVPVFF+FFGK+I++IG A+LFP   +H+VA
Sbjct  29   SFFKLFAFADAWDYFLMALGSIGACVHGASVPVFFIFFGKLINIIGVAYLFPTSVTHRVA  88

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            KYSLDFVYL IVILFSSW EVACWMHTGERQAAKMR+AYLRSML
Sbjct  89   KYSLDFVYLGIVILFSSWIEVACWMHTGERQAAKMRLAYLRSML  132



>ref|XP_010240898.1| PREDICTED: ABC transporter B family member 2-like [Nelumbo nucifera]
Length=1246

 Score =   174 bits (441),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            KLFSFAD  DYVLMF+G VGACVHGASVPVFF+FFGK+I++IG  +LFP   SHKV KYS
Sbjct  31   KLFSFADFWDYVLMFLGSVGACVHGASVPVFFIFFGKLINIIGIGYLFPELVSHKVGKYS  90

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            LDFVYLSIV+LFSSW EV CWMHTGERQAAKMR+AYLR+ML
Sbjct  91   LDFVYLSIVMLFSSWIEVGCWMHTGERQAAKMRLAYLRAML  131



>ref|XP_011018527.1| PREDICTED: ABC transporter B family member 2-like isoform X2 
[Populus euphratica]
Length=1193

 Score =   174 bits (440),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            KLF+FAD  D +LM +G +GACVHGASVPVFF+FFGK+I++IG A+LFP EASHKVAKYS
Sbjct  31   KLFAFADFYDCLLMGLGSLGACVHGASVPVFFIFFGKLINIIGMAYLFPKEASHKVAKYS  90

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            LDFVYLS VILF+SW EVACWMHTGERQAAKMRMAYL+SML
Sbjct  91   LDFVYLSAVILFASWIEVACWMHTGERQAAKMRMAYLKSML  131



>ref|XP_006647720.1| PREDICTED: ABC transporter B family member 2-like [Oryza brachyantha]
Length=1261

 Score =   174 bits (440),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = +2

Query  365  MKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKY  544
            +KLFSFAD  DYVLM +G +GAC HGASVPVFF+FFGK+I++IG A+LFP   S +VAKY
Sbjct  37   LKLFSFADRWDYVLMAMGSLGACAHGASVPVFFIFFGKLINIIGLAYLFPTTVSGRVAKY  96

Query  545  SLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            SLDFVYL +VILFSSWTEVACWMHTGERQAAKMR AYLRSML
Sbjct  97   SLDFVYLGVVILFSSWTEVACWMHTGERQAAKMRQAYLRSML  138



>ref|XP_011018526.1| PREDICTED: ABC transporter B family member 2-like isoform X1 
[Populus euphratica]
Length=1253

 Score =   174 bits (440),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            KLF+FAD  D +LM +G +GACVHGASVPVFF+FFGK+I++IG A+LFP EASHKVAKYS
Sbjct  31   KLFAFADFYDCLLMGLGSLGACVHGASVPVFFIFFGKLINIIGMAYLFPKEASHKVAKYS  90

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            LDFVYLS VILF+SW EVACWMHTGERQAAKMRMAYL+SML
Sbjct  91   LDFVYLSAVILFASWIEVACWMHTGERQAAKMRMAYLKSML  131



>ref|XP_002299180.2| P-glycoprotein [Populus trichocarpa]
 gb|EEE83985.2| P-glycoprotein [Populus trichocarpa]
Length=1285

 Score =   173 bits (439),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            KLF+FAD  D +LM +G +GACVHGASVPVFF+FFGK+I++IG A+LFP EASHKVAKYS
Sbjct  31   KLFAFADFYDCLLMGLGSLGACVHGASVPVFFIFFGKLINIIGMAYLFPKEASHKVAKYS  90

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            LDFVYLS VILF+SW EVACWMHTGERQAAKMRMAYL+SML
Sbjct  91   LDFVYLSAVILFASWIEVACWMHTGERQAAKMRMAYLKSML  131



>gb|KGN60362.1| hypothetical protein Csa_3G901080 [Cucumis sativus]
Length=1272

 Score =   172 bits (437),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            KLF+FAD  DYVLM +G +GAC+HGASVPVFF+FFGK+I++IG A+LFP  A+ KVAKYS
Sbjct  57   KLFAFADFYDYVLMSIGSIGACIHGASVPVFFIFFGKLINIIGMAYLFPEAAAPKVAKYS  116

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            LDF+YLS+ ILFSSW EVACWMH+GERQAAKMRMAYLRSML
Sbjct  117  LDFLYLSVAILFSSWAEVACWMHSGERQAAKMRMAYLRSML  157



>gb|EMT33461.1| ABC transporter B family member 2 [Aegilops tauschii]
Length=1322

 Score =   172 bits (436),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = +2

Query  365  MKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKY  544
            +KLFSFAD  DY+LM VG VGAC HGASVPVFF+FFGK+I++IG A  FPA  S +VAKY
Sbjct  39   LKLFSFADRWDYLLMAVGSVGACAHGASVPVFFIFFGKLINIIGIASFFPAMVSGRVAKY  98

Query  545  SLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            SLDFVYL +VILFSSWTEVACWMHTGERQAAKMR+AYLRSML
Sbjct  99   SLDFVYLGVVILFSSWTEVACWMHTGERQAAKMRLAYLRSML  140



>ref|XP_004953524.1| PREDICTED: ABC transporter B family member 2-like [Setaria italica]
Length=1257

 Score =   172 bits (435),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = +2

Query  365  MKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKY  544
            +KLFSFAD  D VLM VG +GAC HGASVPVFF+FFGK+I++IG A+LFP   S +VAKY
Sbjct  30   LKLFSFADQWDCVLMAVGSLGACAHGASVPVFFIFFGKLINIIGLAYLFPTTVSGRVAKY  89

Query  545  SLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            SLDFVYL IVILFSSWTEVACWMHTGERQAAKMR+AYLR+ML
Sbjct  90   SLDFVYLGIVILFSSWTEVACWMHTGERQAAKMRLAYLRAML  131



>ref|XP_008465999.1| PREDICTED: ABC transporter B family member 2-like [Cucumis melo]
Length=1237

 Score =   171 bits (432),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/101 (75%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            KLF+FAD  DY+LM +G +GAC+HGASVPVFF+FFGK+I++IG A+LFP  A+ KVAKYS
Sbjct  22   KLFAFADFYDYILMSIGSIGACIHGASVPVFFIFFGKLINIIGMAYLFPEAAAPKVAKYS  81

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            LDF+YLS+ ILFSSW EVACWMH+GERQAAKMRMAYL+SML
Sbjct  82   LDFLYLSVAILFSSWAEVACWMHSGERQAAKMRMAYLKSML  122



>emb|CDX92739.1| BnaC07g39970D [Brassica napus]
Length=1241

 Score =   171 bits (432),  Expect = 1e-44, Method: Composition-based stats.
 Identities = 80/104 (77%), Positives = 92/104 (88%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            S +KLFSFAD  D VLM +G +GAC+HGASVPVFF+FFGK+I++IG A++   +ASHKVA
Sbjct  23   SFLKLFSFADFNDCVLMTLGSIGACIHGASVPVFFIFFGKLINIIGTAYMDRHQASHKVA  82

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            KYSLDFVYLS+VILFSSW EVACWMHTGERQAAKMR AYLRSML
Sbjct  83   KYSLDFVYLSVVILFSSWIEVACWMHTGERQAAKMRRAYLRSML  126



>ref|XP_002452712.1| hypothetical protein SORBIDRAFT_04g031170 [Sorghum bicolor]
 gb|EES05688.1| hypothetical protein SORBIDRAFT_04g031170 [Sorghum bicolor]
Length=1260

 Score =   170 bits (430),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 89/102 (87%), Gaps = 0/102 (0%)
 Frame = +2

Query  365  MKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKY  544
            +KLFSFAD  D VLM VG +GAC HGASVPVFF+FFGK+I++IG A+LFP   S +VAKY
Sbjct  35   LKLFSFADRWDCVLMAVGSLGACAHGASVPVFFIFFGKLINIIGLAYLFPTTVSGRVAKY  94

Query  545  SLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            SLDFVYL +VILFSSWTEVACWMHTGERQAAKMR AYLR+ML
Sbjct  95   SLDFVYLGVVILFSSWTEVACWMHTGERQAAKMRQAYLRAML  136



>ref|XP_008676453.1| PREDICTED: uncharacterized protein LOC100191944 isoform X1 [Zea 
mays]
 gb|ACN33264.1| unknown [Zea mays]
 gb|AFW63454.1| hypothetical protein ZEAMMB73_169648 [Zea mays]
Length=1262

 Score =   169 bits (428),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 89/102 (87%), Gaps = 0/102 (0%)
 Frame = +2

Query  365  MKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKY  544
            +KLFSFAD  D VLM VG +GAC HGASVPVFF+FFGK+I++IG A+LFP   S +VAKY
Sbjct  32   LKLFSFADRWDCVLMAVGSLGACAHGASVPVFFIFFGKLINIIGLAYLFPTTVSGRVAKY  91

Query  545  SLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            SLDFVYL IVI FSSWTEVACWMHTGERQAAKMR+AYLR+ML
Sbjct  92   SLDFVYLGIVIFFSSWTEVACWMHTGERQAAKMRLAYLRAML  133



>ref|XP_010274279.1| PREDICTED: ABC transporter B family member 2-like isoform X1 
[Nelumbo nucifera]
Length=1252

 Score =   167 bits (424),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/101 (75%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            KLF+FAD  DYVLM +G VGACVHGASVPVFF+FFGK+I++IG A+LFP   SHKVA Y+
Sbjct  31   KLFAFADSWDYVLMLLGSVGACVHGASVPVFFIFFGKLINIIGVAYLFPTLVSHKVAMYA  90

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            LDFVYLSIV++FSSW EV+CWM+TGERQAAKMR+ YL+SML
Sbjct  91   LDFVYLSIVVMFSSWIEVSCWMYTGERQAAKMRLVYLKSML  131



>emb|CDY42770.1| BnaA03g47690D [Brassica napus]
Length=1135

 Score =   166 bits (419),  Expect = 8e-43, Method: Composition-based stats.
 Identities = 78/104 (75%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            S +KLFSFAD  D VLM +G +GAC+HGASVPVFF+FFGK+I++IG A++   +ASHKVA
Sbjct  23   SFLKLFSFADFNDCVLMTLGSIGACIHGASVPVFFIFFGKLINIIGIAYMDRHQASHKVA  82

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            KYSLDFVYLS+ ILFSSW EVACWMHTGERQAAKMR AYLRS+L
Sbjct  83   KYSLDFVYLSVAILFSSWLEVACWMHTGERQAAKMRRAYLRSIL  126



>ref|XP_009137566.1| PREDICTED: ABC transporter B family member 2-like [Brassica rapa]
Length=1241

 Score =   165 bits (417),  Expect = 1e-42, Method: Composition-based stats.
 Identities = 77/104 (74%), Positives = 90/104 (87%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            S +KLFSFAD  D VLM +G +GAC+HGASVPVFF+FFGK+I++IG A++   +ASHKVA
Sbjct  23   SFLKLFSFADFNDCVLMTLGSIGACIHGASVPVFFIFFGKLINIIGIAYMDRHQASHKVA  82

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            KYSLDFVYLS+ ILFSSW E ACWMHTGERQAAKMR AYLRS+L
Sbjct  83   KYSLDFVYLSVAILFSSWLEAACWMHTGERQAAKMRRAYLRSIL  126



>ref|XP_006854029.1| hypothetical protein AMTR_s00048p00046670 [Amborella trichopoda]
 gb|ERN15496.1| hypothetical protein AMTR_s00048p00046670 [Amborella trichopoda]
Length=1263

 Score =   164 bits (415),  Expect = 3e-42, Method: Composition-based stats.
 Identities = 75/103 (73%), Positives = 88/103 (85%), Gaps = 0/103 (0%)
 Frame = +2

Query  362  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  541
              KLF+FAD  D+VLM +G +GAC HGASVPVFF+FFGK+I++IG A+LFP   S +VAK
Sbjct  37   FFKLFAFADKWDWVLMAIGSLGACAHGASVPVFFIFFGKLINIIGIAYLFPRSVSDRVAK  96

Query  542  YSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            YSLDFVYL I ILFSSWTEVACWM+TGERQA KMR+AY+RSML
Sbjct  97   YSLDFVYLGIAILFSSWTEVACWMYTGERQARKMRLAYVRSML  139



>gb|KHN38940.1| ABC transporter B family member 2 [Glycine soja]
Length=1204

 Score =   163 bits (412),  Expect = 6e-42, Method: Composition-based stats.
 Identities = 77/88 (88%), Positives = 82/88 (93%), Gaps = 0/88 (0%)
 Frame = +2

Query  407  MFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSIVILFS  586
            M VG VGA VHGASVPVFF+FFGK+I+VIG A+LFP EASHKVAKYSLDFVYLSI ILFS
Sbjct  1    MGVGSVGAIVHGASVPVFFIFFGKLINVIGLAYLFPKEASHKVAKYSLDFVYLSIAILFS  60

Query  587  SWTEVACWMHTGERQAAKMRMAYLRSML  670
            SWTEVACWMHTGERQAAKMRMAYL+SML
Sbjct  61   SWTEVACWMHTGERQAAKMRMAYLKSML  88



>gb|ABG75919.1| MDR-like ABC transporter [Ginkgo biloba]
Length=1279

 Score =   161 bits (408),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 72/101 (71%), Positives = 86/101 (85%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            KLFS+ADG DY+LM VG +GAC HGASVPVFF+FFGK+I+ IG A+L P   +H VA YS
Sbjct  61   KLFSYADGWDYLLMAVGSIGACAHGASVPVFFIFFGKLINCIGLAYLDPPAVTHTVAMYS  120

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            LDFVYL +V+LFSSWTEVACWM+TGERQA +MR+ YLR+ML
Sbjct  121  LDFVYLGVVVLFSSWTEVACWMYTGERQATRMRLTYLRAML  161



>ref|XP_004509740.1| PREDICTED: ABC transporter B family member 2-like isoform X3 
[Cicer arietinum]
Length=1047

 Score =   160 bits (405),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 85/103 (83%), Positives = 94/103 (91%), Gaps = 0/103 (0%)
 Frame = +2

Query  362  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  541
            L+KLFSFAD  DYVLM VG VGAC+HGASVP+FF+FFGKII+VI   +LFP EASH+VAK
Sbjct  15   LLKLFSFADFYDYVLMAVGSVGACIHGASVPIFFIFFGKIINVIALVYLFPKEASHQVAK  74

Query  542  YSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            YSLDF+YLSI+ILFSSW EVACWMHTGERQAAKMRMAYLRSML
Sbjct  75   YSLDFLYLSILILFSSWAEVACWMHTGERQAAKMRMAYLRSML  117



>ref|XP_004509738.1| PREDICTED: ABC transporter B family member 2-like isoform X1 
[Cicer arietinum]
Length=1229

 Score =   159 bits (402),  Expect = 2e-40, Method: Composition-based stats.
 Identities = 85/103 (83%), Positives = 94/103 (91%), Gaps = 0/103 (0%)
 Frame = +2

Query  362  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  541
            L+KLFSFAD  DYVLM VG VGAC+HGASVP+FF+FFGKII+VI   +LFP EASH+VAK
Sbjct  15   LLKLFSFADFYDYVLMAVGSVGACIHGASVPIFFIFFGKIINVIALVYLFPKEASHQVAK  74

Query  542  YSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            YSLDF+YLSI+ILFSSW EVACWMHTGERQAAKMRMAYLRSML
Sbjct  75   YSLDFLYLSILILFSSWAEVACWMHTGERQAAKMRMAYLRSML  117



>ref|XP_010906448.1| PREDICTED: ABC transporter B family member 2-like [Elaeis guineensis]
Length=1235

 Score =   149 bits (377),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            S  KLF+F+D  DYVLM +G VGACVHGAS+PVFF+FFGK+++V   A L+PA  SHKVA
Sbjct  21   SFFKLFAFSDAWDYVLMALGSVGACVHGASLPVFFLFFGKLVNVAAVASLYPASVSHKVA  80

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            +Y+LDF+YL    L S+W EV+CWMHTGERQ +K+R+AYLR+ML
Sbjct  81   EYALDFLYLGFATLVSAWIEVSCWMHTGERQVSKIRLAYLRAML  124



>ref|XP_008777170.1| PREDICTED: ABC transporter B family member 2-like [Phoenix dactylifera]
Length=1237

 Score =   145 bits (367),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 79/101 (78%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            KLF+F+D  DYVLM +G V ACVHGASVPVF +FFGK+IDV       PA  SHKV +Y+
Sbjct  27   KLFAFSDARDYVLMALGSVSACVHGASVPVFLIFFGKLIDVAAVGSSNPASVSHKVGEYA  86

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            LDFVYL   IL S+W EVACWMHTGERQ +K+R+AYLR+ML
Sbjct  87   LDFVYLGFGILVSAWIEVACWMHTGERQVSKIRLAYLRAML  127



>ref|XP_004136398.1| PREDICTED: ABC transporter B family member 2-like [Cucumis sativus]
Length=1232

 Score =   144 bits (364),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/101 (68%), Positives = 83/101 (82%), Gaps = 7/101 (7%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            KLF+FAD  DYVLM +G +GAC+HGASVPVFF+FFGK+I+++    +FP        +YS
Sbjct  24   KLFAFADFYDYVLMSIGSIGACIHGASVPVFFIFFGKLINILC-INIFP------FVQYS  76

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            LDF+YLS+ ILFSSW EVACWMH+GERQAAKMRMAYLRSML
Sbjct  77   LDFLYLSVAILFSSWAEVACWMHSGERQAAKMRMAYLRSML  117



>ref|XP_002976764.1| hypothetical protein SELMODRAFT_105467 [Selaginella moellendorffii]
 gb|EFJ22433.1| hypothetical protein SELMODRAFT_105467 [Selaginella moellendorffii]
Length=1290

 Score =   137 bits (344),  Expect = 9e-33, Method: Composition-based stats.
 Identities = 59/101 (58%), Positives = 80/101 (79%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            KL+SFAD +D  L+FVG +GAC HGA++PVFF+FFGK+ID  G  +  P +  H V+KY+
Sbjct  68   KLYSFADAMDLGLIFVGAIGACAHGAAIPVFFIFFGKLIDEFGANYDNPTKLGHGVSKYA  127

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            L FVYL + IL ++W EVACW +TGERQ+A+MR+AYL++ML
Sbjct  128  LYFVYLGLAILVAAWLEVACWTYTGERQSARMRVAYLKAML  168



>ref|XP_002983053.1| hypothetical protein SELMODRAFT_117529 [Selaginella moellendorffii]
 gb|EFJ15862.1| hypothetical protein SELMODRAFT_117529 [Selaginella moellendorffii]
Length=1232

 Score =   136 bits (342),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 61/104 (59%), Positives = 84/104 (81%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            S ++LFSFAD +DYVL+F+G VGA VHGA++P FFVFFGK+ID  G+ +  P +  H+V+
Sbjct  25   SYLQLFSFADYLDYVLIFLGTVGASVHGAAIPGFFVFFGKMIDEFGKDYNNPHKMGHEVS  84

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            KYSL FVYL +VIL ++W EV+CW +TGERQ+++MR  YL++ML
Sbjct  85   KYSLYFVYLGLVILVAAWLEVSCWTYTGERQSSRMRTHYLKAML  128



>ref|XP_002965566.1| ATP-binding cassette transporter [Selaginella moellendorffii]
 gb|EFJ32986.1| ATP-binding cassette transporter [Selaginella moellendorffii]
Length=1243

 Score =   135 bits (339),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 61/104 (59%), Positives = 84/104 (81%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            S ++LFSFAD +DYVL+F+G VGA VHGA++P FFVFFGK+ID  G+ +  P +  H+V+
Sbjct  25   SYLQLFSFADYLDYVLIFLGTVGASVHGAAIPGFFVFFGKMIDEFGKDYNNPHKMGHEVS  84

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            KYSL FVYL +VIL ++W EV+CW +TGERQ+++MR  YL++ML
Sbjct  85   KYSLYFVYLGLVILVAAWLEVSCWTYTGERQSSRMRTHYLKAML  128



>ref|XP_001757525.1| ATP-binding cassette transporter, subfamily B, member 18, group 
MDR/PGP protein PpABCB18 [Physcomitrella patens]
 gb|EDQ77582.1| ATP-binding cassette transporter, subfamily B, member 18, group 
MDR/PGP protein PpABCB18 [Physcomitrella patens]
Length=1251

 Score =   131 bits (330),  Expect = 6e-31, Method: Composition-based stats.
 Identities = 57/101 (56%), Positives = 81/101 (80%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            KL+SFAD  D  L+F+G +GACVHG ++PVFF+FFG++I+  GE    P   S +V+K +
Sbjct  18   KLYSFADSYDVFLIFLGTLGACVHGVAIPVFFIFFGRLINAFGEYADDPETMSTEVSKNA  77

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            L F++L+IV+L ++W EVACWMHTGERQ+A+MR+AYL++ML
Sbjct  78   LYFLFLAIVVLIAAWLEVACWMHTGERQSARMRVAYLKAML  118



>ref|XP_006368377.1| P-glycoprotein [Populus trichocarpa]
 gb|ERP64946.1| P-glycoprotein [Populus trichocarpa]
Length=1230

 Score =   128 bits (322),  Expect = 6e-30, Method: Composition-based stats.
 Identities = 62/103 (60%), Positives = 76/103 (74%), Gaps = 19/103 (18%)
 Frame = +2

Query  362  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  541
            L+KLF+FAD  D+VLM +G +GAC+HGA+VPVFF++FGK+I++IG A+LFP + SHKVAK
Sbjct  35   LLKLFAFADFYDFVLMGLGSIGACIHGAAVPVFFIYFGKLINIIGLAYLFPQQTSHKVAK  94

Query  542  YSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
                               VACWMHTGERQAAKMRMAYL SML
Sbjct  95   -------------------VACWMHTGERQAAKMRMAYLDSML  118



>ref|XP_001774240.1| ATP-binding cassette transporter, subfamily B, member 24, group 
MDR protein PpABCB24 [Physcomitrella patens]
 gb|EDQ61016.1| ATP-binding cassette transporter, subfamily B, member 24, group 
MDR protein PpABCB24 [Physcomitrella patens]
Length=1236

 Score =   127 bits (319),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 78/104 (75%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            S +KLFSFAD VDY LMF+G +GAC HG +VP+FFVFFG++I+  G     P +   +V 
Sbjct  17   SYLKLFSFADTVDYFLMFLGSLGACAHGGAVPIFFVFFGRLINAFGFNQHHPNKLGQEVG  76

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            K +L   YL +V++F+SW EVACW+ TGERQ+A++R+ YL+S+L
Sbjct  77   KEALSMFYLGLVVMFASWLEVACWIQTGERQSARIRVRYLQSIL  120



>ref|XP_002973102.1| ATP-binding cassette transporter [Selaginella moellendorffii]
 gb|EFJ25476.1| ATP-binding cassette transporter [Selaginella moellendorffii]
Length=1214

 Score =   125 bits (313),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 53/93 (57%), Positives = 74/93 (80%), Gaps = 0/93 (0%)
 Frame = +2

Query  392  VDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSLDFVYLSI  571
            +D+ L+FVG +GAC HGA++PVFF+FFGK+ID  G  +  P +  H V+KY+L FVYL +
Sbjct  1    MDWGLIFVGAIGACAHGAAIPVFFIFFGKLIDEFGANYDNPTKLGHGVSKYALYFVYLGL  60

Query  572  VILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
             IL ++W EVACW +TGERQ+A+MR+AYL++ML
Sbjct  61   AILVAAWLEVACWTYTGERQSARMRVAYLKAML  93



>ref|XP_006415715.1| hypothetical protein EUTSA_v10006582mg [Eutrema salsugineum]
 gb|ESQ34068.1| hypothetical protein EUTSA_v10006582mg [Eutrema salsugineum]
Length=1246

 Score =   124 bits (312),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 57/104 (55%), Positives = 78/104 (75%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            SLM LFS AD VD+ LMF+G +GAC+HGA++P+FFVFFGK++D +G     P   S +V+
Sbjct  32   SLMGLFSAADKVDWFLMFLGGLGACIHGATLPLFFVFFGKMLDSLGNLSTDPKAISSRVS  91

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            + +L  VYL +V L S+W  VACWM TGERQ A++R+ YL+S+L
Sbjct  92   QNALYLVYLGLVNLVSAWMGVACWMQTGERQTARLRINYLKSIL  135



>ref|XP_002510564.1| multidrug resistance protein 1, 2, putative [Ricinus communis]
 gb|EEF52751.1| multidrug resistance protein 1, 2, putative [Ricinus communis]
Length=1252

 Score =   124 bits (310),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 55/104 (53%), Positives = 76/104 (73%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            S   LFS AD +DY LMF G +GAC+HGAS+PVFF+FFG++ID +G     P + S +V+
Sbjct  33   SFFALFSAADKIDYFLMFFGSLGACIHGASLPVFFIFFGRMIDSLGNLASDPQKMSTQVS  92

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            K++L  VYL +V+  S+W  VA WM TGERQ A++R+ YL+S+L
Sbjct  93   KHALYLVYLGLVVFVSAWIGVALWMQTGERQTARLRLKYLQSVL  136



>ref|XP_011083466.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter B family member 
13-like [Sesamum indicum]
Length=1247

 Score =   123 bits (309),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 55/104 (53%), Positives = 75/104 (72%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            S  +LF+ AD +DYVLMF+G +GAC+ GA++PVFFV FG++I+ +G   L P   S +V+
Sbjct  35   SFFRLFAVADKIDYVLMFIGSIGACLQGAALPVFFVLFGRMINTLGNLSLDPHRFSSEVS  94

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            KY+L  VYL +V+  S+WT VACW  TGERQ A +R  YL S+L
Sbjct  95   KYALYLVYLGLVVWLSAWTGVACWTQTGERQTALLRQKYLESVL  138



>ref|XP_002893495.1| P-glycoprotein 13 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69754.1| P-glycoprotein 13 [Arabidopsis lyrata subsp. lyrata]
Length=1246

 Score =   122 bits (307),  Expect = 7e-28, Method: Composition-based stats.
 Identities = 55/104 (53%), Positives = 77/104 (74%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            SLM LFS AD +DY LM +G +GAC+HGA++P+FFVFFGK++D +G     P   S +V+
Sbjct  32   SLMGLFSAADKLDYFLMLLGGLGACIHGATLPLFFVFFGKMLDSLGNLSTDPKAISSRVS  91

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            + +L  VYL +V L S+W  V+CWM TGERQ A++R+ YL+S+L
Sbjct  92   QNALYLVYLGLVNLVSAWIGVSCWMQTGERQTARLRINYLKSIL  135



>ref|XP_009113714.1| PREDICTED: ABC transporter B family member 14 [Brassica rapa]
Length=1232

 Score =   122 bits (305),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 57/104 (55%), Positives = 74/104 (71%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            SLM LFS AD VDY+LMF+G  G CVHG ++P+FFVFFGK++D +G         S +V+
Sbjct  21   SLMGLFSAADRVDYILMFLGTFGTCVHGGTLPLFFVFFGKMLDSLGNLSTDSTAISSRVS  80

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            K +L  VYL  V L S+W  VACWM TGERQ A++R+ YL+S+L
Sbjct  81   KNALYLVYLGFVNLVSAWMGVACWMQTGERQTARLRINYLKSIL  124



>ref|NP_174122.1| ABC transporter B family member 14 [Arabidopsis thaliana]
 sp|Q9C7F2.1|AB14B_ARATH RecName: Full=ABC transporter B family member 14; Short=ABC transporter 
ABCB.14; Short=AtABCB14; AltName: Full=Multidrug 
resistance protein 12; AltName: Full=P-glycoprotein 14 [Arabidopsis 
thaliana]
 gb|AAG51476.1|AC069471_7 P-glycoprotein, putative [Arabidopsis thaliana]
 gb|AEE30902.1| ABC transporter B family member 14 [Arabidopsis thaliana]
Length=1247

 Score =   121 bits (304),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 55/104 (53%), Positives = 76/104 (73%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            SLM LFS AD VDY LMF+G +G C+HG ++P+FFVFFG ++D +G+    P   S +V+
Sbjct  32   SLMGLFSAADNVDYFLMFLGGLGTCIHGGTLPLFFVFFGGMLDSLGKLSTDPNAISSRVS  91

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            + +L  VYL +V L S+W  VACWM TGERQ A++R+ YL+S+L
Sbjct  92   QNALYLVYLGLVNLVSAWIGVACWMQTGERQTARLRINYLKSIL  135



>ref|NP_174115.1| ABC transporter B family member 13 [Arabidopsis thaliana]
 sp|Q9C7F8.1|AB13B_ARATH RecName: Full=ABC transporter B family member 13; Short=ABC transporter 
ABCB.13; Short=AtABCB13; AltName: Full=P-glycoprotein 
13; AltName: Full=Putative multidrug resistance protein 
15 [Arabidopsis thaliana]
 gb|AAG51482.1|AC069471_13 P-glycoprotein, putative [Arabidopsis thaliana]
 gb|AEE30893.1| ABC transporter B family member 13 [Arabidopsis thaliana]
Length=1245

 Score =   120 bits (302),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 54/104 (52%), Positives = 76/104 (73%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            SLM LFS AD +DY LM +G +GAC+HGA++P+FFVFFGK++D +G     P   S +V+
Sbjct  31   SLMGLFSAADKLDYFLMLLGGLGACIHGATLPLFFVFFGKMLDSLGNLSTDPKAISSRVS  90

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            + +L  VYL +V   S+W  V+CWM TGERQ A++R+ YL+S+L
Sbjct  91   QNALYLVYLGLVNFVSAWIGVSCWMQTGERQTARLRINYLKSIL  134



>ref|XP_001779184.1| ATP-binding cassette transporter, subfamily B, member 16, group 
MDR/PGP protein PpABCB16 [Physcomitrella patens]
 gb|EDQ56030.1| ATP-binding cassette transporter, subfamily B, member 16, group 
MDR/PGP protein PpABCB16 [Physcomitrella patens]
Length=1284

 Score =   120 bits (301),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 54/104 (52%), Positives = 75/104 (72%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            SL KLF FAD  DY+L+ +G VGA  HG ++PVFF+FFGK++D  G     P + +  V 
Sbjct  66   SLFKLFKFADSFDYLLISIGLVGAAAHGCALPVFFLFFGKLLDGFGANANNPVKMADIVG  125

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            +YSL  +YL IV+ F+SW EVA WM +GERQAA++R+ YL++M+
Sbjct  126  QYSLYMLYLGIVVCFASWAEVAAWMQSGERQAARIRVRYLQAMM  169



>gb|EPS72310.1| hypothetical protein M569_02448, partial [Genlisea aurea]
Length=152

 Score =   112 bits (279),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 68/100 (68%), Gaps = 0/100 (0%)
 Frame = +2

Query  371  LFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSL  550
            LF FADG+DYVLM +G  GA VHGAS+P+F  FF  +I+  G     P + +H+V+KY+ 
Sbjct  19   LFRFADGIDYVLMGIGTAGAVVHGASLPLFLRFFADLINSFGSNENDPRKMTHEVSKYAF  78

Query  551  DFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
             F+ +   I  SSW E++CWM TGERQ AKMR+ YL + L
Sbjct  79   YFLVVGAAIWLSSWAEISCWMWTGERQTAKMRIKYLEAAL  118



>ref|XP_010460561.1| PREDICTED: ABC transporter B family member 13-like isoform X1 
[Camelina sativa]
Length=1248

 Score =   120 bits (300),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 57/104 (55%), Positives = 75/104 (72%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            SLM LFS AD +DY LM +G +GACVHGA++P+FFVFFGK++D +G         S  V+
Sbjct  34   SLMGLFSAADKLDYFLMLLGGLGACVHGATLPLFFVFFGKMLDSLGNLSTDSKAISSHVS  93

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            K +L  VYL +V L S+W  VACWM TGERQ A++R+ YL+S+L
Sbjct  94   KNALYLVYLGLVNLVSAWIGVACWMQTGERQTARLRINYLKSIL  137



>gb|KFK44669.1| hypothetical protein AALP_AA1G288400 [Arabis alpina]
Length=1247

 Score =   120 bits (300),  Expect = 6e-27, Method: Composition-based stats.
 Identities = 54/104 (52%), Positives = 76/104 (73%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            SL+ LFS A+  DY LMF+G +GAC+HGA++P+FFVFFGK++D +G     P   S +V+
Sbjct  32   SLIGLFSAANKFDYFLMFLGGLGACIHGATLPLFFVFFGKMLDSLGNLSTDPKAISSRVS  91

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            + +L  VYL +  L S+W  VACWM TGERQ A++R+ YL+S+L
Sbjct  92   QNALYLVYLGLANLVSAWIGVACWMQTGERQTAQLRINYLKSIL  135



>ref|XP_002877137.1| P-glycoprotein 19 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53396.1| P-glycoprotein 19 [Arabidopsis lyrata subsp. lyrata]
Length=1252

 Score =   119 bits (299),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 78/101 (77%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            KLFSFAD  DY+LMFVG +GA VHG+S+PVFF+ FG++++  G+  +   +  H+V+KYS
Sbjct  28   KLFSFADKFDYLLMFVGSLGAIVHGSSMPVFFLLFGQMVNGFGKNQMDLHQMVHEVSKYS  87

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            L FVYL +V+ FSS+ E+ACWM++GERQ A +R  YL ++L
Sbjct  88   LYFVYLGLVVCFSSYAEIACWMYSGERQVAALRKKYLEAVL  128



>emb|CDP07374.1| unnamed protein product [Coffea canephora]
Length=1259

 Score =   119 bits (299),  Expect = 9e-27, Method: Composition-based stats.
 Identities = 52/104 (50%), Positives = 75/104 (72%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            S++ LF+ AD +DY+LMF G  GAC+HGA++P FFV FG++ID +G     P + +  V+
Sbjct  36   SVLGLFAAADKIDYILMFFGSAGACLHGAALPAFFVLFGRMIDSLGHLSSNPHQMASVVS  95

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            KY++  VYL +VIL S+W  VACW  TGERQ  ++R+ YL+S+L
Sbjct  96   KYAVYLVYLGLVILMSAWIGVACWAQTGERQTTRLRLKYLQSIL  139



>ref|XP_002981381.1| hypothetical protein SELMODRAFT_114581 [Selaginella moellendorffii]
 gb|EFJ17569.1| hypothetical protein SELMODRAFT_114581 [Selaginella moellendorffii]
Length=1239

 Score =   119 bits (298),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 53/103 (51%), Positives = 72/103 (70%), Gaps = 0/103 (0%)
 Frame = +2

Query  362  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  541
            L+K+F+FADGVD   MF G +GA  HG ++P+F + FGK+++  G     P E   +V++
Sbjct  11   LLKIFAFADGVDCAFMFGGTIGAVAHGVALPIFLLLFGKLLNSFGSLASDPQEMYRQVSQ  70

Query  542  YSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            YSL FVYL I ILF+SW EVA WM  GERQ ++MR+ YL +ML
Sbjct  71   YSLYFVYLGIAILFASWAEVALWMQAGERQVSRMRIVYLEAML  113



>gb|KDP36900.1| hypothetical protein JCGZ_08191 [Jatropha curcas]
Length=1221

 Score =   119 bits (298),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 51/104 (49%), Positives = 77/104 (74%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            S   LF  AD +DY+LMFVG +G+C+HGA++PVFF+FFG++ID +G   L P + S K++
Sbjct  35   SFFGLFFAADKIDYLLMFVGSLGSCIHGAALPVFFIFFGRMIDSLGNLALDPHKMSSKIS  94

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            +++L  VYL + +  S+W  VA WM TGERQ +++R+ YL+S+L
Sbjct  95   QHALYLVYLGLAVFVSAWMGVAFWMQTGERQTSRLRLKYLQSVL  138



>gb|AAN28720.2| MDR-like p-glycoprotein [Arabidopsis thaliana]
Length=1252

 Score =   119 bits (297),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 78/101 (77%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            KLFSFAD  DY+LMFVG +GA VHG+S+PVFF+ FG++++  G+  +   +  H+V++YS
Sbjct  28   KLFSFADKFDYLLMFVGSLGAIVHGSSMPVFFLLFGQMVNGFGKNQMDLHQMVHEVSRYS  87

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            L FVYL +V+ FSS+ E+ACWM++GERQ A +R  YL ++L
Sbjct  88   LYFVYLGLVVCFSSYAEIACWMYSGERQVAALRKKYLEAVL  128



>ref|NP_189528.1| ABC transporter B family member 19 [Arabidopsis thaliana]
 sp|Q9LJX0.1|AB19B_ARATH RecName: Full=ABC transporter B family member 19; Short=ABC transporter 
ABCB.19; Short=AtABCB19; AltName: Full=Multidrug 
resistance protein 11; AltName: Full=P-glycoprotein 19 [Arabidopsis 
thaliana]
 dbj|BAB02129.1| P-glycoprotein; multi-drug resistance related; ABC transporter-like 
protein [Arabidopsis thaliana]
 gb|AEE77498.1| ABC transporter B family member 19 [Arabidopsis thaliana]
Length=1252

 Score =   119 bits (297),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 78/101 (77%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            KLFSFAD  DY+LMFVG +GA VHG+S+PVFF+ FG++++  G+  +   +  H+V++YS
Sbjct  28   KLFSFADKFDYLLMFVGSLGAIVHGSSMPVFFLLFGQMVNGFGKNQMDLHQMVHEVSRYS  87

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            L FVYL +V+ FSS+ E+ACWM++GERQ A +R  YL ++L
Sbjct  88   LYFVYLGLVVCFSSYAEIACWMYSGERQVAALRKKYLEAVL  128



>dbj|BAC41846.1| putative P-glycoprotein [Arabidopsis thaliana]
Length=1252

 Score =   119 bits (297),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 78/101 (77%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            KLFSFAD  DY+LMFVG +GA VHG+S+PVFF+ FG++++  G+  +   +  H+V++YS
Sbjct  28   KLFSFADKFDYLLMFVGSLGAIVHGSSMPVFFLLFGQMVNGFGKNQMDLHQMVHEVSRYS  87

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            L FVYL +V+ FSS+ E+ACWM++GERQ A +R  YL ++L
Sbjct  88   LYFVYLGLVVCFSSYAEIACWMYSGERQVAALRKKYLEAVL  128



>ref|XP_002969904.1| ATP-binding cassette transporter [Selaginella moellendorffii]
 gb|EFJ29028.1| ATP-binding cassette transporter [Selaginella moellendorffii]
Length=1239

 Score =   118 bits (296),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 54/103 (52%), Positives = 71/103 (69%), Gaps = 0/103 (0%)
 Frame = +2

Query  362  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  541
            L K+F+FADGVD   MF G +GA  HG ++P+F + FGK+++  G     P E   +V+K
Sbjct  11   LHKIFAFADGVDCAFMFGGTIGAVAHGLALPIFLLLFGKLLNSFGSLASDPQEMYRQVSK  70

Query  542  YSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            YSL FVYL I ILF+SW EVA WM  GERQ ++MR+ YL +ML
Sbjct  71   YSLYFVYLGIAILFASWAEVALWMQAGERQVSRMRIVYLEAML  113



>ref|XP_010527726.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter B family member 
13-like [Tarenaya hassleriana]
Length=1268

 Score =   118 bits (295),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 53/104 (51%), Positives = 74/104 (71%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            SL  LF  AD +DYVLMF G +GA +HGA++PVFF+ FG+++D +G  +  P   S +V+
Sbjct  38   SLFGLFGAADKLDYVLMFFGSLGAAIHGATLPVFFILFGRMLDALGTLYANPGSMSSRVS  97

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            + +L+ VYL +  L SSW  VACWM TGERQ A++R+ YL S+L
Sbjct  98   QTALNAVYLGLANLVSSWVGVACWMQTGERQTARLRINYLNSIL  141



>ref|XP_007225446.1| hypothetical protein PRUPE_ppa000363mg [Prunus persica]
 gb|EMJ26645.1| hypothetical protein PRUPE_ppa000363mg [Prunus persica]
Length=1244

 Score =   118 bits (295),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 53/104 (51%), Positives = 76/104 (73%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            SL+ LF+ AD VD+VLM  G VGAC+HGA +PVFFV FG++ID +G     P + S +V+
Sbjct  35   SLVGLFAAADKVDFVLMLFGSVGACIHGAVLPVFFVLFGRMIDSLGHLAKHPQQLSSRVS  94

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            +++L  VYL +++  S+W  VA WM TGERQ A++R+ YL+S+L
Sbjct  95   QHALYLVYLGLILFASAWIGVAFWMRTGERQTARLRLKYLQSVL  138



>ref|XP_001751653.1| ATP-binding cassette transporter, subfamily B, member 15, group 
MDR/PGP protein PpABCB15 [Physcomitrella patens]
 gb|EDQ83970.1| ATP-binding cassette transporter, subfamily B, member 15, group 
MDR/PGP protein PpABCB15 [Physcomitrella patens]
Length=1264

 Score =   118 bits (295),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 52/101 (51%), Positives = 76/101 (75%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            KLFSFAD VDYVLM VG   A +HGA+VPVFF++F ++I+ +G +   P + + +V++YS
Sbjct  43   KLFSFADKVDYVLMVVGGTAAVLHGAAVPVFFIYFSRLINDLGHSMGDPMKQTAEVSRYS  102

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            ++F YL I  L ++W EV+CWM TGERQ+A++R  YL ++L
Sbjct  103  MNFFYLGIHCLVTAWLEVSCWMITGERQSARIRTKYLHAIL  143



>ref|XP_010502886.1| PREDICTED: ABC transporter B family member 19-like [Camelina 
sativa]
Length=1255

 Score =   118 bits (295),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 78/101 (77%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            KLFSFAD  DY+LMFVG +GA VHG+S+PVFF+ FG++++  G+  +   +  H+V++YS
Sbjct  31   KLFSFADRFDYLLMFVGSLGAIVHGSSMPVFFLLFGQMVNGFGKNQMDLHQMVHEVSRYS  90

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            L F+YL +V+ FSS+ E+ACWM++GERQ A +R  YL ++L
Sbjct  91   LYFIYLGLVVCFSSYAEIACWMYSGERQVAALRKKYLEAVL  131



>ref|XP_010514603.1| PREDICTED: ABC transporter B family member 19-like [Camelina 
sativa]
Length=1254

 Score =   118 bits (295),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 78/101 (77%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            KLFSFAD  DY+LMFVG +GA VHG+S+PVFF+ FG++++  G+  +   +  H+V++YS
Sbjct  30   KLFSFADRFDYLLMFVGSLGAIVHGSSMPVFFLLFGQMVNGFGKNQMDLHQMVHEVSRYS  89

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            L F+YL +V+ FSS+ E+ACWM++GERQ A +R  YL ++L
Sbjct  90   LYFIYLGLVVCFSSYAEIACWMYSGERQVAALRKKYLEAVL  130



>ref|XP_010425667.1| PREDICTED: ABC transporter B family member 19 [Camelina sativa]
Length=1254

 Score =   118 bits (295),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 78/101 (77%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            KLFSFAD  DY+LMFVG +GA VHG+S+PVFF+ FG++++  G+  +   +  H+V++YS
Sbjct  30   KLFSFADRFDYLLMFVGSLGAIVHGSSMPVFFLLFGQMVNGFGKNQMDLHQMVHEVSRYS  89

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            L F+YL +V+ FSS+ E+ACWM++GERQ A +R  YL ++L
Sbjct  90   LYFIYLGLVVCFSSYAEIACWMYSGERQVAALRKKYLEAVL  130



>ref|XP_006290510.1| hypothetical protein CARUB_v10016588mg [Capsella rubella]
 gb|EOA23408.1| hypothetical protein CARUB_v10016588mg [Capsella rubella]
Length=1252

 Score =   118 bits (295),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 78/101 (77%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            KLFSFAD  DY+LMFVG +GA VHG+S+PVFF+ FG++++  G+  +   +  H+V++YS
Sbjct  28   KLFSFADRFDYLLMFVGSLGAIVHGSSMPVFFLLFGQMVNGFGKNQMDLHQMVHEVSRYS  87

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            L F+YL +V+ FSS+ E+ACWM++GERQ A +R  YL ++L
Sbjct  88   LYFIYLGLVVCFSSYAEIACWMYSGERQVAALRKKYLEAVL  128



>ref|XP_008221400.1| PREDICTED: ABC transporter B family member 13-like [Prunus mume]
Length=1205

 Score =   118 bits (295),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 53/104 (51%), Positives = 76/104 (73%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            SL+ LF+ AD VD+VLM  G VGAC+HGA +PVFFV FG++ID +G     P + S +V+
Sbjct  35   SLVGLFAAADKVDFVLMLFGSVGACIHGAVLPVFFVLFGRMIDSLGHLAKHPQQLSSRVS  94

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            +++L  VYL +++  S+W  VA WM TGERQ A++R+ YL+S+L
Sbjct  95   QHALYLVYLGLILFASAWIGVAFWMRTGERQTARLRLKYLQSVL  138



>ref|XP_010499285.1| PREDICTED: ABC transporter B family member 13-like isoform X1 
[Camelina sativa]
Length=1245

 Score =   118 bits (295),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 55/104 (53%), Positives = 75/104 (72%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            SLM LFS +D +DY LM +G +GACVHGA++P+FFVFFGK++D +G         S  V+
Sbjct  31   SLMGLFSASDKLDYFLMLLGGLGACVHGATLPLFFVFFGKMLDSLGNLSTDSKAISSHVS  90

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            K +L  VYL +V L S+W  V+CWM TGERQ A++R+ YL+S+L
Sbjct  91   KNALYLVYLGLVNLVSAWIGVSCWMQTGERQTARLRINYLKSVL  134



>ref|XP_011459839.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter B family member 
13-like, partial [Fragaria vesca subsp. vesca]
Length=1390

 Score =   117 bits (294),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 50/104 (48%), Positives = 75/104 (72%), Gaps = 0/104 (0%)
 Frame = +2

Query  359   SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
             S + LF+ AD +DY+LM  G  G+C+HGA++PVFFV FG++ID +G   + P E S +++
Sbjct  917   SFLGLFAAADQMDYILMLFGSFGSCIHGAALPVFFVLFGRMIDSLGNMAMHPNEISSRIS  976

Query  539   KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
             +Y+L  +YL IV+  S+W  VA W  TGERQ A++R+ YL+S+L
Sbjct  977   EYALYVIYLGIVLFISAWIGVASWTRTGERQTARLRLKYLQSVL  1020


 Score =   108 bits (271),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 49/104 (47%), Positives = 71/104 (68%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            S + LF+ AD +DY+LM  G  G+C+HGA+ PVFFV FG +ID +G   +   E S +++
Sbjct  37   SFLGLFAAADQMDYILMLFGSFGSCIHGAAFPVFFVLFGGMIDSLGHMAMRSNEMSSRIS  96

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            +Y+L  V L IV+  S+W  VA W  TGERQ A++R+ YL+S+L
Sbjct  97   EYALYVVCLGIVLFISAWIGVASWTRTGERQTARLRLKYLQSVL  140



>ref|XP_002890755.1| P-glycoprotein 14 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67014.1| P-glycoprotein 14 [Arabidopsis lyrata subsp. lyrata]
Length=1248

 Score =   117 bits (293),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 54/104 (52%), Positives = 74/104 (71%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            SLM LFS AD VD  LMF+G +G C+HG ++P+FFVFFG ++D +G     P   S +V+
Sbjct  32   SLMGLFSAADNVDCFLMFLGGLGTCIHGGTLPLFFVFFGGMLDSLGNFSTDPNAISSRVS  91

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            + +L  VYL +V L S+W  VACWM TGERQ A++R+ YL+S+L
Sbjct  92   QNALYLVYLGLVNLVSAWIGVACWMQTGERQTARLRINYLKSIL  135



>ref|XP_006415706.1| hypothetical protein EUTSA_v10006583mg [Eutrema salsugineum]
 gb|ESQ34059.1| hypothetical protein EUTSA_v10006583mg [Eutrema salsugineum]
Length=1242

 Score =   117 bits (293),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 53/104 (51%), Positives = 75/104 (72%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            SLM LF  AD VD +LMF+G +G+C+HG ++P+FFVFFGK++D +G     P   S +V+
Sbjct  32   SLMGLFRAADKVDCLLMFLGSLGSCIHGGTLPLFFVFFGKLLDSLGSLSADPKAISSRVS  91

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            + +L  VYL +V L S+W  V CWM TGERQ A++R+ YL+S+L
Sbjct  92   QNALYLVYLGLVNLVSAWMGVTCWMQTGERQTARLRINYLKSIL  135



>ref|XP_009151836.1| PREDICTED: ABC transporter B family member 19 [Brassica rapa]
Length=1252

 Score =   117 bits (293),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 77/101 (76%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            KLFSFAD  DY+LM  G +GA VHG+S+PVFF+ FG++++  G+  +   + +H+V+KYS
Sbjct  28   KLFSFADKFDYLLMTTGTLGAIVHGSSMPVFFLLFGEMVNGFGKNQMDLHQMTHEVSKYS  87

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            L FVYL +V+ FSS+ E+ACWM++GERQ A +R  YL ++L
Sbjct  88   LYFVYLGLVVCFSSYAEIACWMYSGERQVAALRKKYLEAVL  128



>emb|CDX86408.1| BnaA06g31250D [Brassica napus]
Length=1237

 Score =   117 bits (293),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 77/101 (76%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            KLFSFAD  DY+LM  G +GA VHG+S+PVFF+ FG++++  G+  +   + +H+V+KYS
Sbjct  28   KLFSFADKFDYLLMTTGTLGAIVHGSSMPVFFLLFGEMVNGFGKNQMDLHQMTHEVSKYS  87

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            L FVYL +V+ FSS+ E+ACWM++GERQ A +R  YL ++L
Sbjct  88   LYFVYLGLVVCFSSYAEIACWMYSGERQVAALRKKYLEAVL  128



>gb|KFK33112.1| hypothetical protein AALP_AA6G332600 [Arabis alpina]
Length=1240

 Score =   117 bits (292),  Expect = 6e-26, Method: Composition-based stats.
 Identities = 54/104 (52%), Positives = 73/104 (70%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            SLM LFS AD  D  LMF+G +G C+HG ++P FFVFFGK++D +G   + P   S  V+
Sbjct  28   SLMILFSAADKFDCFLMFLGGLGTCIHGGTLPFFFVFFGKLLDSLGNLSMDPKATSSTVS  87

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            + +L  VYL +V L S+W  VACWM TGERQ A++R+ YL+S+L
Sbjct  88   QNALYLVYLGLVNLVSAWIGVACWMQTGERQTARLRINYLKSIL  131



>ref|XP_010478144.1| PREDICTED: ABC transporter B family member 13 isoform X1 [Camelina 
sativa]
 ref|XP_010478146.1| PREDICTED: ABC transporter B family member 13 isoform X3 [Camelina 
sativa]
Length=1246

 Score =   116 bits (291),  Expect = 9e-26, Method: Composition-based stats.
 Identities = 55/104 (53%), Positives = 74/104 (71%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            SLM LFS AD +DY LM +G +GACVHGA++P+FFV FGK++D +G         S  V+
Sbjct  32   SLMGLFSAADKLDYFLMLLGGLGACVHGATLPLFFVLFGKMLDSLGNLSADSKAISSHVS  91

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            K +L  VYL +V L S+W  V+CWM TGERQ A++R+ YL+S+L
Sbjct  92   KNALYLVYLGLVNLVSAWIGVSCWMQTGERQTARLRINYLKSIL  135



>gb|KFK33760.1| hypothetical protein AALP_AA5G056700 [Arabis alpina]
Length=1251

 Score =   116 bits (291),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 78/101 (77%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            KLFSFAD  DY+LM +G +GA +HG+S+PVFF+ FG++++  G+  +   + +H+V+KY+
Sbjct  27   KLFSFADKFDYLLMSIGTLGAIIHGSSMPVFFLLFGEMVNGFGKNQMDLHQMTHQVSKYA  86

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            L FVYL +V+ FSS+ E+ACWM++GERQ A +R  YL ++L
Sbjct  87   LYFVYLGLVVCFSSYAEIACWMYSGERQVAALRKKYLEAVL  127



>ref|XP_006395333.1| hypothetical protein EUTSA_v10003528mg [Eutrema salsugineum]
 gb|ESQ32619.1| hypothetical protein EUTSA_v10003528mg [Eutrema salsugineum]
Length=1255

 Score =   116 bits (291),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 77/101 (76%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            KLFSFAD  DY+LM  G +GA +HG+S+PVFF+ FG++++  G+  +   + +H+V+KY+
Sbjct  31   KLFSFADKFDYLLMITGSLGAIIHGSSMPVFFLLFGEMVNGFGKNQMDLQQMTHEVSKYA  90

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            L FVYL +V+ FSS+ E+ACWM++GERQ A +R  YL ++L
Sbjct  91   LYFVYLGLVVCFSSYAEIACWMYSGERQVAALRKKYLEAVL  131



>ref|XP_007017851.1| P-glycoprotein 13 [Theobroma cacao]
 gb|EOY15076.1| P-glycoprotein 13 [Theobroma cacao]
Length=1241

 Score =   116 bits (291),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 51/104 (49%), Positives = 76/104 (73%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            S + LF+ AD +DY LMF G +GAC+HGA++PVFF+ FG++ID +G     P + S +V+
Sbjct  28   SFLGLFAAADKLDYALMFSGSLGACIHGAALPVFFILFGRMIDSLGHLSSNPQKLSARVS  87

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            +++L  VYL +V+  S+W  VA WM TGERQ A++R+ YL+S+L
Sbjct  88   EHALYLVYLGLVVFASAWIGVAFWMQTGERQTARLRLKYLQSVL  131



>ref|XP_008348224.1| PREDICTED: ABC transporter B family member 19-like [Malus domestica]
Length=162

 Score =   108 bits (271),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 76/101 (75%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            +LFSFAD  D++LM  G +GA VHG+S+PVFF+ FG++++  GE  +   + + +VAKY+
Sbjct  26   QLFSFADKYDWLLMIFGSLGAVVHGSSMPVFFLMFGEMVNGFGENQMNLQKMTAEVAKYA  85

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            L FVYL +++  +S+ E+ACWM+TGERQ +++R  YL ++L
Sbjct  86   LYFVYLGLIVCVTSYAEIACWMYTGERQVSRLRKKYLEAVL  126



>emb|CDY65012.1| BnaCnng45670D [Brassica napus]
Length=1253

 Score =   116 bits (290),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 77/101 (76%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            KLFSFAD  DY+LM  G +GA VHG+S+PVFF+ FG++++  G+  +   + +H+V+KY+
Sbjct  28   KLFSFADKFDYLLMITGTLGAIVHGSSMPVFFLLFGEMVNGFGKNQMDLHQMTHEVSKYA  87

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            L FVYL +++ FSS+ E+ACWM++GERQ A +R  YL ++L
Sbjct  88   LYFVYLGLIVCFSSYAEIACWMYSGERQVAALRKKYLEAVL  128



>ref|XP_002301961.1| multidrug resistance P-glycoprotein [Populus trichocarpa]
 gb|EEE81234.1| multidrug resistance P-glycoprotein [Populus trichocarpa]
Length=1219

 Score =   115 bits (288),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 71/104 (68%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            S+  LFS AD  D+ LMF+G VG+C HGA  P+FFV FG +ID +G     P + S +V+
Sbjct  14   SIFGLFSAADKFDHFLMFLGLVGSCAHGAVFPLFFVLFGHLIDSLGHVRSDPHQMSSQVS  73

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            KYSLD VYL + +  + W  VA WM TGERQ A++R+ YL+S+L
Sbjct  74   KYSLDLVYLGLGVFVAGWIGVASWMQTGERQTARLRLKYLQSVL  117



>ref|XP_009113724.1| PREDICTED: ABC transporter B family member 13 isoform X3 [Brassica 
rapa]
Length=1218

 Score =   115 bits (288),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 52/104 (50%), Positives = 72/104 (69%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            SLM LF  AD +D  LM +G +GAC  GA++P+FFVFFGK++D +G     P   S +V+
Sbjct  25   SLMGLFGAADKLDCFLMILGGLGACTLGATLPLFFVFFGKMLDSLGNLSTDPKSLSSRVS  84

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            K +LD VYL +V   S+W  VACW  TGERQ A++R+ YL+++L
Sbjct  85   KNALDLVYLGLVTFLSAWIGVACWTQTGERQTARLRIKYLKAIL  128



>ref|XP_011034997.1| PREDICTED: ABC transporter B family member 13-like isoform X1 
[Populus euphratica]
Length=1246

 Score =   115 bits (287),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 71/104 (68%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            S+  LFS AD  D+ LMF+G VG+C HGA  P+FFV FG +ID +G     P + S +V+
Sbjct  33   SIFGLFSAADKFDHFLMFLGLVGSCAHGAVYPMFFVLFGHLIDSLGHVGSDPHQMSSQVS  92

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            KYSLD VYL + +  + W  VA WM TGERQ A++R+ YL+S+L
Sbjct  93   KYSLDLVYLGLGVFVAGWIGVASWMQTGERQTARLRLKYLQSVL  136



>ref|XP_009113722.1| PREDICTED: ABC transporter B family member 13 isoform X1 [Brassica 
rapa]
 ref|XP_009113723.1| PREDICTED: ABC transporter B family member 13 isoform X2 [Brassica 
rapa]
Length=1247

 Score =   115 bits (287),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 52/104 (50%), Positives = 72/104 (69%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            SLM LF  AD +D  LM +G +GAC  GA++P+FFVFFGK++D +G     P   S +V+
Sbjct  25   SLMGLFGAADKLDCFLMILGGLGACTLGATLPLFFVFFGKMLDSLGNLSTDPKSLSSRVS  84

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            K +LD VYL +V   S+W  VACW  TGERQ A++R+ YL+++L
Sbjct  85   KNALDLVYLGLVTFLSAWIGVACWTQTGERQTARLRIKYLKAIL  128



>ref|XP_011085762.1| PREDICTED: ABC transporter B family member 19-like [Sesamum indicum]
Length=1250

 Score =   114 bits (286),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 50/101 (50%), Positives = 75/101 (74%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            +LFSFAD  DY+LM  G +GA +HG+S+PVFF+ FG++++  G+  +   + +H+VAKY+
Sbjct  26   QLFSFADKYDYLLMISGSIGAVIHGSSMPVFFLLFGEMVNGFGKNQMDLHKMTHEVAKYA  85

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            L FVYL +V+  SS+ E+ACWM+TGERQ   +R  YL ++L
Sbjct  86   LYFVYLGLVVCLSSYAEIACWMYTGERQVGALRRKYLEAVL  126



>emb|CDY27639.1| BnaA09g27680D [Brassica napus]
Length=1218

 Score =   114 bits (286),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 52/104 (50%), Positives = 72/104 (69%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            SLM LF  AD +D  LM +G +GAC  GA++P+FFVFFGK++D +G     P   S +V+
Sbjct  25   SLMGLFGAADKLDCFLMILGGLGACTLGATLPLFFVFFGKMLDSLGNLSTDPKALSSRVS  84

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            K +LD VYL +V   S+W  VACW  TGERQ A++R+ YL+++L
Sbjct  85   KNALDLVYLGLVTFLSAWIGVACWTQTGERQTARLRINYLKAIL  128



>ref|XP_010528330.1| PREDICTED: ABC transporter B family member 19 [Tarenaya hassleriana]
Length=1256

 Score =   114 bits (285),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 76/101 (75%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            KLFSFAD  DY+LM  G +GA VHG+S+PVFF+ FG++++  G+  +   + +++V+KY+
Sbjct  32   KLFSFADRYDYLLMITGSLGAIVHGSSMPVFFLLFGEMVNGFGKNQMDLQKMTNEVSKYA  91

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            L FVYL +V+ FSS+ E+ACWM+TGERQ   +R  YL ++L
Sbjct  92   LYFVYLGLVVCFSSYAEIACWMYTGERQVGTLRKKYLEAVL  132



>emb|CDX84896.1| BnaC05g21590D [Brassica napus]
Length=1051

 Score =   114 bits (284),  Expect = 5e-25, Method: Composition-based stats.
 Identities = 53/104 (51%), Positives = 72/104 (69%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            SLM LF  AD +D  LM +G +GAC  GA++P+FFVFFGK++D IG     P   S +V+
Sbjct  25   SLMGLFGAADKLDCFLMILGGLGACTLGATLPLFFVFFGKMLDSIGNLSTDPKALSSRVS  84

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            K +LD VYL +V   S+W  VACW  TGERQ A++R+ YL+++L
Sbjct  85   KNALDLVYLGLVTFLSAWIGVACWTQTGERQTARLRINYLKAVL  128



>emb|CDP02220.1| unnamed protein product [Coffea canephora]
Length=1250

 Score =   114 bits (284),  Expect = 6e-25, Method: Composition-based stats.
 Identities = 50/101 (50%), Positives = 75/101 (74%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            +LFSFAD  D++LM  G +GA VHG+S+PVFF+ FG++++  G+      +  H+VAKY+
Sbjct  26   QLFSFADKYDWLLMITGSLGAVVHGSSMPVFFLLFGEMVNGFGKNQTDLHKMIHEVAKYA  85

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            L F+YL +++ FSS+ E+ACWMH+GERQA  +R  YL ++L
Sbjct  86   LYFIYLGLIVCFSSYAEIACWMHSGERQAGALRRKYLEAVL  126



>ref|XP_006306603.1| hypothetical protein CARUB_v10008108mg [Capsella rubella]
 gb|EOA39501.1| hypothetical protein CARUB_v10008108mg [Capsella rubella]
Length=1247

 Score =   114 bits (284),  Expect = 7e-25, Method: Composition-based stats.
 Identities = 53/104 (51%), Positives = 72/104 (69%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            SL+ LF  AD VD  LMF+G +G C+HG ++P+FFVFFG ++D +G     P   S  V+
Sbjct  32   SLLGLFGAADNVDCFLMFLGGLGTCIHGGTLPLFFVFFGGMLDSLGNLSTDPKAISSHVS  91

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            + +L  VYL  V L S+W  VACWM TGERQAA++R+ YL+S+L
Sbjct  92   QNALYLVYLGFVNLVSAWIGVACWMQTGERQAARLRINYLKSIL  135



>ref|XP_006856780.1| hypothetical protein AMTR_s00055p00102180 [Amborella trichopoda]
 gb|ERN18247.1| hypothetical protein AMTR_s00055p00102180 [Amborella trichopoda]
Length=1265

 Score =   114 bits (284),  Expect = 7e-25, Method: Composition-based stats.
 Identities = 53/104 (51%), Positives = 71/104 (68%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            S  KL +FAD  D  LMF G +GACVHGA++PVFFV FG++ID +G       + + +V 
Sbjct  41   SFFKLLAFADTTDMFLMFFGTLGACVHGAALPVFFVIFGRLIDSLGCLSGDTNKLASEVG  100

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            K +L  +YL +V++ SSW EVACWM TGERQA  +R+ Y  S+L
Sbjct  101  KNALQLLYLGLVVMASSWIEVACWMQTGERQATCLRLKYFHSVL  144



>ref|XP_003544389.1| PREDICTED: ABC transporter B family member 13-like [Glycine max]
Length=1250

 Score =   113 bits (282),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 51/104 (49%), Positives = 75/104 (72%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            S   LF+ AD  D VLMF+G VG+CVHGA++PVFF+ FG++ID +G     P + S +++
Sbjct  30   SFFGLFAAADATDCVLMFLGSVGSCVHGAALPVFFILFGRMIDSLGHLSNNPHKLSSRIS  89

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            +++L  VYL  V+L S+W  VA WM TGERQ A++R+ YL+++L
Sbjct  90   EHALYLVYLGGVVLVSAWMGVAFWMQTGERQTARLRLKYLQAVL  133



>ref|XP_010501626.1| PREDICTED: ABC transporter B family member 14-like [Camelina 
sativa]
Length=1233

 Score =   113 bits (282),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 52/104 (50%), Positives = 72/104 (69%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            SLM LF  AD VD  LMF+G +G C+HG ++P+FFVFFG ++D +G     P   S +V+
Sbjct  13   SLMGLFGAADHVDCFLMFLGGLGTCIHGGTLPLFFVFFGGMLDSLGSLSTDPKAISSRVS  72

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            + +L  VYL +  L S+W  VACWM TGERQ A++R+ YL+S+L
Sbjct  73   QNALYLVYLGLFNLVSAWIGVACWMQTGERQTARLRINYLKSIL  116



>ref|XP_010439790.1| PREDICTED: ABC transporter B family member 14-like isoform X1 
[Camelina sativa]
Length=1250

 Score =   113 bits (282),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 51/104 (49%), Positives = 72/104 (69%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            +LM LF  AD VD  LMF+G +G C+HG ++P FFVFFG ++D +G  +  P   S  V+
Sbjct  35   TLMGLFGAADHVDCFLMFLGGLGNCIHGGTLPFFFVFFGGMLDSLGNLYKDPKAISSHVS  94

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            + +L  VYL +V L S+W  VACWM TGERQ  ++R++YL+S+L
Sbjct  95   QNALYLVYLGLVNLVSAWIGVACWMQTGERQTRRLRISYLKSIL  138



>ref|XP_010480688.1| PREDICTED: ABC transporter B family member 14 [Camelina sativa]
Length=1247

 Score =   112 bits (281),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 52/104 (50%), Positives = 72/104 (69%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            SLM LF  AD VD  LMF+G +G C+HG ++P+FFVFFG ++D +G     P   S +V+
Sbjct  33   SLMGLFGAADHVDCFLMFLGGLGTCIHGGTLPLFFVFFGGMLDSLGSLSTDPKAISSRVS  92

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            + +L  VYL +  L S+W  VACWM TGERQ A++R+ YL+S+L
Sbjct  93   QNALYLVYLGLFNLVSAWIGVACWMQTGERQTARLRINYLKSIL  136



>ref|XP_007160658.1| hypothetical protein PHAVU_001G005900g [Phaseolus vulgaris]
 gb|ESW32652.1| hypothetical protein PHAVU_001G005900g [Phaseolus vulgaris]
Length=1247

 Score =   112 bits (280),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 51/104 (49%), Positives = 75/104 (72%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            S   LF+ AD  D VLMF+G VG+C+HGA++PVFF+ FG++ID +G     P + S +V+
Sbjct  26   SFFGLFATADSTDCVLMFLGSVGSCLHGAALPVFFILFGRMIDSLGHLSNNPHKLSSRVS  85

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            +++L  VYL  V+L S+W  VA WM TGERQ A++R+ YL+++L
Sbjct  86   EHALYLVYLGGVVLVSAWMGVAFWMQTGERQTARLRLKYLQAVL  129



>ref|XP_003549468.1| PREDICTED: ABC transporter B family member 13-like [Glycine max]
Length=1250

 Score =   112 bits (280),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 51/104 (49%), Positives = 74/104 (71%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            S   LF+ AD  D VLMF+G  G+CVHGA++PVFF+ FG++ID +G     P + S +V+
Sbjct  30   SFFGLFATADATDCVLMFLGCFGSCVHGAALPVFFILFGRMIDSLGHLSNDPHKLSSRVS  89

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            +++L  VYL  V+L S+W  VA WM TGERQ A++R+ YL+++L
Sbjct  90   EHALYLVYLGGVVLVSAWMGVAFWMQTGERQTARLRLKYLQAVL  133



>emb|CDY00109.1| BnaC09g01920D [Brassica napus]
Length=1245

 Score =   112 bits (280),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 76/101 (75%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            KLFSFAD  D++LM  G +GA +HG+S+PVFF+ FG++++  G+  +   + +H+V+KY+
Sbjct  28   KLFSFADKFDHLLMITGSIGAIIHGSSMPVFFLLFGEMVNGFGKNQMDLHQMTHEVSKYA  87

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            L FVYL +V+  SS+ E+ACWM++GERQ A +R  YL ++L
Sbjct  88   LYFVYLGLVVCVSSYAEIACWMYSGERQVAALRKKYLEAVL  128



>gb|KHG20565.1| ABC transporter B family member 19 [Gossypium arboreum]
Length=1249

 Score =   112 bits (280),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 48/101 (48%), Positives = 75/101 (74%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            +LF+FAD  DY+LM  G +GA +HG+S+PVFF+ FG++++  G+      + +H+VAKY+
Sbjct  25   QLFTFADKYDYLLMITGSLGAIIHGSSMPVFFLLFGEMVNGFGKNQSDLPKMTHEVAKYA  84

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            L FVYL +++  SS+ E+ACWM+TGERQ + +R  YL ++L
Sbjct  85   LYFVYLGLIVCLSSYAEIACWMYTGERQVSTLRTKYLEAVL  125



>gb|KJB33609.1| hypothetical protein B456_006G021600 [Gossypium raimondii]
Length=1249

 Score =   112 bits (279),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 48/101 (48%), Positives = 75/101 (74%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            +LF+FAD  DY+LM  G +GA +HG+S+PVFF+ FG++++  G+      + +H+VAKY+
Sbjct  25   QLFTFADKYDYLLMITGSLGAIIHGSSMPVFFLLFGEMVNGFGKNQSDLPKMTHEVAKYA  84

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            L FVYL +++  SS+ E+ACWM+TGERQ + +R  YL ++L
Sbjct  85   LYFVYLGLIVCLSSYAEIACWMYTGERQVSTLRKKYLEAVL  125



>ref|XP_007032497.1| ATP binding cassette subfamily B19 isoform 1 [Theobroma cacao]
 gb|EOY03423.1| ATP binding cassette subfamily B19 isoform 1 [Theobroma cacao]
Length=1256

 Score =   112 bits (279),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 49/101 (49%), Positives = 75/101 (74%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            +LFSFAD  DY LM  G +GA +HG+S+PVFF+ FG++++  G+     ++ +H+VAKY+
Sbjct  25   QLFSFADKYDYFLMISGSLGAIIHGSSMPVFFLLFGEMVNGFGKNQSDLSKMTHEVAKYA  84

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            L FVYL +++  SS+ E+ACWM+TGERQ + +R  YL ++L
Sbjct  85   LYFVYLGLIVCLSSYAEIACWMYTGERQVSTLRKKYLEAVL  125



>ref|XP_011098607.1| PREDICTED: ABC transporter B family member 19 [Sesamum indicum]
Length=1250

 Score =   112 bits (279),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/101 (50%), Positives = 75/101 (74%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            +LFSFAD  D +LM  G +GA +HG+S+PVFF+ FG++++  G+  +   + +H+VAKY+
Sbjct  25   QLFSFADKYDIILMISGSLGAIIHGSSMPVFFLLFGEMVNGFGKNQMDLHKMTHEVAKYA  84

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            L FVYL +V+ FSS+ E+ACWM+TGERQ   +R  YL ++L
Sbjct  85   LYFVYLGLVVCFSSYAEIACWMYTGERQVGALRKKYLEAVL  125



>ref|XP_006435210.1| hypothetical protein CICLE_v10000054mg [Citrus clementina]
 gb|ESR48450.1| hypothetical protein CICLE_v10000054mg [Citrus clementina]
Length=1253

 Score =   111 bits (278),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 49/104 (47%), Positives = 75/104 (72%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            S + LF+ AD +D VLMF+G +GA +HGA++PVFF+ FG++ID +G     P   + +++
Sbjct  36   SFLSLFAAADKIDCVLMFLGSLGAFIHGATLPVFFILFGRMIDSLGHLSSHPHRLTSRIS  95

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            +++L  VYL +V L S+W  VA WM TGERQ A++R+ YL+S+L
Sbjct  96   EHALYLVYLGLVALVSAWIGVAFWMQTGERQTARLRLKYLQSVL  139



>gb|KDO84908.1| hypothetical protein CISIN_1g000851mg [Citrus sinensis]
Length=1253

 Score =   111 bits (278),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 49/104 (47%), Positives = 75/104 (72%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            S + LF+ AD +D VLMF+G +GA +HGA++PVFF+ FG++ID +G     P   + +++
Sbjct  36   SFLSLFAAADKIDCVLMFLGSLGAFIHGATLPVFFILFGRMIDSLGHLSSHPHRLTSRIS  95

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            +++L  VYL +V L S+W  VA WM TGERQ A++R+ YL+S+L
Sbjct  96   EHALYLVYLGLVALVSAWIGVAFWMQTGERQTARLRLKYLQSVL  139



>ref|XP_007032498.1| ATP binding cassette subfamily B19 isoform 2 [Theobroma cacao]
 gb|EOY03424.1| ATP binding cassette subfamily B19 isoform 2 [Theobroma cacao]
Length=1216

 Score =   111 bits (278),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 49/101 (49%), Positives = 75/101 (74%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            +LFSFAD  DY LM  G +GA +HG+S+PVFF+ FG++++  G+     ++ +H+VAKY+
Sbjct  25   QLFSFADKYDYFLMISGSLGAIIHGSSMPVFFLLFGEMVNGFGKNQSDLSKMTHEVAKYA  84

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            L FVYL +++  SS+ E+ACWM+TGERQ + +R  YL ++L
Sbjct  85   LYFVYLGLIVCLSSYAEIACWMYTGERQVSTLRKKYLEAVL  125



>ref|XP_006473687.1| PREDICTED: ABC transporter B family member 13-like isoform X1 
[Citrus sinensis]
Length=1260

 Score =   111 bits (278),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 49/104 (47%), Positives = 75/104 (72%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            S + LF+ AD +D VLMF+G +GA +HGA++PVFF+ FG++ID +G     P   + +++
Sbjct  43   SFLSLFAAADKIDCVLMFLGSLGAFIHGATLPVFFILFGRMIDSLGHLSSHPHRLTSRIS  102

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            +++L  VYL +V L S+W  VA WM TGERQ A++R+ YL+S+L
Sbjct  103  EHALYLVYLGLVALVSAWIGVAFWMQTGERQTARLRLKYLQSVL  146



>ref|XP_009111610.1| PREDICTED: ABC transporter B family member 19-like [Brassica 
rapa]
Length=1252

 Score =   111 bits (278),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 76/101 (75%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            KLFSFAD  D++LM  G +GA +HG+S+PVFF+ FG++++  G+  +   + +H+V++Y+
Sbjct  28   KLFSFADKFDHLLMITGSIGAIIHGSSMPVFFLLFGEMVNGFGKNQMDLHQMTHEVSRYA  87

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            L FVYL +V+  SS+ E+ACWM++GERQ A +R  YL ++L
Sbjct  88   LYFVYLGLVVCVSSYAEIACWMYSGERQVAALRKKYLEAVL  128



>emb|CDY20012.1| BnaA09g02390D [Brassica napus]
Length=1253

 Score =   111 bits (278),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 76/101 (75%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            KLFSFAD  D++LM  G +GA +HG+S+PVFF+ FG++++  G+  +   + +H+V++Y+
Sbjct  28   KLFSFADKFDHLLMITGSIGAIIHGSSMPVFFLLFGEMVNGFGKNQMDLHQMTHEVSRYA  87

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            L FVYL +V+  SS+ E+ACWM++GERQ A +R  YL ++L
Sbjct  88   LYFVYLGLVVCVSSYAEIACWMYSGERQVAALRKKYLEAVL  128



>emb|CAN71068.1| hypothetical protein VITISV_031708 [Vitis vinifera]
Length=1344

 Score =   111 bits (277),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 50/104 (48%), Positives = 73/104 (70%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            S   LF+ AD +D   MF G +GAC+HGA++PVFFV FG++ID +G     P + S +V+
Sbjct  123  SFFGLFAAADTLDCFFMFFGSIGACIHGAALPVFFVLFGRMIDSLGRLSSDPDKLSSQVS  182

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            +++L  VYL + +L S+W  VA WM TGERQ A++R+ YL+S+L
Sbjct  183  RHALYLVYLGLGVLASAWIGVAFWMQTGERQTARLRLKYLQSVL  226



>ref|XP_008230752.1| PREDICTED: ABC transporter B family member 19 [Prunus mume]
 ref|XP_008230753.1| PREDICTED: ABC transporter B family member 19 [Prunus mume]
Length=1249

 Score =   110 bits (276),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 48/101 (48%), Positives = 76/101 (75%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            +LFSFAD  D++LM  G +GA +HG+S+PVFF+ FG++++  G+  +   + + +VAKY+
Sbjct  25   QLFSFADKYDWLLMISGSIGAIIHGSSMPVFFLLFGEMVNGFGKNQMDLKKMTAEVAKYA  84

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            L FVYL +++ FSS+ E+ACWM+TGERQ + +R  YL ++L
Sbjct  85   LYFVYLGLIVCFSSYAEIACWMYTGERQVSTLRKKYLEAVL  125



>ref|XP_007217651.1| hypothetical protein PRUPE_ppa000359mg [Prunus persica]
 gb|EMJ18850.1| hypothetical protein PRUPE_ppa000359mg [Prunus persica]
Length=1249

 Score =   110 bits (276),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 48/101 (48%), Positives = 76/101 (75%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            +LFSFAD  D++LM  G +GA +HG+S+PVFF+ FG++++  G+  +   + + +VAKY+
Sbjct  25   QLFSFADKYDWLLMISGSIGAIIHGSSMPVFFLLFGEMVNGFGKNQMDLKKMTAEVAKYA  84

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            L FVYL +++ FSS+ E+ACWM+TGERQ + +R  YL ++L
Sbjct  85   LYFVYLGLIVCFSSYAEIACWMYTGERQVSTLRKKYLEAVL  125



>gb|KJB11390.1| hypothetical protein B456_001G256100 [Gossypium raimondii]
Length=1249

 Score =   110 bits (276),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 48/101 (48%), Positives = 75/101 (74%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            +LF+FAD  DY+LM  G +GA +HG+S+PVFF+ FG++++  G+      + +H+VAKY+
Sbjct  25   QLFTFADRYDYMLMISGSLGAIIHGSSMPVFFLLFGEMVNGFGKNQSDLPKMTHEVAKYA  84

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            L FVYL +++  SS+ E+ACWM+TGERQ + +R  YL ++L
Sbjct  85   LYFVYLGLIVCLSSYAEIACWMYTGERQVSTLRKKYLEAVL  125



>gb|KHG22495.1| ABC transporter B family member 19 [Gossypium arboreum]
Length=1249

 Score =   110 bits (276),  Expect = 8e-24, Method: Composition-based stats.
 Identities = 48/101 (48%), Positives = 75/101 (74%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            +LF+FAD  DY+LM  G +GA +HG+S+PVFF+ FG++++  G+      + +H+VAKY+
Sbjct  25   QLFTFADRYDYMLMISGSLGAIIHGSSMPVFFLLFGEMVNGFGKNQSDLPKMTHEVAKYA  84

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            L FVYL +++  SS+ E+ACWM+TGERQ + +R  YL ++L
Sbjct  85   LYFVYLGLIVCLSSYAEIACWMYTGERQVSTLRKKYLEAVL  125



>ref|XP_002962569.1| ATP-binding cassette transporter [Selaginella moellendorffii]
 gb|EFJ36032.1| ATP-binding cassette transporter [Selaginella moellendorffii]
Length=1329

 Score =   110 bits (276),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 81/101 (80%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            K+++FAD +DY+LM +G +GA VHG +VPV+F FFG+++D  GE +  P+  + +V+ YS
Sbjct  135  KMYAFADPLDYLLMAIGTLGAVVHGLAVPVYFYFFGRLVDAFGENYANPSSMASEVSTYS  194

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            L  +YL++V+L ++W EV+CWMH+GERQ+AK+R+ YL+S+L
Sbjct  195  LYLLYLALVVLGAAWLEVSCWMHSGERQSAKIRIKYLKSIL  235



>ref|XP_006431131.1| hypothetical protein CICLE_v10010931mg [Citrus clementina]
 gb|ESR44371.1| hypothetical protein CICLE_v10010931mg [Citrus clementina]
Length=1252

 Score =   110 bits (276),  Expect = 8e-24, Method: Composition-based stats.
 Identities = 48/103 (47%), Positives = 74/103 (72%), Gaps = 0/103 (0%)
 Frame = +2

Query  362  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  541
              +LFSFAD  D+ LM  G +GA +HG+S+PVFF+ FG++++  G+      + +H+V K
Sbjct  26   FFQLFSFADKYDWCLMIFGSLGAVIHGSSMPVFFLLFGEMVNGFGKNQTDIHKMTHEVCK  85

Query  542  YSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            Y+L FVYL +++ FSS+ E+ACWM+TGERQ + +R  YL ++L
Sbjct  86   YALYFVYLGLIVCFSSYAEIACWMYTGERQVSTLRKKYLEAVL  128



>ref|XP_006482578.1| PREDICTED: ABC transporter B family member 19-like [Citrus sinensis]
Length=1252

 Score =   110 bits (276),  Expect = 8e-24, Method: Composition-based stats.
 Identities = 48/103 (47%), Positives = 74/103 (72%), Gaps = 0/103 (0%)
 Frame = +2

Query  362  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  541
              +LFSFAD  D+ LM  G +GA +HG+S+PVFF+ FG++++  G+      + +H+V K
Sbjct  26   FFQLFSFADKYDWCLMIFGSLGAVIHGSSMPVFFLLFGEMVNGFGKNQTDIHKMTHEVCK  85

Query  542  YSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            Y+L FVYL +++ FSS+ E+ACWM+TGERQ + +R  YL ++L
Sbjct  86   YALYFVYLGLIVCFSSYAEIACWMYTGERQVSTLRKKYLEAVL  128



>gb|KDO72551.1| hypothetical protein CISIN_1g000856mg [Citrus sinensis]
Length=1252

 Score =   110 bits (276),  Expect = 8e-24, Method: Composition-based stats.
 Identities = 48/103 (47%), Positives = 74/103 (72%), Gaps = 0/103 (0%)
 Frame = +2

Query  362  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  541
              +LFSFAD  D+ LM  G +GA +HG+S+PVFF+ FG++++  G+      + +H+V K
Sbjct  26   FFQLFSFADKYDWCLMIFGSLGAVIHGSSMPVFFLLFGEMVNGFGKNQTDIHKMTHEVCK  85

Query  542  YSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            Y+L FVYL +++ FSS+ E+ACWM+TGERQ + +R  YL ++L
Sbjct  86   YALYFVYLGLIVCFSSYAEIACWMYTGERQVSTLRKKYLEAVL  128



>ref|XP_002283051.2| PREDICTED: ABC transporter B family member 19 [Vitis vinifera]
Length=1250

 Score =   110 bits (275),  Expect = 9e-24, Method: Composition-based stats.
 Identities = 49/101 (49%), Positives = 75/101 (74%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            +LFSFAD  D++LM  G VGA +HG+S+PVFF+ FG++++  G+     ++ + +VAKY+
Sbjct  26   QLFSFADKYDWILMVSGSVGAVIHGSSMPVFFLLFGEMVNGFGKNQTDLSKMTEEVAKYA  85

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            L FVYL +V+  SS+ E+ACWM+TGERQ + +R  YL ++L
Sbjct  86   LYFVYLGVVVCISSYAEIACWMYTGERQVSTLRKKYLEAVL  126



>gb|KJB63497.1| hypothetical protein B456_010G002700 [Gossypium raimondii]
Length=1242

 Score =   110 bits (275),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 50/104 (48%), Positives = 75/104 (72%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            S ++LFS AD +D  LM  G +GAC+HGA++PVFFV FG++ID +G     P + S +V+
Sbjct  29   SFLRLFSAADKLDCALMVFGSLGACIHGAALPVFFVMFGRMIDSLGHLSSDPHKLSAQVS  88

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            ++++  VYL +V+  S+W  VA WM TGERQ A++R+ YL+S+L
Sbjct  89   EHAIYLVYLGLVVFASAWIGVAFWMQTGERQTARLRLKYLQSVL  132



>ref|XP_010552950.1| PREDICTED: ABC transporter B family member 19-like isoform X1 
[Tarenaya hassleriana]
Length=1254

 Score =   110 bits (275),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 76/101 (75%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            +LFSFAD  D++LM  G +GA VHG+S+PVFF+ FG++++  G+  +   + + +V+KY+
Sbjct  30   QLFSFADKYDHLLMITGSLGAVVHGSSMPVFFLLFGEMVNGFGKNQMDLQKMTSEVSKYA  89

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            L FVYL +V+ FSS+ E+ACWM+TGERQ   +R  YL+++L
Sbjct  90   LYFVYLGLVVCFSSYAEIACWMYTGERQVGALRKRYLQAVL  130



>ref|XP_008379345.1| PREDICTED: ABC transporter B family member 19 [Malus domestica]
Length=1250

 Score =   110 bits (275),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 48/103 (47%), Positives = 76/103 (74%), Gaps = 0/103 (0%)
 Frame = +2

Query  362  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  541
              +LFSFAD  D++LM  G +GA VHG+S+PVFF+ FG++++  GE  +   + + +VAK
Sbjct  24   FFQLFSFADKYDWLLMIFGSLGAVVHGSSMPVFFLMFGEMVNGFGENQMNLQKMTAEVAK  83

Query  542  YSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            Y+L FVYL +++  +S+ E+ACWM+TGERQ +++R  YL ++L
Sbjct  84   YALYFVYLGLIVCVTSYAEIACWMYTGERQVSRLRKKYLEAVL  126



>emb|CBI22189.3| unnamed protein product [Vitis vinifera]
Length=1088

 Score =   110 bits (274),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 49/101 (49%), Positives = 75/101 (74%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            +LFSFAD  D++LM  G VGA +HG+S+PVFF+ FG++++  G+     ++ + +VAKY+
Sbjct  26   QLFSFADKYDWILMVSGSVGAVIHGSSMPVFFLLFGEMVNGFGKNQTDLSKMTEEVAKYA  85

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            L FVYL +V+  SS+ E+ACWM+TGERQ + +R  YL ++L
Sbjct  86   LYFVYLGVVVCISSYAEIACWMYTGERQVSTLRKKYLEAVL  126



>ref|XP_002517493.1| multidrug resistance protein 1, 2, putative [Ricinus communis]
 gb|EEF45035.1| multidrug resistance protein 1, 2, putative [Ricinus communis]
Length=1259

 Score =   110 bits (274),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 48/101 (48%), Positives = 74/101 (73%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            +LFSFAD  D++LM  G  GA +HG+S+PVFF+ FG++++  G+      + +H+V+KY+
Sbjct  35   QLFSFADNYDWLLMISGSTGAIIHGSSMPVFFLLFGEMVNGFGKNQSDLTKMTHEVSKYA  94

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            L FVYL +V+  SS+ E+ACWM+TGERQ + +R  YL ++L
Sbjct  95   LYFVYLGLVVCLSSYAEIACWMYTGERQVSTLRKKYLEAVL  135



>ref|XP_003543769.1| PREDICTED: ABC transporter B family member 19-like isoform X1 
[Glycine max]
 gb|KHN13230.1| ABC transporter B family member 19 [Glycine soja]
Length=1249

 Score =   110 bits (274),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 75/101 (74%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            KLFSFAD  D++LM  G +GA VHG+S+PVFF+ FG++++  G+  +   + + +V+KY+
Sbjct  25   KLFSFADKCDWMLMISGSIGAIVHGSSMPVFFLLFGEMVNGFGKNQMDLKKMTEEVSKYA  84

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            L FVYL +V+  SS+ E+ACWM+TGERQ + +R  YL ++L
Sbjct  85   LYFVYLGLVVCISSYAEIACWMYTGERQVSTLRKKYLEAVL  125



>ref|XP_002279471.2| PREDICTED: ABC transporter B family member 13-like [Vitis vinifera]
Length=1254

 Score =   110 bits (274),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 50/104 (48%), Positives = 73/104 (70%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            S   LF+ AD +D   MF G +GAC+HGA++PVFFV FG++ID +G     P + S +V+
Sbjct  33   SFFGLFAAADTLDCFFMFFGSIGACIHGAALPVFFVLFGRMIDSLGRLSSDPDKLSSQVS  92

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            +++L  VYL + +L S+W  VA WM TGERQ A++R+ YL+S+L
Sbjct  93   RHALYLVYLGLGVLASAWIGVAFWMQTGERQTARLRLKYLQSVL  136



>ref|XP_003554410.1| PREDICTED: ABC transporter B family member 19-like isoform X1 
[Glycine max]
Length=1250

 Score =   110 bits (274),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 75/101 (74%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            KLFSFAD  D++LM  G +GA +HG+S+PVFF+ FG++++  G+  +   + + +V+KY+
Sbjct  26   KLFSFADKCDWMLMISGSIGAIIHGSSMPVFFLLFGEMVNGFGKNQMNLKKMTEEVSKYA  85

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            L FVYL +V+  SS+ E+ACWM+TGERQ + +R  YL ++L
Sbjct  86   LYFVYLGLVVCISSYAEIACWMYTGERQVSTLRKKYLEAVL  126



>gb|KDO84910.1| hypothetical protein CISIN_1g000851mg [Citrus sinensis]
Length=782

 Score =   109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 75/104 (72%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            S + LF+ AD +D VLMF+G +GA +HGA++PVFF+ FG++ID +G     P   + +++
Sbjct  36   SFLSLFAAADKIDCVLMFLGSLGAFIHGATLPVFFILFGRMIDSLGHLSSHPHRLTSRIS  95

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            +++L  VYL +V L S+W  VA WM TGERQ A++R+ YL+S+L
Sbjct  96   EHALYLVYLGLVALVSAWIGVAFWMQTGERQTARLRLKYLQSVL  139



>ref|XP_006338462.1| PREDICTED: ABC transporter B family member 19-like [Solanum tuberosum]
Length=1249

 Score =   109 bits (273),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 47/101 (47%), Positives = 75/101 (74%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            +LFSFAD  DY+LM  G +GA +HG+S+PVFF+ FG++++  G+  +   + +H+V+KY+
Sbjct  25   QLFSFADKYDYLLMTCGSIGAILHGSSMPVFFLLFGEMVNGFGKNQMDLHKMTHEVSKYA  84

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            L FVYL +++  SS+ E+ CWM+TGERQ + +R  YL ++L
Sbjct  85   LYFVYLGLIVCASSYAEIGCWMYTGERQVSTLRKKYLEAVL  125



>ref|XP_007151220.1| hypothetical protein PHAVU_004G027800g [Phaseolus vulgaris]
 gb|ESW23214.1| hypothetical protein PHAVU_004G027800g [Phaseolus vulgaris]
Length=1249

 Score =   109 bits (273),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 75/101 (74%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            KLFSFAD  D++LM  G +GA VHG+S+PVFF+ FG++++  G+  +   + + +V+KY+
Sbjct  25   KLFSFADKCDWMLMISGSLGAIVHGSSMPVFFLLFGEMVNGFGKNQMDLKKMTEEVSKYA  84

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            L FVYL +V+  SS+ E+ACWM+TGERQ + +R  YL ++L
Sbjct  85   LYFVYLGLVVCLSSYAEIACWMYTGERQVSTLRKKYLEAVL  125



>ref|NP_001234209.1| L04 [Solanum lycopersicum]
 gb|ABX82928.1| L04 [Solanum lycopersicum]
Length=1249

 Score =   109 bits (273),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 47/101 (47%), Positives = 75/101 (74%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            +LFSFAD  DY+LM  G +GA +HG+S+PVFF+ FG++++  G+  +   + +H+V+KY+
Sbjct  25   QLFSFADKYDYLLMTCGSIGAILHGSSMPVFFLLFGEMVNGFGKNQMDLHKMTHEVSKYA  84

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            L FVYL +++  SS+ E+ CWM+TGERQ + +R  YL ++L
Sbjct  85   LYFVYLGLIVCASSYAEIGCWMYTGERQVSALRKKYLEAVL  125



>ref|XP_011008935.1| PREDICTED: ABC transporter B family member 19 [Populus euphratica]
Length=1251

 Score =   109 bits (273),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 75/101 (74%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            +LFSFAD  D++LM  G +GA +HG+S+PVFF+ FG++++  G+      + +H+V+KY+
Sbjct  27   QLFSFADKYDWLLMISGSIGAIIHGSSMPVFFLLFGEMVNGFGKNQSDLYKMTHEVSKYA  86

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            L FVYL IV+  SS+ E+ACWM+TGERQ + +R  YL ++L
Sbjct  87   LYFVYLGIVVCLSSYAEIACWMYTGERQVSTLRKKYLEAVL  127



>gb|ABX82929.1| LO4 [Solanum pennellii]
Length=1249

 Score =   109 bits (273),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 47/101 (47%), Positives = 75/101 (74%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            +LFSFAD  DY+LM  G +GA +HG+S+PVFF+ FG++++  G+  +   + +H+V+KY+
Sbjct  25   QLFSFADKYDYLLMTCGSIGAILHGSSMPVFFLLFGEMVNGFGKNQMDLHKMTHEVSKYA  84

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            L FVYL +++  SS+ E+ CWM+TGERQ + +R  YL ++L
Sbjct  85   LYFVYLGLIVCASSYAEIGCWMYTGERQVSALRKKYLEAVL  125



>ref|XP_002323847.1| multidrug resistance P-glycoprotein [Populus trichocarpa]
 gb|EEF03980.1| multidrug resistance P-glycoprotein [Populus trichocarpa]
Length=1251

 Score =   109 bits (273),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 75/101 (74%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            +LFSFAD  D++LM  G +GA +HG+S+PVFF+ FG++++  G+      + +H+V+KY+
Sbjct  27   QLFSFADKYDWLLMISGSIGAIIHGSSMPVFFLLFGEMVNGFGKNQSDLYKMTHEVSKYA  86

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            L FVYL IV+  SS+ E+ACWM+TGERQ + +R  YL ++L
Sbjct  87   LYFVYLGIVVCLSSYAEIACWMYTGERQVSTLRKKYLEAVL  127



>ref|XP_006827168.1| hypothetical protein AMTR_s00010p00254310 [Amborella trichopoda]
 gb|ERM94405.1| hypothetical protein AMTR_s00010p00254310 [Amborella trichopoda]
Length=1252

 Score =   109 bits (273),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 48/101 (48%), Positives = 75/101 (74%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            KLFSF+D  D+ +M +G VGA VHG+S+PVFF+FFG +++  G+  +   + + +V+KY+
Sbjct  25   KLFSFSDSYDWFVMTIGTVGAVVHGSSMPVFFLFFGDLVNGFGKNQMDLRKMTEEVSKYA  84

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            L FVYL +++  SS+ E+ACWM+TGERQ + +R  YL ++L
Sbjct  85   LYFVYLGLIVCASSYAEIACWMYTGERQVSALRKKYLEAVL  125



>ref|XP_010439800.1| PREDICTED: ABC transporter B family member 14-like isoform X2 
[Camelina sativa]
Length=1249

 Score =   109 bits (272),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 52/104 (50%), Positives = 71/104 (68%), Gaps = 1/104 (1%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            +LM LF  AD VD  LMF+G +G C+HG ++P FFVFFG ++D +G  +  P   S  V 
Sbjct  35   TLMGLFGAADHVDCFLMFLGGLGNCIHGGTLPFFFVFFGGMLDSLGNLYKDPKAISSHV-  93

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            K +L  VYL +V L S+W  VACWM TGERQ  ++R++YL+S+L
Sbjct  94   KNALYLVYLGLVNLVSAWIGVACWMQTGERQTRRLRISYLKSIL  137



>ref|XP_001759716.1| ATP-binding cassette transporter, subfamily B, member 26, group 
MDR/PGP protein PpABCB26 [Physcomitrella patens]
 gb|EDQ75628.1| ATP-binding cassette transporter, subfamily B, member 26, group 
MDR/PGP protein PpABCB26 [Physcomitrella patens]
Length=1301

 Score =   109 bits (272),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 51/104 (49%), Positives = 70/104 (67%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            SL +LF++AD +D  L+  G + A VHG S+P+F +F G +ID  G     P   +  V 
Sbjct  84   SLFRLFTYADLLDCFLIATGALAAVVHGLSMPIFLLFLGDLIDGFGANINNPKRTAEDVD  143

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            KY++  VYL IV+ F+SW EVA WM TGERQAA++R+ YL+SML
Sbjct  144  KYAVYMVYLGIVVWFASWAEVAAWMQTGERQAARIRVLYLQSML  187



>ref|XP_006306598.1| hypothetical protein CARUB_v10008102mg [Capsella rubella]
 gb|EOA39496.1| hypothetical protein CARUB_v10008102mg [Capsella rubella]
Length=1277

 Score =   108 bits (271),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 58/135 (43%), Positives = 79/135 (59%), Gaps = 31/135 (23%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            SLM LFS AD +DY LM +G +GAC+HGA++P+FFVFFGK++D +G     P   S +V+
Sbjct  32   SLMGLFSAADKLDYFLMLLGGLGACIHGATLPLFFVFFGKMLDSLGNLSTDPKTISSRVS  91

Query  539  KYSL-------------DF------------------VYLSIVILFSSWTEVACWMHTGE  625
            + SL             DF                  VYL +V L S+W  V+CWM TGE
Sbjct  92   QVSLKPAINGNILFLSIDFVVITFHGVLSFFKNALYLVYLGLVNLVSAWIGVSCWMQTGE  151

Query  626  RQAAKMRMAYLRSML  670
            RQ A++R+ YL+S+L
Sbjct  152  RQTARLRINYLKSIL  166



>ref|XP_010108971.1| ABC transporter B family member 19 [Morus notabilis]
 gb|EXC20611.1| ABC transporter B family member 19 [Morus notabilis]
Length=1249

 Score =   108 bits (270),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 73/101 (72%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            +LFSFAD  DY+LM  G VGA +HG+S+P FF+ FG++++  G+  +   + + +V+KYS
Sbjct  25   QLFSFADKYDYLLMISGSVGAVIHGSSMPFFFLLFGQMVNGFGKNQMDLRKMTDEVSKYS  84

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            L FVYL +V+  SS+ E+ACWM+TGERQ   +R  YL ++L
Sbjct  85   LYFVYLGLVVCVSSYAEIACWMYTGERQVGTLRKKYLEAVL  125



>ref|XP_009758464.1| PREDICTED: ABC transporter B family member 19 [Nicotiana sylvestris]
Length=1249

 Score =   108 bits (270),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 47/101 (47%), Positives = 74/101 (73%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            +LFSFAD  DY+LM  G +GA +HG+S+PVFF+ FG++++  G+  +   +  H+V+KY+
Sbjct  25   QLFSFADKYDYLLMISGSIGAIIHGSSMPVFFLLFGEMVNGFGKNQMDLHKMVHEVSKYA  84

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            L FVYL +++  SS+ E+ CWM+TGERQ + +R  YL ++L
Sbjct  85   LYFVYLGLIVCASSYAEIGCWMYTGERQVSALRKKYLEAVL  125



>ref|XP_009591470.1| PREDICTED: ABC transporter B family member 19 [Nicotiana tomentosiformis]
Length=1249

 Score =   108 bits (270),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 47/101 (47%), Positives = 74/101 (73%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            +LFSFAD  DY+LM  G +GA +HG+S+PVFF+ FG++++  G+  +   +  H+V+KY+
Sbjct  25   QLFSFADKYDYLLMISGSIGAIIHGSSMPVFFLLFGEMVNGFGKNQMDLHKMVHEVSKYA  84

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            L FVYL +++  SS+ E+ CWM+TGERQ + +R  YL ++L
Sbjct  85   LYFVYLGLIVCASSYAEIGCWMYTGERQVSALRKKYLEAVL  125



>gb|KEH24996.1| ABC transporter B family protein [Medicago truncatula]
Length=1250

 Score =   108 bits (270),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 75/101 (74%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            +LFSFAD  D++LM  G +GA +HG+S+PVFF+ FG++++  G+  +   + + +V+KY+
Sbjct  26   QLFSFADKYDWILMISGSIGAIIHGSSMPVFFLLFGQMVNGFGKNQMDLKKMTDEVSKYA  85

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            L FVYL +V+  SS+ E+ACWM+TGERQ + +R  YL ++L
Sbjct  86   LYFVYLGLVVCISSYAEIACWMYTGERQVSTLRKKYLEAVL  126



>gb|AAP72956.1| putative MDR-like P-glycoprotein [Lactuca sativa]
Length=1251

 Score =   108 bits (270),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 48/101 (48%), Positives = 72/101 (71%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            +LFSFAD  DY LM +G +GA +HG+S+P FF+ FG++I+  G+        +H+V+KY+
Sbjct  27   QLFSFADKFDYALMILGSIGAIIHGSSMPFFFLLFGQMINGFGKNQSDLNTMTHEVSKYA  86

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            L FVYL +V+  SS+ E+ CWM+TGERQ + +R  YL ++L
Sbjct  87   LYFVYLGLVVCISSYAEIGCWMYTGERQVSTLRKRYLEAVL  127



>ref|XP_004489384.1| PREDICTED: ABC transporter B family member 19-like [Cicer arietinum]
Length=1250

 Score =   108 bits (270),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 47/101 (47%), Positives = 75/101 (74%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            +LFSFAD  D++LM  G +GA +HG+S+PVFF+ FG++++  G+  +   + + +V+KY+
Sbjct  26   QLFSFADKYDWILMISGSIGAIIHGSSMPVFFLLFGQMVNGFGKNQMDLKKMTDEVSKYA  85

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            L FVYL +V+  SS+ E+ACWM+TGERQ + +R  YL ++L
Sbjct  86   LYFVYLGLVVCISSYAEIACWMYTGERQVSTLRKKYLEAVL  126



>gb|KCW51753.1| hypothetical protein EUGRSUZ_J01214 [Eucalyptus grandis]
Length=1250

 Score =   108 bits (269),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 48/101 (48%), Positives = 75/101 (74%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            +LFSFAD  D++LM  G +GA +HG+S+PVFF+ FG++++  G+      + + +V+KY+
Sbjct  25   QLFSFADKYDWLLMISGSLGAIIHGSSMPVFFLLFGEMVNGFGKNQSDLKKMTQEVSKYA  84

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            L FVYL +V+  SS+ E+ACWM+TGERQA+ +R  YL ++L
Sbjct  85   LYFVYLGLVVCLSSYAEIACWMYTGERQASTLRKKYLEAVL  125



>ref|XP_010032346.1| PREDICTED: ABC transporter B family member 19 [Eucalyptus grandis]
 gb|KCW51754.1| hypothetical protein EUGRSUZ_J01214 [Eucalyptus grandis]
Length=1249

 Score =   108 bits (269),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 48/101 (48%), Positives = 75/101 (74%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            +LFSFAD  D++LM  G +GA +HG+S+PVFF+ FG++++  G+      + + +V+KY+
Sbjct  25   QLFSFADKYDWLLMISGSLGAIIHGSSMPVFFLLFGEMVNGFGKNQSDLKKMTQEVSKYA  84

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            L FVYL +V+  SS+ E+ACWM+TGERQA+ +R  YL ++L
Sbjct  85   LYFVYLGLVVCLSSYAEIACWMYTGERQASTLRKKYLEAVL  125



>ref|XP_004136487.1| PREDICTED: ABC transporter B family member 13-like [Cucumis sativus]
Length=1281

 Score =   108 bits (269),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 51/104 (49%), Positives = 70/104 (67%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            S   LF  ADG+D +LM  G +GA VHGAS+PVFFV FG++ID +G     P   S ++ 
Sbjct  61   SFFGLFGAADGIDCLLMVFGSLGAFVHGASLPVFFVLFGRMIDSLGHLSKHPHRLSSRIV  120

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            + +L  +YL +++L S+W  VA WM TGERQ A++RM YL S+L
Sbjct  121  ENALYLIYLGLIVLASAWIGVAFWMQTGERQTARLRMKYLNSIL  164



>ref|XP_010693227.1| PREDICTED: ABC transporter B family member 19 [Beta vulgaris 
subsp. vulgaris]
Length=1250

 Score =   108 bits (269),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 48/101 (48%), Positives = 74/101 (73%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            +LFSFAD  DY LM +G +GA +HG+S+PVFF+ FG++++  G+        +H+V+KY+
Sbjct  26   QLFSFADKYDYFLMSLGSLGAVIHGSSMPVFFLLFGEMVNGFGKNQSDLQTMTHEVSKYA  85

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            L FVYL +++  SS+ E+ACWM++GERQA  +R  YL ++L
Sbjct  86   LYFVYLGLIVCVSSYAEIACWMYSGERQAGALREKYLEAVL  126



>ref|XP_010266821.1| PREDICTED: ABC transporter B family member 13-like [Nelumbo nucifera]
Length=1248

 Score =   107 bits (268),  Expect = 8e-23, Method: Composition-based stats.
 Identities = 47/104 (45%), Positives = 74/104 (71%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            SL  LF+FAD  DY LMF+  +G+ +HGA++P+FFVFFG++I+ +      P   + +++
Sbjct  33   SLFGLFAFADTFDYFLMFLATIGSIIHGAALPLFFVFFGRLINSLDSIAKDPHRLTSEIS  92

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            + +L FVYL +++  S+W  +A WM TGERQAA +R+ YL+S+L
Sbjct  93   QEALHFVYLGVLVFASAWMGIAFWMQTGERQAACLRLKYLQSVL  136



>gb|KGN60047.1| hypothetical protein Csa_3G873270 [Cucumis sativus]
Length=1248

 Score =   107 bits (268),  Expect = 8e-23, Method: Composition-based stats.
 Identities = 51/104 (49%), Positives = 70/104 (67%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            S   LF  ADG+D +LM  G +GA VHGAS+PVFFV FG++ID +G     P   S ++ 
Sbjct  28   SFFGLFGAADGIDCLLMVFGSLGAFVHGASLPVFFVLFGRMIDSLGHLSKHPHRLSSRIV  87

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            + +L  +YL +++L S+W  VA WM TGERQ A++RM YL S+L
Sbjct  88   ENALYLIYLGLIVLASAWIGVAFWMQTGERQTARLRMKYLNSIL  131



>gb|AIU41631.1| ABC transporter family protein [Hevea brasiliensis]
Length=1259

 Score =   107 bits (267),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 73/100 (73%), Gaps = 0/100 (0%)
 Frame = +2

Query  371  LFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSL  550
            LFSFAD  D++LM  G +GA +HG+S+PVFF+ FG++++  G+      + +H+V+KY+L
Sbjct  36   LFSFADKYDWLLMISGSLGAIIHGSSMPVFFLLFGEMVNGFGKNQSDLPKMTHEVSKYAL  95

Query  551  DFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
             FVYL +V+  SS+ E+ACWM+TGERQ   +R  YL ++L
Sbjct  96   YFVYLGLVVCISSYAEIACWMYTGERQVGTLRKKYLEAVL  135



>ref|XP_004164800.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter B family member 
13-like [Cucumis sativus]
Length=1248

 Score =   107 bits (267),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 51/104 (49%), Positives = 70/104 (67%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            S   LF  ADG+D +LM  G +GA VHGAS+PVFFV FG++ID +G     P   S ++ 
Sbjct  28   SXFGLFGAADGIDCLLMVFGSLGAFVHGASLPVFFVLFGRMIDSLGHLSKHPHRLSSRIV  87

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            + +L  +YL +++L S+W  VA WM TGERQ A++RM YL S+L
Sbjct  88   ENALYLIYLGLIVLASAWIGVAFWMQTGERQTARLRMKYLNSIL  131



>ref|XP_010069803.1| PREDICTED: ABC transporter B family member 13-like [Eucalyptus 
grandis]
 gb|KCW58265.1| hypothetical protein EUGRSUZ_H00958 [Eucalyptus grandis]
Length=1253

 Score =   107 bits (267),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 49/104 (47%), Positives = 71/104 (68%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            S   LF  AD +D VLMF G  GAC+HGA++PVFFV FG++ID +G+    P   S +V+
Sbjct  40   SFFGLFVAADKIDCVLMFFGSAGACIHGAALPVFFVLFGRMIDSLGKLSSDPHGLSSRVS  99

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            + +L  VYL +++  S+W  VA W  TGERQ A++R+ YL+++L
Sbjct  100  EDALYLVYLGVIVFASAWIGVALWTQTGERQTARLRLKYLQAVL  143



>ref|XP_009415585.1| PREDICTED: ABC transporter B family member 19 [Musa acuminata 
subsp. malaccensis]
Length=1255

 Score =   107 bits (267),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 50/101 (50%), Positives = 73/101 (72%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            +LFSFAD  D +LM  G VGA VHG+++PVFF+ FG +++  G+        +H+V+KY+
Sbjct  29   ELFSFADRWDCLLMAAGSVGAVVHGSAMPVFFLLFGDLVNGFGKNQHHLMVMTHEVSKYA  88

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            L FVYL +V+  SS+ E+ACWM+TGERQA+ +R  YL ++L
Sbjct  89   LYFVYLGLVVCLSSYAEIACWMYTGERQASALRRKYLEAVL  129



>ref|XP_008459308.1| PREDICTED: ABC transporter B family member 19 [Cucumis melo]
Length=1250

 Score =   107 bits (266),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 47/101 (47%), Positives = 74/101 (73%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            +LFSFAD  D+ LM +G  GA +HG+S+PVFF+ FG++++  G+      + + +V+KY+
Sbjct  26   QLFSFADKYDWFLMILGSFGAIIHGSSMPVFFLLFGEMVNGFGKNQSNFHKMTAEVSKYA  85

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            L FVYL +++ FSS+ E+ACWM+TGERQ + +R  YL ++L
Sbjct  86   LYFVYLGLIVCFSSYAEIACWMYTGERQVSTLRKKYLEAVL  126



>ref|XP_004148691.1| PREDICTED: ABC transporter B family member 19-like [Cucumis sativus]
Length=1250

 Score =   107 bits (266),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 47/101 (47%), Positives = 74/101 (73%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            +LFSFAD  D+ LM +G  GA +HG+S+PVFF+ FG++++  G+      + + +V+KY+
Sbjct  26   QLFSFADKYDWFLMILGSFGAIIHGSSMPVFFLLFGEMVNGFGKNQSNFHKMTAEVSKYA  85

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            L FVYL +++ FSS+ E+ACWM+TGERQ + +R  YL ++L
Sbjct  86   LYFVYLGLIVCFSSYAEIACWMYTGERQVSTLRKKYLEAVL  126



>ref|XP_009395922.1| PREDICTED: ABC transporter B family member 19-like [Musa acuminata 
subsp. malaccensis]
Length=1256

 Score =   107 bits (266),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 49/101 (49%), Positives = 73/101 (72%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            +LFSFAD  D +LM  G VGA VHG+++PVFF+ FG +++  G+     +  +H+V+KY+
Sbjct  30   ELFSFADRWDCLLMAAGSVGAVVHGSAMPVFFLLFGDLVNGFGKNQTHLSVMTHEVSKYA  89

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            L FVYL +V+  SS+ E+ CWM+TGERQA+ +R  YL ++L
Sbjct  90   LYFVYLGLVVCLSSYAEIGCWMYTGERQASALRRRYLEAVL  130



>ref|XP_008788471.1| PREDICTED: ABC transporter B family member 13-like [Phoenix dactylifera]
Length=1276

 Score =   107 bits (266),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 46/100 (46%), Positives = 71/100 (71%), Gaps = 0/100 (0%)
 Frame = +2

Query  371  LFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYSL  550
            LFSFAD  D +LM  G +GACVHGA++P+FF+ FG++ID +G     P   + +V+K++L
Sbjct  55   LFSFADRFDCLLMIFGGIGACVHGAALPIFFLLFGRLIDSLGSLSADPQRLASEVSKHAL  114

Query  551  DFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
              VY+ ++++ S+W  VA W  TGERQ A++R+ Y+ S+L
Sbjct  115  QLVYVGLLVMASAWIGVAFWAETGERQTARLRVKYIHSVL  154



>ref|XP_010256924.1| PREDICTED: ABC transporter B family member 19 [Nelumbo nucifera]
Length=1249

 Score =   106 bits (265),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 48/101 (48%), Positives = 72/101 (71%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            +LFSFAD  D+VLM  G +GA VHG+++PVFF+ FG +++  G+      + + +VAKY+
Sbjct  25   QLFSFADKYDWVLMIAGSIGAVVHGSAMPVFFLLFGDMVNGFGKNQSDLKKMTEEVAKYA  84

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            L FVYL +V+  SS+ E+ACWM++GERQ   +R  YL ++L
Sbjct  85   LYFVYLGLVVCLSSYAEIACWMYSGERQVISLRKKYLEAVL  125



>ref|XP_008341564.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter B family member 
19-like [Malus domestica]
Length=1250

 Score =   106 bits (265),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 75/101 (74%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            +LFSFAD  D++LM  G +GA VHG+S+P+FF+ FG++++  GE  +   + + +VAKY+
Sbjct  26   QLFSFADKYDWMLMIFGSLGAVVHGSSMPLFFLMFGEMVNGFGENQMNLQKMTAEVAKYA  85

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            L FVYL +++  +S+ E+ACWM+TGERQ + +R  YL ++L
Sbjct  86   LYFVYLGLIVCVTSYAEIACWMYTGERQVSTLRKKYLEAVL  126



>ref|XP_009347047.1| PREDICTED: ABC transporter B family member 19 [Pyrus x bretschneideri]
Length=1250

 Score =   106 bits (265),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 75/101 (74%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            +LFSFAD  D++LM  G +GA VHG+S+P+FF+ FG++++  GE  +   + + +VAKY+
Sbjct  26   QLFSFADKYDWMLMIFGSLGAVVHGSSMPLFFLMFGEMVNGFGENQMNLQKMTAEVAKYA  85

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            L FVYL +++  +S+ E+ACWM+TGERQ + +R  YL ++L
Sbjct  86   LYFVYLGLIVCVTSYAEIACWMYTGERQVSTLRKKYLEAVL  126



>gb|KGN52452.1| Multidrug resistance protein 1, 2 [Cucumis sativus]
Length=1361

 Score =   106 bits (264),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 47/101 (47%), Positives = 74/101 (73%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            +LFSFAD  D+ LM +G  GA +HG+S+PVFF+ FG++++  G+      + + +V+KY+
Sbjct  137  QLFSFADKYDWFLMILGSFGAIIHGSSMPVFFLLFGEMVNGFGKNQSNFHKMTAEVSKYA  196

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            L FVYL +++ FSS+ E+ACWM+TGERQ + +R  YL ++L
Sbjct  197  LYFVYLGLIVCFSSYAEIACWMYTGERQVSTLRKKYLEAVL  237



>ref|XP_010554005.1| PREDICTED: ABC transporter B family member 19-like [Tarenaya 
hassleriana]
Length=1250

 Score =   106 bits (264),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 73/101 (72%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            KLFSFAD  D + M  G +GA VHG+S+PVFF+ FG++++  G+  +   + + +V+KY+
Sbjct  26   KLFSFADKYDCLFMITGSLGAIVHGSSMPVFFLIFGEMVNGFGKNQMDLHKLTDEVSKYA  85

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            L F+YL +V+ FSS+ E+ACWM+TGERQ   +R  YL ++L
Sbjct  86   LYFIYLGLVVCFSSYAEIACWMYTGERQVGALRKKYLEAVL  126



>ref|XP_004304313.1| PREDICTED: ABC transporter B family member 19 [Fragaria vesca 
subsp. vesca]
Length=1250

 Score =   106 bits (264),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 47/101 (47%), Positives = 74/101 (73%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            +LFSFAD  D +LM  G +GA +HG+S+PVFF+ FG++++  G+  +   + + +VAKY+
Sbjct  26   QLFSFADKYDCLLMVSGSIGAIIHGSSMPVFFLLFGEMVNGFGKNQMDLHKMTAEVAKYA  85

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            L FVYL +++  SS+ E+ACWM+TGERQ + +R  YL ++L
Sbjct  86   LYFVYLGLIVCVSSYAEIACWMYTGERQVSTLRKKYLEAVL  126



>ref|XP_011094609.1| PREDICTED: ABC transporter B family member 1-like [Sesamum indicum]
Length=1378

 Score =   105 bits (262),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 49/103 (48%), Positives = 69/103 (67%), Gaps = 0/103 (0%)
 Frame = +2

Query  362  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  541
            L +LF FADG+DYVLM +G VGA VHG+S+P+F  FF  +++  G       + + +V K
Sbjct  115  LSELFRFADGLDYVLMAIGSVGAIVHGSSLPLFLRFFADLVNSFGSNANDVDKMTQEVLK  174

Query  542  YSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            Y+L F+ +   I  SSW E++CWM TGERQ+ KMR+ YL + L
Sbjct  175  YALYFLVVGAAIWASSWAEISCWMWTGERQSTKMRIKYLEAAL  217



>ref|XP_009334844.1| PREDICTED: ABC transporter B family member 13-like [Pyrus x bretschneideri]
Length=1245

 Score =   105 bits (261),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 53/104 (51%), Positives = 75/104 (72%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            S + LF+ AD VD VLMF+G VGAC+HG  +PVFFV FG++ID +G   + P + S +++
Sbjct  33   SFLGLFAAADKVDCVLMFLGSVGACIHGGVLPVFFVLFGRMIDSLGHLAMNPQQQSARIS  92

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            +Y+L  VYL +V+  S+W  VA W  TGERQ A++RM YL+S+L
Sbjct  93   EYALYLVYLGLVLFASAWIGVAFWTRTGERQTARLRMKYLQSVL  136



>ref|XP_010939542.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter B family member 
19-like [Elaeis guineensis]
Length=1253

 Score =   105 bits (261),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 72/101 (71%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            +LF+FAD  D  LM  G VGA VHG+++PVFF+ FG +++  G+      + +++V+KY+
Sbjct  27   ELFAFADRCDLALMAAGSVGAVVHGSAMPVFFLLFGDLVNGFGKNQADLGKMTNEVSKYA  86

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            L FVYL +++  SS+ E+ACWM+TGERQA  +R  YL ++L
Sbjct  87   LYFVYLGLIVCLSSYAEIACWMYTGERQAGALRRRYLEAVL  127



>dbj|BAK05967.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1266

 Score =   105 bits (261),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 72/101 (71%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            +LFSFAD +D++LM  G  GA VHGA++PVFF+ FG++++  G+        + +V+KYS
Sbjct  40   ELFSFADPLDWLLMAAGSAGAVVHGAAMPVFFLLFGELVNGFGKNQHHLRRMTDEVSKYS  99

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            L FVYL +V+  SS+ E+ACWM+TGERQ   +R  YL ++L
Sbjct  100  LYFVYLGLVVCASSYLEIACWMYTGERQVGALRRRYLEAVL  140



>gb|KDP45498.1| hypothetical protein JCGZ_09747 [Jatropha curcas]
Length=1253

 Score =   105 bits (261),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 46/101 (46%), Positives = 72/101 (71%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            +LFSFAD  D++LM  G +GA +HG+S+PVFF+ FG++++  G+      + + +V+KY+
Sbjct  29   QLFSFADKYDWLLMISGSIGAIIHGSSMPVFFLLFGEMVNGFGKNQSDLPKMTDEVSKYA  88

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            L FVYL +V+  SS+ E+ CWM+TGERQ   +R  YL ++L
Sbjct  89   LYFVYLGLVVCLSSYAEIGCWMYTGERQVGTLRKKYLEAVL  129



>ref|XP_008387923.1| PREDICTED: ABC transporter B family member 13-like [Malus domestica]
Length=1245

 Score =   104 bits (260),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 53/104 (51%), Positives = 75/104 (72%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            S + LF+ AD VD VLMF+G VGAC+HG  +PVFFV FG++ID +G   + P + S +++
Sbjct  33   SFLGLFAAADKVDCVLMFLGSVGACIHGGVLPVFFVLFGRMIDSLGHLAMNPQQLSARIS  92

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            +Y+L  VYL +V+  S+W  VA W  TGERQ A++RM YL+S+L
Sbjct  93   EYALYLVYLGLVLFASAWIGVAFWTRTGERQTARLRMKYLQSVL  136



>ref|XP_009339152.1| PREDICTED: ABC transporter B family member 1-like [Pyrus x bretschneideri]
Length=1345

 Score =   104 bits (260),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 47/101 (47%), Positives = 66/101 (65%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            +LF FADG+DYVLM +G VGA VHG S+P+F  FF  +++  G       +  H+V KY+
Sbjct  85   ELFRFADGLDYVLMAIGSVGALVHGCSLPIFLRFFADLVNSFGSNANDMDKMMHEVLKYA  144

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            L F+ +   +   SW E++CWM TGERQ+ KMR+ YL + L
Sbjct  145  LSFLVVGAAVWAGSWAEISCWMWTGERQSTKMRIKYLEAAL  185



>ref|XP_004304461.2| PREDICTED: ABC transporter B family member 1 [Fragaria vesca 
subsp. vesca]
Length=1354

 Score =   104 bits (259),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 67/101 (66%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            ++F FADG+DYVLM +G VGA VHG S+P+F  FF  +++  G     P +   +V KY+
Sbjct  94   QVFRFADGLDYVLMGIGSVGAIVHGCSLPIFLRFFADLVNSFGANADHPDKMMQEVLKYA  153

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            L F+ +   I  SSW E++CWM TGERQ+ KMR+ YL + L
Sbjct  154  LYFLVVGAAIWASSWAEISCWMWTGERQSTKMRIKYLEAAL  194



>ref|XP_004173028.1| PREDICTED: ABC transporter B family member 19-like, partial [Cucumis 
sativus]
Length=848

 Score =   103 bits (258),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 74/101 (73%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            +LFSFAD  D+ LM +G  GA +HG+S+PVFF+ FG++++  G+      + + +V+KY+
Sbjct  26   QLFSFADKYDWFLMILGSFGAIIHGSSMPVFFLLFGEMVNGFGKNQSNFHKMTAEVSKYA  85

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            L FVYL +++ FSS+ E+ACWM+TGERQ + +R  YL ++L
Sbjct  86   LYFVYLGLIVCFSSYAEIACWMYTGERQVSTLRKKYLEAVL  126



>ref|XP_004494063.1| PREDICTED: ABC transporter B family member 1-like, partial [Cicer 
arietinum]
Length=1283

 Score =   104 bits (259),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 67/101 (66%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            +LF FADG+DY+LM +G VGA VHG S+P+F  FF  +++  G       + +H+V KY+
Sbjct  98   ELFRFADGLDYILMTIGTVGAIVHGCSLPIFLRFFADLVNSFGSNANNLDKMTHEVVKYA  157

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
              F+ +   I  SSW E++CWM TGERQ+ KMR+ YL + L
Sbjct  158  FYFLVVGAAIWASSWAEISCWMWTGERQSTKMRIKYLEAAL  198



>gb|KEH42187.1| ABC transporter B family protein [Medicago truncatula]
Length=1321

 Score =   104 bits (259),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 68/101 (67%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            +LF FADG+DYVLM +G +GA VHG S+P+F  FF  +++  G       + + +VAKY+
Sbjct  62   ELFRFADGLDYVLMIIGSLGAVVHGCSLPLFLRFFADLVNSFGSNANNLDKMTQEVAKYA  121

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            L F+ +   I  SSW E++CWM TGERQ+ KMR+ YL + L
Sbjct  122  LYFLIVGAAIWASSWAEISCWMWTGERQSTKMRIKYLEAAL  162



>gb|AFP44695.1| hypothetical protein [Eragrostis tef]
Length=1354

 Score =   104 bits (259),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 52/103 (50%), Positives = 65/103 (63%), Gaps = 0/103 (0%)
 Frame = +2

Query  362  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  541
            L  LF FADG+D VLM VG +GA VHG S+PVF  FF  ++D  G     P      VAK
Sbjct  104  LGSLFRFADGLDCVLMSVGTLGALVHGCSLPVFLRFFADLVDSFGSHADDPDTMVRLVAK  163

Query  542  YSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            Y+L F+ +   I  SSW E++CWM TGERQ+ +MR+ YL S L
Sbjct  164  YALYFLVVGAAIWASSWAEISCWMWTGERQSTRMRIRYLESAL  206



>gb|KHG13479.1| ABC transporter B family member 13 [Gossypium arboreum]
Length=1239

 Score =   104 bits (259),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 50/104 (48%), Positives = 72/104 (69%), Gaps = 3/104 (3%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            S + LFS AD +D  LM  G +GAC+HGA++PVFFV FG++ID +G     P + S   A
Sbjct  29   SFLGLFSAADKLDCALMVFGSLGACIHGAALPVFFVMFGRMIDSLGHLSSDPHKLS---A  85

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            ++++  VYL +V+  S+W  VA WM TGERQ A++R+ YL+S+L
Sbjct  86   QHAIYLVYLGLVVFASAWIGVAFWMQTGERQTARLRLKYLQSVL  129



>ref|XP_008369562.1| PREDICTED: ABC transporter B family member 1-like [Malus domestica]
Length=1346

 Score =   103 bits (258),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 47/101 (47%), Positives = 66/101 (65%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            +LF FADG+DYVLM +G VGA VHG S+P+F  FF  +++  G       +  H+V KY+
Sbjct  86   ELFRFADGLDYVLMAIGSVGALVHGCSLPIFLRFFADLVNSFGSNANDMDKMXHEVLKYA  145

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            L F+ +   +   SW E++CWM TGERQ+ KMR+ YL + L
Sbjct  146  LYFLVVGAAVWAGSWAEISCWMWTGERQSTKMRIKYLEAAL  186



>ref|NP_001052982.1| Os04g0459000 [Oryza sativa Japonica Group]
 dbj|BAF14896.1| Os04g0459000 [Oryza sativa Japonica Group]
 gb|EEE61119.1| hypothetical protein OsJ_15045 [Oryza sativa Japonica Group]
Length=1259

 Score =   103 bits (257),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 71/101 (70%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            +LF FAD +D++LM  G  GA VHGA++PVFF+ FG++I+  G+        + +V+KYS
Sbjct  33   ELFGFADPLDWLLMAAGSAGAVVHGAAMPVFFLLFGELINGFGKNQHSLRRMTDEVSKYS  92

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            L FVYL +V+  SS+ E+ACWM+TGERQ   +R  YL ++L
Sbjct  93   LYFVYLGLVVCASSYLEIACWMYTGERQVGALRRRYLEAVL  133



>ref|XP_010234205.1| PREDICTED: ABC transporter B family member 1 [Brachypodium distachyon]
Length=1376

 Score =   103 bits (257),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 67/104 (64%), Gaps = 0/104 (0%)
 Frame = +2

Query  359  SLMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVA  538
            +L  LF FADG+D VLM VG +GA VHG S+PVF  FF  ++D  G     P      V+
Sbjct  112  ALRDLFRFADGLDRVLMAVGTLGALVHGCSLPVFLRFFADLVDSFGSHAGDPDTMVRLVS  171

Query  539  KYSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            KY+L F+ +   I  SSW E+ACWM TGERQ+A+MR+ YL + L
Sbjct  172  KYALYFLVVGAAIWASSWAEIACWMWTGERQSARMRVRYLSAAL  215



>ref|XP_006652374.1| PREDICTED: ABC transporter B family member 19-like [Oryza brachyantha]
Length=1255

 Score =   103 bits (257),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 71/101 (70%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            +LF FAD +D++LM  G  GA VHGA++PVFF+ FG++I+  G+        + +V+KYS
Sbjct  29   ELFGFADPLDWLLMAAGSAGAVVHGAAMPVFFLLFGELINGFGKNQHSLRRMTDEVSKYS  88

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            L FVYL +V+  SS+ E+ACWM+TGERQ   +R  YL ++L
Sbjct  89   LYFVYLGLVVCASSYLEIACWMYTGERQVGALRRRYLEAVL  129



>ref|XP_009339155.1| PREDICTED: ABC transporter B family member 1 [Pyrus x bretschneideri]
Length=1345

 Score =   103 bits (257),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 47/101 (47%), Positives = 66/101 (65%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            +LF FADG+DYVLM +G VGA VHG S+P+F  FF  +++  G       +  H+V KY+
Sbjct  85   ELFRFADGLDYVLMAIGSVGALVHGCSLPIFLRFFADLVNSFGSNANDMDKMMHEVLKYA  144

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            L F+ +   +   SW E++CWM TGERQ+ KMR+ YL + L
Sbjct  145  LYFLVVGAAVWAGSWAEISCWMWTGERQSTKMRIKYLEAAL  185



>ref|XP_006843046.1| hypothetical protein AMTR_s00076p00195870 [Amborella trichopoda]
 gb|ERN04721.1| hypothetical protein AMTR_s00076p00195870 [Amborella trichopoda]
Length=1332

 Score =   103 bits (257),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 47/103 (46%), Positives = 65/103 (63%), Gaps = 0/103 (0%)
 Frame = +2

Query  362  LMKLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAK  541
             MKLF +ADG+D VLM +G  GA VHG+S+P+F  FF  +++  G     P +   +V K
Sbjct  79   FMKLFRYADGLDCVLMVLGTAGAIVHGSSLPIFLRFFADLVNSFGSNADNPDKMMQEVLK  138

Query  542  YSLDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            Y+  F+ +   I  SSW E++CWM TGERQ  KMR+ YL + L
Sbjct  139  YAFYFLVVGAAIWGSSWAEISCWMWTGERQTTKMRIKYLEAAL  181



>ref|NP_001169660.1| uncharacterized protein LOC100383541 [Zea mays]
 gb|ACN34410.1| unknown [Zea mays]
 gb|AFW58473.1| hypothetical protein ZEAMMB73_248443 [Zea mays]
Length=1264

 Score =   103 bits (256),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 71/101 (70%), Gaps = 0/101 (0%)
 Frame = +2

Query  368  KLFSFADGVDYVLMFVGFVGACVHGASVPVFFVFFGKIIDVIGEAFLFPAEASHKVAKYS  547
            +LF FAD +D++LM  G  GA VHGA++PVFF+ FG++++  G+        + +V+KYS
Sbjct  40   ELFGFADPLDWLLMAAGSAGAVVHGAAMPVFFLLFGELVNGFGKNQHNLRRMTDEVSKYS  99

Query  548  LDFVYLSIVILFSSWTEVACWMHTGERQAAKMRMAYLRSML  670
            L FVYL +V+  SS+ E+ACWM+TGERQ   +R  YL ++L
Sbjct  100  LYFVYLGLVVCASSYLEIACWMYTGERQVGALRRRYLEAVL  140



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1077565505600