BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF052B19

Length=616
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006345419.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      254   7e-76   Solanum tuberosum [potatoes]
ref|XP_010324687.1|  PREDICTED: alpha-N-acetylglucosaminidase iso...    254   8e-76   Solanum lycopersicum
ref|XP_009611357.1|  PREDICTED: LOW QUALITY PROTEIN: alpha-N-acet...    254   2e-75   
ref|XP_009758541.1|  PREDICTED: alpha-N-acetylglucosaminidase           253   2e-75   Nicotiana sylvestris
ref|XP_011087998.1|  PREDICTED: alpha-N-acetylglucosaminidase           253   3e-75   Sesamum indicum [beniseed]
gb|EYU27032.1|  hypothetical protein MIMGU_mgv1a001508mg                249   8e-74   Erythranthe guttata [common monkey flower]
emb|CDP19299.1|  unnamed protein product                                248   1e-73   Coffea canephora [robusta coffee]
ref|XP_002273084.1|  PREDICTED: alpha-N-acetylglucosaminidase iso...    248   1e-73   
emb|CBI24942.3|  unnamed protein product                                249   2e-73   Vitis vinifera
emb|CAA77084.1|  alpha-N-acetylglucosaminidase                          246   7e-73   Nicotiana tabacum [American tobacco]
ref|XP_008356745.1|  PREDICTED: alpha-N-acetylglucosaminidase-lik...    235   1e-72   
ref|XP_008356744.1|  PREDICTED: alpha-N-acetylglucosaminidase-lik...    236   2e-72   
ref|XP_008375270.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      236   2e-72   
ref|XP_002314048.1|  hypothetical protein POPTR_0009s06320g             244   5e-72   Populus trichocarpa [western balsam poplar]
ref|XP_004499942.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      244   6e-72   Cicer arietinum [garbanzo]
ref|XP_011025477.1|  PREDICTED: alpha-N-acetylglucosaminidase           243   2e-71   Populus euphratica
ref|XP_007148897.1|  hypothetical protein PHAVU_005G023300g             242   2e-71   Phaseolus vulgaris [French bean]
ref|XP_007148898.1|  hypothetical protein PHAVU_005G023300g             242   2e-71   Phaseolus vulgaris [French bean]
ref|XP_003599415.1|  Alpha-N-acetylglucosaminidase                      236   5e-71   
ref|XP_008231468.1|  PREDICTED: alpha-N-acetylglucosaminidase           240   2e-70   Prunus mume [ume]
ref|XP_007052478.1|  Alpha-N-acetylglucosaminidase family / NAGLU...    240   2e-70   
ref|XP_010257138.1|  PREDICTED: alpha-N-acetylglucosaminidase iso...    239   3e-70   Nelumbo nucifera [Indian lotus]
gb|KDP43563.1|  hypothetical protein JCGZ_16850                         239   3e-70   Jatropha curcas
gb|KJB24983.1|  hypothetical protein B456_004G170700                    238   6e-70   Gossypium raimondii
ref|XP_004135943.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      237   1e-69   Cucumis sativus [cucumbers]
gb|AES69667.2|  alpha-N-acetylglucosaminidase family protein            237   1e-69   Medicago truncatula
gb|KJB24984.1|  hypothetical protein B456_004G170700                    237   1e-69   Gossypium raimondii
ref|XP_003599416.1|  Alpha-N-acetylglucosaminidase                      238   1e-69   
gb|AES69665.2|  alpha-N-acetylglucosaminidase family protein            237   2e-69   Medicago truncatula
gb|KGN45103.1|  hypothetical protein Csa_7G425950                       237   2e-69   Cucumis sativus [cucumbers]
gb|KJB24982.1|  hypothetical protein B456_004G170700                    238   2e-69   Gossypium raimondii
ref|XP_002517786.1|  alpha-n-acetylglucosaminidase, putative            221   2e-69   
ref|XP_003599414.1|  Alpha-N-acetylglucosaminidase                      238   2e-69   
ref|XP_007218923.1|  hypothetical protein PRUPE_ppa001555mg             237   2e-69   Prunus persica
ref|XP_003535842.1|  PREDICTED: alpha-N-acetylglucosaminidase-lik...    237   3e-69   Glycine max [soybeans]
gb|KHM99190.1|  Alpha-N-acetylglucosaminidase                           237   3e-69   Glycine soja [wild soybean]
ref|XP_008461320.1|  PREDICTED: alpha-N-acetylglucosaminidase           235   6e-69   Cucumis melo [Oriental melon]
gb|EPS69705.1|  hypothetical protein M569_05058                         224   6e-69   Genlisea aurea
ref|XP_009368036.1|  PREDICTED: alpha-N-acetylglucosaminidase           236   8e-69   Pyrus x bretschneideri [bai li]
ref|XP_006482916.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      234   2e-68   Citrus sinensis [apfelsine]
ref|XP_006438966.1|  hypothetical protein CICLE_v10030724mg             234   2e-68   Citrus clementina [clementine]
gb|KDO83338.1|  hypothetical protein CISIN_1g003545mg                   234   2e-68   Citrus sinensis [apfelsine]
gb|KHG14952.1|  Alpha-N-acetylglucosaminidase                           229   2e-66   Gossypium arboreum [tree cotton]
ref|XP_010097439.1|  hypothetical protein L484_004673                   228   4e-66   
ref|XP_010067843.1|  PREDICTED: alpha-N-acetylglucosaminidase           228   5e-66   Eucalyptus grandis [rose gum]
gb|KFK25597.1|  hypothetical protein AALP_AA8G134900                    218   7e-66   Arabis alpina [alpine rockcress]
ref|XP_010938527.1|  PREDICTED: alpha-N-acetylglucosaminidase iso...    223   9e-66   
ref|XP_010492144.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      226   3e-65   Camelina sativa [gold-of-pleasure]
ref|XP_011469504.1|  PREDICTED: alpha-N-acetylglucosaminidase iso...    224   7e-65   Fragaria vesca subsp. vesca
ref|XP_010938526.1|  PREDICTED: alpha-N-acetylglucosaminidase iso...    224   1e-64   Elaeis guineensis
ref|XP_010694988.1|  PREDICTED: alpha-N-acetylglucosaminidase           224   2e-64   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010534240.1|  PREDICTED: alpha-N-acetylglucosaminidase           224   2e-64   Tarenaya hassleriana [spider flower]
emb|CDX91103.1|  BnaC02g04940D                                          222   6e-64   
gb|KFK25594.1|  hypothetical protein AALP_AA8G134900                    220   2e-63   Arabis alpina [alpine rockcress]
ref|NP_196873.1|  alpha-N-acetylglucosaminidase                         221   2e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006287089.1|  hypothetical protein CARUB_v10000251mg             220   2e-63   Capsella rubella
ref|XP_006851078.1|  hypothetical protein AMTR_s00025p00242240          219   5e-63   
ref|XP_002871580.1|  alpha-N-acetylglucosaminidase family               219   6e-63   
ref|XP_006399864.1|  hypothetical protein EUTSA_v100127271mg            213   9e-63   
ref|XP_009125936.1|  PREDICTED: alpha-N-acetylglucosaminidase           218   1e-62   Brassica rapa
ref|XP_008802642.1|  PREDICTED: alpha-N-acetylglucosaminidase           215   2e-61   Phoenix dactylifera
emb|CDX85632.1|  BnaA02g01810D                                          213   2e-60   
ref|XP_010453461.1|  PREDICTED: alpha-N-acetylglucosaminidase-lik...    211   3e-60   Camelina sativa [gold-of-pleasure]
ref|XP_010453460.1|  PREDICTED: alpha-N-acetylglucosaminidase-lik...    211   4e-60   Camelina sativa [gold-of-pleasure]
ref|XP_011008329.1|  PREDICTED: alpha-N-acetylglucosaminidase-lik...    202   1e-56   Populus euphratica
ref|XP_011008330.1|  PREDICTED: alpha-N-acetylglucosaminidase-lik...    202   1e-56   Populus euphratica
gb|KGN63613.1|  hypothetical protein Csa_1G005740                       198   1e-56   Cucumis sativus [cucumbers]
ref|XP_002318632.2|  hypothetical protein POPTR_0012s07760g             200   3e-56   
ref|XP_009391536.1|  PREDICTED: alpha-N-acetylglucosaminidase           201   3e-56   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEE59081.1|  hypothetical protein OsJ_10898                          200   6e-56   Oryza sativa Japonica Group [Japonica rice]
emb|CAN83148.1|  hypothetical protein VITISV_031934                     197   7e-56   Vitis vinifera
ref|XP_009625154.1|  PREDICTED: alpha-N-acetylglucosaminidase-lik...    197   1e-55   
ref|XP_009625156.1|  PREDICTED: alpha-N-acetylglucosaminidase-lik...    197   1e-55   
ref|XP_002511461.1|  alpha-n-acetylglucosaminidase, putative            198   2e-55   Ricinus communis
ref|XP_009625153.1|  PREDICTED: alpha-N-acetylglucosaminidase-lik...    198   2e-55   
ref|XP_004138287.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      198   2e-55   
emb|CBI15090.3|  unnamed protein product                                198   2e-55   Vitis vinifera
ref|XP_010663217.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      198   3e-55   Vitis vinifera
ref|XP_009625152.1|  PREDICTED: alpha-N-acetylglucosaminidase-lik...    198   3e-55   Nicotiana tomentosiformis
ref|XP_009625151.1|  PREDICTED: alpha-N-acetylglucosaminidase-lik...    197   4e-55   Nicotiana tomentosiformis
gb|KDP31153.1|  hypothetical protein JCGZ_11529                         197   4e-55   Jatropha curcas
ref|XP_008453133.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      197   4e-55   Cucumis melo [Oriental melon]
gb|KHN19339.1|  Alpha-N-acetylglucosaminidase                           192   6e-55   Glycine soja [wild soybean]
gb|EEC75285.1|  hypothetical protein OsI_11626                          197   6e-55   Oryza sativa Indica Group [Indian rice]
ref|XP_003557830.1|  PREDICTED: alpha-N-acetylglucosaminidase iso...    196   1e-54   Brachypodium distachyon [annual false brome]
ref|XP_007210354.1|  hypothetical protein PRUPE_ppa001642mg             195   2e-54   
ref|XP_008239708.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      195   2e-54   
ref|XP_009799807.1|  PREDICTED: alpha-N-acetylglucosaminidase-lik...    193   1e-53   Nicotiana sylvestris
ref|XP_009799801.1|  PREDICTED: alpha-N-acetylglucosaminidase-lik...    192   2e-53   Nicotiana sylvestris
ref|XP_009799792.1|  PREDICTED: alpha-N-acetylglucosaminidase-lik...    192   2e-53   Nicotiana sylvestris
ref|XP_008660142.1|  PREDICTED: alpha-N-acetylglucosaminidase           192   2e-53   
gb|KDO35993.1|  hypothetical protein CISIN_1g027682mg                   181   3e-53   Citrus sinensis [apfelsine]
ref|XP_006345181.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      192   3e-53   Solanum tuberosum [potatoes]
ref|XP_006581937.1|  PREDICTED: alpha-N-acetylglucosaminidase-lik...    192   3e-53   Glycine max [soybeans]
ref|XP_002465249.1|  hypothetical protein SORBIDRAFT_01g034960          191   9e-53   
ref|XP_011464528.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      191   9e-53   Fragaria vesca subsp. vesca
ref|XP_010112589.1|  hypothetical protein L484_010094                   191   1e-52   
gb|KCW83403.1|  hypothetical protein EUGRSUZ_B00338                     190   1e-52   Eucalyptus grandis [rose gum]
emb|CDP16996.1|  unnamed protein product                                190   2e-52   Coffea canephora [robusta coffee]
ref|XP_008793800.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      190   2e-52   
ref|XP_010027872.1|  PREDICTED: alpha-N-acetylglucosaminidase-lik...    189   2e-52   Eucalyptus grandis [rose gum]
ref|XP_010027879.1|  PREDICTED: alpha-N-acetylglucosaminidase-lik...    189   3e-52   Eucalyptus grandis [rose gum]
gb|KCW83402.1|  hypothetical protein EUGRSUZ_B00338                     189   3e-52   Eucalyptus grandis [rose gum]
ref|XP_006581936.1|  PREDICTED: alpha-N-acetylglucosaminidase-lik...    187   1e-51   Glycine max [soybeans]
ref|XP_001782392.1|  predicted protein                                  186   3e-51   
ref|XP_010324692.1|  PREDICTED: alpha-N-acetylglucosaminidase iso...    186   4e-51   
gb|KHG03421.1|  Alpha-N-acetylglucosaminidase                           186   5e-51   Gossypium arboreum [tree cotton]
ref|XP_007036096.1|  Alpha-N-acetylglucosaminidase family / NAGLU...    186   6e-51   
gb|KJB08355.1|  hypothetical protein B456_001G078400                    186   8e-51   Gossypium raimondii
ref|XP_008393078.1|  PREDICTED: alpha-N-acetylglucosaminidase-lik...    184   2e-50   
ref|XP_008393079.1|  PREDICTED: alpha-N-acetylglucosaminidase-lik...    184   2e-50   
ref|XP_006439736.1|  hypothetical protein CICLE_v10018883mg             182   8e-50   
ref|XP_006439737.1|  hypothetical protein CICLE_v10018883mg             182   1e-49   
ref|XP_006439738.1|  hypothetical protein CICLE_v10018883mg             182   2e-49   Citrus clementina [clementine]
ref|XP_006653830.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      181   3e-49   
gb|EEC78143.1|  hypothetical protein OsI_17702                          181   4e-49   Oryza sativa Indica Group [Indian rice]
dbj|BAK03902.1|  predicted protein                                      179   1e-48   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK07078.1|  predicted protein                                      179   1e-48   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004977055.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      178   3e-48   Setaria italica
ref|XP_006476679.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      178   3e-48   Citrus sinensis [apfelsine]
ref|XP_007138123.1|  hypothetical protein PHAVU_009G182100g             176   1e-47   Phaseolus vulgaris [French bean]
ref|XP_006651392.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      176   1e-47   
tpg|DAA35664.1|  TPA: hypothetical protein ZEAMMB73_337226              174   5e-47   
tpg|DAA35665.1|  TPA: hypothetical protein ZEAMMB73_337226              176   8e-47   
ref|XP_008667109.1|  PREDICTED: uncharacterized protein LOC100192...    174   1e-46   
ref|XP_003580702.1|  PREDICTED: alpha-N-acetylglucosaminidase-lik...    173   2e-46   Brachypodium distachyon [annual false brome]
ref|XP_010928215.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      170   2e-45   Elaeis guineensis
emb|CAJ86183.1|  H0212B02.15                                            167   9e-45   Oryza sativa [red rice]
ref|XP_004502129.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      164   4e-43   Cicer arietinum [garbanzo]
gb|EEE61812.1|  hypothetical protein OsJ_16433                          164   1e-42   Oryza sativa Japonica Group [Japonica rice]
emb|CAE04506.2|  OSJNBb0059K02.16                                       162   2e-42   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002977411.1|  hypothetical protein SELMODRAFT_107285             160   7e-42   
ref|XP_002974994.1|  hypothetical protein SELMODRAFT_102402             159   1e-41   
gb|KEH35072.1|  alpha-N-acetylglucosaminidase family protein            158   6e-41   Medicago truncatula
ref|XP_011087174.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      156   6e-40   Sesamum indicum [beniseed]
ref|XP_010092738.1|  hypothetical protein L484_024633                   147   7e-39   
ref|XP_010659443.1|  PREDICTED: alpha-N-acetylglucosaminidase iso...    149   3e-38   
gb|EMT10178.1|  hypothetical protein F775_30738                         145   5e-36   
gb|AES69666.2|  alpha-N-acetylglucosaminidase family protein            141   3e-35   Medicago truncatula
gb|KEH33252.1|  alpha-N-acetylglucosaminidase family protein            141   3e-35   Medicago truncatula
gb|EMS50400.1|  hypothetical protein TRIUR3_11279                       138   5e-34   Triticum urartu
ref|XP_006856885.1|  hypothetical protein AMTR_s00055p00202230          135   4e-33   
ref|XP_009420949.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      126   1e-31   
gb|EMT10385.1|  hypothetical protein F775_10757                         124   8e-29   
gb|EMS67905.1|  hypothetical protein TRIUR3_00413                       120   1e-27   Triticum urartu
ref|XP_008375269.1|  PREDICTED: uncharacterized protein LOC103438510    100   2e-23   
ref|XP_005645139.1|  hypothetical protein COCSUDRAFT_37819              100   2e-20   Coccomyxa subellipsoidea C-169
ref|XP_002503216.1|  GH family 89 protein                             94.0    3e-18   Micromonas commoda
gb|KCW51928.1|  hypothetical protein EUGRSUZ_J01382                   82.8    2e-16   Eucalyptus grandis [rose gum]
gb|KIZ03038.1|  alpha-N-acetylglucosaminidase                         87.4    3e-16   Monoraphidium neglectum
gb|KFM79407.1|  Alpha-N-acetylglucosaminidase                         85.5    8e-16   Stegodyphus mimosarum
ref|XP_973259.1|  PREDICTED: alpha-N-acetylglucosaminidase isofor...  85.5    1e-15   Tribolium castaneum [rust-red flour beetle]
ref|XP_008191832.1|  PREDICTED: alpha-N-acetylglucosaminidase iso...  85.1    1e-15   Tribolium castaneum [rust-red flour beetle]
gb|KCW51927.1|  hypothetical protein EUGRSUZ_J01382                   79.0    3e-15   Eucalyptus grandis [rose gum]
ref|XP_011064972.1|  PREDICTED: alpha-N-acetylglucosaminidase iso...  82.8    1e-14   Acromyrmex echinatior
ref|XP_007558657.1|  PREDICTED: alpha-N-acetylglucosaminidase-lik...  82.0    2e-14   Poecilia formosa
ref|XP_001656341.1|  AAEL003150-PA                                    82.0    2e-14   Aedes aegypti
ref|XP_008436403.1|  PREDICTED: alpha-N-acetylglucosaminidase iso...  81.6    2e-14   Poecilia reticulata
ref|XP_008111624.1|  PREDICTED: LOW QUALITY PROTEIN: alpha-N-acet...  81.6    3e-14   
ref|XP_004342502.1|  alpha-N-acetylglucosaminidase family protein     81.3    4e-14   Acanthamoeba castellanii str. Neff
ref|XP_011266261.1|  PREDICTED: alpha-N-acetylglucosaminidase         80.9    5e-14   
ref|XP_006822720.1|  PREDICTED: LOW QUALITY PROTEIN: alpha-N-acet...  80.1    5e-14   Saccoglossus kowalevskii
ref|XP_006901783.1|  PREDICTED: alpha-N-acetylglucosaminidase         80.1    7e-14   Elephantulus edwardii [Cape long-eared elephant shrew]
gb|EFZ16314.1|  hypothetical protein SINV_06335                       76.6    8e-14   
ref|XP_005105869.1|  PREDICTED: alpha-N-acetylglucosaminidase-like    79.3    1e-13   
gb|KCW66076.1|  hypothetical protein EUGRSUZ_G03358                   79.0    2e-13   Eucalyptus grandis [rose gum]
ref|XP_011152868.1|  PREDICTED: alpha-N-acetylglucosaminidase         79.3    2e-13   Harpegnathos saltator
gb|KDR09306.1|  Alpha-N-acetylglucosaminidase                         79.0    2e-13   Zootermopsis nevadensis
gb|KCW66077.1|  hypothetical protein EUGRSUZ_G03358                   79.0    2e-13   Eucalyptus grandis [rose gum]
gb|EFN75548.1|  Alpha-N-acetylglucosaminidase                         79.0    2e-13   Harpegnathos saltator
ref|XP_005105870.1|  PREDICTED: alpha-N-acetylglucosaminidase-like    78.6    2e-13   
ref|XP_008436404.1|  PREDICTED: alpha-N-acetylglucosaminidase iso...  78.6    2e-13   Poecilia reticulata
ref|XP_003397173.1|  PREDICTED: alpha-N-acetylglucosaminidase-like    78.6    2e-13   Bombus terrestris [large earth bumblebee]
ref|XP_004987699.1|  alpha-N-acetylglucosaminidase                    78.2    3e-13   Salpingoeca rosetta
ref|XP_011162675.1|  PREDICTED: alpha-N-acetylglucosaminidase         78.6    3e-13   Solenopsis invicta [imported red fire ant]
ref|XP_004609026.1|  PREDICTED: alpha-N-acetylglucosaminidase         78.2    4e-13   Sorex araneus [Eurasian shrew]
ref|XP_003703688.1|  PREDICTED: alpha-N-acetylglucosaminidase         77.8    4e-13   
ref|XP_001865888.1|  alpha-N-acetyl glucosaminidase                   77.8    5e-13   Culex quinquefasciatus
ref|XP_006559874.1|  PREDICTED: alpha-N-acetylglucosaminidase-like    77.4    6e-13   Apis mellifera [bee]
ref|XP_005950306.1|  PREDICTED: alpha-N-acetylglucosaminidase-like    77.0    7e-13   Haplochromis burtoni
ref|XP_004571517.1|  PREDICTED: alpha-N-acetylglucosaminidase-like    77.0    8e-13   Maylandia zebra
ref|XP_005471266.1|  PREDICTED: alpha-N-acetylglucosaminidase-like    77.0    8e-13   Oreochromis niloticus
ref|XP_003698943.1|  PREDICTED: LOW QUALITY PROTEIN: alpha-N-acet...  77.0    8e-13   
ref|XP_688608.3|  PREDICTED: alpha-N-acetylglucosaminidase            77.0    9e-13   Danio rerio [leopard danio]
ref|XP_006620136.1|  PREDICTED: alpha-N-acetylglucosaminidase-like    76.6    1e-12   Apis dorsata [rock honeybee]
ref|XP_006801729.1|  PREDICTED: alpha-N-acetylglucosaminidase-like    76.3    1e-12   Neolamprologus brichardi [lyretail cichlid]
ref|XP_003488083.1|  PREDICTED: alpha-N-acetylglucosaminidase-like    76.6    1e-12   Bombus impatiens
ref|WP_013992396.1|  alpha-N-acetylglucosaminidase                    76.6    1e-12   Zobellia galactanivorans
gb|ELT93213.1|  hypothetical protein CAPTEDRAFT_144379                75.9    2e-12   Capitella teleta
ref|XP_004347190.1|  AlphaN-acetylglucosaminidase (NAGLU)             75.9    2e-12   Acanthamoeba castellanii str. Neff
ref|XP_009859446.1|  PREDICTED: alpha-N-acetylglucosaminidase         75.9    2e-12   
ref|XP_008312357.1|  PREDICTED: alpha-N-acetylglucosaminidase         75.1    3e-12   Cynoglossus semilaevis [half-smooth tongue sole]
gb|KHM49101.1|  alpha-N-acetylglucosaminidase                         74.7    4e-12   Coprobacter secundus
gb|EDM06080.1|  rCG33377, isoform CRA_c                               72.0    5e-12   Rattus norvegicus [brown rat]
ref|XP_003414528.1|  PREDICTED: alpha-N-acetylglucosaminidase         74.7    5e-12   Loxodonta africana [African bush elephant]
ref|WP_044225091.1|  alpha-N-acetylglucosaminidase                    74.7    5e-12   
ref|XP_007955960.1|  PREDICTED: alpha-N-acetylglucosaminidase         74.7    5e-12   Orycteropus afer afer
ref|XP_011333453.1|  PREDICTED: alpha-N-acetylglucosaminidase iso...  74.7    5e-12   
ref|XP_008147571.1|  PREDICTED: alpha-N-acetylglucosaminidase         74.3    6e-12   Eptesicus fuscus
ref|WP_022218286.1|  hypothetical protein                             74.3    6e-12   
ref|XP_005531528.1|  PREDICTED: alpha-N-acetylglucosaminidase         74.3    6e-12   Pseudopodoces humilis [Tibetan ground-jay]
gb|ETE58649.1|  Alpha-N-acetylglucosaminidase                         74.7    7e-12   Ophiophagus hannah
ref|XP_008988628.1|  PREDICTED: alpha-N-acetylglucosaminidase-like    71.2    8e-12   Callithrix jacchus [common marmoset]
ref|XP_003978574.1|  PREDICTED: alpha-N-acetylglucosaminidase-like    73.6    1e-11   
ref|XP_006638268.1|  PREDICTED: alpha-N-acetylglucosaminidase-like    73.6    1e-11   Lepisosteus oculatus
ref|XP_003131436.1|  PREDICTED: alpha-N-acetylglucosaminidase         73.6    1e-11   
ref|WP_029711569.1|  hypothetical protein                             73.2    1e-11   
ref|XP_004655806.1|  PREDICTED: alpha-N-acetylglucosaminidase         72.8    2e-11   Jaculus jaculus
ref|XP_006924662.1|  PREDICTED: alpha-N-acetylglucosaminidase         72.8    2e-11   Pteropus alecto
ref|XP_011379506.1|  PREDICTED: alpha-N-acetylglucosaminidase         72.8    2e-11   Pteropus vampyrus
ref|XP_003786703.1|  PREDICTED: alpha-N-acetylglucosaminidase         72.8    2e-11   Otolemur garnettii
ref|XP_007535086.1|  PREDICTED: alpha-N-acetylglucosaminidase         72.8    2e-11   Erinaceus europaeus [common hedgehog]
ref|XP_001081442.1|  PREDICTED: alpha-N-acetylglucosaminidase         72.4    2e-11   Rattus norvegicus [brown rat]
gb|KFH63695.1|  hypothetical protein MVEG_10388                       72.8    2e-11   Mortierella verticillata NRRL 6337
ref|XP_004209763.1|  PREDICTED: alpha-N-acetylglucosaminidase-like    69.7    2e-11   
ref|XP_002605948.1|  hypothetical protein BRAFLDRAFT_132235           72.4    3e-11   Branchiostoma floridae
ref|XP_004859890.1|  PREDICTED: alpha-N-acetylglucosaminidase         72.4    3e-11   Heterocephalus glaber [naked mole rat]
ref|XP_010899528.1|  PREDICTED: alpha-N-acetylglucosaminidase         72.0    3e-11   Esox lucius
ref|XP_010980090.1|  PREDICTED: alpha-N-acetylglucosaminidase         72.0    3e-11   Camelus dromedarius [camel]
ref|XP_004685005.1|  PREDICTED: alpha-N-acetylglucosaminidase         72.0    4e-11   Condylura cristata
ref|XP_548088.2|  PREDICTED: alpha-N-acetylglucosaminidase            71.6    4e-11   Canis lupus familiaris [dogs]
gb|ERL93790.1|  hypothetical protein D910_11076                       72.0    4e-11   Dendroctonus ponderosae
ref|XP_005111892.1|  PREDICTED: alpha-N-acetylglucosaminidase-like    71.6    5e-11   
emb|CDQ63621.1|  unnamed protein product                              71.6    5e-11   Oncorhynchus mykiss
gb|KFB50231.1|  AGAP011750-PA-like protein                            71.6    5e-11   Anopheles sinensis
ref|XP_003279518.1|  PREDICTED: LOW QUALITY PROTEIN: alpha-N-acet...  71.2    7e-11   Nomascus leucogenys [White-cheeked Gibbon]
ref|XP_002719212.1|  PREDICTED: alpha-N-acetylglucosaminidase         71.2    7e-11   Oryctolagus cuniculus [domestic rabbit]
ref|XP_004472516.1|  PREDICTED: LOW QUALITY PROTEIN: alpha-N-acet...  71.2    7e-11   
ref|XP_001606979.1|  PREDICTED: alpha-N-acetylglucosaminidase         71.2    7e-11   
ref|XP_007102204.1|  PREDICTED: alpha-N-acetylglucosaminidase         70.9    7e-11   
ref|WP_010802636.1|  MULTISPECIES: hypothetical protein               70.9    8e-11   Parabacteroides
ref|XP_004342501.1|  AlphaN-acetylglucosaminidase, putative           69.7    1e-10   Acanthamoeba castellanii str. Neff
ref|XP_004772740.1|  PREDICTED: alpha-N-acetylglucosaminidase iso...  70.5    1e-10   Mustela putorius furo [black ferret]
ref|XP_002827555.2|  PREDICTED: alpha-N-acetylglucosaminidase         70.5    1e-10   Pongo abelii [orang utan]
ref|NP_000254.2|  alpha-N-acetylglucosaminidase precursor             70.5    1e-10   Homo sapiens [man]
ref|XP_523654.2|  PREDICTED: alpha-N-acetylglucosaminidase            70.5    1e-10   Pan troglodytes
ref|XP_004410599.1|  PREDICTED: alpha-N-acetylglucosaminidase         70.5    1e-10   Odobenus rosmarus divergens
ref|XP_010384417.1|  PREDICTED: alpha-N-acetylglucosaminidase         70.5    1e-10   Rhinopithecus roxellana
gb|AAC50512.1|  alpha-N-acetylglucosaminidase                         70.5    1e-10   Homo sapiens [man]
ref|XP_005584302.1|  PREDICTED: alpha-N-acetylglucosaminidase         70.5    1e-10   Macaca fascicularis [crab eating macaque]
ref|XP_007449909.1|  PREDICTED: alpha-N-acetylglucosaminidase         70.5    1e-10   Lipotes vexillifer [baiji]
ref|XP_004041658.1|  PREDICTED: alpha-N-acetylglucosaminidase         70.5    1e-10   Gorilla gorilla gorilla [lowland gorilla]
ref|XP_003913130.1|  PREDICTED: alpha-N-acetylglucosaminidase         70.5    1e-10   Papio anubis [baboon]
ref|XP_008010821.1|  PREDICTED: alpha-N-acetylglucosaminidase         70.5    1e-10   Chlorocebus sabaeus
ref|XP_004772739.1|  PREDICTED: alpha-N-acetylglucosaminidase iso...  70.5    1e-10   
ref|XP_001095618.2|  PREDICTED: alpha-N-acetylglucosaminidase-like    70.1    1e-10   
ref|XP_004390347.1|  PREDICTED: alpha-N-acetylglucosaminidase         70.1    1e-10   Trichechus manatus latirostris
gb|EFX83393.1|  hypothetical protein DAPPUDRAFT_301977                70.1    1e-10   Daphnia pulex
ref|XP_004994842.1|  lysosomal alpha-N-acetyl glucosaminidase         70.1    1e-10   Salpingoeca rosetta
ref|XP_004319191.1|  PREDICTED: alpha-N-acetylglucosaminidase         70.1    1e-10   
ref|XP_006055805.1|  PREDICTED: alpha-N-acetylglucosaminidase         70.1    2e-10   Bubalus bubalis [domestic water buffalo]
ref|XP_003743422.1|  PREDICTED: alpha-N-acetylglucosaminidase-like    70.1    2e-10   
ref|XP_003733088.1|  PREDICTED: LOW QUALITY PROTEIN: alpha-N-acet...  70.1    2e-10   
ref|XP_004434504.1|  PREDICTED: alpha-N-acetylglucosaminidase         69.7    2e-10   Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|WP_028811329.1|  alpha-N-acetylglucosaminidase                    70.1    2e-10   Streptomyces flavidovirens
ref|XP_320760.4|  AGAP011750-PA                                       69.7    2e-10   Anopheles gambiae str. PEST
ref|XP_003584151.1|  PREDICTED: alpha-N-acetylglucosaminidase         69.7    2e-10   
ref|XP_011064974.1|  PREDICTED: alpha-N-acetylglucosaminidase iso...  69.7    2e-10   Acromyrmex echinatior
ref|XP_009094885.1|  PREDICTED: LOW QUALITY PROTEIN: alpha-N-acet...  69.7    2e-10   
ref|XP_007424968.1|  PREDICTED: alpha-N-acetylglucosaminidase         69.3    2e-10   Python bivittatus
ref|NP_001095696.1|  alpha-N-acetylglucosaminidase precursor          68.9    3e-10   Bos taurus [bovine]
ref|XP_005313977.1|  PREDICTED: alpha-N-acetylglucosaminidase         68.9    3e-10   Chrysemys picta bellii
ref|WP_039482735.1|  hypothetical protein                             68.9    3e-10   Pedobacter kyungheensis
ref|XP_004633968.1|  PREDICTED: alpha-N-acetylglucosaminidase         68.9    3e-10   Octodon degus
ref|XP_005369092.1|  PREDICTED: alpha-N-acetylglucosaminidase         68.9    4e-10   Microtus ochrogaster [prairie voles]
ref|WP_007658406.1|  hypothetical protein                             68.9    4e-10   Parabacteroides goldsteinii
ref|XP_006992969.1|  PREDICTED: alpha-N-acetylglucosaminidase         68.9    4e-10   Peromyscus maniculatus bairdii
ref|XP_011064973.1|  PREDICTED: alpha-N-acetylglucosaminidase iso...  68.9    4e-10   Acromyrmex echinatior
ref|XP_004282871.1|  PREDICTED: alpha-N-acetylglucosaminidase         68.9    4e-10   Orcinus orca [Orca]
gb|AAB88084.1|  Naglu                                                 68.9    4e-10   Mus musculus [mouse]
ref|NP_038820.2|  alpha-N-acetylglucosaminidase precursor             68.9    4e-10   Mus musculus [mouse]
ref|XP_002110537.1|  hypothetical protein TRIADDRAFT_54660            68.6    4e-10   Trichoplax adhaerens
ref|XP_004365200.1|  lysosomal alpha-N-acetyl glucosaminidase         68.6    4e-10   Capsaspora owczarzaki ATCC 30864
ref|WP_018530625.1|  alpha-N-acetylglucosaminidase                    68.6    5e-10   Streptomyces sp. HmicA12
gb|KDS13673.1|  alpha-N-acetylglucosaminidase (NAGLU) C-terminal ...  68.2    6e-10   Bacteroides fragilis str. 3725 D9 ii
ref|WP_032846413.1|  MULTISPECIES: alpha-N-acetylglucosaminidase      68.2    6e-10   
ref|WP_007479571.1|  hypothetical protein                             68.2    7e-10   Bacteroides salyersiae
ref|XP_007899764.1|  PREDICTED: alpha-N-acetylglucosaminidase         68.2    7e-10   Callorhinchus milii [Australian ghost shark]
ref|XP_008833525.1|  PREDICTED: alpha-N-acetylglucosaminidase         68.2    7e-10   
ref|WP_037661705.1|  alpha-N-acetylglucosaminidase                    68.2    7e-10   
ref|XP_005321936.1|  PREDICTED: alpha-N-acetylglucosaminidase         67.8    8e-10   
ref|WP_030687294.1|  alpha-N-acetylglucosaminidase                    68.2    8e-10   
ref|XP_001365931.1|  PREDICTED: alpha-N-acetylglucosaminidase         67.4    8e-10   
ref|XP_006833764.1|  PREDICTED: alpha-N-acetylglucosaminidase         67.8    9e-10   
ref|WP_030786822.1|  alpha-N-acetylglucosaminidase                    67.4    1e-09   
ref|XP_007236414.1|  PREDICTED: alpha-N-acetylglucosaminidase         67.0    1e-09   
ref|WP_005940832.1|  hypothetical protein                             66.6    2e-09   
ref|XP_010027888.1|  PREDICTED: alpha-N-acetylglucosaminidase-lik...  66.6    2e-09   
ref|WP_022506540.1|  alpha-N-acetylglucosaminidase (NAGLU)            66.6    2e-09   
ref|WP_016906832.1|  hypothetical protein                             66.6    2e-09   
ref|WP_005928056.1|  MULTISPECIES: hypothetical protein               66.2    3e-09   
ref|WP_030570988.1|  alpha-N-acetylglucosaminidase                    66.2    3e-09   
ref|XP_001366343.1|  PREDICTED: alpha-N-acetylglucosaminidase-like    66.2    3e-09   
ref|WP_029426385.1|  hypothetical protein                             65.9    3e-09   
ref|XP_005394687.1|  PREDICTED: alpha-N-acetylglucosaminidase         65.9    3e-09   
ref|WP_007216448.1|  hypothetical protein                             65.9    4e-09   
ref|XP_008798054.1|  PREDICTED: uncharacterized protein LOC103713067  62.0    4e-09   
ref|WP_007211478.1|  MULTISPECIES: hypothetical protein               65.9    4e-09   
ref|WP_022208901.1|  hypothetical protein                             65.9    4e-09   
ref|WP_021967035.1|  hypothetical protein                             65.5    4e-09   
ref|XP_010967292.1|  PREDICTED: alpha-N-acetylglucosaminidase         65.5    4e-09   
ref|WP_009328151.1|  Tat pathway signal sequence domain protein       65.5    5e-09   
ref|WP_005929485.1|  hypothetical protein                             65.5    5e-09   
gb|EFF54982.1|  conserved domain protein                              62.8    5e-09   
ref|WP_030563824.1|  alpha-N-acetylglucosaminidase                    65.5    6e-09   
gb|EFF51734.1|  conserved domain protein                              63.5    7e-09   
ref|WP_019545934.1|  hypothetical protein                             65.1    7e-09   
ref|WP_044262858.1|  hypothetical protein                             65.1    7e-09   
ref|WP_007485778.1|  hypothetical protein                             65.1    7e-09   
ref|WP_044158144.1|  hypothetical protein                             65.1    7e-09   
ref|WP_002560095.1|  hypothetical protein                             65.1    7e-09   
ref|WP_022393136.1|  hypothetical protein                             64.7    7e-09   
ref|XP_003504701.1|  PREDICTED: alpha-N-acetylglucosaminidase iso...  64.7    8e-09   
ref|XP_005070217.1|  PREDICTED: alpha-N-acetylglucosaminidase         64.7    8e-09   
ref|WP_025835426.1|  alpha-N-acetylglucosaminidase                    64.7    9e-09   
ref|WP_021935997.1|  uncharacterized protein                          64.7    9e-09   
ref|WP_013632159.1|  alpha-N-acetylglucosaminidase                    64.3    9e-09   
ref|XP_008556350.1|  PREDICTED: alpha-N-acetylglucosaminidase         64.3    1e-08   
ref|WP_005478435.1|  alpha-N-acetylglucosaminidase                    64.3    1e-08   
ref|XP_004824877.1|  PREDICTED: LOW QUALITY PROTEIN: alpha-N-acet...  64.3    1e-08   
ref|XP_011333454.1|  PREDICTED: alpha-N-acetylglucosaminidase iso...  64.3    1e-08   
ref|XP_002426494.1|  alpha-N-acetylglucosaminidase, putative          64.3    1e-08   
ref|WP_008646408.1|  alpha-N-acetylglucosaminidase                    63.9    1e-08   
ref|WP_010987390.1|  alpha-N-acetylglucosaminidase                    63.9    1e-08   
gb|EFI36751.1|  alpha-N-acetylglucosaminidase                         63.9    1e-08   
ref|WP_022199174.1|  uncharacterized protein                          63.9    1e-08   
ref|WP_025867983.1|  alpha-N-acetylglucosaminidase                    63.9    2e-08   
ref|WP_002559220.1|  alpha-N-acetylglucosaminidase                    63.9    2e-08   
ref|WP_007483997.1|  alpha-N-acetylglucosaminidase                    63.9    2e-08   
ref|WP_026309809.1|  hypothetical protein                             63.9    2e-08   
ref|WP_008016606.1|  MULTISPECIES: alpha-N-acetylglucosaminidase      63.9    2e-08   
emb|CDM01315.1|  Alpha-N-acetylglucosaminidase                        63.9    2e-08   
ref|WP_008023166.1|  alpha-N-acetylglucosaminidase                    63.9    2e-08   
ref|WP_004323839.1|  alpha-N-acetylglucosaminidase                    63.9    2e-08   
ref|WP_004296442.1|  alpha-N-acetylglucosaminidase                    63.9    2e-08   
ref|WP_004302420.1|  alpha-N-acetylglucosaminidase                    63.5    2e-08   
ref|WP_015531748.1|  Alpha-N-acetylglucosaminidase (NAGLU)            63.5    2e-08   
ref|WP_030360990.1|  MULTISPECIES: alpha-N-acetylglucosaminidase      63.9    2e-08   
ref|WP_032844205.1|  MULTISPECIES: alpha-N-acetylglucosaminidase      63.5    2e-08   
ref|WP_009000983.1|  alpha-N-acetylglucosaminidase                    63.5    2e-08   
gb|EEO58806.1|  Alpha-N-acetylglucosaminidase (NAGLU)                 63.5    2e-08   
gb|KDS10637.1|  alpha-N-acetylglucosaminidase (NAGLU) C-terminal ...  63.5    2e-08   
ref|WP_032849872.1|  MULTISPECIES: alpha-N-acetylglucosaminidase      63.5    2e-08   
ref|WP_008642605.1|  MULTISPECIES: alpha-N-acetylglucosaminidase      63.5    2e-08   
ref|XP_008517470.1|  PREDICTED: alpha-N-acetylglucosaminidase         63.5    2e-08   
gb|EYU29516.1|  hypothetical protein MIMGU_mgv1a0184371mg             62.4    2e-08   
ref|XP_785272.3|  PREDICTED: alpha-N-acetylglucosaminidase            63.5    2e-08   
ref|WP_032849684.1|  alpha-N-acetylglucosaminidase                    63.5    2e-08   
gb|EEO57612.1|  Alpha-N-acetylglucosaminidase (NAGLU)                 63.5    2e-08   
ref|WP_027291688.1|  hypothetical protein                             63.5    2e-08   
ref|XP_006092419.1|  PREDICTED: LOW QUALITY PROTEIN: alpha-N-acet...  63.5    2e-08   
ref|XP_011413971.1|  PREDICTED: alpha-N-acetylglucosaminidase-lik...  63.5    2e-08   
gb|EJJ04702.1|  alpha-N-acetylglucosaminidase                         63.5    2e-08   
ref|WP_040899408.1|  alpha-N-acetylglucosaminidase                    63.5    2e-08   
ref|WP_004308401.1|  alpha-N-acetylglucosaminidase                    63.2    2e-08   
ref|XP_011413973.1|  PREDICTED: alpha-N-acetylglucosaminidase-lik...  63.5    2e-08   
ref|XP_011413974.1|  PREDICTED: alpha-N-acetylglucosaminidase-lik...  63.5    2e-08   
ref|XP_011413972.1|  PREDICTED: alpha-N-acetylglucosaminidase-lik...  63.5    2e-08   
ref|WP_033527443.1|  alpha-N-acetylglucosaminidase                    63.5    2e-08   
ref|WP_030382558.1|  MULTISPECIES: alpha-N-acetylglucosaminidase      63.2    2e-08   
ref|WP_044364179.1|  alpha-N-acetylglucosaminidase                    63.2    3e-08   
gb|EKC30145.1|  Alpha-N-acetylglucosaminidase                         63.2    3e-08   
ref|WP_026310060.1|  hypothetical protein                             63.2    3e-08   
ref|XP_007177897.1|  PREDICTED: alpha-N-acetylglucosaminidase-like    62.8    3e-08   
gb|AAK73655.1|  lysosomal alpha-N-acetyl glucosaminidase              62.8    3e-08   
ref|XP_002074254.1|  GK18384                                          62.8    4e-08   
gb|AAK73654.1|  lysosomal alpha-N-acetyl glucosaminidase              62.8    4e-08   
ref|WP_022148391.1|  predicted protein                                62.4    4e-08   
ref|WP_028550309.1|  hypothetical protein                             62.4    4e-08   
ref|WP_007759559.1|  alpha-N-acetylglucosaminidase                    62.4    4e-08   
ref|WP_037693934.1|  alpha-N-acetylglucosaminidase                    62.8    4e-08   
ref|WP_042131612.1|  hypothetical protein                             62.4    4e-08   
ref|XP_004599216.1|  PREDICTED: alpha-N-acetylglucosaminidase         62.4    5e-08   
gb|KFH72986.1|  hypothetical protein MVEG_00211                       62.0    5e-08   
emb|CDA84490.1|  alpha-N-acetylglucosaminidase (NAGLU)                62.0    5e-08   
ref|WP_007481407.1|  hypothetical protein                             62.0    6e-08   
ref|WP_015809585.1|  alpha-N-acetylglucosaminidase                    62.0    6e-08   
ref|XP_001638539.1|  predicted protein                                61.6    7e-08   
ref|WP_026997693.1|  alpha-N-acetylglucosaminidase                    61.6    7e-08   
ref|WP_009125103.1|  alpha-N-acetylglucosaminidase                    61.6    8e-08   
ref|WP_035611287.1|  hypothetical protein                             61.6    8e-08   
ref|WP_018850517.1|  hypothetical protein                             61.6    9e-08   
ref|WP_030892161.1|  MULTISPECIES: alpha-N-acetylglucosaminidase      61.6    9e-08   
ref|WP_027759705.1|  alpha-N-acetylglucosaminidase                    61.2    1e-07   
ref|WP_027291636.1|  alpha-N-acetylglucosaminidase                    61.2    1e-07   
ref|WP_019358703.1|  hypothetical protein                             61.2    1e-07   
ref|WP_008863225.1|  hypothetical protein                             61.2    1e-07   
ref|WP_042154026.1|  alpha-N-acetylglucosaminidase                    61.2    1e-07   
ref|XP_009061231.1|  hypothetical protein LOTGIDRAFT_175910           60.8    1e-07   
gb|ACU05595.1|  Alpha-N-acetylglucosaminidase                         61.2    1e-07   
ref|WP_008505739.1|  alpha-N-acetylglucosaminidase                    61.2    1e-07   
ref|WP_036674753.1|  alpha-N-acetylglucosaminidase                    61.2    1e-07   
ref|WP_030083639.1|  alpha-N-acetylglucosaminidase                    61.2    1e-07   
ref|WP_032567947.1|  alpha-N-acetylglucosaminidase                    60.8    1e-07   
gb|KJF42829.1|  alpha-N-acetylglucosaminidase                         60.8    1e-07   
ref|WP_031069576.1|  alpha-N-acetylglucosaminidase                    60.8    1e-07   
ref|XP_001970307.1|  GG23441                                          60.8    1e-07   
ref|WP_030813691.1|  alpha-N-acetylglucosaminidase                    60.8    1e-07   
ref|XP_008597633.1|  alpha-N-acetylglucosaminidase, putative          60.8    1e-07   
ref|WP_021847800.1|  alpha-N-acetylglucosaminidase                    60.5    2e-07   
ref|WP_031508536.1|  alpha-N-acetylglucosaminidase                    60.8    2e-07   
ref|WP_038612566.1|  alpha-N-acetylglucosaminidase                    60.5    2e-07   
ref|WP_032543363.1|  alpha-N-acetylglucosaminidase                    60.5    2e-07   
ref|WP_032536918.1|  MULTISPECIES: alpha-N-acetylglucosaminidase      60.5    2e-07   
gb|EEB24327.1|  Alpha-N-acetylglucosaminidase (NAGLU)                 60.5    2e-07   
ref|WP_022011046.1|  glycoside hydrolase family 89                    60.5    2e-07   
ref|WP_005810563.1|  alpha-N-acetylglucosaminidase                    60.5    2e-07   
ref|WP_005823289.1|  alpha-N-acetylglucosaminidase                    60.5    2e-07   
ref|WP_005775364.1|  alpha-N-acetylglucosaminidase                    60.5    2e-07   
ref|WP_032539607.1|  alpha-N-acetylglucosaminidase                    60.5    2e-07   
ref|WP_032530236.1|  alpha-N-acetylglucosaminidase                    60.5    2e-07   
gb|KDS23321.1|  alpha-N-acetylglucosaminidase (NAGLU) C-terminal ...  60.5    2e-07   
gb|EFV65959.1|  glycoside hydrolase family 89                         60.5    2e-07   
ref|WP_005849126.1|  alpha-N-acetylglucosaminidase                    60.5    2e-07   
ref|WP_037975346.1|  alpha-N-acetylglucosaminidase                    60.5    2e-07   
ref|WP_007840638.1|  MULTISPECIES: alpha-N-acetylglucosaminidase      60.5    2e-07   
ref|WP_040893583.1|  alpha-N-acetylglucosaminidase                    60.5    2e-07   
ref|WP_008669385.1|  MULTISPECIES: alpha-N-acetylglucosaminidase      60.5    2e-07   
ref|WP_011965366.1|  alpha-N-acetylglucosaminidase                    60.5    2e-07   
gb|EGG49637.1|  alpha-N-acetylglucosaminidase                         60.5    2e-07   
ref|WP_030548616.1|  alpha-N-acetylglucosaminidase                    60.5    2e-07   
gb|EEZ03613.1|  Alpha-N-acetylglucosaminidase (NAGLU)                 60.1    2e-07   
ref|WP_022508875.1|  glycoside hydrolase family 89                    60.1    2e-07   
ref|WP_004316368.1|  MULTISPECIES: alpha-N-acetylglucosaminidase      60.1    2e-07   
ref|WP_010803522.1|  MULTISPECIES: hypothetical protein               60.1    2e-07   
gb|EPD95541.1|  hypothetical protein HMPREF1486_01738                 60.5    2e-07   
ref|XP_003728120.1|  PREDICTED: alpha-N-acetylglucosaminidase-like    59.7    2e-07   
gb|KDS42638.1|  alpha-N-acetylglucosaminidase (NAGLU) C-terminal ...  60.1    2e-07   
gb|EEX45156.1|  Alpha-N-acetylglucosaminidase (NAGLU)                 60.1    2e-07   
ref|WP_007653366.1|  hypothetical protein                             60.1    2e-07   
ref|WP_041969208.1|  alpha-N-acetylglucosaminidase                    60.1    2e-07   
ref|WP_029425726.1|  alpha-N-acetylglucosaminidase                    60.1    2e-07   
ref|WP_037838998.1|  alpha-N-acetylglucosaminidase                    60.1    2e-07   
ref|WP_037834967.1|  alpha-N-acetylglucosaminidase                    60.1    2e-07   
ref|WP_033230387.1|  MULTISPECIES: alpha-N-acetylglucosaminidase      60.1    2e-07   
ref|WP_032839630.1|  alpha-N-acetylglucosaminidase                    60.1    3e-07   
gb|EFG13634.1|  alpha-N-acetylglucosaminidase (NAGLU)                 60.1    3e-07   
ref|WP_030990729.1|  alpha-N-acetylglucosaminidase                    60.1    3e-07   
ref|WP_042986407.1|  alpha-N-acetylglucosaminidase                    60.1    3e-07   
ref|WP_032577544.1|  alpha-N-acetylglucosaminidase                    60.1    3e-07   
ref|WP_032599594.1|  alpha-N-acetylglucosaminidase                    60.1    3e-07   
ref|WP_032532645.1|  alpha-N-acetylglucosaminidase                    60.1    3e-07   
ref|WP_009291551.1|  alpha-N-acetylglucosaminidase                    60.1    3e-07   
gb|EXY71660.1|  alpha-N-acetylglucosaminidase (NAGLU) tim-barrel ...  58.5    3e-07   
ref|WP_005813399.1|  alpha-N-acetylglucosaminidase                    60.1    3e-07   
gb|EYE47317.1|  alpha-N-acetylglucosaminidase (NAGLU) C-terminal ...  60.1    3e-07   
ref|WP_025814828.1|  alpha-N-acetylglucosaminidase                    60.1    3e-07   
ref|WP_008769378.1|  MULTISPECIES: alpha-N-acetylglucosaminidase      60.1    3e-07   
ref|WP_032578733.1|  alpha-N-acetylglucosaminidase                    60.1    3e-07   
ref|WP_032564220.1|  alpha-N-acetylglucosaminidase                    60.1    3e-07   
ref|WP_032593361.1|  alpha-N-acetylglucosaminidase                    60.1    3e-07   
ref|WP_032582321.1|  alpha-N-acetylglucosaminidase                    60.1    3e-07   
ref|WP_032573566.1|  alpha-N-acetylglucosaminidase                    60.1    3e-07   
ref|WP_032528740.1|  alpha-N-acetylglucosaminidase                    60.1    3e-07   
ref|WP_032569775.1|  alpha-N-acetylglucosaminidase                    60.1    3e-07   
ref|WP_022347848.1|  MULTISPECIES: alpha-N-acetylglucosaminidase      60.1    3e-07   
ref|WP_008658446.1|  MULTISPECIES: alpha-N-acetylglucosaminidase      60.1    3e-07   
ref|WP_011202102.1|  alpha-N-acetylglucosaminidase                    60.1    3e-07   
ref|WP_005801474.1|  alpha-N-acetylglucosaminidase                    60.1    3e-07   
ref|WP_005784698.1|  alpha-N-acetylglucosaminidase                    60.1    3e-07   
ref|WP_005796336.1|  alpha-N-acetylglucosaminidase                    60.1    3e-07   
gb|EEO49539.1|  Alpha-N-acetylglucosaminidase (NAGLU)                 60.1    3e-07   
ref|WP_021892361.1|  uncharacterized protein                          59.7    3e-07   
ref|WP_037793649.1|  alpha-N-acetylglucosaminidase                    60.1    3e-07   
dbj|GAM40387.1|  hypothetical protein TCE0_039f12701                  60.1    3e-07   
ref|XP_008716397.1|  hypothetical protein HMPREF1541_03827            59.7    3e-07   
ref|WP_022829666.1|  alpha-N-acetylglucosaminidase                    59.7    3e-07   
ref|WP_032592882.1|  alpha-N-acetylglucosaminidase                    59.3    4e-07   
ref|WP_044576652.1|  alpha-N-acetylglucosaminidase                    59.7    4e-07   
gb|KHN16294.1|  hypothetical protein glysoja_030269                   56.6    4e-07   
ref|WP_021928269.1|  alpha-N-acetylglucosaminidase                    59.3    4e-07   
gb|EXZ02033.1|  alpha-N-acetylglucosaminidase (NAGLU) C-terminal ...  59.3    4e-07   
ref|WP_032556169.1|  alpha-N-acetylglucosaminidase                    59.3    4e-07   
ref|WP_042984772.1|  alpha-N-acetylglucosaminidase                    59.3    4e-07   
ref|WP_032572541.1|  alpha-N-acetylglucosaminidase                    59.3    5e-07   
gb|KGQ12634.1|  Alpha-N-acetylglucosaminidase                         59.3    5e-07   
ref|WP_030256866.1|  alpha-N-acetylglucosaminidase                    59.3    5e-07   
ref|XP_002057627.1|  GJ18000                                          58.9    5e-07   
ref|XP_007677883.1|  glycoside hydrolase family 89 protein            58.9    5e-07   
ref|WP_007486119.1|  hypothetical protein                             58.9    6e-07   
ref|WP_025868024.1|  hypothetical protein                             58.9    6e-07   
ref|WP_002560933.1|  hypothetical protein                             58.9    6e-07   
ref|WP_004309819.1|  MULTISPECIES: alpha-N-acetylglucosaminidase      58.9    6e-07   
ref|WP_016278136.1|  MULTISPECIES: alpha-N-acetylglucosaminidase      58.9    6e-07   
ref|WP_022511232.1|  hypothetical protein                             58.5    7e-07   
gb|KJD34736.1|  alpha-N-acetylglucosaminidase                         58.5    7e-07   
ref|WP_022340418.1|  alpha-N-acetylglucosaminidase                    58.5    7e-07   
ref|WP_020871947.1|  alpha-N-acetylglucosaminidase                    58.5    7e-07   
ref|WP_022507934.1|  alpha-N-acetylglucosaminidase (NAGLU)            58.5    8e-07   
ref|WP_015809205.1|  alpha-N-acetylglucosaminidase                    58.5    8e-07   
ref|WP_032849058.1|  alpha-N-acetylglucosaminidase                    58.5    8e-07   
gb|EGM98438.1|  hypothetical protein HMPREF1017_04627                 58.5    8e-07   
ref|WP_025018807.1|  alpha-N-acetylglucosaminidase                    58.5    8e-07   
ref|WP_035141001.1|  alpha-N-acetylglucosaminidase                    58.5    8e-07   
ref|XP_008862302.1|  hypothetical protein H310_01064                  58.5    8e-07   
ref|WP_043462133.1|  alpha-N-acetylglucosaminidase                    58.5    9e-07   
ref|WP_005643300.1|  hypothetical protein                             58.5    9e-07   
ref|WP_044625252.1|  alpha-N-acetylglucosaminidase                    58.2    9e-07   
ref|XP_002018715.1|  GL25802                                          58.2    9e-07   
ref|WP_005648984.1|  hypothetical protein                             58.2    1e-06   



>ref|XP_006345419.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Solanum tuberosum]
Length=807

 Score =   254 bits (650),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 132/151 (87%), Gaps = 0/151 (0%)
 Frame = +3

Query  162  SEAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTN  341
            S+A+ES+L RLDSKR  + VQESAAKGVLQRLLP H  SFE KIVSKD+CGG+SCFR+TN
Sbjct  23   SDAVESVLRRLDSKRAQSVVQESAAKGVLQRLLPAHSHSFEFKIVSKDLCGGRSCFRITN  82

Query  342  FKSSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVS  521
            +KSS  +SP+ILIQGTTA+EI SGLHWYLKY CGAHISW+KTGG+Q+ SVPKPG LP V 
Sbjct  83   YKSSRRNSPEILIQGTTAVEIASGLHWYLKYKCGAHISWDKTGGVQLASVPKPGALPLVE  142

Query  522  TEGVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
              GV IQRPVPWNYYQNVVTSSYSYVWWDWQ
Sbjct  143  ARGVTIQRPVPWNYYQNVVTSSYSYVWWDWQ  173



>ref|XP_010324687.1| PREDICTED: alpha-N-acetylglucosaminidase isoform X1 [Solanum 
lycopersicum]
Length=807

 Score =   254 bits (650),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = +3

Query  162  SEAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTN  341
            S+A+ES+L RLDSKR  + VQESAAKGVLQRLLP HL SFE KIVSKD+CGG+SCFR+TN
Sbjct  23   SDAVESVLRRLDSKRAQSVVQESAAKGVLQRLLPAHLHSFEFKIVSKDLCGGRSCFRITN  82

Query  342  FKSSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVS  521
            +KSS  +SP+ILIQGTTA+EI SGL+WYLKY CGAHISW+KTGG+Q+ SVPKPG LP V 
Sbjct  83   YKSSHRNSPEILIQGTTAVEIASGLNWYLKYKCGAHISWDKTGGVQLASVPKPGALPLVE  142

Query  522  TEGVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
             +GV IQRPVPWNYYQNVVTSSYSYVWWDWQ
Sbjct  143  AKGVTIQRPVPWNYYQNVVTSSYSYVWWDWQ  173



>ref|XP_009611357.1| PREDICTED: LOW QUALITY PROTEIN: alpha-N-acetylglucosaminidase 
[Nicotiana tomentosiformis]
Length=857

 Score =   254 bits (649),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = +3

Query  159  ESEAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVT  338
            E +AIES+L RL SK+    VQESAAKGVLQRLLP HL SFE KIVSKD+CGG+SCFR+T
Sbjct  26   ELDAIESVLRRLHSKQAPPIVQESAAKGVLQRLLPAHLHSFEFKIVSKDLCGGRSCFRIT  85

Query  339  NFKSSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSV  518
            N+KSSS +SP+ILIQGTTA+EITSGLHWYLKY CGAHISW+KTGG+Q+ SVPKPG LP V
Sbjct  86   NYKSSSRNSPEILIQGTTAVEITSGLHWYLKYRCGAHISWDKTGGVQLASVPKPGSLPLV  145

Query  519  STEGVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
              +GV IQRPVPWNYYQNVVTSSYS+VWWDWQ
Sbjct  146  EADGVTIQRPVPWNYYQNVVTSSYSFVWWDWQ  177



>ref|XP_009758541.1| PREDICTED: alpha-N-acetylglucosaminidase [Nicotiana sylvestris]
Length=809

 Score =   253 bits (647),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = +3

Query  159  ESEAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVT  338
            ES+AIES+L RL SK     VQESAAKGVLQRLLP HL SFE KIVSKD+CGG+SCFR+T
Sbjct  24   ESDAIESVLRRLHSKEAPPIVQESAAKGVLQRLLPAHLHSFEFKIVSKDLCGGRSCFRIT  83

Query  339  NFKSSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSV  518
            N+K SS +SP+ILIQGTTA+EITSGLHWYLKY CGAHISW+KTGG+Q+ SVPKPG LP V
Sbjct  84   NYKVSSRNSPEILIQGTTAVEITSGLHWYLKYRCGAHISWDKTGGVQLASVPKPGSLPLV  143

Query  519  STEGVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
              +GV IQRPVPWNYYQNVVTSSYS+VWWDWQ
Sbjct  144  EADGVTIQRPVPWNYYQNVVTSSYSFVWWDWQ  175



>ref|XP_011087998.1| PREDICTED: alpha-N-acetylglucosaminidase [Sesamum indicum]
Length=809

 Score =   253 bits (645),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 113/154 (73%), Positives = 136/154 (88%), Gaps = 0/154 (0%)
 Frame = +3

Query  153  VQESEAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFR  332
            VQESE I SLL+ LD+K+PS S QESAA+GVL+RLLPTHLSSF  KI++KD CGG SCF+
Sbjct  27   VQESEVIASLLNSLDAKKPSPSEQESAARGVLRRLLPTHLSSFGFKIITKDACGGNSCFQ  86

Query  333  VTNFKSSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLP  512
            ++N+KSSS DS +I+I+GTTA++ITSGLHWYLKYWCGAH+SW+KTGG Q+ S+PKPG LP
Sbjct  87   ISNYKSSSKDSAEIMIKGTTAVDITSGLHWYLKYWCGAHVSWDKTGGTQLGSIPKPGSLP  146

Query  513  SVSTEGVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
             V  EGV +QRP+PWNYYQNVVTSSYSYVWWDW+
Sbjct  147  PVKYEGVTVQRPMPWNYYQNVVTSSYSYVWWDWE  180



>gb|EYU27032.1| hypothetical protein MIMGU_mgv1a001508mg [Erythranthe guttata]
Length=806

 Score =   249 bits (636),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 113/153 (74%), Positives = 136/153 (89%), Gaps = 0/153 (0%)
 Frame = +3

Query  156  QESEAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRV  335
            QESE IESL++RL +K+PS S QESAA+GVL+RLLP HLSSFE ++++KD CGG SCF++
Sbjct  28   QESEVIESLVNRLTTKKPSPSEQESAARGVLRRLLPAHLSSFEFEVITKDACGGNSCFQI  87

Query  336  TNFKSSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPS  515
            +N+K+SS +S +I+I+GTTA+EITSGL+WYLKY CGAHISWEKTGG Q+ SVPKPG LP 
Sbjct  88   SNYKNSSRNSAEIMIKGTTAVEITSGLYWYLKYMCGAHISWEKTGGAQLASVPKPGSLPP  147

Query  516  VSTEGVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
            V  EGVMIQRPVPWNYYQNVVTSSYSYVWWDW+
Sbjct  148  VRNEGVMIQRPVPWNYYQNVVTSSYSYVWWDWE  180



>emb|CDP19299.1| unnamed protein product [Coffea canephora]
Length=809

 Score =   248 bits (634),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 133/154 (86%), Gaps = 1/154 (1%)
 Frame = +3

Query  156  QESEA-IESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFR  332
            QESEA IESLL RLDSKR   SVQE+AA+GVLQRLLPTHLSSFE KIVSKD C G+SCFR
Sbjct  26   QESEAAIESLLKRLDSKRSPASVQEAAARGVLQRLLPTHLSSFEFKIVSKDGCDGRSCFR  85

Query  333  VTNFKSSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLP  512
            ++N+KSS  +SPQILI+GTTA EITSGLHWYLKY C  H+SW+KTGGIQI SVPKPG LP
Sbjct  86   ISNYKSSRRNSPQILIEGTTATEITSGLHWYLKYLCYVHVSWDKTGGIQIASVPKPGALP  145

Query  513  SVSTEGVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
             VS   V+IQR VPWNYYQNVVTSSYSYVWWDW+
Sbjct  146  RVSDNVVIIQRAVPWNYYQNVVTSSYSYVWWDWE  179



>ref|XP_002273084.1| PREDICTED: alpha-N-acetylglucosaminidase isoform X1 [Vitis vinifera]
Length=803

 Score =   248 bits (634),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/152 (74%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = +3

Query  159  ESEAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVT  338
             SEAIE+LLSRL +KR + SVQESAAK VLQRLLPTHL SF+ +IVSKDVCGG+SCF ++
Sbjct  22   HSEAIEALLSRLATKRAAPSVQESAAKAVLQRLLPTHLDSFQFEIVSKDVCGGKSCFWIS  81

Query  339  NFKSSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSV  518
            N+  SS + P+I+I+GTTA+EI SGLHWY+KYWCGAH+SW+KTG IQI S+PKPG LP V
Sbjct  82   NYNVSSKNGPEIMIKGTTAVEIASGLHWYIKYWCGAHVSWDKTGSIQIASIPKPGSLPLV  141

Query  519  STEGVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
              EGV+IQRPVPWNYYQNVVTSSYSYVWWDW+
Sbjct  142  KDEGVLIQRPVPWNYYQNVVTSSYSYVWWDWE  173



>emb|CBI24942.3| unnamed protein product [Vitis vinifera]
Length=868

 Score =   249 bits (635),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/152 (74%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = +3

Query  159  ESEAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVT  338
             SEAIE+LLSRL +KR + SVQESAAK VLQRLLPTHL SF+ +IVSKDVCGG+SCF ++
Sbjct  87   HSEAIEALLSRLATKRAAPSVQESAAKAVLQRLLPTHLDSFQFEIVSKDVCGGKSCFWIS  146

Query  339  NFKSSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSV  518
            N+  SS + P+I+I+GTTA+EI SGLHWY+KYWCGAH+SW+KTG IQI S+PKPG LP V
Sbjct  147  NYNVSSKNGPEIMIKGTTAVEIASGLHWYIKYWCGAHVSWDKTGSIQIASIPKPGSLPLV  206

Query  519  STEGVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
              EGV+IQRPVPWNYYQNVVTSSYSYVWWDW+
Sbjct  207  KDEGVLIQRPVPWNYYQNVVTSSYSYVWWDWE  238



>emb|CAA77084.1| alpha-N-acetylglucosaminidase [Nicotiana tabacum]
Length=811

 Score =   246 bits (629),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = +3

Query  159  ESEAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVT  338
            ES+AIES+L RL SK     VQESAAKGVLQRLLP HL SFE KIVSKD+CGG+SCFR+T
Sbjct  24   ESDAIESVLRRLHSKEAPPIVQESAAKGVLQRLLPAHLHSFEFKIVSKDLCGGRSCFRIT  83

Query  339  NFKSSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSV  518
            N+K SS +SP+ILIQGTTA+EITSGLHWYLKY CGAHISW+KTGG+Q+ SVPKPG LP V
Sbjct  84   NYKVSSRNSPEILIQGTTAVEITSGLHWYLKYRCGAHISWDKTGGVQLASVPKPGSLPLV  143

Query  519  STEGVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
                + IQRPVPWNYYQNVVTSSYS+VWWDWQ
Sbjct  144  KQMELTIQRPVPWNYYQNVVTSSYSFVWWDWQ  175



>ref|XP_008356745.1| PREDICTED: alpha-N-acetylglucosaminidase-like isoform X2 [Malus 
domestica]
Length=352

 Score =   235 bits (600),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 127/152 (84%), Gaps = 0/152 (0%)
 Frame = +3

Query  159  ESEAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVT  338
            ++EA+ +LL RLDSKR S SVQE+AAK VL+RLLPTH+ SF+ KIVS+D CGG SCF + 
Sbjct  25   KAEAVTALLRRLDSKRSSASVQEAAAKAVLERLLPTHVHSFDFKIVSQDACGGHSCFMLN  84

Query  339  NFKSSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSV  518
            N+  SSG  P+I ++GTTA+EI SGLHWYLKYWCGAH+SW+KTGG Q+ S+P PG LP V
Sbjct  85   NYNLSSGHGPEIQVKGTTAVEIASGLHWYLKYWCGAHVSWDKTGGAQLASIPSPGSLPRV  144

Query  519  STEGVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
              EG+ IQRPVPWNYYQNVVTSSYS+VWWDW+
Sbjct  145  RDEGLRIQRPVPWNYYQNVVTSSYSFVWWDWE  176



>ref|XP_008356744.1| PREDICTED: alpha-N-acetylglucosaminidase-like isoform X1 [Malus 
domestica]
Length=401

 Score =   236 bits (603),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 127/152 (84%), Gaps = 0/152 (0%)
 Frame = +3

Query  159  ESEAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVT  338
            ++EA+ +LL RLDSKR S SVQE+AAK VL+RLLPTH+ SF+ KIVS+D CGG SCF + 
Sbjct  25   KAEAVTALLRRLDSKRSSASVQEAAAKAVLERLLPTHVHSFDFKIVSQDACGGHSCFMLN  84

Query  339  NFKSSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSV  518
            N+  SSG  P+I ++GTTA+EI SGLHWYLKYWCGAH+SW+KTGG Q+ S+P PG LP V
Sbjct  85   NYNLSSGHGPEIQVKGTTAVEIASGLHWYLKYWCGAHVSWDKTGGAQLASIPSPGSLPRV  144

Query  519  STEGVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
              EG+ IQRPVPWNYYQNVVTSSYS+VWWDW+
Sbjct  145  RDEGLRIQRPVPWNYYQNVVTSSYSFVWWDWE  176



>ref|XP_008375270.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Malus domestica]
Length=397

 Score =   236 bits (602),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 127/152 (84%), Gaps = 0/152 (0%)
 Frame = +3

Query  159  ESEAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVT  338
            ++EA+ +LL RLDSKR S SVQE+AAK VL+RLLPTH+ SF+ KIVS+D CGG SCF + 
Sbjct  21   KAEAVTALLRRLDSKRSSASVQEAAAKAVLERLLPTHVHSFDFKIVSQDACGGHSCFMLN  80

Query  339  NFKSSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSV  518
            N+  SSG  P+I ++GTTA+EI SGLHWYLKYWCGAH+SW+KTGG Q+ S+P PG LP V
Sbjct  81   NYNLSSGHGPEIQVKGTTAVEIASGLHWYLKYWCGAHVSWDKTGGAQLASIPSPGSLPRV  140

Query  519  STEGVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
              EG+ IQRPVPWNYYQNVVTSSYS+VWWDW+
Sbjct  141  RDEGLRIQRPVPWNYYQNVVTSSYSFVWWDWE  172



>ref|XP_002314048.1| hypothetical protein POPTR_0009s06320g [Populus trichocarpa]
 gb|EEE88003.1| hypothetical protein POPTR_0009s06320g [Populus trichocarpa]
Length=806

 Score =   244 bits (623),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 131/151 (87%), Gaps = 1/151 (1%)
 Frame = +3

Query  165  EAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNF  344
            EAI+SLL RLDSKR S+S QESAAK VL+RLLP+H+ SF  KIVSKDVCGG SCF + N+
Sbjct  27   EAIDSLLKRLDSKRASSSDQESAAKAVLKRLLPSHIHSFLFKIVSKDVCGGHSCFLINNY  86

Query  345  -KSSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVS  521
             K SSG+ P+I I+GTTA+EI SGLHWYLKYWCGAH+SW+KTGG+QI S+PKPG LP V 
Sbjct  87   YKESSGNGPEISIKGTTAVEIASGLHWYLKYWCGAHVSWDKTGGVQIASIPKPGSLPHVK  146

Query  522  TEGVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
             +GVMIQRPVPWNYYQNVVTSSYSYVWW+W+
Sbjct  147  DKGVMIQRPVPWNYYQNVVTSSYSYVWWNWE  177



>ref|XP_004499942.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Cicer arietinum]
Length=805

 Score =   244 bits (623),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 111/154 (72%), Positives = 129/154 (84%), Gaps = 0/154 (0%)
 Frame = +3

Query  153  VQESEAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFR  332
            + + EAIESLL RLDSKR  +SVQE+AA GVL+RLLPTH SSFE KIVSKDVCGG SCF 
Sbjct  24   LSKHEAIESLLHRLDSKRALSSVQEAAATGVLKRLLPTHFSSFEFKIVSKDVCGGDSCFM  83

Query  333  VTNFKSSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLP  512
            + N   SS + P+I+I+GTT +EI SGLHWYLKYWCGAH+SW+KTGGIQ  S+PKPG LP
Sbjct  84   INNHNKSSQNGPEIIIRGTTGVEIASGLHWYLKYWCGAHVSWDKTGGIQTTSIPKPGSLP  143

Query  513  SVSTEGVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
             +  EGV I+RPVPWNYYQNVVTSSYS+VWWDW+
Sbjct  144  LLKDEGVKIKRPVPWNYYQNVVTSSYSFVWWDWE  177



>ref|XP_011025477.1| PREDICTED: alpha-N-acetylglucosaminidase [Populus euphratica]
Length=806

 Score =   243 bits (619),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/151 (74%), Positives = 132/151 (87%), Gaps = 1/151 (1%)
 Frame = +3

Query  165  EAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNF  344
            EAI+SLL+RLDSKR S+S QESAAK VL+RLLP+H+ SF  KIVSKDVCGG SCF + ++
Sbjct  27   EAIDSLLNRLDSKRASSSDQESAAKAVLKRLLPSHVHSFLFKIVSKDVCGGHSCFLINDY  86

Query  345  -KSSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVS  521
             K SSG+ P+I I+GTTA+EI SGLHWYLKYWCGAH+SW+KTGG+QI S+PKPG LP V 
Sbjct  87   YKESSGNGPEISIKGTTAVEIASGLHWYLKYWCGAHVSWDKTGGVQIASIPKPGSLPRVK  146

Query  522  TEGVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
             +GVMIQRPVPWNYYQNVVTSSYSYVWW+W+
Sbjct  147  DKGVMIQRPVPWNYYQNVVTSSYSYVWWNWE  177



>ref|XP_007148897.1| hypothetical protein PHAVU_005G023300g [Phaseolus vulgaris]
 gb|ESW20891.1| hypothetical protein PHAVU_005G023300g [Phaseolus vulgaris]
Length=802

 Score =   242 bits (618),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/148 (74%), Positives = 128/148 (86%), Gaps = 0/148 (0%)
 Frame = +3

Query  171  IESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKS  350
            +E LL RLDSKR ++SVQE+AA G+L+RLLPTHLSSFE KIVSKDVCGG SCF + N K 
Sbjct  27   MEPLLQRLDSKRAASSVQEAAAVGLLKRLLPTHLSSFEFKIVSKDVCGGDSCFLINNHKK  86

Query  351  SSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEG  530
            SS + P+I+I+GTTA+EI SGLHWYLKYWCGAH+SW+KTGGIQ  SVP+PG LP +  EG
Sbjct  87   SSQNEPEIVIRGTTAVEIASGLHWYLKYWCGAHVSWDKTGGIQTTSVPEPGSLPRLKDEG  146

Query  531  VMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
            V I+RPVPWNYYQNVVTSSYSYVWWDW+
Sbjct  147  VKIKRPVPWNYYQNVVTSSYSYVWWDWE  174



>ref|XP_007148898.1| hypothetical protein PHAVU_005G023300g [Phaseolus vulgaris]
 gb|ESW20892.1| hypothetical protein PHAVU_005G023300g [Phaseolus vulgaris]
Length=796

 Score =   242 bits (618),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/149 (74%), Positives = 128/149 (86%), Gaps = 0/149 (0%)
 Frame = +3

Query  168  AIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFK  347
             +E LL RLDSKR ++SVQE+AA G+L+RLLPTHLSSFE KIVSKDVCGG SCF + N K
Sbjct  26   VMEPLLQRLDSKRAASSVQEAAAVGLLKRLLPTHLSSFEFKIVSKDVCGGDSCFLINNHK  85

Query  348  SSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTE  527
             SS + P+I+I+GTTA+EI SGLHWYLKYWCGAH+SW+KTGGIQ  SVP+PG LP +  E
Sbjct  86   KSSQNEPEIVIRGTTAVEIASGLHWYLKYWCGAHVSWDKTGGIQTTSVPEPGSLPRLKDE  145

Query  528  GVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
            GV I+RPVPWNYYQNVVTSSYSYVWWDW+
Sbjct  146  GVKIKRPVPWNYYQNVVTSSYSYVWWDWE  174



>ref|XP_003599415.1| Alpha-N-acetylglucosaminidase [Medicago truncatula]
Length=539

 Score =   236 bits (603),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 124/150 (83%), Gaps = 0/150 (0%)
 Frame = +3

Query  165  EAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNF  344
            EAI+SLL RLDSKR   SVQESAAKGVL+RLLPTH SSFE  IVSKD CGG SCF + N+
Sbjct  29   EAIQSLLHRLDSKRALPSVQESAAKGVLKRLLPTHFSSFEFIIVSKDACGGDSCFIINNY  88

Query  345  KSSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVST  524
              SS   P+I+I+GTT +EI SGLHWYLKYWCGAH+SW+KTGGIQ  S+PKPG LP +  
Sbjct  89   NKSSQKGPEIIIRGTTGVEIASGLHWYLKYWCGAHVSWDKTGGIQTTSIPKPGSLPLLKD  148

Query  525  EGVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
             GV I+RPVPWNYYQNVVTSSYS+VWWDW+
Sbjct  149  GGVKIKRPVPWNYYQNVVTSSYSFVWWDWE  178



>ref|XP_008231468.1| PREDICTED: alpha-N-acetylglucosaminidase [Prunus mume]
Length=803

 Score =   240 bits (612),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = +3

Query  159  ESEAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVT  338
            E EA+E+LLSRLDSKR S SVQE+AAK VL+RLLPTH+ SF+ KIVSK+ CGGQSCF + 
Sbjct  23   EPEAVEALLSRLDSKRSSASVQEAAAKAVLKRLLPTHVDSFDFKIVSKEACGGQSCFLLN  82

Query  339  NFKSSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSV  518
            N   S    P+I I+GTTA+EI SGLHWYLKYWCGAH+SW+KTGG+Q+ S+PKPG LP V
Sbjct  83   NNNLSRRQGPEIQIKGTTAVEIASGLHWYLKYWCGAHVSWDKTGGVQVVSIPKPGSLPRV  142

Query  519  STEGVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
              EG+ IQRP+PWNYYQNVVTSSYS+VWWDW+
Sbjct  143  RDEGLKIQRPIPWNYYQNVVTSSYSFVWWDWE  174



>ref|XP_007052478.1| Alpha-N-acetylglucosaminidase family / NAGLU family isoform 1 
[Theobroma cacao]
 gb|EOX96635.1| Alpha-N-acetylglucosaminidase family / NAGLU family isoform 1 
[Theobroma cacao]
Length=809

 Score =   240 bits (613),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = +3

Query  159  ESEAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVT  338
             +EA+E +L+RLDSKR S SVQESAAK VL RLLPTH  SF  +IV KDVCGG+SCF + 
Sbjct  29   RTEAVEPILTRLDSKRSSPSVQESAAKAVLGRLLPTHFHSFHFEIVPKDVCGGRSCFLIE  88

Query  339  NFKSSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSV  518
            N+  +S D P+I+I+GTTA+EI SGLHWY+KY+CGAH+SW+KTGG+QI SVPKPG LP V
Sbjct  89   NYNRTSQDGPEIIIKGTTAVEIASGLHWYIKYFCGAHVSWDKTGGVQIASVPKPGSLPLV  148

Query  519  STEGVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
               GV+IQRP+PWNYYQNVVTSSYSYVWWDWQ
Sbjct  149  KDGGVLIQRPIPWNYYQNVVTSSYSYVWWDWQ  180



>ref|XP_010257138.1| PREDICTED: alpha-N-acetylglucosaminidase isoform X1 [Nelumbo 
nucifera]
Length=801

 Score =   239 bits (611),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 123/150 (82%), Gaps = 0/150 (0%)
 Frame = +3

Query  165  EAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNF  344
            E +E LL RLD KR S SVQE+AAK VLQRLLPTHLSSFE  I+ KD CGG SCF + NF
Sbjct  23   EEMEVLLKRLDGKRASPSVQEAAAKAVLQRLLPTHLSSFEFNIIPKDACGGYSCFWIKNF  82

Query  345  KSSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVST  524
              S+ + P+ILIQGTTA+EITSGLHWYLKYWCGAH SW+KTGG QI S+P+PG LP V  
Sbjct  83   DPSNSNGPEILIQGTTAVEITSGLHWYLKYWCGAHFSWDKTGGTQIGSIPRPGSLPLVKD  142

Query  525  EGVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
             G M+QRPVPWNYYQNVVTSSYS+VWWDW+
Sbjct  143  GGEMVQRPVPWNYYQNVVTSSYSFVWWDWE  172



>gb|KDP43563.1| hypothetical protein JCGZ_16850 [Jatropha curcas]
Length=811

 Score =   239 bits (611),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = +3

Query  159  ESEAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVT  338
             +E IE+LL+RLDSK+ S SVQESAAKGVL+RLLP+H+ SF+ KI+SKDVCGG+SCF + 
Sbjct  31   RTETIETLLNRLDSKQASASVQESAAKGVLKRLLPSHVHSFKFKIISKDVCGGKSCFLIN  90

Query  339  NFKSSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSV  518
            N+K S+ + P+I+I+GTT +++ SGLHWY+KYWCGAH+SW+KTGG QI S+PK G LP +
Sbjct  91   NYKESNQNGPEIIIKGTTGVDLASGLHWYIKYWCGAHLSWDKTGGAQIGSIPKQGSLPLI  150

Query  519  STEGVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
               GVMIQRPVPWNYYQNVVTSSYSYVWWDW+
Sbjct  151  KDGGVMIQRPVPWNYYQNVVTSSYSYVWWDWE  182



>gb|KJB24983.1| hypothetical protein B456_004G170700 [Gossypium raimondii]
Length=745

 Score =   238 bits (606),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 127/151 (84%), Gaps = 0/151 (0%)
 Frame = +3

Query  162  SEAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTN  341
            +EAI+  L+RLDSKR S SVQESAAK VL RLLPTHL SF  KIVSKDVCGGQ CF + N
Sbjct  41   TEAIQPSLTRLDSKRSSPSVQESAAKAVLGRLLPTHLLSFHFKIVSKDVCGGQGCFLIEN  100

Query  342  FKSSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVS  521
            +   + + P+ILI+GTTA+EI SGLHWY+KY+CGAH+SW+KTGG+Q+ SVPKPG LP V 
Sbjct  101  YDGPTENGPEILIKGTTAVEIASGLHWYIKYFCGAHVSWDKTGGVQLASVPKPGSLPLVK  160

Query  522  TEGVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
              GV+IQRPVPWNYYQNVVTSSYSYVWWDW+
Sbjct  161  DGGVLIQRPVPWNYYQNVVTSSYSYVWWDWE  191



>ref|XP_004135943.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Cucumis sativus]
Length=774

 Score =   237 bits (605),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = +3

Query  159  ESEAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVT  338
            + EAI++++ RLDSK  S S+QE+AAK +L+RLLPTH+ SFE +IVS+DVCGG SCF ++
Sbjct  22   QQEAIQAIIHRLDSKALSPSIQEAAAKALLRRLLPTHVDSFEFQIVSRDVCGGGSCFLIS  81

Query  339  NFKSSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSV  518
            NFKSSS +  +ILI+GTTA+EITSGL+WYLKYWCGAH+SW+KTGG+Q+ S+PKPG LP +
Sbjct  82   NFKSSSRNGAEILIRGTTAVEITSGLYWYLKYWCGAHVSWDKTGGVQLASIPKPGSLPFL  141

Query  519  STEGVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
               GV+I+RPVPWNYYQNVVTSSYSYVWWDW+
Sbjct  142  KGNGVVIKRPVPWNYYQNVVTSSYSYVWWDWE  173



>gb|AES69667.2| alpha-N-acetylglucosaminidase family protein [Medicago truncatula]
Length=781

 Score =   237 bits (605),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 124/150 (83%), Gaps = 0/150 (0%)
 Frame = +3

Query  165  EAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNF  344
            EAI+SLL RLDSKR   SVQESAAKGVL+RLLPTH SSFE  IVSKD CGG SCF + N+
Sbjct  29   EAIQSLLHRLDSKRALPSVQESAAKGVLKRLLPTHFSSFEFIIVSKDACGGDSCFIINNY  88

Query  345  KSSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVST  524
              SS   P+I+I+GTT +EI SGLHWYLKYWCGAH+SW+KTGGIQ  S+PKPG LP +  
Sbjct  89   NKSSQKGPEIIIRGTTGVEIASGLHWYLKYWCGAHVSWDKTGGIQTTSIPKPGSLPLLKD  148

Query  525  EGVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
             GV I+RPVPWNYYQNVVTSSYS+VWWDW+
Sbjct  149  GGVKIKRPVPWNYYQNVVTSSYSFVWWDWE  178



>gb|KJB24984.1| hypothetical protein B456_004G170700 [Gossypium raimondii]
Length=784

 Score =   237 bits (605),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 127/151 (84%), Gaps = 0/151 (0%)
 Frame = +3

Query  162  SEAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTN  341
            +EAI+  L+RLDSKR S SVQESAAK VL RLLPTHL SF  KIVSKDVCGGQ CF + N
Sbjct  41   TEAIQPSLTRLDSKRSSPSVQESAAKAVLGRLLPTHLLSFHFKIVSKDVCGGQGCFLIEN  100

Query  342  FKSSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVS  521
            +   + + P+ILI+GTTA+EI SGLHWY+KY+CGAH+SW+KTGG+Q+ SVPKPG LP V 
Sbjct  101  YDGPTENGPEILIKGTTAVEIASGLHWYIKYFCGAHVSWDKTGGVQLASVPKPGSLPLVK  160

Query  522  TEGVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
              GV+IQRPVPWNYYQNVVTSSYSYVWWDW+
Sbjct  161  DGGVLIQRPVPWNYYQNVVTSSYSYVWWDWE  191



>ref|XP_003599416.1| Alpha-N-acetylglucosaminidase [Medicago truncatula]
Length=807

 Score =   238 bits (606),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 124/150 (83%), Gaps = 0/150 (0%)
 Frame = +3

Query  165  EAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNF  344
            EAI+SLL RLDSKR   SVQESAAKGVL+RLLPTH SSFE  IVSKD CGG SCF + N+
Sbjct  29   EAIQSLLHRLDSKRALPSVQESAAKGVLKRLLPTHFSSFEFIIVSKDACGGDSCFIINNY  88

Query  345  KSSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVST  524
              SS   P+I+I+GTT +EI SGLHWYLKYWCGAH+SW+KTGGIQ  S+PKPG LP +  
Sbjct  89   NKSSQKGPEIIIRGTTGVEIASGLHWYLKYWCGAHVSWDKTGGIQTTSIPKPGSLPLLKD  148

Query  525  EGVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
             GV I+RPVPWNYYQNVVTSSYS+VWWDW+
Sbjct  149  GGVKIKRPVPWNYYQNVVTSSYSFVWWDWE  178



>gb|AES69665.2| alpha-N-acetylglucosaminidase family protein [Medicago truncatula]
Length=806

 Score =   237 bits (605),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 124/150 (83%), Gaps = 0/150 (0%)
 Frame = +3

Query  165  EAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNF  344
            EAI+SLL RLDSKR   SVQESAAKGVL+RLLPTH SSFE  IVSKD CGG SCF + N+
Sbjct  29   EAIQSLLHRLDSKRALPSVQESAAKGVLKRLLPTHFSSFEFIIVSKDACGGDSCFIINNY  88

Query  345  KSSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVST  524
              SS   P+I+I+GTT +EI SGLHWYLKYWCGAH+SW+KTGGIQ  S+PKPG LP +  
Sbjct  89   NKSSQKGPEIIIRGTTGVEIASGLHWYLKYWCGAHVSWDKTGGIQTTSIPKPGSLPLLKD  148

Query  525  EGVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
             GV I+RPVPWNYYQNVVTSSYS+VWWDW+
Sbjct  149  GGVKIKRPVPWNYYQNVVTSSYSFVWWDWE  178



>gb|KGN45103.1| hypothetical protein Csa_7G425950 [Cucumis sativus]
Length=765

 Score =   237 bits (604),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = +3

Query  159  ESEAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVT  338
            + EAI++++ RLDSK  S S+QE+AAK +L+RLLPTH+ SFE +IVS+DVCGG SCF ++
Sbjct  22   QQEAIQAIIHRLDSKALSPSIQEAAAKALLRRLLPTHVDSFEFQIVSRDVCGGGSCFLIS  81

Query  339  NFKSSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSV  518
            NFKSSS +  +ILI+GTTA+EITSGL+WYLKYWCGAH+SW+KTGG+Q+ S+PKPG LP +
Sbjct  82   NFKSSSRNGAEILIRGTTAVEITSGLYWYLKYWCGAHVSWDKTGGVQLASIPKPGSLPFL  141

Query  519  STEGVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
               GV+I+RPVPWNYYQNVVTSSYSYVWWDW+
Sbjct  142  KGNGVVIKRPVPWNYYQNVVTSSYSYVWWDWE  173



>gb|KJB24982.1| hypothetical protein B456_004G170700 [Gossypium raimondii]
Length=820

 Score =   238 bits (606),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 127/151 (84%), Gaps = 0/151 (0%)
 Frame = +3

Query  162  SEAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTN  341
            +EAI+  L+RLDSKR S SVQESAAK VL RLLPTHL SF  KIVSKDVCGGQ CF + N
Sbjct  41   TEAIQPSLTRLDSKRSSPSVQESAAKAVLGRLLPTHLLSFHFKIVSKDVCGGQGCFLIEN  100

Query  342  FKSSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVS  521
            +   + + P+ILI+GTTA+EI SGLHWY+KY+CGAH+SW+KTGG+Q+ SVPKPG LP V 
Sbjct  101  YDGPTENGPEILIKGTTAVEIASGLHWYIKYFCGAHVSWDKTGGVQLASVPKPGSLPLVK  160

Query  522  TEGVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
              GV+IQRPVPWNYYQNVVTSSYSYVWWDW+
Sbjct  161  DGGVLIQRPVPWNYYQNVVTSSYSYVWWDWE  191



>ref|XP_002517786.1| alpha-n-acetylglucosaminidase, putative [Ricinus communis]
 gb|EEF44593.1| alpha-n-acetylglucosaminidase, putative [Ricinus communis]
Length=174

 Score =   221 bits (564),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 119/144 (83%), Gaps = 0/144 (0%)
 Frame = +3

Query  165  EAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNF  344
            + IE+LLSRLDSKR S SVQESAAKGVLQRLLPTH+ SFE +IV KDVCGG SCF + N 
Sbjct  31   QPIEALLSRLDSKRSSPSVQESAAKGVLQRLLPTHVHSFEFEIVPKDVCGGHSCFLINNS  90

Query  345  KSSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVST  524
               S D P+I I+GT+A+E+TSGLHWYLKYWCGAHISW+KTGGIQ  S+P PG LP V  
Sbjct  91   NQLSQDGPEIFIKGTSAVELTSGLHWYLKYWCGAHISWDKTGGIQKASIPNPGSLPPVKD  150

Query  525  EGVMIQRPVPWNYYQNVVTSSYSY  596
            EG++IQRPVPWNYYQNVVTSS  +
Sbjct  151  EGIVIQRPVPWNYYQNVVTSSCKH  174



>ref|XP_003599414.1| Alpha-N-acetylglucosaminidase [Medicago truncatula]
Length=832

 Score =   238 bits (606),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 124/150 (83%), Gaps = 0/150 (0%)
 Frame = +3

Query  165  EAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNF  344
            EAI+SLL RLDSKR   SVQESAAKGVL+RLLPTH SSFE  IVSKD CGG SCF + N+
Sbjct  29   EAIQSLLHRLDSKRALPSVQESAAKGVLKRLLPTHFSSFEFIIVSKDACGGDSCFIINNY  88

Query  345  KSSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVST  524
              SS   P+I+I+GTT +EI SGLHWYLKYWCGAH+SW+KTGGIQ  S+PKPG LP +  
Sbjct  89   NKSSQKGPEIIIRGTTGVEIASGLHWYLKYWCGAHVSWDKTGGIQTTSIPKPGSLPLLKD  148

Query  525  EGVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
             GV I+RPVPWNYYQNVVTSSYS+VWWDW+
Sbjct  149  GGVKIKRPVPWNYYQNVVTSSYSFVWWDWE  178



>ref|XP_007218923.1| hypothetical protein PRUPE_ppa001555mg [Prunus persica]
 gb|EMJ20122.1| hypothetical protein PRUPE_ppa001555mg [Prunus persica]
Length=803

 Score =   237 bits (604),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/154 (69%), Positives = 127/154 (82%), Gaps = 0/154 (0%)
 Frame = +3

Query  153  VQESEAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFR  332
            + E EA+E+LL RLDSKR   SVQE+AAK VL+RLLPTH+ SF+ KI SK+ CGGQSCF 
Sbjct  21   LSEPEAVEALLRRLDSKRSPASVQEAAAKAVLKRLLPTHVDSFDFKIFSKEACGGQSCFL  80

Query  333  VTNFKSSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLP  512
            + N   SS   P+I I+GTTA+EI SGLHWYLKYWCGAH+SW+KTGG+Q+ S+PKPG LP
Sbjct  81   LNNNNLSSRQGPEIQIKGTTAVEIASGLHWYLKYWCGAHVSWDKTGGVQVVSIPKPGSLP  140

Query  513  SVSTEGVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
             V  EG+ IQRP+PWNYYQNVVTSSYS+VWWDW+
Sbjct  141  RVRDEGLKIQRPIPWNYYQNVVTSSYSFVWWDWE  174



>ref|XP_003535842.1| PREDICTED: alpha-N-acetylglucosaminidase-like isoform X1 [Glycine 
max]
Length=807

 Score =   237 bits (604),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 107/150 (71%), Positives = 126/150 (84%), Gaps = 0/150 (0%)
 Frame = +3

Query  165  EAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNF  344
            EAIE LL RLDSKR   SVQE+AA G+L+RLLP H SSF+ KIVSKDVCGG SCF + N 
Sbjct  25   EAIEPLLQRLDSKRAPPSVQEAAAIGLLKRLLPIHFSSFQFKIVSKDVCGGDSCFLINNH  84

Query  345  KSSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVST  524
              SS + P+I+I+GTTA+EI SGLHWYLKYWCGAH+SW+KTGGIQ  S+P+PG LPS+  
Sbjct  85   NKSSQNEPEIIIRGTTAVEIASGLHWYLKYWCGAHVSWDKTGGIQTTSIPEPGSLPSLKD  144

Query  525  EGVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
            EG+ I+RPVPWNYYQNVVTSSYSYVWW+W+
Sbjct  145  EGLKIKRPVPWNYYQNVVTSSYSYVWWNWE  174



>gb|KHM99190.1| Alpha-N-acetylglucosaminidase [Glycine soja]
Length=807

 Score =   237 bits (604),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 107/150 (71%), Positives = 126/150 (84%), Gaps = 0/150 (0%)
 Frame = +3

Query  165  EAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNF  344
            EAIE LL RLDSKR   SVQE+AA G+L+RLLP H SSF+ KIVSKDVCGG SCF + N 
Sbjct  25   EAIEPLLQRLDSKRAPPSVQEAAAIGLLKRLLPIHFSSFQFKIVSKDVCGGDSCFLINNH  84

Query  345  KSSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVST  524
              SS + P+I+I+GTTA+EI SGLHWYLKYWCGAH+SW+KTGGIQ  S+P+PG LPS+  
Sbjct  85   NKSSQNEPEIIIRGTTAVEIASGLHWYLKYWCGAHVSWDKTGGIQTTSIPEPGSLPSLKD  144

Query  525  EGVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
            EG+ I+RPVPWNYYQNVVTSSYSYVWW+W+
Sbjct  145  EGLKIKRPVPWNYYQNVVTSSYSYVWWNWE  174



>ref|XP_008461320.1| PREDICTED: alpha-N-acetylglucosaminidase [Cucumis melo]
Length=774

 Score =   235 bits (600),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = +3

Query  159  ESEAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVT  338
            + EAI++++ RLDSK  S S+QE+AAK +L+RLLPTH+ SFE +IVS+DVC G SCF ++
Sbjct  22   QQEAIQAIIHRLDSKTLSPSIQEAAAKALLRRLLPTHVDSFEFQIVSRDVCSGGSCFLIS  81

Query  339  NFKSSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSV  518
            NFKSSS +  +ILI+GTTA+EITSGL+WYLKYWCGAH+SW+KTGG+Q+ S+PKPG LP +
Sbjct  82   NFKSSSRNGAEILIRGTTAVEITSGLYWYLKYWCGAHVSWDKTGGVQLASIPKPGSLPFL  141

Query  519  STEGVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
              +GV+I+RPVPWNYYQNVVTSSYSYVWWDW+
Sbjct  142  KGDGVVIKRPVPWNYYQNVVTSSYSYVWWDWE  173



>gb|EPS69705.1| hypothetical protein M569_05058, partial [Genlisea aurea]
Length=315

 Score =   224 bits (572),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 100/149 (67%), Positives = 130/149 (87%), Gaps = 0/149 (0%)
 Frame = +3

Query  168  AIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFK  347
            AIESLL+RL +K+PS+SVQE+AAKGVL+RLLP+H+ SF+ +I+ K+ CGG++CFR+ N +
Sbjct  1    AIESLLNRLQAKKPSSSVQETAAKGVLKRLLPSHVDSFDFRIIPKEACGGKACFRIRNHE  60

Query  348  SSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTE  527
             S+ +S +I+I+GTTA++ITSGLH+Y KY C AH+SWEKTGG Q++SVPKPG LP V + 
Sbjct  61   RSTINSAEIMIEGTTAVDITSGLHFYFKYSCDAHVSWEKTGGAQLDSVPKPGSLPLVRSN  120

Query  528  GVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
            G+ IQRPVPWNYYQNVVTSSYSYVWWDW+
Sbjct  121  GLEIQRPVPWNYYQNVVTSSYSYVWWDWE  149



>ref|XP_009368036.1| PREDICTED: alpha-N-acetylglucosaminidase [Pyrus x bretschneideri]
Length=808

 Score =   236 bits (601),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = +3

Query  159  ESEAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVT  338
            ++EA+ +LL RLDSKR S SVQE+AAK VL+RLLPTH+ SF+ KIVS+D CGG SCF + 
Sbjct  25   KAEAVAALLRRLDSKRSSASVQEAAAKAVLERLLPTHVHSFDFKIVSQDACGGHSCFMLN  84

Query  339  NFKSSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSV  518
            N+  SS   P+I ++GTTA+EI SGLHWYLKYWCGAH+SW+KTGG Q+ S+P PG LP V
Sbjct  85   NYNLSSRHGPEIQVKGTTAVEIASGLHWYLKYWCGAHVSWDKTGGAQLASIPSPGSLPRV  144

Query  519  STEGVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
              EG+ IQRPVPWNYYQNVVTSSYS+VWWDW+
Sbjct  145  RDEGLRIQRPVPWNYYQNVVTSSYSFVWWDWE  176



>ref|XP_006482916.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Citrus sinensis]
Length=811

 Score =   234 bits (598),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 110/149 (74%), Positives = 126/149 (85%), Gaps = 0/149 (0%)
 Frame = +3

Query  153  VQESEAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFR  332
            V + E I+ LL RLDSKR ++SVQESAAK VLQRLLPTH++SF  KIVSKDVCGG SCF 
Sbjct  21   VSKLEGIDVLLDRLDSKRVNSSVQESAAKAVLQRLLPTHVNSFHFKIVSKDVCGGSSCFL  80

Query  333  VTNFKSSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLP  512
            + N+K +S + P+I I+GTTA+EITSGLHWY+KYWCGAH+SWEKTGG QI SVPKPG LP
Sbjct  81   IDNYKRTSQNEPEITIKGTTAVEITSGLHWYIKYWCGAHVSWEKTGGFQIASVPKPGSLP  140

Query  513  SVSTEGVMIQRPVPWNYYQNVVTSSYSYV  599
             V+  GV IQRPVPWNYYQNVVTSSYSYV
Sbjct  141  HVTDGGVKIQRPVPWNYYQNVVTSSYSYV  169



>ref|XP_006438966.1| hypothetical protein CICLE_v10030724mg [Citrus clementina]
 gb|ESR52206.1| hypothetical protein CICLE_v10030724mg [Citrus clementina]
Length=811

 Score =   234 bits (598),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 110/149 (74%), Positives = 126/149 (85%), Gaps = 0/149 (0%)
 Frame = +3

Query  153  VQESEAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFR  332
            V + E I+ LL RLDSKR ++SVQESAAK VLQRLLPTH++SF  KIVSKDVCGG SCF 
Sbjct  21   VSKLEGIDVLLDRLDSKRVNSSVQESAAKAVLQRLLPTHVNSFHFKIVSKDVCGGSSCFL  80

Query  333  VTNFKSSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLP  512
            + N+K +S + P+I I+GTTA+EITSGLHWY+KYWCGAH+SWEKTGG QI SVPKPG LP
Sbjct  81   IDNYKRTSQNEPEITIKGTTAVEITSGLHWYIKYWCGAHVSWEKTGGFQIASVPKPGSLP  140

Query  513  SVSTEGVMIQRPVPWNYYQNVVTSSYSYV  599
             V+  GV IQRPVPWNYYQNVVTSSYSYV
Sbjct  141  HVTDGGVKIQRPVPWNYYQNVVTSSYSYV  169



>gb|KDO83338.1| hypothetical protein CISIN_1g003545mg [Citrus sinensis]
Length=811

 Score =   234 bits (598),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 110/149 (74%), Positives = 127/149 (85%), Gaps = 0/149 (0%)
 Frame = +3

Query  153  VQESEAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFR  332
            V + E I+ LL RLDSKR ++SVQESAAK VLQRLLPTH++SF+ KIVSKDVCGG SCF 
Sbjct  21   VSKLEGIDVLLDRLDSKRVNSSVQESAAKAVLQRLLPTHVNSFQFKIVSKDVCGGSSCFL  80

Query  333  VTNFKSSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLP  512
            + N+K +S + P+I I+GTTA+EITSGLHWY+KYWCGAH+SWEKTGG QI SVPKPG LP
Sbjct  81   IDNYKRTSQNEPEITIKGTTAVEITSGLHWYIKYWCGAHVSWEKTGGFQIVSVPKPGSLP  140

Query  513  SVSTEGVMIQRPVPWNYYQNVVTSSYSYV  599
             V+  GV IQRPVPWNYYQNVVTSSYSYV
Sbjct  141  HVTDGGVKIQRPVPWNYYQNVVTSSYSYV  169



>gb|KHG14952.1| Alpha-N-acetylglucosaminidase [Gossypium arboreum]
Length=805

 Score =   229 bits (583),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/151 (70%), Positives = 125/151 (83%), Gaps = 1/151 (1%)
 Frame = +3

Query  162  SEAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTN  341
            +EAI+  L+RLDSKR S SVQESAAK VL R LPTHL SF  KIVSKDVCGGQ CF + N
Sbjct  27   TEAIQPSLTRLDSKRSSPSVQESAAKAVLGRFLPTHLHSFHFKIVSKDVCGGQGCFLIEN  86

Query  342  FKSSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVS  521
            +   + + P+ILI+GTTA+EI SGLHWY+KY+CGAH+SW+KTGG+Q+ SVPKPG LP V 
Sbjct  87   YDGPTENGPEILIKGTTAVEIASGLHWYIKYFCGAHVSWDKTGGVQLASVPKPGSLPLVK  146

Query  522  TEGVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
              GV+IQRPVPWNYYQNVVTS+ SYVWWDW+
Sbjct  147  DSGVLIQRPVPWNYYQNVVTSN-SYVWWDWE  176



>ref|XP_010097439.1| hypothetical protein L484_004673 [Morus notabilis]
 gb|EXB68327.1| hypothetical protein L484_004673 [Morus notabilis]
Length=802

 Score =   228 bits (582),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 121/152 (80%), Gaps = 0/152 (0%)
 Frame = +3

Query  159  ESEAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVT  338
            E EA++ LL RLDS R   S+QE+AA+ +L RLLPTH+SSF  KIV  DVC G SCF + 
Sbjct  22   EPEAVQHLLRRLDSNRAPASLQEAAAQALLSRLLPTHVSSFVFKIVPMDVCHGHSCFILA  81

Query  339  NFKSSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSV  518
            N+  SS   P+I+I+GTT +E+ SGLHWYLKYWCGAHISW+KTGG QI S+P PG LP V
Sbjct  82   NYNLSSKHGPEIMIKGTTGVELASGLHWYLKYWCGAHISWDKTGGAQIASIPNPGSLPPV  141

Query  519  STEGVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
              EGVMIQRPVPWNYYQNVVTSSYS+VWWDW+
Sbjct  142  KDEGVMIQRPVPWNYYQNVVTSSYSFVWWDWE  173



>ref|XP_010067843.1| PREDICTED: alpha-N-acetylglucosaminidase [Eucalyptus grandis]
Length=804

 Score =   228 bits (580),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 103/149 (69%), Positives = 125/149 (84%), Gaps = 2/149 (1%)
 Frame = +3

Query  165  EAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNF  344
            + IESLL+RL+SKR S SVQE+AA GVL+RLLP H  SF+ KIV KDVCGG++CF + N+
Sbjct  28   DVIESLLTRLESKRASPSVQETAAAGVLERLLPFHSRSFQFKIVPKDVCGGKNCFLIENY  87

Query  345  KSSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVST  524
            +   G  P+ILI+GTTA+E+ SGLHWYLKYWC AH+SW+KTGGIQ+ S+PK G LP +  
Sbjct  88   EEKDG--PEILIRGTTAVELASGLHWYLKYWCNAHVSWDKTGGIQVASIPKAGSLPRLKG  145

Query  525  EGVMIQRPVPWNYYQNVVTSSYSYVWWDW  611
            +GVMIQRPVPWNYYQNVVTSSYSYVWW+W
Sbjct  146  KGVMIQRPVPWNYYQNVVTSSYSYVWWNW  174



>gb|KFK25597.1| hypothetical protein AALP_AA8G134900 [Arabis alpina]
Length=344

 Score =   218 bits (554),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 97/154 (63%), Positives = 124/154 (81%), Gaps = 0/154 (0%)
 Frame = +3

Query  153  VQESEAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFR  332
            +     I+ +L+RLDS R ++SVQESA KG+LQRL+PTH  SFE +I+SKDVCGG SCF 
Sbjct  25   LHHDPIIDGVLNRLDSLRLTSSVQESAVKGLLQRLIPTHFHSFEFRIISKDVCGGSSCFV  84

Query  333  VTNFKSSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLP  512
            + N+  S    P+I+I+GTT +EI SGLHWYLKY C AH+SW+KTGGIQI SVP+PG LP
Sbjct  85   IENYDGSRRIGPEIVIKGTTGVEIASGLHWYLKYKCNAHVSWDKTGGIQIASVPQPGHLP  144

Query  513  SVSTEGVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
             ++++G++I+RPVPW YYQNVVTSSYSYVWW W+
Sbjct  145  RLASKGILIRRPVPWTYYQNVVTSSYSYVWWGWE  178



>ref|XP_010938527.1| PREDICTED: alpha-N-acetylglucosaminidase isoform X2 [Elaeis guineensis]
Length=547

 Score =   223 bits (568),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 101/149 (68%), Positives = 122/149 (82%), Gaps = 0/149 (0%)
 Frame = +3

Query  168  AIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFK  347
            A++ LL RLDSKR S S+QE+AA+GVL+RLLPTHLSSF  +I  K +C    CFR++N  
Sbjct  33   AVKELLKRLDSKRASPSIQEAAARGVLKRLLPTHLSSFRFEIAPKGICEEFGCFRISNID  92

Query  348  SSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTE  527
            +SS   P+ILIQGTTA+EI+SGLHWYLKYWCG HISW+KTGG Q+ SVP PG LP V  +
Sbjct  93   NSSYGGPEILIQGTTAVEISSGLHWYLKYWCGTHISWDKTGGNQVASVPPPGSLPRVEGQ  152

Query  528  GVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
            GV ++RPVPWNYYQNVVTSSYS+VWWDW+
Sbjct  153  GVKVERPVPWNYYQNVVTSSYSFVWWDWK  181



>ref|XP_010492144.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Camelina sativa]
Length=807

 Score =   226 bits (575),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 101/153 (66%), Positives = 124/153 (81%), Gaps = 0/153 (0%)
 Frame = +3

Query  156  QESEAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRV  335
            ++   IE+LL RLDS RP  SVQESAAKG+LQRLLPTH  SF+ +I+SKDVCGG SCF +
Sbjct  24   KQHPTIETLLDRLDSLRPIRSVQESAAKGLLQRLLPTHFHSFDFRIISKDVCGGSSCFLI  83

Query  336  TNFKSSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPS  515
             N        P+I+I+GTT +EI SGLHWYLKY C AH+SW+KTGGIQI+SVP+PG LP 
Sbjct  84   ENSDGLRRIGPEIVIKGTTGVEIASGLHWYLKYKCNAHVSWDKTGGIQIDSVPQPGHLPR  143

Query  516  VSTEGVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
            + ++G++I+RPVPWNYYQNVVTSSYSYVWW W+
Sbjct  144  LDSKGILIRRPVPWNYYQNVVTSSYSYVWWGWE  176



>ref|XP_011469504.1| PREDICTED: alpha-N-acetylglucosaminidase isoform X1 [Fragaria 
vesca subsp. vesca]
Length=804

 Score =   224 bits (572),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 101/154 (66%), Positives = 123/154 (80%), Gaps = 0/154 (0%)
 Frame = +3

Query  153  VQESEAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFR  332
            V+  + +E+LL RLDSKR S SVQ++AAK +L RLLPTH+ SFE KIV KDVCGG SCF 
Sbjct  22   VKPQQPVEALLRRLDSKRSSASVQQAAAKALLFRLLPTHVDSFEFKIVGKDVCGGHSCFV  81

Query  333  VTNFKSSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLP  512
            + N   S    P+I I+GTTA+EI SGLHWYLKY+CGAH+SW+KTGG+Q+ S+P  G LP
Sbjct  82   INNHSPSRRYGPEIEIKGTTAVEIASGLHWYLKYFCGAHVSWDKTGGVQLASIPNTGSLP  141

Query  513  SVSTEGVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
             V  EG+ +QRPVPWNYYQNVVTSSYS+VWWDW+
Sbjct  142  RVKDEGLKVQRPVPWNYYQNVVTSSYSFVWWDWE  175



>ref|XP_010938526.1| PREDICTED: alpha-N-acetylglucosaminidase isoform X1 [Elaeis guineensis]
Length=809

 Score =   224 bits (571),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/149 (68%), Positives = 122/149 (82%), Gaps = 0/149 (0%)
 Frame = +3

Query  168  AIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFK  347
            A++ LL RLDSKR S S+QE+AA+GVL+RLLPTHLSSF  +I  K +C    CFR++N  
Sbjct  33   AVKELLKRLDSKRASPSIQEAAARGVLKRLLPTHLSSFRFEIAPKGICEEFGCFRISNID  92

Query  348  SSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTE  527
            +SS   P+ILIQGTTA+EI+SGLHWYLKYWCG HISW+KTGG Q+ SVP PG LP V  +
Sbjct  93   NSSYGGPEILIQGTTAVEISSGLHWYLKYWCGTHISWDKTGGNQVASVPPPGSLPRVEGQ  152

Query  528  GVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
            GV ++RPVPWNYYQNVVTSSYS+VWWDW+
Sbjct  153  GVKVERPVPWNYYQNVVTSSYSFVWWDWK  181



>ref|XP_010694988.1| PREDICTED: alpha-N-acetylglucosaminidase [Beta vulgaris subsp. 
vulgaris]
Length=808

 Score =   224 bits (570),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 101/153 (66%), Positives = 126/153 (82%), Gaps = 0/153 (0%)
 Frame = +3

Query  156  QESEAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRV  335
            Q SE I  +++RLDS+R S +VQ++AAK +LQRLLP+H S+F  KI+SKDVC G SCF V
Sbjct  27   QSSEPIRDIINRLDSQRSSPTVQQNAAKSLLQRLLPSHSSNFIFKIISKDVCDGNSCFWV  86

Query  336  TNFKSSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPS  515
             N+  S+   PQILI+GTTA+EI SGLHWYLKY+CGAH+SW+KTGG QI S+P+P  LP 
Sbjct  87   ENYNKSTRHGPQILIKGTTAVEIASGLHWYLKYFCGAHVSWDKTGGAQITSIPEPESLPF  146

Query  516  VSTEGVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
            V  EG++++RPVPWNYYQNVVTSSYSYVWWDW+
Sbjct  147  VKDEGLVMKRPVPWNYYQNVVTSSYSYVWWDWK  179



>ref|XP_010534240.1| PREDICTED: alpha-N-acetylglucosaminidase [Tarenaya hassleriana]
Length=817

 Score =   224 bits (570),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 124/153 (81%), Gaps = 0/153 (0%)
 Frame = +3

Query  156  QESEAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRV  335
            ++   IE L+ RLDS R S S QESAA+GVLQRL+PTH  SF+ +IVSKDVCGG SCF +
Sbjct  32   EQHRTIEGLVKRLDSVRLSPSAQESAARGVLQRLIPTHFHSFDFEIVSKDVCGGNSCFLI  91

Query  336  TNFKSSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPS  515
             N  S S + P+I+I+GTT +EI SGLHWYLKY C AHISW+KTGGIQI S+P+PG LP 
Sbjct  92   ENHNSRSRNGPEIVIKGTTGVEIASGLHWYLKYACDAHISWDKTGGIQIASIPRPGHLPR  151

Query  516  VSTEGVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
            ++++ ++I+RPVPWNYYQNVVTSSYSY WW+W+
Sbjct  152  LASDRILIRRPVPWNYYQNVVTSSYSYAWWEWK  184



>emb|CDX91103.1| BnaC02g04940D [Brassica napus]
Length=833

 Score =   222 bits (566),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 122/149 (82%), Gaps = 0/149 (0%)
 Frame = +3

Query  168  AIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFK  347
            AI  LL RL+S RP++SVQESAAKG+LQRL+PTH  SFE  I+SKDVCGG SCF + N+ 
Sbjct  56   AINGLLHRLNSLRPTSSVQESAAKGLLQRLIPTHSHSFEFTIISKDVCGGSSCFIIENYD  115

Query  348  SSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTE  527
               G+ P++LI+GTT +EI SGLHWYLKY C AH+SW+KTGGIQ+ SVP PG LP + ++
Sbjct  116  GPRGNGPEMLIKGTTGVEIASGLHWYLKYKCNAHVSWDKTGGIQVASVPNPGHLPRLYSK  175

Query  528  GVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
             ++I+RPVPWNYYQNVVTSSYSYVWW W+
Sbjct  176  RILIRRPVPWNYYQNVVTSSYSYVWWGWE  204



>gb|KFK25594.1| hypothetical protein AALP_AA8G134900 [Arabis alpina]
Length=733

 Score =   220 bits (560),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 97/148 (66%), Positives = 123/148 (83%), Gaps = 0/148 (0%)
 Frame = +3

Query  171  IESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKS  350
            I+ +L+RLDS R ++SVQESA KG+LQRL+PTH  SFE +I+SKDVCGG SCF + N+  
Sbjct  31   IDGVLNRLDSLRLTSSVQESAVKGLLQRLIPTHFHSFEFRIISKDVCGGSSCFVIENYDG  90

Query  351  SSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEG  530
            S    P+I+I+GTT +EI SGLHWYLKY C AH+SW+KTGGIQI SVP+PG LP ++++G
Sbjct  91   SRRIGPEIVIKGTTGVEIASGLHWYLKYKCNAHVSWDKTGGIQIASVPQPGHLPRLASKG  150

Query  531  VMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
            ++I+RPVPW YYQNVVTSSYSYVWW W+
Sbjct  151  ILIRRPVPWTYYQNVVTSSYSYVWWGWE  178



>ref|NP_196873.1| alpha-N-acetylglucosaminidase [Arabidopsis thaliana]
 dbj|BAB08696.1| alpha-N-acetylglucosaminidase [Arabidopsis thaliana]
 gb|AAL87291.1| putative alpha-N-acetylglucosaminidase [Arabidopsis thaliana]
 gb|AAM51254.1| putative alpha-N-acetylglucosaminidase [Arabidopsis thaliana]
 gb|AED91928.1| alpha-N-acetylglucosaminidase [Arabidopsis thaliana]
Length=806

 Score =   221 bits (562),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 120/148 (81%), Gaps = 0/148 (0%)
 Frame = +3

Query  171  IESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKS  350
            I+ LL RLDS  P++SVQESAAKG+LQRLLPTH  SFEL+I+SKD CGG SCF + N+  
Sbjct  28   IDGLLDRLDSLLPTSSVQESAAKGLLQRLLPTHSQSFELRIISKDACGGTSCFVIENYDG  87

Query  351  SSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEG  530
                 P+ILI+GTT +EI SGLHWYLKY C AH+SW+KTGGIQ+ SVP+PG LP + ++ 
Sbjct  88   PGRIGPEILIKGTTGVEIASGLHWYLKYKCNAHVSWDKTGGIQVASVPQPGHLPRIDSKR  147

Query  531  VMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
            + I+RPVPWNYYQNVVTSSYSYVWW W+
Sbjct  148  IFIRRPVPWNYYQNVVTSSYSYVWWGWE  175



>ref|XP_006287089.1| hypothetical protein CARUB_v10000251mg [Capsella rubella]
 gb|EOA19987.1| hypothetical protein CARUB_v10000251mg [Capsella rubella]
Length=806

 Score =   220 bits (561),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 123/153 (80%), Gaps = 0/153 (0%)
 Frame = +3

Query  156  QESEAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRV  335
            ++   IE+LL RLDS RP+ SVQESAAKG+LQRLLP H  SF+ +I+SK+VC G SCF +
Sbjct  23   KQHPTIENLLDRLDSLRPTRSVQESAAKGLLQRLLPAHFHSFDFRIISKNVCDGSSCFLI  82

Query  336  TNFKSSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPS  515
             N+  +    P+I+I+GTT +EI SGLHWYLKY C AH+SW+KTGGIQI SVP+PG LP 
Sbjct  83   ENYDGTRRFGPEIVIKGTTGVEIASGLHWYLKYKCNAHVSWDKTGGIQIASVPQPGHLPR  142

Query  516  VSTEGVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
            + ++ ++I+RPVPWNYYQNVVTSSYSYVWW W+
Sbjct  143  LDSKRILIRRPVPWNYYQNVVTSSYSYVWWGWE  175



>ref|XP_006851078.1| hypothetical protein AMTR_s00025p00242240 [Amborella trichopoda]
 gb|ERN12659.1| hypothetical protein AMTR_s00025p00242240 [Amborella trichopoda]
Length=800

 Score =   219 bits (559),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 98/155 (63%), Positives = 125/155 (81%), Gaps = 1/155 (1%)
 Frame = +3

Query  153  VQESEAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFR  332
             +  + ++ L+   +S+R S SVQE+A KGVLQRLLP+H SSFE +++SKD+CGG SCF 
Sbjct  16   ARPDKGLDGLIHMAESQRSSPSVQEAAVKGVLQRLLPSHSSSFEFRVISKDLCGGVSCFW  75

Query  333  VTNFKSSSG-DSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLL  509
            + NF +S    SP++LI+G TA+EI +GLHWY+KYWCGAH+SW+KTGG QI S+P PGLL
Sbjct  76   IKNFNNSGVIGSPEMLIEGATAVEIAAGLHWYIKYWCGAHVSWDKTGGTQIVSIPDPGLL  135

Query  510  PSVSTEGVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
            P V   GVM+QRPVPW+YYQNVVTSSYSYVWWDW+
Sbjct  136  PRVQGNGVMVQRPVPWSYYQNVVTSSYSYVWWDWE  170



>ref|XP_002871580.1| alpha-N-acetylglucosaminidase family [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47839.1| alpha-N-acetylglucosaminidase family [Arabidopsis lyrata subsp. 
lyrata]
Length=806

 Score =   219 bits (559),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 98/149 (66%), Positives = 120/149 (81%), Gaps = 0/149 (0%)
 Frame = +3

Query  168  AIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFK  347
             I+ LL+RLDS  P++SVQESAAKG+LQRLLPTH  SFE +I SKDVCGG SCF + N+ 
Sbjct  27   TIDRLLNRLDSLLPTSSVQESAAKGLLQRLLPTHFHSFEFRIFSKDVCGGTSCFLIENYD  86

Query  348  SSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTE  527
                  P+I I+GTT +EI SGLHWYLKY C AH+SW+KTGGIQI SVP+PG LP + ++
Sbjct  87   DPRRIGPEIRIKGTTGVEIASGLHWYLKYKCNAHVSWDKTGGIQIASVPQPGHLPRLDSK  146

Query  528  GVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
             ++I+RP+PWNYYQNVVTSSYSYVWW W+
Sbjct  147  RILIRRPIPWNYYQNVVTSSYSYVWWGWE  175



>ref|XP_006399864.1| hypothetical protein EUTSA_v100127271mg, partial [Eutrema salsugineum]
 gb|ESQ41317.1| hypothetical protein EUTSA_v100127271mg, partial [Eutrema salsugineum]
Length=450

 Score =   213 bits (541),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 96/153 (63%), Positives = 119/153 (78%), Gaps = 0/153 (0%)
 Frame = +3

Query  156  QESEAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRV  335
            ++   I+ LL  LDS RP+ SVQ SAAKG+LQRL+PTH  SF+  I+SKDVCGG SCF +
Sbjct  23   KQHPTIDRLLLNLDSLRPTPSVQVSAAKGLLQRLIPTHFHSFDFSIISKDVCGGSSCFLI  82

Query  336  TNFKSSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPS  515
             N+       P+I+I+GTT +EI SGLHWYLKY C AH+SW+KTGGIQI SVP PG LP 
Sbjct  83   ENYDGPRRIGPEIVIKGTTGVEIASGLHWYLKYKCNAHVSWDKTGGIQIASVPHPGHLPR  142

Query  516  VSTEGVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
            + ++ ++I+RPVPWNYYQNVVTSSYSYVWW W+
Sbjct  143  LDSKRILIRRPVPWNYYQNVVTSSYSYVWWGWE  175



>ref|XP_009125936.1| PREDICTED: alpha-N-acetylglucosaminidase [Brassica rapa]
Length=833

 Score =   218 bits (556),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 101/150 (67%), Positives = 121/150 (81%), Gaps = 1/150 (1%)
 Frame = +3

Query  168  AIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFK  347
            AI  LL RLDS RP++SVQESAAKG+LQRL+PTH  SFE  I+SKDVCGG SCF + N  
Sbjct  56   AINPLLHRLDSLRPTSSVQESAAKGLLQRLIPTHSHSFEFSIISKDVCGGSSCFIIENHD  115

Query  348  SSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVS-T  524
               G+ P+I+I+GTT +EI SGLHWYLKY C AH+SW+KTGGIQI SVP PG LP +  +
Sbjct  116  GPRGNGPEIVIKGTTGVEIASGLHWYLKYKCNAHVSWDKTGGIQIASVPLPGHLPRLEYS  175

Query  525  EGVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
            + ++I+RPVPWNYYQNVVTSSYSYVWW W+
Sbjct  176  KRILIRRPVPWNYYQNVVTSSYSYVWWGWE  205



>ref|XP_008802642.1| PREDICTED: alpha-N-acetylglucosaminidase [Phoenix dactylifera]
Length=809

 Score =   215 bits (547),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/149 (66%), Positives = 120/149 (81%), Gaps = 0/149 (0%)
 Frame = +3

Query  168  AIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFK  347
            A++ LL RLD KR S S+QE+AA GVL+RLLP H SSF  +I  K +C    CFR+++ +
Sbjct  33   AMKELLRRLDGKRASPSIQEAAAWGVLKRLLPNHTSSFRFEIAPKGICEEFGCFRISSIE  92

Query  348  SSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTE  527
            +SS   P+ILIQGTTA+EI+SGLHWYLKYWCGAHISW+KTGG Q+ SVP PG LP V  +
Sbjct  93   NSSYGGPEILIQGTTAVEISSGLHWYLKYWCGAHISWDKTGGNQVASVPPPGSLPRVEGQ  152

Query  528  GVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
            GV ++RPVPWNYYQNVVTSSYS+VWWDW+
Sbjct  153  GVKLERPVPWNYYQNVVTSSYSFVWWDWK  181



>emb|CDX85632.1| BnaA02g01810D [Brassica napus]
Length=834

 Score =   213 bits (541),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/150 (66%), Positives = 119/150 (79%), Gaps = 1/150 (1%)
 Frame = +3

Query  168  AIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFK  347
            AI  LL RLDS RP++SVQESAAKG+L RL+PTH  SFE  I+SKDVCGG SCF + N+ 
Sbjct  56   AINPLLHRLDSLRPTSSVQESAAKGLLHRLIPTHSHSFEFSIISKDVCGGSSCFIIENYD  115

Query  348  SSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVS-T  524
             S     +I+I+GTT +EI SGLHWYLKY C AH+SW+KTGGIQI SVP PG LP +  +
Sbjct  116  GSRETGLEIVIKGTTGVEIASGLHWYLKYKCNAHVSWDKTGGIQIASVPLPGHLPRLEYS  175

Query  525  EGVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
            + ++I+RPVPWNYYQNVVTSSYSYVWW W+
Sbjct  176  KRILIRRPVPWNYYQNVVTSSYSYVWWGWE  205



>ref|XP_010453461.1| PREDICTED: alpha-N-acetylglucosaminidase-like isoform X2 [Camelina 
sativa]
Length=742

 Score =   211 bits (538),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 117/148 (79%), Gaps = 0/148 (0%)
 Frame = +3

Query  156  QESEAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRV  335
            ++   I+SLL RLDS RP  SVQESAAKG+LQRLL  H  SF+ +I+SKDVCGG SCF +
Sbjct  24   KQHPTIDSLLDRLDSLRPIRSVQESAAKGLLQRLLSNHFHSFDFRIISKDVCGGSSCFLI  83

Query  336  TNFKSSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPS  515
             N+       P I+I+GTT +EI SGLHWYLKY C AH+SW+KTGGIQI SVP+PG LP 
Sbjct  84   ENYDGPGRIGPDIVIKGTTGVEIASGLHWYLKYKCNAHVSWDKTGGIQIASVPQPGHLPR  143

Query  516  VSTEGVMIQRPVPWNYYQNVVTSSYSYV  599
            + ++G++I+RPVPWNYYQNVVTSSYSYV
Sbjct  144  LDSKGILIRRPVPWNYYQNVVTSSYSYV  171



>ref|XP_010453460.1| PREDICTED: alpha-N-acetylglucosaminidase-like isoform X1 [Camelina 
sativa]
Length=805

 Score =   211 bits (538),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 117/148 (79%), Gaps = 0/148 (0%)
 Frame = +3

Query  156  QESEAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRV  335
            ++   I+SLL RLDS RP  SVQESAAKG+LQRLL  H  SF+ +I+SKDVCGG SCF +
Sbjct  24   KQHPTIDSLLDRLDSLRPIRSVQESAAKGLLQRLLSNHFHSFDFRIISKDVCGGSSCFLI  83

Query  336  TNFKSSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPS  515
             N+       P I+I+GTT +EI SGLHWYLKY C AH+SW+KTGGIQI SVP+PG LP 
Sbjct  84   ENYDGPGRIGPDIVIKGTTGVEIASGLHWYLKYKCNAHVSWDKTGGIQIASVPQPGHLPR  143

Query  516  VSTEGVMIQRPVPWNYYQNVVTSSYSYV  599
            + ++G++I+RPVPWNYYQNVVTSSYSYV
Sbjct  144  LDSKGILIRRPVPWNYYQNVVTSSYSYV  171



>ref|XP_011008329.1| PREDICTED: alpha-N-acetylglucosaminidase-like isoform X1 [Populus 
euphratica]
Length=813

 Score =   202 bits (513),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/149 (60%), Positives = 115/149 (77%), Gaps = 1/149 (1%)
 Frame = +3

Query  171  IESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKS  350
            I  +L   D +R   S Q +AA+GVLQRLLP+H SSFE +IVSK+ CGG+SCF + N  S
Sbjct  34   ISKILEIQDRERALPSAQVAAARGVLQRLLPSHSSSFEFRIVSKEQCGGESCFIIKNHPS  93

Query  351  -SSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTE  527
             +   +PQILI G T +E+  GLHWYLKYWCG+HISW+KTGG+Q+NS+PK G LP +  +
Sbjct  94   FTRRGAPQILISGVTGVEVLFGLHWYLKYWCGSHISWDKTGGVQLNSIPKLGSLPRLQDD  153

Query  528  GVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
            G+++QRPVPWNYYQN VTSSYS+ WWDW+
Sbjct  154  GILVQRPVPWNYYQNAVTSSYSFAWWDWK  182



>ref|XP_011008330.1| PREDICTED: alpha-N-acetylglucosaminidase-like isoform X2 [Populus 
euphratica]
Length=812

 Score =   202 bits (513),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/149 (60%), Positives = 115/149 (77%), Gaps = 1/149 (1%)
 Frame = +3

Query  171  IESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKS  350
            I  +L   D +R   S Q +AA+GVLQRLLP+H SSFE +IVSK+ CGG+SCF + N  S
Sbjct  34   ISKILEIQDRERALPSAQVAAARGVLQRLLPSHSSSFEFRIVSKEQCGGESCFIIKNHPS  93

Query  351  -SSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTE  527
             +   +PQILI G T +E+  GLHWYLKYWCG+HISW+KTGG+Q+NS+PK G LP +  +
Sbjct  94   FTRRGAPQILISGVTGVEVLFGLHWYLKYWCGSHISWDKTGGVQLNSIPKLGSLPRLQDD  153

Query  528  GVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
            G+++QRPVPWNYYQN VTSSYS+ WWDW+
Sbjct  154  GILVQRPVPWNYYQNAVTSSYSFAWWDWK  182



>gb|KGN63613.1| hypothetical protein Csa_1G005740 [Cucumis sativus]
Length=534

 Score =   198 bits (504),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/152 (61%), Positives = 116/152 (76%), Gaps = 3/152 (2%)
 Frame = +3

Query  165  EAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNF  344
            E I  LL   D +R    VQ +AA+GVL+RLLP+HL SF+ +IVSKD CGG+SCF + N 
Sbjct  111  EYISRLLEIQDRERVPAYVQVAAARGVLRRLLPSHLPSFDFQIVSKDKCGGESCFVIRNH  170

Query  345  KS--SSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSV  518
            ++   SGD P+ILI G T +EI +GLHWYLK+WCGAHISW+KTGG Q+ SVPK GLLP +
Sbjct  171  RAFRKSGD-PEILIAGVTGVEILAGLHWYLKHWCGAHISWDKTGGSQLFSVPKAGLLPRI  229

Query  519  STEGVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
             T  V++QRP+P NYYQN VTSSYS+ WWDW+
Sbjct  230  QTNEVVVQRPIPLNYYQNAVTSSYSFAWWDWK  261



>ref|XP_002318632.2| hypothetical protein POPTR_0012s07760g, partial [Populus trichocarpa]
 gb|EEE96852.2| hypothetical protein POPTR_0012s07760g, partial [Populus trichocarpa]
Length=760

 Score =   200 bits (509),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 88/141 (62%), Positives = 113/141 (80%), Gaps = 1/141 (1%)
 Frame = +3

Query  195  DSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKS-SSGDSPQ  371
            D +R   SVQ +AA+GVLQRLLP+H SSFE +IVSK+ CGG+SCF + N  S +   +PQ
Sbjct  1    DRERALPSVQVAAARGVLQRLLPSHSSSFEFRIVSKEQCGGESCFIIKNHPSFTRRGAPQ  60

Query  372  ILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVMIQRPV  551
            ILI G T +E+ +GLHWYLKYWCG+HISW+KTGG+Q+NS+PK G LP +  + +++QRPV
Sbjct  61   ILISGVTGVEVLAGLHWYLKYWCGSHISWDKTGGVQLNSIPKLGSLPRLQDDSILVQRPV  120

Query  552  PWNYYQNVVTSSYSYVWWDWQ  614
            PWNYYQN VTSSYS+ WWDW+
Sbjct  121  PWNYYQNAVTSSYSFAWWDWK  141



>ref|XP_009391536.1| PREDICTED: alpha-N-acetylglucosaminidase [Musa acuminata subsp. 
malaccensis]
Length=811

 Score =   201 bits (510),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 120/150 (80%), Gaps = 0/150 (0%)
 Frame = +3

Query  165  EAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNF  344
            E+I  LL RL++KRPS+SVQ +AA  +L RLLPTH SSF  +I+ K +C    CF ++N 
Sbjct  34   ESIGELLRRLENKRPSSSVQVAAAHALLLRLLPTHHSSFRFEIIPKGICKQNGCFHISNV  93

Query  345  KSSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVST  524
             SS+ D  +ILI+GTTA+EI+SGLHWYLKYWCGAHISW+KTGG+Q+ SVP PG L  V  
Sbjct  94   NSSNSDGAEILIRGTTAVEISSGLHWYLKYWCGAHISWDKTGGVQLASVPPPGSLARVDG  153

Query  525  EGVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
            EGV ++RPVPW+YYQNVVTSSYSYVWWDW+
Sbjct  154  EGVKVERPVPWSYYQNVVTSSYSYVWWDWR  183



>gb|EEE59081.1| hypothetical protein OsJ_10898 [Oryza sativa Japonica Group]
Length=812

 Score =   200 bits (508),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 91/132 (69%), Positives = 107/132 (81%), Gaps = 1/132 (1%)
 Frame = +3

Query  222  QESAAKGVLQRLLPTHLSSFELKIVSKD-VCGGQSCFRVTNFKSSSGDSPQILIQGTTAI  398
            QE+AA G+L+RLLP+H  SF  +IVSK  VCGG SCFR++N   S  +  +ILIQGTTA+
Sbjct  56   QEAAAAGLLRRLLPSHARSFRFQIVSKGGVCGGSSCFRISNADGSRRNGAEILIQGTTAV  115

Query  399  EITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVMIQRPVPWNYYQNVV  578
            E+ SGLHWYLKYWCGAHISW+KTGG Q+ SVP PG LP V   GV I+RPVPWNYYQNVV
Sbjct  116  ELASGLHWYLKYWCGAHISWDKTGGAQLASVPLPGSLPQVKGTGVKIERPVPWNYYQNVV  175

Query  579  TSSYSYVWWDWQ  614
            TSSYS+VWWDW+
Sbjct  176  TSSYSFVWWDWK  187



>emb|CAN83148.1| hypothetical protein VITISV_031934 [Vitis vinifera]
Length=562

 Score =   197 bits (500),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 92/149 (62%), Positives = 111/149 (74%), Gaps = 1/149 (1%)
 Frame = +3

Query  171  IESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKS  350
            I  LL   D +R   SVQ +AA GVL RLLP+H SSFE  IVSK+ CGG SCF ++N  S
Sbjct  31   ISRLLEIQDRERAPPSVQIAAAYGVLHRLLPSHSSSFEFGIVSKEQCGGDSCFMISNHPS  90

Query  351  SSGD-SPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTE  527
            SSG  +P+ILI G T +EI +GLHWYLKYWCG+HISW+KTGG Q+ SVP  G  P V   
Sbjct  91   SSGHGAPEILITGVTGVEIMAGLHWYLKYWCGSHISWDKTGGAQLLSVPDSGSFPHVQEA  150

Query  528  GVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
            G++IQRP+PWNYYQN VTSSY++ WWDW+
Sbjct  151  GILIQRPIPWNYYQNAVTSSYTFAWWDWK  179



>ref|XP_009625154.1| PREDICTED: alpha-N-acetylglucosaminidase-like isoform X4 [Nicotiana 
tomentosiformis]
Length=647

 Score =   197 bits (502),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 115/149 (77%), Gaps = 1/149 (1%)
 Frame = +3

Query  171  IESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKS  350
            +  LL   + +R  +SVQ +AA GVL RL+P+H SSFE  ++ K+ CGG+SCF ++N   
Sbjct  32   VSPLLEIQERERAPSSVQLTAAYGVLNRLIPSHFSSFEFHVIPKEHCGGESCFTISNHPG  91

Query  351  SSGD-SPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTE  527
            S+ + SP+IL+ GTTA+EI SGLHWYLKYWCGAHISW KTGG Q+ SVP PG LP+V   
Sbjct  92   SAREGSPEILVSGTTAVEILSGLHWYLKYWCGAHISWSKTGGAQLASVPNPGSLPAVQDA  151

Query  528  GVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
            GV+++RPVPW+YYQN VTSSY++ WWDW+
Sbjct  152  GVVVKRPVPWSYYQNAVTSSYTFAWWDWE  180



>ref|XP_009625156.1| PREDICTED: alpha-N-acetylglucosaminidase-like isoform X5 [Nicotiana 
tomentosiformis]
Length=634

 Score =   197 bits (502),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 115/149 (77%), Gaps = 1/149 (1%)
 Frame = +3

Query  171  IESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKS  350
            +  LL   + +R  +SVQ +AA GVL RL+P+H SSFE  ++ K+ CGG+SCF ++N   
Sbjct  32   VSPLLEIQERERAPSSVQLTAAYGVLNRLIPSHFSSFEFHVIPKEHCGGESCFTISNHPG  91

Query  351  SSGD-SPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTE  527
            S+ + SP+IL+ GTTA+EI SGLHWYLKYWCGAHISW KTGG Q+ SVP PG LP+V   
Sbjct  92   SAREGSPEILVSGTTAVEILSGLHWYLKYWCGAHISWSKTGGAQLASVPNPGSLPAVQDA  151

Query  528  GVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
            GV+++RPVPW+YYQN VTSSY++ WWDW+
Sbjct  152  GVVVKRPVPWSYYQNAVTSSYTFAWWDWE  180



>ref|XP_002511461.1| alpha-n-acetylglucosaminidase, putative [Ricinus communis]
 gb|EEF52063.1| alpha-n-acetylglucosaminidase, putative [Ricinus communis]
Length=809

 Score =   198 bits (504),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 115/149 (77%), Gaps = 1/149 (1%)
 Frame = +3

Query  171  IESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKS  350
            I  LL   + +R S SVQ +AA+GVL RLLP+H S+FE +I+SK+ CGGQSCF + N+  
Sbjct  30   ISRLLEIQERERASPSVQLAAARGVLHRLLPSHSSAFEFRIISKEQCGGQSCFIIENYPF  89

Query  351  SSGD-SPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTE  527
            S+G  +P+I+I G   +E+ +GLHWYLKYWCG+HISW+KTGG Q+NS+PK G LP V   
Sbjct  90   STGPVTPEIIISGVNGMEVVAGLHWYLKYWCGSHISWDKTGGAQLNSIPKLGSLPHVQDA  149

Query  528  GVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
            GV++ RP+PWNYYQN VTSSY++ WWDW+
Sbjct  150  GVLVLRPIPWNYYQNAVTSSYTFAWWDWK  178



>ref|XP_009625153.1| PREDICTED: alpha-N-acetylglucosaminidase-like isoform X3 [Nicotiana 
tomentosiformis]
Length=734

 Score =   198 bits (503),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 115/149 (77%), Gaps = 1/149 (1%)
 Frame = +3

Query  171  IESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKS  350
            +  LL   + +R  +SVQ +AA GVL RL+P+H SSFE  ++ K+ CGG+SCF ++N   
Sbjct  32   VSPLLEIQERERAPSSVQLTAAYGVLNRLIPSHFSSFEFHVIPKEHCGGESCFTISNHPG  91

Query  351  SSGD-SPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTE  527
            S+ + SP+IL+ GTTA+EI SGLHWYLKYWCGAHISW KTGG Q+ SVP PG LP+V   
Sbjct  92   SAREGSPEILVSGTTAVEILSGLHWYLKYWCGAHISWSKTGGAQLASVPNPGSLPAVQDA  151

Query  528  GVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
            GV+++RPVPW+YYQN VTSSY++ WWDW+
Sbjct  152  GVVVKRPVPWSYYQNAVTSSYTFAWWDWE  180



>ref|XP_004138287.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Cucumis sativus]
Length=808

 Score =   198 bits (504),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/152 (61%), Positives = 116/152 (76%), Gaps = 3/152 (2%)
 Frame = +3

Query  165  EAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNF  344
            E I  LL   D +R    VQ +AA+GVL+RLLP+HL SF+ +IVSKD CGG+SCF + N 
Sbjct  30   EYISRLLEIQDRERVPAYVQVAAARGVLRRLLPSHLPSFDFQIVSKDKCGGESCFVIRNH  89

Query  345  KS--SSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSV  518
            ++   SGD P+ILI G T +EI +GLHWYLK+WCGAHISW+KTGG Q+ SVPK GLLP +
Sbjct  90   RAFRKSGD-PEILIAGVTGVEILAGLHWYLKHWCGAHISWDKTGGSQLFSVPKAGLLPRI  148

Query  519  STEGVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
             T  V++QRP+P NYYQN VTSSYS+ WWDW+
Sbjct  149  QTNEVVVQRPIPLNYYQNAVTSSYSFAWWDWK  180



>emb|CBI15090.3| unnamed protein product [Vitis vinifera]
Length=846

 Score =   198 bits (503),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/149 (62%), Positives = 111/149 (74%), Gaps = 1/149 (1%)
 Frame = +3

Query  171  IESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKS  350
            I  LL   D +R   SVQ +AA GVL RLLP+H SSFE  IVSK+ CGG SCF ++N  S
Sbjct  31   ISRLLEIQDRERAPPSVQIAAAYGVLHRLLPSHSSSFEFGIVSKEQCGGDSCFMISNHPS  90

Query  351  SSGD-SPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTE  527
            SSG  +P+ILI G T +EI +GLHWYLKYWCG+HISW+KTGG Q+ SVP  G  P V   
Sbjct  91   SSGHGAPEILITGVTGVEIMAGLHWYLKYWCGSHISWDKTGGAQLLSVPDSGSFPRVQEA  150

Query  528  GVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
            G++IQRP+PWNYYQN VTSSY++ WWDW+
Sbjct  151  GILIQRPIPWNYYQNAVTSSYTFAWWDWK  179



>ref|XP_010663217.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Vitis vinifera]
Length=813

 Score =   198 bits (503),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 92/149 (62%), Positives = 111/149 (74%), Gaps = 1/149 (1%)
 Frame = +3

Query  171  IESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKS  350
            I  LL   D +R   SVQ +AA GVL RLLP+H SSFE  IVSK+ CGG SCF ++N  S
Sbjct  31   ISRLLEIQDRERAPPSVQIAAAYGVLHRLLPSHSSSFEFGIVSKEQCGGDSCFMISNHPS  90

Query  351  SSGD-SPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTE  527
            SSG  +P+ILI G T +EI +GLHWYLKYWCG+HISW+KTGG Q+ SVP  G  P V   
Sbjct  91   SSGHGAPEILITGVTGVEIMAGLHWYLKYWCGSHISWDKTGGAQLLSVPDSGSFPRVQEA  150

Query  528  GVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
            G++IQRP+PWNYYQN VTSSY++ WWDW+
Sbjct  151  GILIQRPIPWNYYQNAVTSSYTFAWWDWK  179



>ref|XP_009625152.1| PREDICTED: alpha-N-acetylglucosaminidase-like isoform X2 [Nicotiana 
tomentosiformis]
Length=824

 Score =   198 bits (503),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 115/149 (77%), Gaps = 1/149 (1%)
 Frame = +3

Query  171  IESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKS  350
            +  LL   + +R  +SVQ +AA GVL RL+P+H SSFE  ++ K+ CGG+SCF ++N   
Sbjct  32   VSPLLEIQERERAPSSVQLTAAYGVLNRLIPSHFSSFEFHVIPKEHCGGESCFTISNHPG  91

Query  351  SSGD-SPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTE  527
            S+ + SP+IL+ GTTA+EI SGLHWYLKYWCGAHISW KTGG Q+ SVP PG LP+V   
Sbjct  92   SAREGSPEILVSGTTAVEILSGLHWYLKYWCGAHISWSKTGGAQLASVPNPGSLPAVQDA  151

Query  528  GVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
            GV+++RPVPW+YYQN VTSSY++ WWDW+
Sbjct  152  GVVVKRPVPWSYYQNAVTSSYTFAWWDWE  180



>ref|XP_009625151.1| PREDICTED: alpha-N-acetylglucosaminidase-like isoform X1 [Nicotiana 
tomentosiformis]
Length=832

 Score =   197 bits (502),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 115/149 (77%), Gaps = 1/149 (1%)
 Frame = +3

Query  171  IESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKS  350
            +  LL   + +R  +SVQ +AA GVL RL+P+H SSFE  ++ K+ CGG+SCF ++N   
Sbjct  32   VSPLLEIQERERAPSSVQLTAAYGVLNRLIPSHFSSFEFHVIPKEHCGGESCFTISNHPG  91

Query  351  SSGD-SPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTE  527
            S+ + SP+IL+ GTTA+EI SGLHWYLKYWCGAHISW KTGG Q+ SVP PG LP+V   
Sbjct  92   SAREGSPEILVSGTTAVEILSGLHWYLKYWCGAHISWSKTGGAQLASVPNPGSLPAVQDA  151

Query  528  GVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
            GV+++RPVPW+YYQN VTSSY++ WWDW+
Sbjct  152  GVVVKRPVPWSYYQNAVTSSYTFAWWDWE  180



>gb|KDP31153.1| hypothetical protein JCGZ_11529 [Jatropha curcas]
Length=808

 Score =   197 bits (502),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 116/152 (76%), Gaps = 3/152 (2%)
 Frame = +3

Query  165  EAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTN-  341
            + I  LL   + +R   SVQ ++A+GVLQRLLP+H S FE +I+SK+ CGGQSCF + N 
Sbjct  28   DYISRLLEIQERERAPPSVQLASARGVLQRLLPSHSSGFEFRIISKEHCGGQSCFIIKNN  87

Query  342  -FKSSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSV  518
             F +  G +P+IL+ G T +E+ +GLHWYLKYWCG+HISW+KTGG Q+NS+PK G LP V
Sbjct  88   PFYTRPG-TPEILVSGVTGVEVLAGLHWYLKYWCGSHISWDKTGGAQLNSIPKLGSLPRV  146

Query  519  STEGVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
               GV++QRP+PWNYYQN VTSSY++ WWDW+
Sbjct  147  QDSGVLVQRPIPWNYYQNAVTSSYTFAWWDWK  178



>ref|XP_008453133.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Cucumis melo]
Length=808

 Score =   197 bits (502),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 92/152 (61%), Positives = 117/152 (77%), Gaps = 3/152 (2%)
 Frame = +3

Query  165  EAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNF  344
            E I  LL   D +R    VQ +AA+GVL+RLLP+HLSSF+ +IVSKD CGG+SCF + N 
Sbjct  30   EYISRLLEIQDRERVPAYVQVAAARGVLRRLLPSHLSSFDFQIVSKDKCGGESCFVIRNH  89

Query  345  KS--SSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSV  518
            ++    GD P+ILI G T +E+ +GLHWYLK+WCGAHISW+KTGG Q+ SVPK GLLP +
Sbjct  90   RAFRKPGD-PEILIAGVTGVEVLAGLHWYLKHWCGAHISWDKTGGSQLFSVPKAGLLPRI  148

Query  519  STEGVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
             T+ V+I+RP+P NYYQN VTSSYS+ WWDW+
Sbjct  149  QTDEVVIRRPIPLNYYQNAVTSSYSFAWWDWK  180



>gb|KHN19339.1| Alpha-N-acetylglucosaminidase [Glycine soja]
Length=434

 Score =   192 bits (487),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 90/152 (59%), Positives = 115/152 (76%), Gaps = 2/152 (1%)
 Frame = +3

Query  165  EAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNF  344
            + I  L+   D +R   SVQE+AA+GVL RLLP+H SSFE +I+SK  CGG+ CF++ N 
Sbjct  26   DTIFRLIRIQDRERAPPSVQEAAARGVLLRLLPSHSSSFEFRILSKKQCGGEYCFKIKNH  85

Query  345  KS-SSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPG-LLPSV  518
             S ++   PQILI+GTT ++I +GLHWYLK+WCG+HISW+KTGG Q+ SVP  G LLP V
Sbjct  86   PSFTTAGDPQILIEGTTGVDIVAGLHWYLKHWCGSHISWDKTGGSQLFSVPNVGLLLPRV  145

Query  519  STEGVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
               GV +QRPVPW+YYQN VTSSYS+ WWDW+
Sbjct  146  HHAGVSVQRPVPWSYYQNAVTSSYSFAWWDWE  177



>gb|EEC75285.1| hypothetical protein OsI_11626 [Oryza sativa Indica Group]
Length=812

 Score =   197 bits (500),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 106/132 (80%), Gaps = 1/132 (1%)
 Frame = +3

Query  222  QESAAKGVLQRLLPTHLSSFELKIVSKD-VCGGQSCFRVTNFKSSSGDSPQILIQGTTAI  398
            QE+AA G+L+RLLP+H  SF  +IVSK  VCGG SCFR++N   S  +  +ILIQGTTA+
Sbjct  56   QEAAAAGLLRRLLPSHARSFRFQIVSKGGVCGGSSCFRISNADGSRRNGAEILIQGTTAV  115

Query  399  EITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVMIQRPVPWNYYQNVV  578
            E+ SGLHWYLKYWCGAHISW+KTGG Q+ SVP PG LP V    V I+RPVPWNYYQNVV
Sbjct  116  ELASGLHWYLKYWCGAHISWDKTGGAQLASVPLPGSLPQVKRTVVKIERPVPWNYYQNVV  175

Query  579  TSSYSYVWWDWQ  614
            TSSYS+VWWDW+
Sbjct  176  TSSYSFVWWDWK  187



>ref|XP_003557830.1| PREDICTED: alpha-N-acetylglucosaminidase isoform X1 [Brachypodium 
distachyon]
Length=809

 Score =   196 bits (498),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 110/148 (74%), Gaps = 1/148 (1%)
 Frame = +3

Query  174  ESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKD-VCGGQSCFRVTNFKS  350
            E+L +    +  S +VQE AA GVL RLLP+H  SF  +I +K  VCG  SCFR++N   
Sbjct  37   EALRTAAGRRAASPAVQEGAAAGVLHRLLPSHAHSFRFQIDTKGGVCGESSCFRISNVDG  96

Query  351  SSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEG  530
            S     +I+IQGTTA+E+ SGLHWYLKYWCG HISW+KTGG Q+ SVP PG LP V+  G
Sbjct  97   SGRGGAEIMIQGTTAVELASGLHWYLKYWCGVHISWDKTGGAQLASVPSPGSLPRVNGTG  156

Query  531  VMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
            V I+RPVPWNYYQNVVTSSYS+VWWDW+
Sbjct  157  VKIKRPVPWNYYQNVVTSSYSFVWWDWR  184



>ref|XP_007210354.1| hypothetical protein PRUPE_ppa001642mg [Prunus persica]
 gb|EMJ11553.1| hypothetical protein PRUPE_ppa001642mg [Prunus persica]
Length=787

 Score =   195 bits (496),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/150 (61%), Positives = 113/150 (75%), Gaps = 3/150 (2%)
 Frame = +3

Query  171  IESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKS  350
            I  LL   D +R  + VQ +AA+GVL+RLLP+H SSF+ +IVS++ CGG SCF + N  S
Sbjct  6    ISRLLEIQDRERAPSYVQVAAARGVLRRLLPSHSSSFDFQIVSREQCGGASCFMIKNHPS  65

Query  351  --SSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVST  524
                GD PQILI G T +EI +GLHWYLK+WCG+HISW+KTGG Q+ SVPK GLL  V  
Sbjct  66   FRRRGD-PQILISGVTGVEILAGLHWYLKHWCGSHISWDKTGGAQLFSVPKAGLLSRVQD  124

Query  525  EGVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
             G+++QRPVPWNYYQN VTSSYS+ WWDW+
Sbjct  125  AGILVQRPVPWNYYQNAVTSSYSFAWWDWE  154



>ref|XP_008239708.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Prunus mume]
Length=819

 Score =   195 bits (496),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 112/150 (75%), Gaps = 3/150 (2%)
 Frame = +3

Query  171  IESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKS  350
            I  LL   D +R    VQ +AA+GVL+RLLP+H SSF+ +IVSK+ CGG SCF + N  S
Sbjct  38   ISRLLEIQDRERAPPYVQVAAARGVLRRLLPSHSSSFDFQIVSKEQCGGASCFMIKNHPS  97

Query  351  --SSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVST  524
                GD PQILI G T +EI +GLHWYLK+WCG+HISW+KTGG Q+ SVPK GLL  V  
Sbjct  98   FRRRGD-PQILISGVTGVEILAGLHWYLKHWCGSHISWDKTGGAQLFSVPKAGLLSRVQD  156

Query  525  EGVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
             G+++QRPVPWNYYQN VTSSYS+ WWDW+
Sbjct  157  AGILVQRPVPWNYYQNAVTSSYSFAWWDWE  186



>ref|XP_009799807.1| PREDICTED: alpha-N-acetylglucosaminidase-like isoform X3 [Nicotiana 
sylvestris]
Length=734

 Score =   193 bits (490),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 113/148 (76%), Gaps = 1/148 (1%)
 Frame = +3

Query  171  IESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKS  350
            +  LL   + +R  +S+Q +AA GVL RL+P+H S+FE  I++KD C G+ CF ++N   
Sbjct  32   VSRLLEIQERERAPSSLQLTAAYGVLNRLIPSHFSTFEFHIITKDHCDGEFCFNISNHPG  91

Query  351  SSGD-SPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTE  527
            S+ + SP+ILI GTTA+EI SGLHWYLKYWCGAHISW KTGG Q+ SVP PG LP+V   
Sbjct  92   SAREGSPEILISGTTAVEILSGLHWYLKYWCGAHISWIKTGGAQLASVPYPGSLPAVQDA  151

Query  528  GVMIQRPVPWNYYQNVVTSSYSYVWWDW  611
            G++++RPVPW+YYQN VTSSY++ WWDW
Sbjct  152  GIVVKRPVPWSYYQNAVTSSYTFAWWDW  179



>ref|XP_009799801.1| PREDICTED: alpha-N-acetylglucosaminidase-like isoform X2 [Nicotiana 
sylvestris]
Length=814

 Score =   192 bits (489),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 113/148 (76%), Gaps = 1/148 (1%)
 Frame = +3

Query  171  IESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKS  350
            +  LL   + +R  +S+Q +AA GVL RL+P+H S+FE  I++KD C G+ CF ++N   
Sbjct  32   VSRLLEIQERERAPSSLQLTAAYGVLNRLIPSHFSTFEFHIITKDHCDGEFCFNISNHPG  91

Query  351  SSGD-SPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTE  527
            S+ + SP+ILI GTTA+EI SGLHWYLKYWCGAHISW KTGG Q+ SVP PG LP+V   
Sbjct  92   SAREGSPEILISGTTAVEILSGLHWYLKYWCGAHISWIKTGGAQLASVPYPGSLPAVQDA  151

Query  528  GVMIQRPVPWNYYQNVVTSSYSYVWWDW  611
            G++++RPVPW+YYQN VTSSY++ WWDW
Sbjct  152  GIVVKRPVPWSYYQNAVTSSYTFAWWDW  179



>ref|XP_009799792.1| PREDICTED: alpha-N-acetylglucosaminidase-like isoform X1 [Nicotiana 
sylvestris]
Length=822

 Score =   192 bits (489),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 113/148 (76%), Gaps = 1/148 (1%)
 Frame = +3

Query  171  IESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKS  350
            +  LL   + +R  +S+Q +AA GVL RL+P+H S+FE  I++KD C G+ CF ++N   
Sbjct  32   VSRLLEIQERERAPSSLQLTAAYGVLNRLIPSHFSTFEFHIITKDHCDGEFCFNISNHPG  91

Query  351  SSGD-SPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTE  527
            S+ + SP+ILI GTTA+EI SGLHWYLKYWCGAHISW KTGG Q+ SVP PG LP+V   
Sbjct  92   SAREGSPEILISGTTAVEILSGLHWYLKYWCGAHISWIKTGGAQLASVPYPGSLPAVQDA  151

Query  528  GVMIQRPVPWNYYQNVVTSSYSYVWWDW  611
            G++++RPVPW+YYQN VTSSY++ WWDW
Sbjct  152  GIVVKRPVPWSYYQNAVTSSYTFAWWDW  179



>ref|XP_008660142.1| PREDICTED: alpha-N-acetylglucosaminidase [Zea mays]
 gb|AFW88340.1| hypothetical protein ZEAMMB73_315381 [Zea mays]
Length=814

 Score =   192 bits (489),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/141 (65%), Positives = 109/141 (77%), Gaps = 2/141 (1%)
 Frame = +3

Query  198  SKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKD-VCGGQSCFRVTNFKSSSGDS-PQ  371
            S++ S + QE AA G+L+RLLP H  SF  +I SK  VCG  SCFR++N    SG    +
Sbjct  48   SRKASPAEQEGAAAGLLRRLLPFHSGSFSFQIDSKGGVCGQSSCFRISNVVDGSGKGGAE  107

Query  372  ILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVMIQRPV  551
            ILIQGTTA+E+ SGLHWYLKYWCGAHISW+KTGG Q+ S+P PG LP V  +GV I+RPV
Sbjct  108  ILIQGTTAVELASGLHWYLKYWCGAHISWDKTGGAQLASIPSPGSLPRVQGKGVKIERPV  167

Query  552  PWNYYQNVVTSSYSYVWWDWQ  614
            PWNYYQNVVTSSYS+VWWDW+
Sbjct  168  PWNYYQNVVTSSYSFVWWDWK  188



>gb|KDO35993.1| hypothetical protein CISIN_1g027682mg [Citrus sinensis]
Length=220

 Score =   181 bits (460),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 81/151 (54%), Positives = 109/151 (72%), Gaps = 1/151 (1%)
 Frame = +3

Query  165  EAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNF  344
            + I  LL   D +R   SVQ +AA  VLQRLLP+H S+F+ +I+SK  CGG+ CF + N 
Sbjct  34   QYISRLLDIQDRERAPPSVQLAAAYAVLQRLLPSHYSAFQFRIISKKQCGGEYCFILRNH  93

Query  345  KSSS-GDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVS  521
             SS    +P+I+I G T +E+ +GLHWYL+YWCG+HISW+KTGG+Q+ S+PK G  P V 
Sbjct  94   PSSYIRGTPEIVISGVTGVEVLAGLHWYLRYWCGSHISWDKTGGVQVASMPKLGSFPRVQ  153

Query  522  TEGVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
              GV ++RP+P NYYQN VTSSY++ WWDW+
Sbjct  154  DAGVFVKRPIPLNYYQNAVTSSYTFAWWDWK  184



>ref|XP_006345181.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Solanum tuberosum]
Length=819

 Score =   192 bits (488),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 113/149 (76%), Gaps = 1/149 (1%)
 Frame = +3

Query  171  IESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKS  350
            +  LL   + +R  +SVQ + A GVL RL+P+H SSF+  I+ K+ CGG+ CF ++N   
Sbjct  33   VSPLLEIQERERAPSSVQLTTAYGVLNRLIPSHFSSFQFHIIPKEHCGGEFCFNISNHPG  92

Query  351  SSGD-SPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTE  527
             + D SP+ILI+GTTA++I SG+HWYLKYWCGAHISW KTGG Q+ SVP PG LP+V   
Sbjct  93   LARDGSPEILIRGTTAVDILSGVHWYLKYWCGAHISWSKTGGAQLASVPDPGSLPAVQDA  152

Query  528  GVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
            GV+++RPVPW+YYQN VTSSY++ WWDW+
Sbjct  153  GVLVKRPVPWSYYQNAVTSSYTFAWWDWK  181



>ref|XP_006581937.1| PREDICTED: alpha-N-acetylglucosaminidase-like isoform X2 [Glycine 
max]
Length=813

 Score =   192 bits (488),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 90/152 (59%), Positives = 114/152 (75%), Gaps = 2/152 (1%)
 Frame = +3

Query  165  EAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNF  344
            + I  L+   D +R   SVQE+AA+GVL RLLP+H SSFE +I+SK  CGG+ CF++ N 
Sbjct  26   DTIFRLIRIQDRERAPPSVQEAAARGVLLRLLPSHSSSFEFRILSKKQCGGEYCFKIKNH  85

Query  345  KS-SSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPG-LLPSV  518
             S +    PQILI+GTT ++I +GLHWYLK+WCG+HISW+KTGG Q+ SVP  G LLP V
Sbjct  86   PSFTKAGDPQILIEGTTGVDIVAGLHWYLKHWCGSHISWDKTGGSQLFSVPNVGLLLPRV  145

Query  519  STEGVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
               GV +QRPVPW+YYQN VTSSYS+ WWDW+
Sbjct  146  HHAGVSVQRPVPWSYYQNAVTSSYSFAWWDWE  177



>ref|XP_002465249.1| hypothetical protein SORBIDRAFT_01g034960 [Sorghum bicolor]
 gb|EER92247.1| hypothetical protein SORBIDRAFT_01g034960 [Sorghum bicolor]
Length=777

 Score =   191 bits (484),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 109/141 (77%), Gaps = 2/141 (1%)
 Frame = +3

Query  198  SKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKD-VCGGQSCFRVTNFKSSSGDS-PQ  371
            S++ S + QE+AA G+L+RLLP+H  SF  +I SK  VCG  SCFR++N    SG    +
Sbjct  48   SRKASPAEQEAAAAGLLRRLLPSHAGSFSFQIDSKGAVCGQSSCFRISNVVDGSGKGGAE  107

Query  372  ILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVMIQRPV  551
            ILIQGTT +E+ SGLHWYLKYWCGAHISW++TGG Q+ S+P PG LP V  +GV I+RPV
Sbjct  108  ILIQGTTGVELASGLHWYLKYWCGAHISWDRTGGAQLASIPSPGSLPRVQGKGVKIERPV  167

Query  552  PWNYYQNVVTSSYSYVWWDWQ  614
             WNYYQNVVTSSYSYVWWDW+
Sbjct  168  LWNYYQNVVTSSYSYVWWDWK  188



>ref|XP_011464528.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Fragaria vesca 
subsp. vesca]
Length=827

 Score =   191 bits (484),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 90/149 (60%), Positives = 108/149 (72%), Gaps = 2/149 (1%)
 Frame = +3

Query  171  IESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKS  350
            I ++L   D +R    VQ +AA+GVL RLLP+H SSF+ +IVSK+ CGG SCF + N  S
Sbjct  39   ISNVLELQDRERAPPYVQVAAARGVLHRLLPSHSSSFDFQIVSKEQCGGASCFMIKNHPS  98

Query  351  --SSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVST  524
                G  PQILI G T +EI +GLHWYLK WCG+HISW+KTGG Q+ SVPK GLL  V  
Sbjct  99   FRRRGIDPQILISGVTGVEILAGLHWYLKNWCGSHISWDKTGGAQLFSVPKAGLLSCVGD  158

Query  525  EGVMIQRPVPWNYYQNVVTSSYSYVWWDW  611
             G+++QRPVPWNYYQN VTSSYS  WWDW
Sbjct  159  GGILVQRPVPWNYYQNAVTSSYSLAWWDW  187



>ref|XP_010112589.1| hypothetical protein L484_010094 [Morus notabilis]
 gb|EXC34224.1| hypothetical protein L484_010094 [Morus notabilis]
Length=856

 Score =   191 bits (484),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 114/150 (76%), Gaps = 3/150 (2%)
 Frame = +3

Query  171  IESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKS  350
            I  LL + D +R   S+Q +AA+GVL+RLLP+H SSF+ +I+SK+ CGG SCF + N  S
Sbjct  35   ISKLLDKQDRERAPPSLQVAAARGVLRRLLPSHSSSFDFQIISKEQCGGSSCFIIRNNPS  94

Query  351  --SSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVST  524
                GD  +ILI G T +EI +GLHWYLK WCG+HISWEKTGG+Q+ SVPK   LP V+ 
Sbjct  95   FLRRGDR-EILITGVTGVEILAGLHWYLKNWCGSHISWEKTGGVQLFSVPKSEFLPRVND  153

Query  525  EGVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
            +GV++QRP+PW+YYQN VTSSY++ WWDW+
Sbjct  154  DGVLVQRPIPWSYYQNAVTSSYTFAWWDWE  183



>gb|KCW83403.1| hypothetical protein EUGRSUZ_B00338 [Eucalyptus grandis]
Length=732

 Score =   190 bits (482),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 111/149 (74%), Gaps = 1/149 (1%)
 Frame = +3

Query  171  IESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKS  350
            +  LL   D +R   +VQ +AA+G L+RLLP+  SSFE +I+SKD CGG+ CF +TN  S
Sbjct  38   VSRLLEIQDRERAPATVQLAAARGALRRLLPSRYSSFEFRIISKDECGGEICFVITNHPS  97

Query  351  -SSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTE  527
                 +P+ILI G T +E+ +GLHWYLKYWCG+HISW+KTGG+Q  S+PK G LP V   
Sbjct  98   FGRRGAPEILISGVTGVEVLAGLHWYLKYWCGSHISWDKTGGLQTYSMPKFGSLPRVHDA  157

Query  528  GVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
            GV++QRP+PW+YYQN V+SSYS+ WWDW+
Sbjct  158  GVIVQRPIPWSYYQNAVSSSYSFAWWDWK  186



>emb|CDP16996.1| unnamed protein product [Coffea canephora]
Length=842

 Score =   190 bits (483),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 109/149 (73%), Gaps = 1/149 (1%)
 Frame = +3

Query  171  IESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKS  350
            I   L   D +R  +SVQ +AA GVL RL P+H SSFE KI+ K+ CGG+ CF+++N  S
Sbjct  33   ISRFLEIQDKERAPSSVQLTAAYGVLNRLFPSHSSSFEFKIIPKEHCGGELCFKISNHPS  92

Query  351  SSGDS-PQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTE  527
               +  P+ILI GTT +E+ +GLHWYLKYWCGAHISW KTGG Q+ SVPK G LP V   
Sbjct  93   FRYNGYPEILISGTTGVELAAGLHWYLKYWCGAHISWMKTGGAQLASVPKAGSLPQVQHA  152

Query  528  GVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
            GV I+RPVPW+YYQN VTSSY++ WWDW+
Sbjct  153  GVEIRRPVPWSYYQNAVTSSYTFAWWDWE  181



>ref|XP_008793800.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Phoenix dactylifera]
Length=821

 Score =   190 bits (482),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 115/153 (75%), Gaps = 1/153 (1%)
 Frame = +3

Query  159  ESEAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVT  338
            E   +  +L   + +R S SVQ +  +G+L RLLP+H +SFE +I+ K  CGG++CF + 
Sbjct  23   EHSHLARVLEIQERERVSPSVQIATVRGLLGRLLPSHQASFEFEIIPKAECGGKACFIIN  82

Query  339  NFKSSS-GDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPS  515
            N  SS    SP+ILI G + +E+++GLHWYLKYWC AHISWEK GG+Q++SVPKPG LP 
Sbjct  83   NHPSSGIKGSPEILIHGVSGVELSAGLHWYLKYWCLAHISWEKAGGVQLSSVPKPGALPH  142

Query  516  VSTEGVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
            VS+ GV++QRP+PW+YYQN V+SSYS+ WWDW+
Sbjct  143  VSSTGVLVQRPIPWSYYQNAVSSSYSFAWWDWE  175



>ref|XP_010027872.1| PREDICTED: alpha-N-acetylglucosaminidase-like isoform X1 [Eucalyptus 
grandis]
Length=817

 Score =   189 bits (481),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 111/149 (74%), Gaps = 1/149 (1%)
 Frame = +3

Query  171  IESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKS  350
            +  LL   D +R   +VQ +AA+G L+RLLP+  SSFE +I+SKD CGG+ CF +TN  S
Sbjct  38   VSRLLEIQDRERAPATVQLAAARGALRRLLPSRYSSFEFRIISKDECGGEICFVITNHPS  97

Query  351  -SSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTE  527
                 +P+ILI G T +E+ +GLHWYLKYWCG+HISW+KTGG+Q  S+PK G LP V   
Sbjct  98   FGRRGAPEILISGVTGVEVLAGLHWYLKYWCGSHISWDKTGGLQTYSMPKFGSLPRVHDA  157

Query  528  GVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
            GV++QRP+PW+YYQN V+SSYS+ WWDW+
Sbjct  158  GVIVQRPIPWSYYQNAVSSSYSFAWWDWK  186



>ref|XP_010027879.1| PREDICTED: alpha-N-acetylglucosaminidase-like isoform X2 [Eucalyptus 
grandis]
Length=816

 Score =   189 bits (481),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 111/149 (74%), Gaps = 1/149 (1%)
 Frame = +3

Query  171  IESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKS  350
            +  LL   D +R   +VQ +AA+G L+RLLP+  SSFE +I+SKD CGG+ CF +TN  S
Sbjct  38   VSRLLEIQDRERAPATVQLAAARGALRRLLPSRYSSFEFRIISKDECGGEICFVITNHPS  97

Query  351  -SSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTE  527
                 +P+ILI G T +E+ +GLHWYLKYWCG+HISW+KTGG+Q  S+PK G LP V   
Sbjct  98   FGRRGAPEILISGVTGVEVLAGLHWYLKYWCGSHISWDKTGGLQTYSMPKFGSLPRVHDA  157

Query  528  GVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
            GV++QRP+PW+YYQN V+SSYS+ WWDW+
Sbjct  158  GVIVQRPIPWSYYQNAVSSSYSFAWWDWK  186



>gb|KCW83402.1| hypothetical protein EUGRSUZ_B00338 [Eucalyptus grandis]
Length=822

 Score =   189 bits (481),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 111/149 (74%), Gaps = 1/149 (1%)
 Frame = +3

Query  171  IESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKS  350
            +  LL   D +R   +VQ +AA+G L+RLLP+  SSFE +I+SKD CGG+ CF +TN  S
Sbjct  38   VSRLLEIQDRERAPATVQLAAARGALRRLLPSRYSSFEFRIISKDECGGEICFVITNHPS  97

Query  351  -SSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTE  527
                 +P+ILI G T +E+ +GLHWYLKYWCG+HISW+KTGG+Q  S+PK G LP V   
Sbjct  98   FGRRGAPEILISGVTGVEVLAGLHWYLKYWCGSHISWDKTGGLQTYSMPKFGSLPRVHDA  157

Query  528  GVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
            GV++QRP+PW+YYQN V+SSYS+ WWDW+
Sbjct  158  GVIVQRPIPWSYYQNAVSSSYSFAWWDWK  186



>ref|XP_006581936.1| PREDICTED: alpha-N-acetylglucosaminidase-like isoform X1 [Glycine 
max]
Length=814

 Score =   187 bits (476),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 90/153 (59%), Positives = 114/153 (75%), Gaps = 3/153 (2%)
 Frame = +3

Query  165  EAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNF  344
            + I  L+   D +R   SVQE+AA+GVL RLLP+H SSFE +I+SK  CGG+ CF++ N 
Sbjct  26   DTIFRLIRIQDRERAPPSVQEAAARGVLLRLLPSHSSSFEFRILSKKQCGGEYCFKIKNH  85

Query  345  KS-SSGDSPQIL-IQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPG-LLPS  515
             S +    PQIL I+GTT ++I +GLHWYLK+WCG+HISW+KTGG Q+ SVP  G LLP 
Sbjct  86   PSFTKAGDPQILRIEGTTGVDIVAGLHWYLKHWCGSHISWDKTGGSQLFSVPNVGLLLPR  145

Query  516  VSTEGVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
            V   GV +QRPVPW+YYQN VTSSYS+ WWDW+
Sbjct  146  VHHAGVSVQRPVPWSYYQNAVTSSYSFAWWDWE  178



>ref|XP_001782392.1| predicted protein [Physcomitrella patens]
 gb|EDQ52786.1| predicted protein [Physcomitrella patens]
Length=801

 Score =   186 bits (473),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 82/149 (55%), Positives = 113/149 (76%), Gaps = 2/149 (1%)
 Frame = +3

Query  174  ESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKSS  353
            E++L+++ S++   S QE A+  VL RLLP+HLSSFE +I++K+ CGG+ CF + N  S+
Sbjct  30   ETVLNKIQSEKAPASTQERASYDVLARLLPSHLSSFEFRIITKEECGGKFCFLLQNHPSA  89

Query  354  S--GDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTE  527
               G +P+I I GTT +E+ +GLHWYLK+WC  HISW+KTGG Q+++V +PG LP +  +
Sbjct  90   GVYGGAPEIRISGTTGVELCAGLHWYLKHWCNGHISWDKTGGAQLHTVHRPGFLPRLQGD  149

Query  528  GVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
             + IQRPV WNYYQNVVTSSYSYVWW W+
Sbjct  150  TLTIQRPVDWNYYQNVVTSSYSYVWWTWE  178



>ref|XP_010324692.1| PREDICTED: alpha-N-acetylglucosaminidase isoform X2 [Solanum 
lycopersicum]
Length=744

 Score =   186 bits (472),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = +3

Query  303  DVCGGQSCFRVTNFKSSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQI  482
            D+CGG+SCFR+TN+KSS  +SP+ILIQGTTA+EI SGL+WYLKY CGAHISW+KTGG+Q+
Sbjct  7    DLCGGRSCFRITNYKSSHRNSPEILIQGTTAVEIASGLNWYLKYKCGAHISWDKTGGVQL  66

Query  483  NSVPKPGLLPSVSTEGVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
             SVPKPG LP V  +GV IQRPVPWNYYQNVVTSSYSYVWWDWQ
Sbjct  67   ASVPKPGALPLVEAKGVTIQRPVPWNYYQNVVTSSYSYVWWDWQ  110



>gb|KHG03421.1| Alpha-N-acetylglucosaminidase [Gossypium arboreum]
Length=804

 Score =   186 bits (472),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 111/150 (74%), Gaps = 2/150 (1%)
 Frame = +3

Query  171  IESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQ-SCFRVTNFK  347
            I  LL   + +R   S Q +AA+GVL RLLP+H S+FE +I+SK+ CGG+ +CF + N  
Sbjct  29   ISKLLQIQERERAPPSFQVAAARGVLHRLLPSHSSAFEFRIISKEKCGGEGACFIINNHP  88

Query  348  SS-SGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVST  524
            SS    +P+ILI G T +E+ +GLHWYLKYWCG+HISW+KTGG Q+ S+P  G LP V  
Sbjct  89   SSYKSGAPEILISGVTGVEVLAGLHWYLKYWCGSHISWQKTGGAQLFSIPPLGSLPRVQV  148

Query  525  EGVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
             G+++QRP+PWNYYQN VTSSY++ WWDW+
Sbjct  149  GGILVQRPIPWNYYQNAVTSSYTFAWWDWE  178



>ref|XP_007036096.1| Alpha-N-acetylglucosaminidase family / NAGLU family isoform 1 
[Theobroma cacao]
 gb|EOY20597.1| Alpha-N-acetylglucosaminidase family / NAGLU family isoform 1 
[Theobroma cacao]
Length=798

 Score =   186 bits (471),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 111/150 (74%), Gaps = 2/150 (1%)
 Frame = +3

Query  171  IESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVS-KDVCGGQSCFRVTNFK  347
            +  LL   D +R   S+Q +AA+ VL RLLP+H S+FE +I+S K+ CGG SCF + N  
Sbjct  30   VSKLLEIQDHERAPPSLQVAAARAVLHRLLPSHSSAFEFRIISSKEECGGGSCFIIKNHP  89

Query  348  SSSGD-SPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVST  524
            +S    +P+ILI G T +E+ +GLHWYLKY CG+HISWEKTGG Q++S+PK G LP V  
Sbjct  90   ASHKHGAPEILISGVTGVEVLAGLHWYLKYLCGSHISWEKTGGAQLSSIPKLGSLPRVQD  149

Query  525  EGVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
             G+++QRP+PWNYYQN VTSSYS+ WWDW+
Sbjct  150  TGILVQRPIPWNYYQNAVTSSYSFAWWDWE  179



>gb|KJB08355.1| hypothetical protein B456_001G078400 [Gossypium raimondii]
Length=838

 Score =   186 bits (471),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 111/150 (74%), Gaps = 2/150 (1%)
 Frame = +3

Query  171  IESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQ-SCFRVTNFK  347
            I  LL   + +R   S Q +AA+GVL RLLP+H S+FE +I+SK+ CGG+ +CF + N  
Sbjct  29   ISKLLQIQERERALPSFQVAAARGVLHRLLPSHSSAFEFRIISKEKCGGEGACFIINNHP  88

Query  348  SS-SGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVST  524
            SS    +P+ILI G T +E+ +GLHWYLKYWCG+HISW+KTGG Q+ S+P  G LP V  
Sbjct  89   SSYKSGAPEILISGVTGVEVLAGLHWYLKYWCGSHISWQKTGGAQLFSIPPLGSLPPVQD  148

Query  525  EGVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
             G+++QRP+PWNYYQN VTSSY++ WWDW+
Sbjct  149  GGILVQRPIPWNYYQNAVTSSYTFAWWDWE  178



>ref|XP_008393078.1| PREDICTED: alpha-N-acetylglucosaminidase-like isoform X1 [Malus 
domestica]
Length=823

 Score =   184 bits (468),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 109/150 (73%), Gaps = 3/150 (2%)
 Frame = +3

Query  171  IESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKS  350
            I  LL   D ++    VQ +AA+GVL+RLLP+H SSF+ +IVSK+ CGG SCF + N  S
Sbjct  34   ISRLLEIQDREKAPPHVQVAAARGVLRRLLPSHSSSFDFQIVSKEQCGGASCFMIKNNPS  93

Query  351  --SSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVST  524
                GD PQILI G T +EI +GLHWYLK  C +HISW+KTGG Q+ SVPK GLL  V  
Sbjct  94   FRRRGD-PQILISGVTGVEILAGLHWYLKNLCNSHISWDKTGGAQLFSVPKSGLLTRVQD  152

Query  525  EGVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
             G+++QRPVPWNYYQN VTSSY++ WWDW+
Sbjct  153  AGILVQRPVPWNYYQNAVTSSYTFAWWDWE  182



>ref|XP_008393079.1| PREDICTED: alpha-N-acetylglucosaminidase-like isoform X2 [Malus 
domestica]
Length=822

 Score =   184 bits (468),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 109/150 (73%), Gaps = 3/150 (2%)
 Frame = +3

Query  171  IESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKS  350
            I  LL   D ++    VQ +AA+GVL+RLLP+H SSF+ +IVSK+ CGG SCF + N  S
Sbjct  34   ISRLLEIQDREKAPPHVQVAAARGVLRRLLPSHSSSFDFQIVSKEQCGGASCFMIKNNPS  93

Query  351  --SSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVST  524
                GD PQILI G T +EI +GLHWYLK  C +HISW+KTGG Q+ SVPK GLL  V  
Sbjct  94   FRRRGD-PQILISGVTGVEILAGLHWYLKNLCNSHISWDKTGGAQLFSVPKSGLLTRVQD  152

Query  525  EGVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
             G+++QRPVPWNYYQN VTSSY++ WWDW+
Sbjct  153  AGILVQRPVPWNYYQNAVTSSYTFAWWDWE  182



>ref|XP_006439736.1| hypothetical protein CICLE_v10018883mg [Citrus clementina]
 ref|XP_006439739.1| hypothetical protein CICLE_v10018883mg [Citrus clementina]
 gb|ESR52976.1| hypothetical protein CICLE_v10018883mg [Citrus clementina]
 gb|ESR52979.1| hypothetical protein CICLE_v10018883mg [Citrus clementina]
Length=711

 Score =   182 bits (461),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 81/149 (54%), Positives = 108/149 (72%), Gaps = 1/149 (1%)
 Frame = +3

Query  171  IESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKS  350
            I  LL   D +R   SVQ +AA  VLQRLLP+H S+F+ +I+SK  CGG+ CF + N  S
Sbjct  36   ISRLLDIQDRERAPPSVQLAAAYAVLQRLLPSHYSAFQFRIISKKQCGGEYCFILRNHPS  95

Query  351  SS-GDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTE  527
            S    +P+I+I G T +E+ +GLHWYL+YWCG+HISW+KTGG+Q+ S+PK G  P V   
Sbjct  96   SYIRGTPEIVISGVTGVEVLAGLHWYLRYWCGSHISWDKTGGVQVASMPKLGSFPRVQDA  155

Query  528  GVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
            GV ++RP+P NYYQN VTSSY++ WWDW+
Sbjct  156  GVFVKRPIPLNYYQNAVTSSYTFAWWDWK  184



>ref|XP_006439737.1| hypothetical protein CICLE_v10018883mg [Citrus clementina]
 gb|ESR52977.1| hypothetical protein CICLE_v10018883mg [Citrus clementina]
Length=733

 Score =   182 bits (461),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/149 (54%), Positives = 108/149 (72%), Gaps = 1/149 (1%)
 Frame = +3

Query  171  IESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKS  350
            I  LL   D +R   SVQ +AA  VLQRLLP+H S+F+ +I+SK  CGG+ CF + N  S
Sbjct  36   ISRLLDIQDRERAPPSVQLAAAYAVLQRLLPSHYSAFQFRIISKKQCGGEYCFILRNHPS  95

Query  351  SS-GDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTE  527
            S    +P+I+I G T +E+ +GLHWYL+YWCG+HISW+KTGG+Q+ S+PK G  P V   
Sbjct  96   SYIRGTPEIVISGVTGVEVLAGLHWYLRYWCGSHISWDKTGGVQVASMPKLGSFPRVQDA  155

Query  528  GVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
            GV ++RP+P NYYQN VTSSY++ WWDW+
Sbjct  156  GVFVKRPIPLNYYQNAVTSSYTFAWWDWK  184



>ref|XP_006439738.1| hypothetical protein CICLE_v10018883mg [Citrus clementina]
 gb|ESR52978.1| hypothetical protein CICLE_v10018883mg [Citrus clementina]
Length=814

 Score =   182 bits (461),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/149 (54%), Positives = 108/149 (72%), Gaps = 1/149 (1%)
 Frame = +3

Query  171  IESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKS  350
            I  LL   D +R   SVQ +AA  VLQRLLP+H S+F+ +I+SK  CGG+ CF + N  S
Sbjct  36   ISRLLDIQDRERAPPSVQLAAAYAVLQRLLPSHYSAFQFRIISKKQCGGEYCFILRNHPS  95

Query  351  SS-GDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTE  527
            S    +P+I+I G T +E+ +GLHWYL+YWCG+HISW+KTGG+Q+ S+PK G  P V   
Sbjct  96   SYIRGTPEIVISGVTGVEVLAGLHWYLRYWCGSHISWDKTGGVQVASMPKLGSFPRVQDA  155

Query  528  GVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
            GV ++RP+P NYYQN VTSSY++ WWDW+
Sbjct  156  GVFVKRPIPLNYYQNAVTSSYTFAWWDWK  184



>ref|XP_006653830.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Oryza brachyantha]
Length=833

 Score =   181 bits (460),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 77/138 (56%), Positives = 112/138 (81%), Gaps = 2/138 (1%)
 Frame = +3

Query  204  RPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKSSSGD-SPQILI  380
            RP+ + QE+AA+G+L RLLP+H +SF+ +++S D CGG++CF V N+    G+ +P+ILI
Sbjct  45   RPA-AEQEAAARGLLTRLLPSHSASFDFRVISTDQCGGKACFIVDNYPLFDGEGTPEILI  103

Query  381  QGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVMIQRPVPWN  560
             G + +EI++GLHWYLK++C +HISW+KTGG Q++SVP+PG LP V + G++IQRP+ W+
Sbjct  104  LGISGVEISAGLHWYLKHYCASHISWDKTGGTQLSSVPRPGSLPRVPSGGILIQRPIGWS  163

Query  561  YYQNVVTSSYSYVWWDWQ  614
            YYQN VTSSYS+ WWDW+
Sbjct  164  YYQNAVTSSYSFAWWDWE  181



>gb|EEC78143.1| hypothetical protein OsI_17702 [Oryza sativa Indica Group]
Length=829

 Score =   181 bits (458),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 77/138 (56%), Positives = 111/138 (80%), Gaps = 2/138 (1%)
 Frame = +3

Query  204  RPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKSSSGD-SPQILI  380
            RP+ + QE+AA+G+L RLLP+H  SF+ +++S D CGG++CF V N     G+ +PQ+L+
Sbjct  45   RPA-AEQEAAARGLLARLLPSHSGSFDFRVISADQCGGKACFIVDNHPLFDGEGTPQVLL  103

Query  381  QGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVMIQRPVPWN  560
             GT+ +EI++GLHWYLK++C AH+SW+KTGG Q++SVP+PG LP + + G++IQRPV W+
Sbjct  104  LGTSGVEISAGLHWYLKHYCAAHVSWDKTGGAQLSSVPRPGSLPRLPSGGILIQRPVGWS  163

Query  561  YYQNVVTSSYSYVWWDWQ  614
            YYQN VTSSYS+ WWDW+
Sbjct  164  YYQNAVTSSYSFAWWDWE  181



>dbj|BAK03902.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=829

 Score =   179 bits (455),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 108/139 (78%), Gaps = 2/139 (1%)
 Frame = +3

Query  201  KRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKSSSGD-SPQIL  377
            +RP+ + Q  AA+G+L RLLP+H +SFE ++VS + CGG++CF + N  S  G+ +P+IL
Sbjct  46   RRPA-AEQVDAARGLLARLLPSHSASFEFRVVSTEQCGGKACFNINNHPSFHGEGTPEIL  104

Query  378  IQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVMIQRPVPW  557
            I G + +EI++GLHWYLK++C AHISW KTGG Q++SVP PG LP V   G++IQRPV W
Sbjct  105  ILGASGVEISAGLHWYLKHYCAAHISWAKTGGAQLSSVPYPGSLPRVPAGGILIQRPVDW  164

Query  558  NYYQNVVTSSYSYVWWDWQ  614
            +YYQN VTSSYS+ WWDW+
Sbjct  165  SYYQNAVTSSYSFAWWDWE  183



>dbj|BAK07078.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=829

 Score =   179 bits (455),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 108/139 (78%), Gaps = 2/139 (1%)
 Frame = +3

Query  201  KRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKSSSGD-SPQIL  377
            +RP+ + Q  AA+G+L RLLP+H +SFE ++VS + CGG++CF + N  S  G+ +P+IL
Sbjct  46   RRPA-AEQVDAARGLLARLLPSHSASFEFRVVSTEQCGGKACFNINNHPSFHGEGTPEIL  104

Query  378  IQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVMIQRPVPW  557
            I G + +EI++GLHWYLK++C AHISW KTGG Q++SVP PG LP V   G++IQRPV W
Sbjct  105  ILGASGVEISAGLHWYLKHYCAAHISWAKTGGAQLSSVPYPGSLPRVPAGGILIQRPVDW  164

Query  558  NYYQNVVTSSYSYVWWDWQ  614
            +YYQN VTSSYS+ WWDW+
Sbjct  165  SYYQNAVTSSYSFAWWDWE  183



>ref|XP_004977055.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Setaria italica]
Length=830

 Score =   178 bits (452),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 107/136 (79%), Gaps = 1/136 (1%)
 Frame = +3

Query  210  SNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKSSSGD-SPQILIQG  386
            S++ QE+AA+G+L+R+LP+H +SFE +I+SK+ CGG++CF ++N     G+ +P+ILI G
Sbjct  50   SSAEQEAAARGLLERILPSHSASFEFRIISKEQCGGKACFIISNHPLFDGEGTPEILILG  109

Query  387  TTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVMIQRPVPWNYY  566
             + +EI++G HWYLK +C AHISW KTGG Q++S+P PG LP V   GV IQRPV W+YY
Sbjct  110  VSGVEISAGFHWYLKNYCAAHISWYKTGGAQLSSIPHPGSLPRVPAAGVFIQRPVDWSYY  169

Query  567  QNVVTSSYSYVWWDWQ  614
            QN VTSSYS+ WWDW+
Sbjct  170  QNAVTSSYSFAWWDWE  185



>ref|XP_006476679.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Citrus sinensis]
Length=814

 Score =   178 bits (452),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 108/149 (72%), Gaps = 1/149 (1%)
 Frame = +3

Query  171  IESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKS  350
            I  LL   + +R   SVQ +AA  VLQRLLP+H S+F+ +I+SK  C G+ CF + N  S
Sbjct  36   ISRLLDIQERERAPPSVQLAAAYAVLQRLLPSHYSAFQFRIISKKQCDGEYCFILRNHPS  95

Query  351  SS-GDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTE  527
            S    +P+I+I G T +E+ +GLHWYL+YWCG+HISW+KTGG+Q+ S+PK G  P V   
Sbjct  96   SYIRGTPEIVISGVTGVEVLAGLHWYLRYWCGSHISWDKTGGVQVASMPKLGSFPRVQDA  155

Query  528  GVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
            GV+++RP+P NYYQN VTSSY++ WWDW+
Sbjct  156  GVLVKRPIPLNYYQNAVTSSYTFAWWDWK  184



>ref|XP_007138123.1| hypothetical protein PHAVU_009G182100g [Phaseolus vulgaris]
 gb|ESW10117.1| hypothetical protein PHAVU_009G182100g [Phaseolus vulgaris]
Length=777

 Score =   176 bits (447),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/152 (56%), Positives = 111/152 (73%), Gaps = 7/152 (5%)
 Frame = +3

Query  168  AIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFK  347
            AI  L+   D +R   SVQE+AA+GVL RLLP+  SSF+ +I     CGG+ CF + N  
Sbjct  28   AISRLIEIQDRERAPPSVQEAAARGVLLRLLPSQSSSFQFRIKQ---CGGEYCFVIKNHP  84

Query  348  S--SSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSV-  518
            S  + GD PQILI+GTT ++I SGLHWYLK+WCG+HISW+KTGG Q+ S+P  G LP + 
Sbjct  85   SFATPGD-PQILIEGTTGVDIVSGLHWYLKHWCGSHISWDKTGGSQLFSLPNVGFLPRIP  143

Query  519  STEGVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
             + G+ +QRP+PW+YYQN VTSSYS+ WWDW+
Sbjct  144  HSAGISVQRPIPWSYYQNAVTSSYSFAWWDWE  175



>ref|XP_006651392.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Oryza brachyantha]
Length=755

 Score =   176 bits (446),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/122 (67%), Positives = 97/122 (80%), Gaps = 2/122 (2%)
 Frame = +3

Query  255  LLPTHLSSFELKIVSKD-VCGGQS-CFRVTNFKSSSGDSPQILIQGTTAIEITSGLHWYL  428
            LLP+H  SF  +I SK  VCGG+S CFR++N   S+ +  +ILIQGTTA+E+ SGLHWYL
Sbjct  9    LLPSHARSFRFQIDSKGGVCGGESSCFRISNAVGSAKNGAEILIQGTTAVELASGLHWYL  68

Query  429  KYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVMIQRPVPWNYYQNVVTSSYSYVWWD  608
            KYWCGAHISW+KTGG Q+ SVP P  LP V   GV I+RPVPWNYYQNVVTSSYS+VWWD
Sbjct  69   KYWCGAHISWDKTGGAQLASVPLPEHLPQVKGTGVKIERPVPWNYYQNVVTSSYSFVWWD  128

Query  609  WQ  614
            W+
Sbjct  129  WK  130



>tpg|DAA35664.1| TPA: hypothetical protein ZEAMMB73_337226 [Zea mays]
Length=721

 Score =   174 bits (441),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 74/138 (54%), Positives = 108/138 (78%), Gaps = 3/138 (2%)
 Frame = +3

Query  210  SNSVQESAAKGVLQRLLPTHLSSFELKIVSK--DVCGGQSCFRVTNFKSSSGD-SPQILI  380
            S++ QE+AA+G+L RLLP+H +SFE +++S   ++CGG++CF + N     G+ +P+ILI
Sbjct  47   SSAEQEAAARGLLARLLPSHSTSFEFRVISTSTELCGGKTCFVINNHPLFDGEGTPEILI  106

Query  381  QGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVMIQRPVPWN  560
             G + +EI++G HWYLK++C AHISW+KTGG Q++++P+PG LP V   GV+IQRP+ W+
Sbjct  107  LGASGVEISAGFHWYLKHYCAAHISWDKTGGAQLSTIPRPGSLPRVPDGGVLIQRPIDWS  166

Query  561  YYQNVVTSSYSYVWWDWQ  614
            YYQN VTSSYS+ WWDW 
Sbjct  167  YYQNAVTSSYSFAWWDWD  184



>tpg|DAA35665.1| TPA: hypothetical protein ZEAMMB73_337226 [Zea mays]
Length=1202

 Score =   176 bits (446),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 74/137 (54%), Positives = 108/137 (79%), Gaps = 3/137 (2%)
 Frame = +3

Query  210  SNSVQESAAKGVLQRLLPTHLSSFELKIVSK--DVCGGQSCFRVTNFKSSSGD-SPQILI  380
            S++ QE+AA+G+L RLLP+H +SFE +++S   ++CGG++CF + N     G+ +P+ILI
Sbjct  47   SSAEQEAAARGLLARLLPSHSTSFEFRVISTSTELCGGKTCFVINNHPLFDGEGTPEILI  106

Query  381  QGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVMIQRPVPWN  560
             G + +EI++G HWYLK++C AHISW+KTGG Q++++P+PG LP V   GV+IQRP+ W+
Sbjct  107  LGASGVEISAGFHWYLKHYCAAHISWDKTGGAQLSTIPRPGSLPRVPDGGVLIQRPIDWS  166

Query  561  YYQNVVTSSYSYVWWDW  611
            YYQN VTSSYS+ WWDW
Sbjct  167  YYQNAVTSSYSFAWWDW  183



>ref|XP_008667109.1| PREDICTED: uncharacterized protein LOC100192858 isoform X1 [Zea 
mays]
 tpg|DAA35663.1| TPA: hypothetical protein ZEAMMB73_337226 [Zea mays]
Length=831

 Score =   174 bits (441),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 74/138 (54%), Positives = 108/138 (78%), Gaps = 3/138 (2%)
 Frame = +3

Query  210  SNSVQESAAKGVLQRLLPTHLSSFELKIVSK--DVCGGQSCFRVTNFKSSSGD-SPQILI  380
            S++ QE+AA+G+L RLLP+H +SFE +++S   ++CGG++CF + N     G+ +P+ILI
Sbjct  47   SSAEQEAAARGLLARLLPSHSTSFEFRVISTSTELCGGKTCFVINNHPLFDGEGTPEILI  106

Query  381  QGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVMIQRPVPWN  560
             G + +EI++G HWYLK++C AHISW+KTGG Q++++P+PG LP V   GV+IQRP+ W+
Sbjct  107  LGASGVEISAGFHWYLKHYCAAHISWDKTGGAQLSTIPRPGSLPRVPDGGVLIQRPIDWS  166

Query  561  YYQNVVTSSYSYVWWDWQ  614
            YYQN VTSSYS+ WWDW 
Sbjct  167  YYQNAVTSSYSFAWWDWD  184



>ref|XP_003580702.1| PREDICTED: alpha-N-acetylglucosaminidase-like isoform X1 [Brachypodium 
distachyon]
Length=829

 Score =   173 bits (438),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/139 (55%), Positives = 106/139 (76%), Gaps = 2/139 (1%)
 Frame = +3

Query  201  KRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKSSSGD-SPQIL  377
            +RP  + Q  AA+G+L RLLP+H +SFE +++S + CGG++CF + N     G+ +P+IL
Sbjct  45   RRPP-AEQVYAAEGLLARLLPSHSTSFEFRVISTEQCGGKACFIINNHPLFDGEGTPEIL  103

Query  378  IQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVMIQRPVPW  557
            I G + +EI++GLHWYLK++C AHISW KTGG Q++SVP PG LP V   G++I+RPV W
Sbjct  104  ILGVSGVEISAGLHWYLKHYCAAHISWAKTGGAQLSSVPHPGSLPHVPAGGILIRRPVDW  163

Query  558  NYYQNVVTSSYSYVWWDWQ  614
            +YYQN VTSSYS+ WWDW+
Sbjct  164  SYYQNAVTSSYSFAWWDWE  182



>ref|XP_010928215.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Elaeis guineensis]
Length=823

 Score =   170 bits (431),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/148 (52%), Positives = 109/148 (74%), Gaps = 1/148 (1%)
 Frame = +3

Query  159  ESEAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVT  338
            E   +  ++   + +R S SVQ +  + +L RLLP+H +SFE +I+ K  CGG++CF + 
Sbjct  23   EHSHLARVIEIQERERVSPSVQIATVRSLLGRLLPSHQASFEFEIIPKAKCGGKACFIIN  82

Query  339  NFKSSS-GDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPS  515
            N  SS    S +ILI G + +E+++GLHWYLKYWC AHISWEK+GG+Q++SVPKPG LP 
Sbjct  83   NHPSSGIKGSSEILIHGVSGVELSAGLHWYLKYWCLAHISWEKSGGVQLSSVPKPGALPH  142

Query  516  VSTEGVMIQRPVPWNYYQNVVTSSYSYV  599
            VS+ GV++QRP+PW+YYQN V+SSYS+ 
Sbjct  143  VSSTGVLVQRPIPWSYYQNAVSSSYSFA  170



>emb|CAJ86183.1| H0212B02.15 [Oryza sativa Indica Group]
 emb|CAJ86322.1| OSIGBa0113E10.5 [Oryza sativa Indica Group]
Length=692

 Score =   167 bits (424),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 77/162 (48%), Positives = 111/162 (69%), Gaps = 26/162 (16%)
 Frame = +3

Query  204  RPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDV------------------------C  311
            RP+ + QE+AA+G+L RLLP+H  SF+ +++S D                         C
Sbjct  45   RPA-AEQEAAARGLLARLLPSHSGSFDFRVISADFPLPGTVVVLICKDSQSVPWNPQDQC  103

Query  312  GGQSCFRVTNFKSSSGD-SPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINS  488
            GG++CF V N     G+ +PQ+L+ GT+ +EI++GLHWYLK++C AH+SW+KTGG Q++S
Sbjct  104  GGKACFIVDNHPLFDGEGTPQVLLLGTSGVEISAGLHWYLKHYCAAHVSWDKTGGAQLSS  163

Query  489  VPKPGLLPSVSTEGVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
            VP+PG LP + + G++IQRPV W+YYQN VTSSYS+ WWDW+
Sbjct  164  VPRPGSLPRLPSGGILIQRPVGWSYYQNAVTSSYSFAWWDWE  205



>ref|XP_004502129.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Cicer arietinum]
Length=808

 Score =   164 bits (415),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 110/153 (72%), Gaps = 3/153 (2%)
 Frame = +3

Query  165  EAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNF  344
            +AI  +L   D +R   SVQE+AA+ +L RLLP+H S+F  +I+SK+ CGG+ CF + N 
Sbjct  34   DAISRILQIQDLERAPLSVQEAAARSLLLRLLPSHSSAFYFRIISKNQCGGEYCFTINNN  93

Query  345  KSSS---GDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPS  515
               S      PQILI+GTT +EI +GLHWYLK WCG+HISW+KTGG Q+ SVP  G LP 
Sbjct  94   NHPSFVTQRPPQILIEGTTGVEIVAGLHWYLKNWCGSHISWDKTGGSQLFSVPNVGFLPR  153

Query  516  VSTEGVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
            V   G+ ++RP+PW+YYQN VTSSYS+ WWDW+
Sbjct  154  VPDTGISVRRPIPWSYYQNAVTSSYSFAWWDWK  186



>gb|EEE61812.1| hypothetical protein OsJ_16433 [Oryza sativa Japonica Group]
Length=1129

 Score =   164 bits (415),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/138 (55%), Positives = 110/138 (80%), Gaps = 2/138 (1%)
 Frame = +3

Query  204  RPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKSSSGD-SPQILI  380
            RP+ + QE+AA+G+L  LLP+H  SF+ +++S D CGG++CF V N     G+ +PQ+L+
Sbjct  345  RPA-AEQEAAARGLLALLLPSHSGSFDFRVISADQCGGKACFIVDNHPLFDGEGTPQVLL  403

Query  381  QGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVMIQRPVPWN  560
             GT+ +EI++GLHWYLK++C AH+SW+KTGG Q++SVP+PG LP + + G++IQRPV W+
Sbjct  404  LGTSGVEISAGLHWYLKHYCAAHVSWDKTGGAQLSSVPRPGSLPRLPSGGILIQRPVGWS  463

Query  561  YYQNVVTSSYSYVWWDWQ  614
            YYQN VTSSYS+ WWDW+
Sbjct  464  YYQNAVTSSYSFAWWDWE  481



>emb|CAE04506.2| OSJNBb0059K02.16 [Oryza sativa Japonica Group]
Length=829

 Score =   162 bits (410),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/138 (55%), Positives = 110/138 (80%), Gaps = 2/138 (1%)
 Frame = +3

Query  204  RPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKSSSGD-SPQILI  380
            RP+ + QE+AA+G+L  LLP+H  SF+ +++S D CGG++CF V N     G+ +PQ+L+
Sbjct  45   RPA-AEQEAAARGLLALLLPSHSGSFDFRVISADQCGGKACFIVDNHPLFDGEGTPQVLL  103

Query  381  QGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVMIQRPVPWN  560
             GT+ +EI++GLHWYLK++C AH+SW+KTGG Q++SVP+PG LP + + G++IQRPV W+
Sbjct  104  LGTSGVEISAGLHWYLKHYCAAHVSWDKTGGAQLSSVPRPGSLPRLPSGGILIQRPVGWS  163

Query  561  YYQNVVTSSYSYVWWDWQ  614
            YYQN VTSSYS+ WWDW+
Sbjct  164  YYQNAVTSSYSFAWWDWE  181



>ref|XP_002977411.1| hypothetical protein SELMODRAFT_107285 [Selaginella moellendorffii]
 gb|EFJ21415.1| hypothetical protein SELMODRAFT_107285 [Selaginella moellendorffii]
Length=761

 Score =   160 bits (405),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 102/136 (75%), Gaps = 2/136 (1%)
 Frame = +3

Query  207  PSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKSSSGDSPQILIQG  386
            P    Q  AA  VL+RL+P H+S+F+L+I++ + CGG+SCF++++       S +I I G
Sbjct  2    PPARDQLRAAASVLRRLIPGHVSAFQLQIITLEDCGGKSCFQLSSLMDEG--SRKISIHG  59

Query  387  TTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVMIQRPVPWNYY  566
            T+ +E+ +GL+WYLK WCGAHISW+ TGG Q++++P+P  LP++   GV IQR VPW+YY
Sbjct  60   TSGVELCAGLYWYLKNWCGAHISWDLTGGSQLDTIPEPQALPALPPGGVKIQRSVPWSYY  119

Query  567  QNVVTSSYSYVWWDWQ  614
            QNVVTSSYSY WW+W+
Sbjct  120  QNVVTSSYSYAWWNWK  135



>ref|XP_002974994.1| hypothetical protein SELMODRAFT_102402 [Selaginella moellendorffii]
 gb|EFJ23779.1| hypothetical protein SELMODRAFT_102402 [Selaginella moellendorffii]
Length=761

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 101/136 (74%), Gaps = 2/136 (1%)
 Frame = +3

Query  207  PSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKSSSGDSPQILIQG  386
            P    Q  AA  VL+RL+P H S+F+L+I++ + CGG+SCF++++       S +I I G
Sbjct  2    PPARDQLRAAASVLRRLIPGHASAFQLQIITLEDCGGKSCFQLSSLMDEG--SRKISIHG  59

Query  387  TTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVMIQRPVPWNYY  566
            T+ +E+ +GL+WYLK WCGAHISW+ TGG Q++++P+P  LP++   GV IQR VPW+YY
Sbjct  60   TSGVELCAGLYWYLKNWCGAHISWDLTGGSQLDTIPEPQALPALPPGGVKIQRSVPWSYY  119

Query  567  QNVVTSSYSYVWWDWQ  614
            QNVVTSSYSY WW+W+
Sbjct  120  QNVVTSSYSYAWWNWK  135



>gb|KEH35072.1| alpha-N-acetylglucosaminidase family protein [Medicago truncatula]
Length=786

 Score =   158 bits (399),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 79/150 (53%), Positives = 100/150 (67%), Gaps = 11/150 (7%)
 Frame = +3

Query  165  EAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNF  344
            +AI   L     +R   SVQE+AA+ VL RLLP+H  SF  +I+SK      S   +T F
Sbjct  31   DAISRTLQIQHRERSPPSVQEAAARSVLLRLLPSHSDSFHFRIISKAFQFSLSI-SLTYF  89

Query  345  KSSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVST  524
                      LI+GTT ++I SGLHWYLK+WCG+HISW+KTGG Q+ SVP  GLLP V  
Sbjct  90   ----------LIEGTTGVDIVSGLHWYLKHWCGSHISWDKTGGSQLFSVPNVGLLPRVHD  139

Query  525  EGVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
             G+ ++RPVPW+YYQN VTSSYS+ WWDW+
Sbjct  140  AGISVRRPVPWSYYQNAVTSSYSFAWWDWK  169



>ref|XP_011087174.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Sesamum indicum]
Length=944

 Score =   156 bits (394),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 102/146 (70%), Gaps = 1/146 (1%)
 Frame = +3

Query  165  EAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNF  344
            E I  LL   D +R   S+Q SAA   L RL+P+H SSF+  I+SKD+CGG+ CF++ N 
Sbjct  159  EYISRLLEIQDRERAPPSIQISAAYAALNRLIPSHSSSFQFSIISKDLCGGEPCFKLNNH  218

Query  345  KSSSGD-SPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVS  521
             + + D S +ILI GTT +E+  GLHWYLKYWCGAHISW KTGG Q +SVPK G L  + 
Sbjct  219  PAVNHDGSAEILISGTTGVELLFGLHWYLKYWCGAHISWSKTGGAQFSSVPKSGSLNRIQ  278

Query  522  TEGVMIQRPVPWNYYQNVVTSSYSYV  599
              G+ ++RP PW+YYQN V+SSY++ 
Sbjct  279  DAGITMKRPTPWSYYQNAVSSSYTFA  304



>ref|XP_010092738.1| hypothetical protein L484_024633 [Morus notabilis]
 gb|EXB52083.1| hypothetical protein L484_024633 [Morus notabilis]
Length=313

 Score =   147 bits (370),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 64/97 (66%), Positives = 75/97 (77%), Gaps = 0/97 (0%)
 Frame = +3

Query  294  VSKDVCGGQSCFRVTNFKSSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGG  473
            + KDVC G SCF + N+  SS   P+I+I+GTT +E+ SGLHWYLKYWCGAHISW+KT G
Sbjct  169  LRKDVCHGHSCFILANYNLSSKHGPEIMIKGTTGVELASGLHWYLKYWCGAHISWDKTAG  228

Query  474  IQINSVPKPGLLPSVSTEGVMIQRPVPWNYYQNVVTS  584
             QI S+P PG LP V  EGVMIQRPV WNYYQNVV +
Sbjct  229  AQIASIPNPGSLPLVKDEGVMIQRPVLWNYYQNVVQA  265



>ref|XP_010659443.1| PREDICTED: alpha-N-acetylglucosaminidase isoform X2 [Vitis vinifera]
Length=715

 Score =   149 bits (377),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 72/79 (91%), Gaps = 0/79 (0%)
 Frame = +3

Query  378  IQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVMIQRPVPW  557
            I+GTTA+EI SGLHWY+KYWCGAH+SW+KTG IQI S+PKPG LP V  EGV+IQRPVPW
Sbjct  7    IKGTTAVEIASGLHWYIKYWCGAHVSWDKTGSIQIASIPKPGSLPLVKDEGVLIQRPVPW  66

Query  558  NYYQNVVTSSYSYVWWDWQ  614
            NYYQNVVTSSYSYVWWDW+
Sbjct  67   NYYQNVVTSSYSYVWWDWE  85



>gb|EMT10178.1| hypothetical protein F775_30738 [Aegilops tauschii]
Length=945

 Score =   145 bits (365),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 76/104 (73%), Gaps = 0/104 (0%)
 Frame = +3

Query  285  LKIVSKDVCGGQSCFRVTNFKSSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEK  464
            L ++   VCG  SCFR++N   SS    +ILIQG TA+E+ SGLHWYLKYWCG HISW+K
Sbjct  42   LPLLQGGVCGDSSCFRISNVDGSSKGGAEILIQGNTAVELASGLHWYLKYWCGVHISWDK  101

Query  465  TGGIQINSVPKPGLLPSVSTEGVMIQRPVPWNYYQNVVTSSYSY  596
            TGG Q+ SVP PG LP V    V ++RPVPWNYYQNVVTSS  +
Sbjct  102  TGGAQLASVPSPGSLPRVKGTAVKVERPVPWNYYQNVVTSSCEF  145



>gb|AES69666.2| alpha-N-acetylglucosaminidase family protein [Medicago truncatula]
Length=686

 Score =   141 bits (356),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 60/79 (76%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +3

Query  378  IQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVMIQRPVPW  557
            I+GTT +EI SGLHWYLKYWCGAH+SW+KTGGIQ  S+PKPG LP +   GV I+RPVPW
Sbjct  5    IRGTTGVEIASGLHWYLKYWCGAHVSWDKTGGIQTTSIPKPGSLPLLKDGGVKIKRPVPW  64

Query  558  NYYQNVVTSSYSYVWWDWQ  614
            NYYQNVVTSSYS+VWWDW+
Sbjct  65   NYYQNVVTSSYSFVWWDWE  83



>gb|KEH33252.1| alpha-N-acetylglucosaminidase family protein [Medicago truncatula]
Length=711

 Score =   141 bits (356),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 60/79 (76%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +3

Query  378  IQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVMIQRPVPW  557
            I+GTT +EI SGLHWYLKYWCGAH+SW+KTGGIQ  S+PKPG LP +   GV I+RPVPW
Sbjct  5    IRGTTGVEIASGLHWYLKYWCGAHVSWDKTGGIQTTSIPKPGSLPLLKDGGVKIKRPVPW  64

Query  558  NYYQNVVTSSYSYVWWDWQ  614
            NYYQNVVTSSYS+VWWDW+
Sbjct  65   NYYQNVVTSSYSFVWWDWE  83



>gb|EMS50400.1| hypothetical protein TRIUR3_11279 [Triticum urartu]
Length=717

 Score =   138 bits (348),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = +3

Query  369  QILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVMIQRP  548
            ++ IQG TA+E+ SGLHWYLKYWCG HISW+KTGG Q+ SVP PG LP V    V ++RP
Sbjct  78   EMRIQGNTAVELASGLHWYLKYWCGVHISWDKTGGAQLASVPSPGSLPRVKETAVKVERP  137

Query  549  VPWNYYQNVVTSSYSYVWWDWQ  614
            VPWNYYQNVVTSSYS+VWWDW+
Sbjct  138  VPWNYYQNVVTSSYSFVWWDWR  159



>ref|XP_006856885.1| hypothetical protein AMTR_s00055p00202230 [Amborella trichopoda]
 gb|ERN18352.1| hypothetical protein AMTR_s00055p00202230 [Amborella trichopoda]
Length=727

 Score =   135 bits (341),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = +3

Query  354  SGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGV  533
            S D  +  I+GTT +E+++GLHWYLK+WCGAHISW+KTGG+Q+ S+P PG LP V + GV
Sbjct  10   SQDYSKKRIKGTTGVELSAGLHWYLKHWCGAHISWDKTGGVQLASIPVPGSLPHVQSAGV  69

Query  534  MIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
            ++QRP+PW+YYQN VTSSYS+ WWDW+
Sbjct  70   LVQRPIPWSYYQNAVTSSYSFAWWDWK  96



>ref|XP_009420949.1| PREDICTED: alpha-N-acetylglucosaminidase-like, partial [Musa 
acuminata subsp. malaccensis]
Length=260

 Score =   126 bits (316),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 53/83 (64%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +3

Query  366  PQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVMIQR  545
            P+ILIQGT+ +E+++G HWYLK+WC  HISWEKTGG+Q++SVPK G LP V + G+++QR
Sbjct  5    PEILIQGTSGVELSAGFHWYLKHWCLIHISWEKTGGLQLSSVPKVGSLPHVPSAGILVQR  64

Query  546  PVPWNYYQNVVTSSYSYVWWDWQ  614
            PVP +YYQN VTSSYS+ WW W+
Sbjct  65   PVPLSYYQNAVTSSYSHAWWSWE  87



>gb|EMT10385.1| hypothetical protein F775_10757 [Aegilops tauschii]
Length=768

 Score =   124 bits (310),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 53/83 (64%), Positives = 65/83 (78%), Gaps = 0/83 (0%)
 Frame = +3

Query  366  PQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVMIQR  545
            PQ  I G + +EI++GLHWYLK +C AHISW KTGG Q++SVP PG LP V   G++IQR
Sbjct  35   PQTWILGASGVEISTGLHWYLKNYCAAHISWAKTGGSQLSSVPYPGSLPRVPAGGILIQR  94

Query  546  PVPWNYYQNVVTSSYSYVWWDWQ  614
            PV W+YYQN VTSSYS+ WWDW+
Sbjct  95   PVDWSYYQNAVTSSYSFAWWDWE  117



>gb|EMS67905.1| hypothetical protein TRIUR3_00413 [Triticum urartu]
Length=732

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 63/79 (80%), Gaps = 0/79 (0%)
 Frame = +3

Query  378  IQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVMIQRPVPW  557
            I G + +EI++GLHWYLK +C AHISW KTGG Q++SVP PG LP V   G++IQRPV W
Sbjct  3    ILGASGVEISAGLHWYLKNYCAAHISWAKTGGSQLSSVPYPGSLPRVPAGGILIQRPVDW  62

Query  558  NYYQNVVTSSYSYVWWDWQ  614
            +YYQN VTSSYS+ WWDW+
Sbjct  63   SYYQNAVTSSYSFAWWDWE  81



>ref|XP_008375269.1| PREDICTED: uncharacterized protein LOC103438510 [Malus domestica]
Length=115

 Score =   100 bits (250),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = +3

Query  159  ESEAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVT  338
            ++EA+ +LL RLDSKR S SVQE+AAK VL+RLLPTH+ SF+ KIVS+D CGG SCF + 
Sbjct  25   KAEAVTALLRRLDSKRSSASVQEAAAKAVLERLLPTHVHSFDFKIVSQDACGGHSCFMLN  84

Query  339  NFKSSSGDSPQI  374
            N+  SSG  P+I
Sbjct  85   NYNLSSGHGPEI  96



>ref|XP_005645139.1| hypothetical protein COCSUDRAFT_37819 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE20595.1| hypothetical protein COCSUDRAFT_37819 [Coccomyxa subellipsoidea 
C-169]
Length=762

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 77/135 (57%), Gaps = 8/135 (6%)
 Frame = +3

Query  216  SVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKSSSGDSPQILIQGTTA  395
            S Q  A  G+L R+LP +   FEL+ +        +CF V        D  +I+++G + 
Sbjct  15   SQQIDAVNGLLDRILPEYSHLFELRALPDCDSIQSACFEVHT------DGKRIVVKGASG  68

Query  396  IEITSGLHWYLKYWCGAHISWEKTGGIQIN-SVPKPGLLPSVSTEGVMI-QRPVPWNYYQ  569
            IE+ SG+HW+LKY C +  SW  TGG  I+ S  KP  L  +S  G +   R VPW+YYQ
Sbjct  69   IEMASGIHWFLKYACNSSTSWHLTGGNNIDSSCFKPESLERISLAGPLRGARSVPWSYYQ  128

Query  570  NVVTSSYSYVWWDWQ  614
            NVVT SYS  +WDW+
Sbjct  129  NVVTPSYSMAFWDWE  143



>ref|XP_002503216.1| GH family 89 protein [Micromonas sp. RCC299]
 gb|ACO64474.1| GH family 89 protein [Micromonas sp. RCC299]
Length=1260

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 53/129 (41%), Positives = 73/129 (57%), Gaps = 11/129 (9%)
 Frame = +3

Query  243  VLQRLLPTHLSS--FELKIVSKD--VCGGQSCFRVTNFKSSSGDSP-QILIQGTTAIEIT  407
            +++RLLP H  S   E +   +D     G  CF + N     GD P  I I G+T +E  
Sbjct  30   LMERLLPNHAGSNLIEFRGRHRDGGCAEGARCFSIQN-----GDKPGTISIAGSTGVEQA  84

Query  408  SGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVMIQRPVPWNYYQNVVTSS  587
            +GLH YL+ +CGAH+ WE TGG Q++SVP+ G LP V   GV++  P     Y N  T S
Sbjct  85   AGLHHYLRRFCGAHLGWEATGGHQLHSVPR-GSLPPVDDAGVVVNLPFERTVYMNPETFS  143

Query  588  YSYVWWDWQ  614
            YS  +WD++
Sbjct  144  YSTAFWDYE  152



>gb|KCW51928.1| hypothetical protein EUGRSUZ_J01382 [Eucalyptus grandis]
Length=138

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 52/74 (70%), Gaps = 4/74 (5%)
 Frame = +3

Query  366  PQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVMIQR  545
            PQ+ I G   +E+ + L W LKY    HISW+KT G+Q++S+PK G LP V   GV++QR
Sbjct  57   PQLTISGVFGVEVVACLRWCLKY----HISWDKTSGLQMHSIPKFGSLPCVHDAGVVVQR  112

Query  546  PVPWNYYQNVVTSS  587
            P+PW+Y QN +TSS
Sbjct  113  PIPWHYNQNAITSS  126



>gb|KIZ03038.1| alpha-N-acetylglucosaminidase [Monoraphidium neglectum]
Length=745

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 45/127 (35%), Positives = 74/127 (58%), Gaps = 11/127 (9%)
 Frame = +3

Query  243  VLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKSSSGDSPQILIQGTTAIEITSGLHW  422
            +L+R+LP H   F+L++V          FRV         + ++ ++GT+ +E+ SG HW
Sbjct  20   LLRRMLPAHAHLFDLRLVPLSPDAPHGHFRVAT------RARRVAVEGTSPVELASGAHW  73

Query  423  YLKYWCGAHISWEKTGGIQINS----VPKPGLLPSVSTEGVMIQRPVPWNYYQNVVTSSY  590
            +LK+  G  +SW+ TGG QI++      +   L  V ++   ++R VP  +YQNVVT+SY
Sbjct  74   WLKHHAGCSVSWDATGGPQIDAAAFGAARMDELGGVGSDET-VRRAVPSTFYQNVVTASY  132

Query  591  SYVWWDW  611
            S+ +WDW
Sbjct  133  SFAFWDW  139



>gb|KFM79407.1| Alpha-N-acetylglucosaminidase, partial [Stegodyphus mimosarum]
Length=534

 Score = 85.5 bits (210),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 52/144 (36%), Positives = 79/144 (55%), Gaps = 15/144 (10%)
 Frame = +3

Query  183  LSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKSSSGD  362
            +  L+S   S+ V+E+A K +L RL+P     F +K+             +  F+  SGD
Sbjct  28   IDALESAHISSEVEENAVKQLLTRLIPDRAEQFIIKV-------NNHLDDIDYFQIESGD  80

Query  363  SPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVMIQ  542
              +++I GT     ++G++ YLKY+CG HI+W    G Q+N    P +LP    + + I+
Sbjct  81   D-KVIITGTRGYAASAGVYHYLKYFCGCHIAW---SGSQLNL---PKVLPK-PAKPLKIK  132

Query  543  RPVPWNYYQNVVTSSYSYVWWDWQ  614
                + YYQNV TSSYSYVWW W+
Sbjct  133  FNDKYRYYQNVCTSSYSYVWWAWE  156



>ref|XP_973259.1| PREDICTED: alpha-N-acetylglucosaminidase isoform X2 [Tribolium 
castaneum]
Length=747

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 51/142 (36%), Positives = 73/142 (51%), Gaps = 17/142 (12%)
 Frame = +3

Query  192  LDSKRPSNSV--QESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKSSSGDS  365
             D  RP  S+  Q  A K +++RL+P     F++KI        +  F++       GD 
Sbjct  18   FDHIRPKASLKTQTDAVKDLIKRLIPGQAQFFDIKIQPDLNHEDKDAFKIEKI----GDL  73

Query  366  PQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVMIQR  545
             QI   GTT +   +G + YLKY+C  H+SWE T       +  P +LP V+    +  R
Sbjct  74   IQI--TGTTGVAAATGFNHYLKYFCNCHVSWETT------QLKVPEVLPEVNLTITLNDR  125

Query  546  PVPWNYYQNVVTSSYSYVWWDW  611
               + YYQNV T+SYS+VWWDW
Sbjct  126  ---FRYYQNVCTTSYSFVWWDW  144



>ref|XP_008191832.1| PREDICTED: alpha-N-acetylglucosaminidase isoform X1 [Tribolium 
castaneum]
 gb|EFA02249.1| hypothetical protein TcasGA2_TC007912 [Tribolium castaneum]
Length=747

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 51/142 (36%), Positives = 73/142 (51%), Gaps = 17/142 (12%)
 Frame = +3

Query  192  LDSKRPSNSV--QESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKSSSGDS  365
             D  RP  S+  Q  A K +++RL+P     F++KI        +  F++       GD 
Sbjct  18   FDHIRPKASLKTQTDAVKDLIKRLIPGQAQFFDIKIQPDLNHEDKDAFKIEKI----GDL  73

Query  366  PQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVMIQR  545
             QI   GTT +   +G + YLKY+C  H+SWE T       +  P +LP V+    +  R
Sbjct  74   IQI--TGTTGVAAATGFNHYLKYFCNCHVSWETT------QLKVPEVLPEVNLTITLNDR  125

Query  546  PVPWNYYQNVVTSSYSYVWWDW  611
               + YYQNV T+SYS+VWWDW
Sbjct  126  ---FRYYQNVCTTSYSFVWWDW  144



>gb|KCW51927.1| hypothetical protein EUGRSUZ_J01382 [Eucalyptus grandis]
Length=111

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 49/70 (70%), Gaps = 4/70 (6%)
 Frame = +3

Query  378  IQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVMIQRPVPW  557
            I G   +E+ + L W LKY    HISW+KT G+Q++S+PK G LP V   GV++QRP+PW
Sbjct  34   ISGVFGVEVVACLRWCLKY----HISWDKTSGLQMHSIPKFGSLPCVHDAGVVVQRPIPW  89

Query  558  NYYQNVVTSS  587
            +Y QN +TSS
Sbjct  90   HYNQNAITSS  99



>ref|XP_011064972.1| PREDICTED: alpha-N-acetylglucosaminidase isoform X1 [Acromyrmex 
echinatior]
Length=759

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 51/138 (37%), Positives = 70/138 (51%), Gaps = 15/138 (11%)
 Frame = +3

Query  204  RPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCG-GQSCFRVTNFKSSSGDSPQILI  380
            R S  +Q  AAK V +RLL   +S   + I+  D+   G+  F++T          QI I
Sbjct  46   RTSPEIQAKAAKNVAERLLGKEISKLFIMILDTDLGPIGKDTFKITK-----NLLDQIEI  100

Query  381  QGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVMIQRPVPWN  560
            +GT+ + IT GLH+YLK +C  HISW+ T       +  P  LP V  + +   R   + 
Sbjct  101  RGTSGVAITWGLHYYLKNYCNVHISWDGT------HIELPNTLPEVRVKIISNDR---FR  151

Query  561  YYQNVVTSSYSYVWWDWQ  614
            YYQNV T  YS  WW W 
Sbjct  152  YYQNVCTVGYSSAWWQWH  169



>ref|XP_007558657.1| PREDICTED: alpha-N-acetylglucosaminidase-like isoform X1 [Poecilia 
formosa]
Length=763

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 56/146 (38%), Positives = 80/146 (55%), Gaps = 16/146 (11%)
 Frame = +3

Query  183  LSRLDSKRP--SNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKSSS  356
             S LD  +P  S+  Q  A  G+L+RLL    + F   IVS +         V   +S+ 
Sbjct  24   FSTLDHIKPKASDKEQARAVSGLLRRLLGNRSTEF---IVSVNRSLSNDSLDVCELRSAK  80

Query  357  GDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVM  536
             +  +I+  G+T + + SG++ YLKY+C  H+SW    G Q+  VP P  LP ++  GV+
Sbjct  81   NN--KIVATGSTGVALASGIYNYLKYFCNCHVSW---SGNQL-EVPSP--LPQLT--GVL  130

Query  537  -IQRPVPWNYYQNVVTSSYSYVWWDW  611
             I  P  + YYQNV T SYS+VWWDW
Sbjct  131  RINTPHRFRYYQNVCTVSYSFVWWDW  156



>ref|XP_001656341.1| AAEL003150-PA [Aedes aegypti]
 gb|EAT45604.1| AAEL003150-PA [Aedes aegypti]
Length=763

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 73/134 (54%), Gaps = 18/134 (13%)
 Frame = +3

Query  216  SVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFK-SSSGDSPQILIQGTT  392
            S+Q+ AA+ ++ R+LP     FE+++  +         ++ +FK   + DS  + I G+ 
Sbjct  40   SIQKQAAQELIGRILPERAHQFEVELNGR--------LKLNSFKILKTNDSTSVSITGSN  91

Query  393  AIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVMIQRPVPWNYYQN  572
             +    G ++YLKY+CG H+SW+   G Q+N    P  LP V  E   IQ P    YYQN
Sbjct  92   GVAAAKGFYYYLKYYCGCHVSWD---GDQLNL---PDDLPEVDVE---IQAPSSIVYYQN  142

Query  573  VVTSSYSYVWWDWQ  614
            V T SYS+ WW W+
Sbjct  143  VCTWSYSFSWWTWK  156



>ref|XP_008436403.1| PREDICTED: alpha-N-acetylglucosaminidase isoform X1 [Poecilia 
reticulata]
Length=796

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 56/146 (38%), Positives = 80/146 (55%), Gaps = 16/146 (11%)
 Frame = +3

Query  183  LSRLDSKRP--SNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKSSS  356
             S LD  +P  S+  Q  A  G+L+RLL    + F   IVS +         V   +S+ 
Sbjct  57   FSTLDHIKPKASDKEQARAVSGLLRRLLGNRSTEF---IVSVNRSLSNDSLDVCELRSAK  113

Query  357  GDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVM  536
             +  +I+  G+T + + SG++ YLKY+C  H+SW    G Q+  VP P  LP ++  GV+
Sbjct  114  NN--KIVATGSTGVALASGIYNYLKYFCNCHVSW---SGNQL-EVPSP--LPQLT--GVL  163

Query  537  -IQRPVPWNYYQNVVTSSYSYVWWDW  611
             I  P  + YYQNV T SYS+VWWDW
Sbjct  164  RINTPHRFRYYQNVCTVSYSFVWWDW  189



>ref|XP_008111624.1| PREDICTED: LOW QUALITY PROTEIN: alpha-N-acetylglucosaminidase 
[Anolis carolinensis]
Length=750

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 74/134 (55%), Gaps = 13/134 (10%)
 Frame = +3

Query  213  NSVQESAAKGVLQRLL-PTHLSSFELKIVSKDVCGGQSCFRVTNFKSSSGDSPQILIQGT  389
            ++ Q  A + +L+RLL P   S+F + +      GG   +R+     SSG    + + G+
Sbjct  31   DTRQAEAVRELLERLLGPRAASAFAVSVNRSLAGGGLDTYRL-----SSGAPGVVEVAGS  85

Query  390  TAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVMIQRPVPWNYYQ  569
            + +   SG++ YLK +CG H+SW    G+Q+     P  LP V TE + +  P  + +YQ
Sbjct  86   SGVAAASGIYRYLKDFCGCHVSWS---GLQLK---LPDRLPPVPTE-IFVTSPNRFRFYQ  138

Query  570  NVVTSSYSYVWWDW  611
            NV T SYSYVWW+W
Sbjct  139  NVCTQSYSYVWWNW  152



>ref|XP_004342502.1| alpha-N-acetylglucosaminidase family protein [Acanthamoeba castellanii 
str. Neff]
 gb|ELR20308.1| alpha-N-acetylglucosaminidase family protein [Acanthamoeba castellanii 
str. Neff]
Length=854

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 73/134 (54%), Gaps = 5/134 (4%)
 Frame = +3

Query  219  VQESAAKGVLQRLL-PTHLSSFELKIVSKDVCGGQSCFRVTNFKSSS-GDSPQILIQGTT  392
            VQ  A +G++ RLL  +++  F+L I+        +        + + G   Q+ IQG++
Sbjct  54   VQVQAVQGLIGRLLGASYVPLFQLSILPSPYASSSTDHDYYTLSTRTVGGVTQVQIQGSS  113

Query  393  AIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVMIQRPVPWNYYQN  572
             + + SGLHWYLKY C   +SW   G    N++  P  LP++S + + +Q PV + YY N
Sbjct  114  GVALASGLHWYLKYSCNCSVSWGVAG--SGNNLALPSRLPALS-KPLAMQSPVKYRYYLN  170

Query  573  VVTSSYSYVWWDWQ  614
            V T SYS VWW W 
Sbjct  171  VCTHSYSSVWWQWD  184



>ref|XP_011266261.1| PREDICTED: alpha-N-acetylglucosaminidase [Camponotus floridanus]
 gb|EFN61518.1| Alpha-N-acetylglucosaminidase [Camponotus floridanus]
Length=737

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 55/153 (36%), Positives = 79/153 (52%), Gaps = 16/153 (10%)
 Frame = +3

Query  159  ESEAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCG-GQSCFRV  335
            +S+A +  L  + S   S  +Q  AAK V +RLL   +S   + +V  D+    +  F+V
Sbjct  28   KSDAFQVTLGHIRS-HTSPEIQAKAAKDVAERLLGKEISKLFIMMVDTDLGPIDKDTFKV  86

Query  336  TNFKSSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPS  515
            T  K+  G   +I I+GT+ + IT GLH+YLK +C  HISW+ T       +  P  LP 
Sbjct  87   T--KNPLG---EIEIRGTSGVAITWGLHYYLKNYCNVHISWDGT------QITLPNTLPE  135

Query  516  VSTEGVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
            V    + I     + YYQNV T  YS  WW W+
Sbjct  136  VR---IKITSNDRFRYYQNVCTVGYSSTWWQWK  165



>ref|XP_006822720.1| PREDICTED: LOW QUALITY PROTEIN: alpha-N-acetylglucosaminidase-like 
[Saccoglossus kowalevskii]
Length=586

 Score = 80.1 bits (196),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 76/135 (56%), Gaps = 12/135 (9%)
 Frame = +3

Query  210  SNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKSSSGDSPQILIQGT  389
            S+  Q  A +G++QR LP   + F+   V+ D   GQ+   + +F+  +    ++ ++GT
Sbjct  19   SDDTQADAVRGLIQRXLPDRATQFK---VTVDQGLGQA--NMDSFEIETTGINEVTLRGT  73

Query  390  TAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVMIQRPVPWNYYQ  569
            T +   S    YLK +C  HISW    G Q+N VP+   LP V ++ V +  P  + YYQ
Sbjct  74   TGVAAASAFQHYLKNYCHCHISWS---GDQLN-VPRD--LPIVKSK-VRVVSPNRFRYYQ  126

Query  570  NVVTSSYSYVWWDWQ  614
            NV T SYS+VWWDW+
Sbjct  127  NVCTVSYSFVWWDWK  141



>ref|XP_006901783.1| PREDICTED: alpha-N-acetylglucosaminidase [Elephantulus edwardii]
Length=744

 Score = 80.1 bits (196),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 52/146 (36%), Positives = 80/146 (55%), Gaps = 13/146 (9%)
 Frame = +3

Query  180  LLSRLDSKRPSNSVQESAAKGVLQRLL-PTHLSSFELKIV-SKDVCGGQSCFRVTNFKSS  353
            +L RLD      + + +A + +L RLL P   + F + +  S  V  G   +R+    S 
Sbjct  14   ILVRLDGSAGDEAQEAAAVRALLVRLLGPGPAADFSVTVQRSLAVESGLDTYRL----SG  69

Query  354  SGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGV  533
             G    + + G+T +   +GLH YL+ +CG H++W    G Q++ +P+P  LPSV  E +
Sbjct  70   GGAEKPVRVAGSTGVAAAAGLHRYLRDFCGCHVAWS---GSQLH-LPRP--LPSVPEE-L  122

Query  534  MIQRPVPWNYYQNVVTSSYSYVWWDW  611
            +   P  + YYQNV T SYS+VWWDW
Sbjct  123  VEATPNRYRYYQNVCTHSYSFVWWDW  148



>gb|EFZ16314.1| hypothetical protein SINV_06335 [Solenopsis invicta]
Length=187

 Score = 76.6 bits (187),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 51/138 (37%), Positives = 72/138 (52%), Gaps = 15/138 (11%)
 Frame = +3

Query  204  RPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCG-GQSCFRVTNFKSSSGDSPQILI  380
            R S  +Q  AAK V +RLL    S   + I+  D+    +  F +T  K+S G   +I I
Sbjct  9    RTSPEIQTKAAKDVAERLLGKETSKLFIMILDTDLGPIDKDTFEIT--KNSLG---KIEI  63

Query  381  QGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVMIQRPVPWN  560
            +GT+ + IT GL++YLK++C  H+SW+ T       +  P  LP V    V I     + 
Sbjct  64   RGTSGVAITWGLNYYLKHYCNVHVSWDGT------QISLPNTLPYVR---VKITSNDRFR  114

Query  561  YYQNVVTSSYSYVWWDWQ  614
            YYQNV T  YS  WW W+
Sbjct  115  YYQNVCTVGYSSAWWQWR  132



>ref|XP_005105869.1| PREDICTED: alpha-N-acetylglucosaminidase-like, partial [Aplysia 
californica]
Length=658

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 52/144 (36%), Positives = 78/144 (54%), Gaps = 13/144 (9%)
 Frame = +3

Query  183  LSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKSSSGD  362
            LS L +K  S  VQ  AA+GV+ RL+    + F++ +        +  FR+    SS+GD
Sbjct  40   LSHLKTK-TSPDVQREAARGVISRLVKDRAADFDVDVNPDLGPKERDTFRL----SSTGD  94

Query  363  SPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVMIQ  542
              +ILI+GTT + ++ G + Y+KYWC A  +W    G Q    P    LP +  + V+I 
Sbjct  95   G-RILIEGTTGVAVSMGFYHYIKYWCNAQRTW---AGQQTELPPT---LPVIE-KPVVIT  146

Query  543  RPVPWNYYQNVVTSSYSYVWWDWQ  614
                + YY+NV T SYS+V+W W 
Sbjct  147  SNDRFRYYKNVCTESYSFVFWQWD  170



>gb|KCW66076.1| hypothetical protein EUGRSUZ_G03358 [Eucalyptus grandis]
Length=742

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +3

Query  477  QINSVPKPGLLPSVSTEGVMIQRPVPWNYYQNVVTSSYSYVWWDW  611
            ++ S+PK G LP +  +GVMIQRPVPWNYYQNVVTSSYSYVWW+W
Sbjct  68   KVASIPKAGSLPRLKGKGVMIQRPVPWNYYQNVVTSSYSYVWWNW  112


 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = +3

Query  165  EAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSK  302
            + IESLL+RL+SKR S SVQE+AA GVL+RLLP H  SF+ KIV K
Sbjct  23   DVIESLLTRLESKRASPSVQETAAAGVLERLLPFHSRSFQFKIVPK  68



>ref|XP_011152868.1| PREDICTED: alpha-N-acetylglucosaminidase [Harpegnathos saltator]
Length=767

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 51/136 (38%), Positives = 72/136 (53%), Gaps = 15/136 (11%)
 Frame = +3

Query  210  SNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVC-GGQSCFRVTNFKSSSGDSPQILIQG  386
            S  VQ  AAK V++RLL    +   +  V  D+   G+  F+VT  K+  G+   I I+G
Sbjct  43   SPEVQTEAAKDVVRRLLGNKTAELFVVAVDNDLGPAGKDTFKVT--KNPLGN---IEIRG  97

Query  387  TTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVMIQRPVPWNYY  566
            T+ + IT GL++YLK +C  H+SW+ T       +  P +LP V  +     R   + YY
Sbjct  98   TSGVAITWGLNYYLKNYCNVHVSWDGT------QISLPNILPEVRIKITSNDR---FRYY  148

Query  567  QNVVTSSYSYVWWDWQ  614
            QNV T  YS  WW WQ
Sbjct  149  QNVCTVGYSSAWWQWQ  164



>gb|KDR09306.1| Alpha-N-acetylglucosaminidase [Zootermopsis nevadensis]
Length=782

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/149 (32%), Positives = 77/149 (52%), Gaps = 14/149 (9%)
 Frame = +3

Query  165  EAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNF  344
            +   S L  L ++  S  +Q  AA GV++RL+P     F++ +  +    G+  F+V   
Sbjct  24   DGFHSTLGHLKAQ-ASPQIQAQAATGVIKRLIPDKAELFQVTVDPRLGPVGKDTFKV--L  80

Query  345  KSSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVST  524
            K +  D  ++ + GT+ +    G H YLKY+C  H+SW+       + +  P  LP V+ 
Sbjct  81   KENGQD--RVNLVGTSGVAAVWGFHHYLKYYCFCHVSWDS------DQLSLPEKLPPVNI  132

Query  525  EGVMIQRPVPWNYYQNVVTSSYSYVWWDW  611
                + R   + YYQNV T+SYS+VWW W
Sbjct  133  TVTSVDR---FRYYQNVCTTSYSFVWWGW  158



>gb|KCW66077.1| hypothetical protein EUGRSUZ_G03358 [Eucalyptus grandis]
Length=696

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +3

Query  477  QINSVPKPGLLPSVSTEGVMIQRPVPWNYYQNVVTSSYSYVWWDW  611
            ++ S+PK G LP +  +GVMIQRPVPWNYYQNVVTSSYSYVWW+W
Sbjct  68   KVASIPKAGSLPRLKGKGVMIQRPVPWNYYQNVVTSSYSYVWWNW  112


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = +3

Query  165  EAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSK  302
            + IESLL+RL+SKR S SVQE+AA GVL+RLLP H  SF+ KIV K
Sbjct  23   DVIESLLTRLESKRASPSVQETAAAGVLERLLPFHSRSFQFKIVPK  68



>gb|EFN75548.1| Alpha-N-acetylglucosaminidase [Harpegnathos saltator]
Length=741

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 51/136 (38%), Positives = 72/136 (53%), Gaps = 15/136 (11%)
 Frame = +3

Query  210  SNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVC-GGQSCFRVTNFKSSSGDSPQILIQG  386
            S  VQ  AAK V++RLL    +   +  V  D+   G+  F+VT  K+  G+   I I+G
Sbjct  17   SPEVQTEAAKDVVRRLLGNKTAELFVVAVDNDLGPAGKDTFKVT--KNPLGN---IEIRG  71

Query  387  TTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVMIQRPVPWNYY  566
            T+ + IT GL++YLK +C  H+SW+ T       +  P +LP V  +     R   + YY
Sbjct  72   TSGVAITWGLNYYLKNYCNVHVSWDGT------QISLPNILPEVRIKITSNDR---FRYY  122

Query  567  QNVVTSSYSYVWWDWQ  614
            QNV T  YS  WW WQ
Sbjct  123  QNVCTVGYSSAWWQWQ  138



>ref|XP_005105870.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Aplysia californica]
Length=628

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 77/144 (53%), Gaps = 13/144 (9%)
 Frame = +3

Query  183  LSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKSSSGD  362
            LS L +K  S  VQ  AA+GV+ RL+    + F++ +        +  FR+++ K     
Sbjct  31   LSHLKTKT-SPDVQREAARGVISRLVKDRAADFDVDVNPDLGPKERDTFRLSSTKDG---  86

Query  363  SPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVMIQ  542
              +ILI+GTT + ++ GL++Y+KYWC A  +W    G Q    P    LP +  + V+I 
Sbjct  87   --KILIEGTTGVAVSMGLYYYIKYWCNAQRTW---AGQQTELPPT---LPVIE-KPVVIT  137

Query  543  RPVPWNYYQNVVTSSYSYVWWDWQ  614
                + YY+NV T SYS+ +W W 
Sbjct  138  SNDRFRYYKNVCTESYSFAFWQWD  161



>ref|XP_008436404.1| PREDICTED: alpha-N-acetylglucosaminidase isoform X2 [Poecilia 
reticulata]
Length=763

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 54/143 (38%), Positives = 78/143 (55%), Gaps = 16/143 (11%)
 Frame = +3

Query  192  LDSKRPS--NSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKSSSGDS  365
            LD  +P   +  Q  A  G+L+RLL    + F   IVS +         V   +S+  + 
Sbjct  27   LDHIQPKVGDEEQARAVSGLLRRLLGNRSTEF---IVSVNRSLSNDSLDVCELRSAKNN-  82

Query  366  PQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVM-IQ  542
             +I+  G+T + + SG++ YLKY+C  H+SW    G Q+  VP P  LP ++  GV+ I 
Sbjct  83   -KIVATGSTGVALASGIYNYLKYFCNCHVSW---SGNQL-EVPSP--LPQLT--GVLRIN  133

Query  543  RPVPWNYYQNVVTSSYSYVWWDW  611
             P  + YYQNV T SYS+VWWDW
Sbjct  134  TPHRFRYYQNVCTVSYSFVWWDW  156



>ref|XP_003397173.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Bombus terrestris]
Length=770

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 49/137 (36%), Positives = 70/137 (51%), Gaps = 13/137 (9%)
 Frame = +3

Query  204  RPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKSSSGDSPQILIQ  383
            R S  VQ  AA+GV +RLL    ++  L +V+ D+  G +       K +S D  Q+ I 
Sbjct  39   RTSPEVQAEAARGVAERLLGRERAAKFLMVVNPDL--GPTGLDTFLIKKNSLD--QVEIF  94

Query  384  GTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVMIQRPVPWNY  563
            G++ + +  GLH+YLK +C  HISWE       N +  P  LP V  +     R   + Y
Sbjct  95   GSSGVAVAWGLHYYLKTYCNVHISWEG------NQIELPQTLPDVRVKVTSNDR---FRY  145

Query  564  YQNVVTSSYSYVWWDWQ  614
            YQNV T  Y++ WW W 
Sbjct  146  YQNVCTLGYTFAWWQWD  162



>ref|XP_004987699.1| alpha-N-acetylglucosaminidase [Salpingoeca rosetta]
 gb|EGD81303.1| alpha-N-acetylglucosaminidase [Salpingoeca rosetta]
Length=696

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 45/129 (35%), Positives = 74/129 (57%), Gaps = 7/129 (5%)
 Frame = +3

Query  231  AAKGVLQRLLPTH-LSSFELKIVSKDVCGGQSCFRVTNFKSSSGDSPQILIQGTTAIEIT  407
            AA+ +++R L +  L+ FE  +++        CF + N   S+ ++  + I GT+ +E+ 
Sbjct  63   AAQALVRRRLGSDALNHFEFYLINT-THDETLCFELAN---SNTNASVVTIGGTSPVEMA  118

Query  408  SGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVMIQRPVPWNYYQNVVTSS  587
            +GL+++L+ +     SW KTGG  I+  P P  +P V +    + +   + YYQNVVT S
Sbjct  119  TGLNFFLREYLHMSFSWNKTGGDVIH--PLPATMPVVHSHHAHVNKTTFYTYYQNVVTVS  176

Query  588  YSYVWWDWQ  614
            YS VWWDWQ
Sbjct  177  YSMVWWDWQ  185



>ref|XP_011162675.1| PREDICTED: alpha-N-acetylglucosaminidase [Solenopsis invicta]
Length=820

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 54/154 (35%), Positives = 80/154 (52%), Gaps = 16/154 (10%)
 Frame = +3

Query  156  QESEAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCG-GQSCFR  332
             +S+  ++ L  + S R S  +Q  AAK V +RLL    S   + I+  D+    +  F 
Sbjct  45   HKSDMFQNTLGHIKS-RTSPEIQTKAAKDVAERLLGKETSKLFIMILDTDLGPIDKDTFE  103

Query  333  VTNFKSSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLP  512
            +T  K+S G   +I I+GT+ + IT GL++YLK++C  H+SW+ T       +  P  LP
Sbjct  104  IT--KNSLG---KIEIRGTSGVAITWGLNYYLKHYCNVHVSWDGT------QISLPNTLP  152

Query  513  SVSTEGVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
             V    V I     + YYQNV T  YS  WW W+
Sbjct  153  YVR---VKITSNDRFRYYQNVCTVGYSSAWWQWR  183



>ref|XP_004609026.1| PREDICTED: alpha-N-acetylglucosaminidase [Sorex araneus]
Length=838

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 51/153 (33%), Positives = 77/153 (50%), Gaps = 34/153 (22%)
 Frame = +3

Query  156  QESEAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRV  335
            +E+EA+  LL+RL    P+ S + S  + +                       G   FR+
Sbjct  107  REAEAVRELLARLLGPGPAASFEVSVERALAAE-------------------SGLDTFRL  147

Query  336  TNFKSSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPS  515
                S  G   ++ +QG+T +   +GLH YL+ +CG H++W    G Q++ +P+P  LP+
Sbjct  148  ----SGGGAGARVHVQGSTGVAAAAGLHRYLRDYCGCHVAWS---GSQLH-LPQP--LPA  197

Query  516  VS-TEGVMIQRPVPWNYYQNVVTSSYSYVWWDW  611
            V  TE      P  + YYQNV T SYS+VWWDW
Sbjct  198  VELTEAT----PNRYRYYQNVCTQSYSFVWWDW  226



>ref|XP_003703688.1| PREDICTED: alpha-N-acetylglucosaminidase [Megachile rotundata]
Length=744

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 70/134 (52%), Gaps = 17/134 (13%)
 Frame = +3

Query  216  SVQESAAKGVLQRLLPTHLSSFELKIVSKDVCG--GQSCFRVTNFKSSSGDSPQILIQGT  389
              Q  AAKGV +RLL    +   +  V  D CG  G+  F +   K+SS    QI I GT
Sbjct  19   KAQAVAAKGVAERLLGVERARLFVMDVDPD-CGPVGKDTFLIE--KTSSN---QIKIVGT  72

Query  390  TAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVMIQRPVPWNYYQ  569
            + + ++ GLH+YLK++C AHISWE       N +  P  LP V  +     R   + YYQ
Sbjct  73   SGVAVSWGLHYYLKHYCNAHISWEG------NQLHLPSTLPDVHVKVTSNDR---FRYYQ  123

Query  570  NVVTSSYSYVWWDW  611
            NV +  Y+ VWW W
Sbjct  124  NVCSFGYTSVWWQW  137



>ref|XP_001865888.1| alpha-N-acetyl glucosaminidase [Culex quinquefasciatus]
 gb|EDS42452.1| alpha-N-acetyl glucosaminidase [Culex quinquefasciatus]
Length=761

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 47/136 (35%), Positives = 76/136 (56%), Gaps = 16/136 (12%)
 Frame = +3

Query  204  RPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKSSSGDSPQILIQ  383
            + S  VQ++A   ++ R++P   S F+   V+ D     + F++T     + DS  +LI 
Sbjct  35   KTSPEVQQTATAELISRIVPERASQFK---VTVDSALKPNSFKITK----TSDSSVVLIV  87

Query  384  GTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVMIQRPVPWNY  563
            G++ +  + G + YLKY+CG H+SW+   G Q++    P  LP+V+   V ++ P    Y
Sbjct  88   GSSGVAASKGFYHYLKYYCGCHVSWD---GDQLDL---PDDLPNVN---VSVEAPSSIVY  138

Query  564  YQNVVTSSYSYVWWDW  611
            YQNV T SYS+ WW W
Sbjct  139  YQNVCTWSYSFSWWTW  154



>ref|XP_006559874.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Apis mellifera]
Length=773

 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 54/152 (36%), Positives = 76/152 (50%), Gaps = 16/152 (11%)
 Frame = +3

Query  162  SEAIESLLSRLDSKRPSNSVQESAAKGVLQRLL-PTHLSSFELKIVSKDVCGGQSCFRVT  338
            S   ++ LS +   R S+  Q +AA GV++RLL P    +F + +       G+  F + 
Sbjct  27   SNVFQNTLSHI-RPRISSEEQANAAAGVVERLLGPERAKNFVMMVNPNFTSPGKDSFLIK  85

Query  339  NFKSSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSV  518
              K+S G   Q+ I GT+ +    GLH+YLK +C  HISWE       N V  P +LP V
Sbjct  86   --KNSMG---QVEILGTSGVVAAWGLHYYLKTYCNVHISWEG------NQVELPDILPDV  134

Query  519  STEGVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
                V I     + YYQNV T  Y+  WW W+
Sbjct  135  R---VKISSNDRFRYYQNVCTLGYTSAWWQWE  163



>ref|XP_005950306.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Haplochromis burtoni]
Length=751

 Score = 77.0 bits (188),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 79/143 (55%), Gaps = 16/143 (11%)
 Frame = +3

Query  192  LDSKRP--SNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKSSSGDS  365
            LD  RP  S+  Q  A   +L+RLL    + F   IVS +         V   +S+  + 
Sbjct  28   LDHIRPRASDRAQGRAVTELLRRLLGNRSAEF---IVSVNGSLSNDSLDVCELRSTKNN-  83

Query  366  PQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVM-IQ  542
             +++  G+T + + SG++ YLKY+C  H+SW    G Q++ +P+P  LP ++  GV+ I 
Sbjct  84   -KVVATGSTGVAVASGIYNYLKYFCNCHVSWS---GNQLD-LPRP--LPKLT--GVLRIS  134

Query  543  RPVPWNYYQNVVTSSYSYVWWDW  611
             P  + YYQNV T SYS VWWDW
Sbjct  135  TPHRFRYYQNVCTFSYSSVWWDW  157



>ref|XP_004571517.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Maylandia zebra]
 ref|XP_005752738.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Pundamilia nyererei]
Length=751

 Score = 77.0 bits (188),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 79/143 (55%), Gaps = 16/143 (11%)
 Frame = +3

Query  192  LDSKRP--SNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKSSSGDS  365
            LD  RP  S+  Q  A   +L+RLL    + F   IVS +         V   +S+  + 
Sbjct  28   LDHIRPRASDRAQGRAVTELLRRLLGNRSAEF---IVSINGSLSNDSLDVCELRSTKNN-  83

Query  366  PQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVM-IQ  542
             +++  G+T + + SG++ YLKY+C  H+SW    G Q++ +P+P  LP ++  GV+ I 
Sbjct  84   -KVVATGSTGVAVASGIYNYLKYFCNCHVSWS---GNQLD-LPRP--LPKLT--GVLRIS  134

Query  543  RPVPWNYYQNVVTSSYSYVWWDW  611
             P  + YYQNV T SYS VWWDW
Sbjct  135  TPHRFRYYQNVCTFSYSSVWWDW  157



>ref|XP_005471266.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Oreochromis niloticus]
Length=751

 Score = 77.0 bits (188),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 79/143 (55%), Gaps = 16/143 (11%)
 Frame = +3

Query  192  LDSKRP--SNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKSSSGDS  365
            LD  RP  S+  Q  A   +L+RLL    + F   IVS +         V   +S+  + 
Sbjct  28   LDHIRPRASDRAQGRAVTELLRRLLGNRSAEF---IVSVNGSLSNDSLDVCELRSTKNN-  83

Query  366  PQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVM-IQ  542
             +++  G+T + + SG++ YLKY+C  H+SW    G Q++ +P+P  LP ++  GV+ I 
Sbjct  84   -RVVATGSTGVAVASGIYNYLKYFCNCHVSWS---GNQLD-LPRP--LPKLT--GVLRIS  134

Query  543  RPVPWNYYQNVVTSSYSYVWWDW  611
             P  + YYQNV T SYS VWWDW
Sbjct  135  TPHRFRYYQNVCTFSYSSVWWDW  157



>ref|XP_003698943.1| PREDICTED: LOW QUALITY PROTEIN: alpha-N-acetylglucosaminidase-like 
[Apis florea]
Length=769

 Score = 77.0 bits (188),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 54/144 (38%), Positives = 71/144 (49%), Gaps = 17/144 (12%)
 Frame = +3

Query  192  LDSKRP--SNSVQESAAKGVLQRLL-PTHLSSFELKIVSKDVCGGQSCFRVTNFKSSSGD  362
            LD  RP  S+  Q +AA GV++RLL P    +F + +       G+  F +   K+S G 
Sbjct  31   LDHIRPQISSEEQANAAAGVVERLLGPERAKNFVMMVNPNFTSPGKDTFSIK--KNSVG-  87

Query  363  SPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVMIQ  542
              QI I GT+ +    GLH+YLK +C  HISWE T          P  LP V    V I 
Sbjct  88   --QIEILGTSGVAAAWGLHYYLKTYCNVHISWEGT------KXQLPDTLPDVR---VKIS  136

Query  543  RPVPWNYYQNVVTSSYSYVWWDWQ  614
                + YYQNV T  Y+  WW W+
Sbjct  137  SNDRFRYYQNVCTLGYTSAWWQWE  160



>ref|XP_688608.3| PREDICTED: alpha-N-acetylglucosaminidase [Danio rerio]
Length=757

 Score = 77.0 bits (188),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 52/144 (36%), Positives = 81/144 (56%), Gaps = 15/144 (10%)
 Frame = +3

Query  183  LSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKSSSGD  362
            L+ L +K  S+  Q  A   +L+RLL      F   IVS +         V   +S+  +
Sbjct  28   LAHLRAK-ASDKSQSRAVLDLLRRLLGNRAREF---IVSVNRTLSADGLDVCELRSAKNN  83

Query  363  SPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVM-I  539
              +++  G+T + + +G++ YLKY+C  H+SW    G Q+N +P+P  LP+++  GV+ I
Sbjct  84   --KVVAVGSTGVAVATGIYNYLKYFCNCHVSW---AGDQLN-LPRP--LPALT--GVLRI  133

Query  540  QRPVPWNYYQNVVTSSYSYVWWDW  611
              P  + YYQNV T+SYS VWWDW
Sbjct  134  STPHRFRYYQNVCTASYSSVWWDW  157



>ref|XP_006620136.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Apis dorsata]
Length=771

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 54/152 (36%), Positives = 78/152 (51%), Gaps = 16/152 (11%)
 Frame = +3

Query  162  SEAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCG-GQSCFRVT  338
            S   ++ LS +   R S+  Q +AA GV++RLL T  +   + +V+ +    G+  F + 
Sbjct  26   SNVFQNTLSHI-KPRISSEEQANAAAGVVERLLGTERAKNFVMMVNPNFTSPGKDYFLIK  84

Query  339  NFKSSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSV  518
              K+S G   Q+ I GT+ +  T GLH+YLK +C  H+SWE       N V  P  LP V
Sbjct  85   --KNSMG---QVEILGTSGVATTWGLHYYLKTYCNVHVSWEG------NQVELPDTLPDV  133

Query  519  STEGVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
                V I     + YYQNV T  Y+  WW W+
Sbjct  134  R---VKISSNDRFRYYQNVCTLGYTSAWWQWE  162



>ref|XP_006801729.1| PREDICTED: alpha-N-acetylglucosaminidase-like, partial [Neolamprologus 
brichardi]
Length=542

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 79/143 (55%), Gaps = 16/143 (11%)
 Frame = +3

Query  192  LDSKRP--SNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKSSSGDS  365
            LD  RP  S+  Q  A   +L+RLL    + F   IVS +         V   +S+  + 
Sbjct  28   LDHIRPRASDRAQGRAVTELLRRLLGNRSAEF---IVSVNGSLSNDSLDVCELRSTKNN-  83

Query  366  PQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVM-IQ  542
             +++  G+T + + SG++ YLKY+C  H+SW    G Q++ +P+P  LP ++  GV+ I 
Sbjct  84   -KVVATGSTGVAVASGIYNYLKYFCNCHVSWS---GNQLD-LPRP--LPKLT--GVLRIS  134

Query  543  RPVPWNYYQNVVTSSYSYVWWDW  611
             P  + YYQNV T SYS VWWDW
Sbjct  135  TPHRFRYYQNVCTFSYSSVWWDW  157



>ref|XP_003488083.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Bombus impatiens]
Length=770

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/135 (36%), Positives = 69/135 (51%), Gaps = 13/135 (10%)
 Frame = +3

Query  210  SNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKSSSGDSPQILIQGT  389
            S  VQ  AA+GV +RLL    ++  L +V+ D+  G +       K +S D  Q+ I G+
Sbjct  41   SPEVQAEAARGVAERLLGHERAAKFLMVVNPDL--GPTGLDTFLIKKNSLD--QVEIFGS  96

Query  390  TAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVMIQRPVPWNYYQ  569
            + + +  GLH+YLK +C  HISWE       N +  P  LP V  +     R   + YYQ
Sbjct  97   SGVAVAWGLHYYLKTYCNVHISWEG------NQIELPQTLPDVRVKVTSNDR---FRYYQ  147

Query  570  NVVTSSYSYVWWDWQ  614
            NV T  Y++ WW W 
Sbjct  148  NVCTLGYTFAWWQWD  162



>ref|WP_013992396.1| alpha-N-acetylglucosaminidase [Zobellia galactanivorans]
 ref|YP_004735475.1| alpha-N-acetylglucosaminidase [Zobellia galactanivorans]
 emb|CAZ95084.1| Alpha-N-acetylglucosaminidase, family GH89 [Zobellia galactanivorans]
Length=747

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 68/129 (53%), Gaps = 14/129 (11%)
 Frame = +3

Query  225  ESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKSSSGDSPQILIQGTTAIEI  404
            E +A G+L R+LP   SSF  K ++      +  F V+N     G + +I+I G +A+ +
Sbjct  26   EKSAYGILNRILPERASSFVFKEIT--ASKDKDVFEVSN-----GHAGKIVISGNSAVAM  78

Query  405  TSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVMIQRPVPWNYYQNVVTS  584
             SGL WYLK +C AHIS      +  N +  P  LP ++++ +  + P  + Y  N  T 
Sbjct  79   ASGLDWYLKNYCNAHIS------LNYNQLDLPKTLPRLTSK-IRKETPFDYRYLFNYCTY  131

Query  585  SYSYVWWDW  611
             Y+  WW+W
Sbjct  132  GYTMPWWNW  140



>gb|ELT93213.1| hypothetical protein CAPTEDRAFT_144379, partial [Capitella teleta]
Length=718

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/144 (30%), Positives = 73/144 (51%), Gaps = 15/144 (10%)
 Frame = +3

Query  192  LDSKRPSNSV--QESAAKGVLQRLLPTHLSSFELKI-VSKDVCGGQSCFRVTNFKSSSGD  362
            LD+ R    V  Q  A + +++RL+      FE+ I +  +    +  F++ N  +    
Sbjct  1    LDAIRAEADVDTQAEATRDLIRRLIDDRADEFEVDIQLDFNHADDRDIFKLANIGA----  56

Query  363  SPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVMIQ  542
              ++ I  +T +    G ++YL+ +CG  ++W    G+Q      P +LPS+   G+ I 
Sbjct  57   --KVHITASTGVAAAWGFYYYLREYCGCQVTW---AGVQTEL---PAVLPSLPPTGITIT  108

Query  543  RPVPWNYYQNVVTSSYSYVWWDWQ  614
                + YYQNV T SYS+VWWDW+
Sbjct  109  ANDRFRYYQNVCTVSYSFVWWDWK  132



>ref|XP_004347190.1| AlphaN-acetylglucosaminidase (NAGLU) [Acanthamoeba castellanii 
str. Neff]
 gb|ELR21808.1| AlphaN-acetylglucosaminidase (NAGLU) [Acanthamoeba castellanii 
str. Neff]
Length=800

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 42/128 (33%), Positives = 65/128 (51%), Gaps = 13/128 (10%)
 Frame = +3

Query  228  SAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKSSSGDSPQILIQGTTAIEIT  407
            + A  V+   +  H+ SF+  +V      G   F++    + +G          + + + 
Sbjct  28   TGATSVVDPQVEAHVDSFDFGLVPPQPHSGNDLFQLLPTHTVNG----------SGVALA  77

Query  408  SGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVMIQRPVPWNYYQNVVTSS  587
            SGL+WYLKY+C A ++W + G      +P P  LP V+T  V++  PV W YY NV T S
Sbjct  78   SGLYWYLKYYCNASVTWGENGTGDNLVLPDP--LPQVAT-AVVMNAPVRWRYYLNVCTVS  134

Query  588  YSYVWWDW  611
            YS  WW+W
Sbjct  135  YSSAWWNW  142



>ref|XP_009859446.1| PREDICTED: alpha-N-acetylglucosaminidase [Ciona intestinalis]
Length=896

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 51/151 (34%), Positives = 73/151 (48%), Gaps = 16/151 (11%)
 Frame = +3

Query  159  ESEAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVT  338
            +   IE  LS + S    +  QE+A   +LQR++        + I+             +
Sbjct  20   QKHYIEKSLSPVRSYTAGHE-QETAVAQLLQRVIGERSQDVVVSILPA----------AS  68

Query  339  NFKSSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSV  518
             F + S     + I G+ A+ +    + YLKY+C   ISW    G QI+ +P P  LP V
Sbjct  69   EFATLSYAGKTLKITGSDAVSVAFAFNHYLKYYCRKQISW---AGDQISDIPNP--LPPV  123

Query  519  STEGVMIQRPVPWNYYQNVVTSSYSYVWWDW  611
              EGV I+  V + YYQNV T SYS VWW+W
Sbjct  124  PAEGVTIKAGVKYRYYQNVCTVSYSSVWWNW  154



>ref|XP_008312357.1| PREDICTED: alpha-N-acetylglucosaminidase [Cynoglossus semilaevis]
Length=752

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 75/137 (55%), Gaps = 14/137 (10%)
 Frame = +3

Query  204  RPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKSSSGDSPQILIQ  383
            R S+ VQ  A   +L+RLL    + F    VS +     +   V   +S+  +  ++   
Sbjct  34   RTSDKVQTRAVSELLKRLLGNRSAEF---FVSVNRSLSNNSLEVCELRSTKNN--KVFAS  88

Query  384  GTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVM-IQRPVPWN  560
            G+T + + +G++ YLKY+CG H+SW    G Q++ +P P  LP +S  GV+ I     + 
Sbjct  89   GSTGVAVATGIYNYLKYFCGCHVSW---SGDQLD-LPSP--LPKLS--GVLRISSQHRFR  140

Query  561  YYQNVVTSSYSYVWWDW  611
            YYQNV T SYS VWWDW
Sbjct  141  YYQNVCTFSYSSVWWDW  157



>gb|KHM49101.1| alpha-N-acetylglucosaminidase [Coprobacter sp. 177]
Length=733

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 47/131 (36%), Positives = 72/131 (55%), Gaps = 16/131 (12%)
 Frame = +3

Query  222  QESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKSSSGDSPQILIQGTTAIE  401
            QE A KG+++RLLP+H SSFE++ V K     +  F +     S GD  +I+++GT+ + 
Sbjct  23   QEKAVKGLIERLLPSHSSSFEVRHVEKS---EKDYFEI----ESVGD--KIVLRGTSGVA  73

Query  402  ITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVMIQRPVPWNYYQNVVT  581
            I S L+ YL+ +    I W         ++  PG LP V  + V+ + P  + YY N  T
Sbjct  74   IASALNHYLREYGKCQIDWHS------RNINLPGELPRVEKK-VVKETPYTYRYYFNYCT  126

Query  582  SSYSYVWWDWQ  614
             +YS  WWDW+
Sbjct  127  FNYSMSWWDWE  137



>gb|EDM06080.1| rCG33377, isoform CRA_c [Rattus norvegicus]
Length=239

 Score = 72.0 bits (175),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 47/153 (31%), Positives = 75/153 (49%), Gaps = 31/153 (20%)
 Frame = +3

Query  153  VQESEAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFR  332
             QE+EA+  L+ RL    P+                   L S E  + ++          
Sbjct  24   AQEAEAVRELVVRLLGPGPAADF----------------LVSVERALANES--------G  59

Query  333  VTNFKSSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLP  512
            +  +  S G    +L++G++ +   +GLH YL+ +CG HI+W  +   Q++ +P P  LP
Sbjct  60   LDTYSLSGGGGVPVLVRGSSGVAAAAGLHRYLRDFCGCHIAWSSS---QLH-LPSP--LP  113

Query  513  SVSTEGVMIQRPVPWNYYQNVVTSSYSYVWWDW  611
            +V  +G+    P  + YYQNV T SYS+VWWDW
Sbjct  114  AV-PDGLTEATPNRYRYYQNVCTHSYSFVWWDW  145



>ref|XP_003414528.1| PREDICTED: alpha-N-acetylglucosaminidase [Loxodonta africana]
Length=744

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 47/152 (31%), Positives = 75/152 (49%), Gaps = 30/152 (20%)
 Frame = +3

Query  156  QESEAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRV  335
            +E+ A+++LL+RL   RP+     S  + +                       G   +R+
Sbjct  27   REAAAVQALLARLLGPRPAADFSVSVERSLAAE-------------------SGLDTYRL  67

Query  336  TNFKSSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPS  515
                S  G   ++ + G+T +   +GLH YL+ +CG H++W    G Q+  +P+P  LP+
Sbjct  68   ----SGGGAGARVRVAGSTGVAAAAGLHRYLRDFCGCHVAWS---GSQLR-LPRP--LPA  117

Query  516  VSTEGVMIQRPVPWNYYQNVVTSSYSYVWWDW  611
            V  E +    P  + YYQNV T SYS+VWWDW
Sbjct  118  VPEE-LTEATPNRYRYYQNVCTQSYSFVWWDW  148



>ref|WP_044225091.1| alpha-N-acetylglucosaminidase [Coprobacter sp. 177]
Length=726

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 47/131 (36%), Positives = 72/131 (55%), Gaps = 16/131 (12%)
 Frame = +3

Query  222  QESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKSSSGDSPQILIQGTTAIE  401
            QE A KG+++RLLP+H SSFE++ V K     +  F +     S GD  +I+++GT+ + 
Sbjct  16   QEKAVKGLIERLLPSHSSSFEVRHVEKS---EKDYFEI----ESVGD--KIVLRGTSGVA  66

Query  402  ITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVMIQRPVPWNYYQNVVT  581
            I S L+ YL+ +    I W         ++  PG LP V  + V+ + P  + YY N  T
Sbjct  67   IASALNHYLREYGKCQIDWHS------RNINLPGELPRVEKK-VVKETPYTYRYYFNYCT  119

Query  582  SSYSYVWWDWQ  614
             +YS  WWDW+
Sbjct  120  FNYSMSWWDWE  130



>ref|XP_007955960.1| PREDICTED: alpha-N-acetylglucosaminidase [Orycteropus afer afer]
Length=744

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 36/88 (41%), Positives = 55/88 (63%), Gaps = 7/88 (8%)
 Frame = +3

Query  348  SSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTE  527
            S  G   Q+ + G+T +  ++GLH YL+ +CG H++W  +   Q+  +P+P  LP+V  E
Sbjct  68   SGGGAGAQVRVAGSTGVAASAGLHRYLRDFCGCHVAWSSS---QLR-LPQP--LPAVPEE  121

Query  528  GVMIQRPVPWNYYQNVVTSSYSYVWWDW  611
             + +  P  + YYQNV T SYS+VWWDW
Sbjct  122  -LTVATPNRYRYYQNVCTQSYSFVWWDW  148



>ref|XP_011333453.1| PREDICTED: alpha-N-acetylglucosaminidase isoform X1 [Cerapachys 
biroi]
 gb|EZA57836.1| Alpha-N-acetylglucosaminidase [Cerapachys biroi]
Length=767

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 69/135 (51%), Gaps = 17/135 (13%)
 Frame = +3

Query  216  SVQESAAKGVLQRLLPTHLSSFELKIVSKDVC---GGQSCFRVTNFKSSSGDSPQILIQG  386
             VQ  AA+ V +RLL    +   + IV   V     G+  F++T  K+  G   +I I+G
Sbjct  47   EVQAKAAEDVAKRLLGERTAKLFVMIVDTKVGPTWSGKDSFKIT--KNPLG---KIEIRG  101

Query  387  TTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVMIQRPVPWNYY  566
            TT + IT GL++YLK +C  H+SW+ T       +  P +LP V  +     R   + YY
Sbjct  102  TTGVAITWGLNYYLKNYCNVHVSWDGT------QISLPNVLPDVRVKVTSNDR---FRYY  152

Query  567  QNVVTSSYSYVWWDW  611
            QNV T  YS  WW W
Sbjct  153  QNVCTVGYSSAWWQW  167



>ref|XP_008147571.1| PREDICTED: alpha-N-acetylglucosaminidase [Eptesicus fuscus]
Length=744

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 48/152 (32%), Positives = 76/152 (50%), Gaps = 30/152 (20%)
 Frame = +3

Query  156  QESEAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRV  335
            +E+EA+ +LL+RL    P+ +   S  + +                       G   +R+
Sbjct  27   REAEAVRALLARLLGPGPAAAFSVSVERALAAE-------------------SGLDTYRL  67

Query  336  TNFKSSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPS  515
                S  G   Q+ + G+T +   +GLH YL+ +CG H++W    G Q++ +P+P  LP+
Sbjct  68   ----SGGGAGAQVRVLGSTGVAAAAGLHRYLRDFCGCHVAWS---GSQLH-LPQP--LPA  117

Query  516  VSTEGVMIQRPVPWNYYQNVVTSSYSYVWWDW  611
            V  E +    P  + YYQNV T SYS+VWWDW
Sbjct  118  VPEE-LTEATPNRYRYYQNVCTHSYSFVWWDW  148



>ref|WP_022218286.1| hypothetical protein [Bacteroides clarus CAG:160]
 emb|CDB83839.1| putative uncharacterized protein [Bacteroides clarus CAG:160]
Length=759

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 40/137 (29%), Positives = 76/137 (55%), Gaps = 16/137 (12%)
 Frame = +3

Query  204  RPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKSSSGDSPQILIQ  383
            + +N VQ++   G+++R+ P + S +EL+++ +    G+  + +       G+  +I+++
Sbjct  20   QANNDVQKTVY-GLIERITPGYASQYELELIEQ--TEGKDVYEI------EGNGRKIILR  70

Query  384  GTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVMIQRPVPWNY  563
            G  A+ + S  +WYLKY C AH+SW    G Q+N    P +LP  + +  ++  P  +  
Sbjct  71   GNNAVSLASAFNWYLKYTCNAHVSW---FGNQLN---LPDILPQPADKQRIVIEP-KYRV  123

Query  564  YQNVVTSSYSYVWWDWQ  614
            Y N  T SY+  WW+W+
Sbjct  124  YLNYCTVSYTAAWWNWE  140



>ref|XP_005531528.1| PREDICTED: alpha-N-acetylglucosaminidase [Pseudopodoces humilis]
Length=754

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 43/130 (33%), Positives = 68/130 (52%), Gaps = 10/130 (8%)
 Frame = +3

Query  222  QESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKSSSGDSPQILIQGTTAIE  401
            QE A + + +RLL    ++  L +      GG   +R+    S  G +  + + G++ + 
Sbjct  37   QEEAVRALARRLLGPRAAAVALSVDPALAAGGPDIYRLW---SPPGAAVAVAVTGSSGVA  93

Query  402  ITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVMIQRPVPWNYYQNVVT  581
              +GL+ YL+ +CG H+SW    G Q+  +P P  LP +  E +    P  + YYQNV T
Sbjct  94   AAAGLYRYLRDFCGCHLSWS---GAQLR-LPDP--LPRLRAE-IRAAAPGRYRYYQNVCT  146

Query  582  SSYSYVWWDW  611
             SYS+ WWDW
Sbjct  147  QSYSFAWWDW  156



>gb|ETE58649.1| Alpha-N-acetylglucosaminidase [Ophiophagus hannah]
Length=1435

 Score = 74.7 bits (182),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 50/150 (33%), Positives = 80/150 (53%), Gaps = 17/150 (11%)
 Frame = +3

Query  165  EAIESLLSRLDSKRPSNSVQESAAKGVLQRLL-PTHLSSFELKIVSKDVCGGQSCFRVTN  341
            EA+  L    +  R     Q +A + +L+RLL P   S+F +  V++ + G      +  
Sbjct  706  EAMARLTPEAEEAR-----QATAVRKLLERLLGPRAASAFAVS-VNRSLAGPGG---LDT  756

Query  342  FKSSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVS  521
            ++ SS     I + G++ +   SG++ YLK +CG H+SW    G Q+     P  LP VS
Sbjct  757  YRLSSETPGTINVSGSSGVAAASGIYHYLKDFCGCHVSW---SGTQLRL---PERLPPVS  810

Query  522  TEGVMIQRPVPWNYYQNVVTSSYSYVWWDW  611
             E +++  P  + +YQNV T SYS+VWW+W
Sbjct  811  AE-IIVTSPNRFRFYQNVCTYSYSFVWWNW  839



>ref|XP_008988628.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Callithrix jacchus]
Length=253

 Score = 71.2 bits (173),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 57/93 (61%), Gaps = 7/93 (8%)
 Frame = +3

Query  333  VTNFKSSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLP  512
            +  +  S G + ++ ++G+T +   +GLH YL+ +CG H++W    G Q+  +P+P  LP
Sbjct  60   LDTYSLSGGGAARVRVRGSTGVAAAAGLHRYLRDFCGCHVAWS---GSQLR-LPRP--LP  113

Query  513  SVSTEGVMIQRPVPWNYYQNVVTSSYSYVWWDW  611
            +V  E +    P  + YYQNV T SYS+VWWDW
Sbjct  114  AVPGE-LTEATPNRYRYYQNVCTQSYSFVWWDW  145



>ref|XP_003978574.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Takifugu rubripes]
Length=751

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 50/143 (35%), Positives = 78/143 (55%), Gaps = 16/143 (11%)
 Frame = +3

Query  192  LDSKRPS--NSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKSSSGDS  365
            LD  +PS  +  Q  A  G+L RLL      F   IV+ +         V   +S+  + 
Sbjct  28   LDHIKPSVSDKAQGRAVSGLLTRLLGDRSEEF---IVTVNRSLSNDSLDVCELRSTKNN-  83

Query  366  PQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVM-IQ  542
             +I+  G++ + + SG++ Y+KY+C  H+SW    G Q++ +P+P  LP ++  GV+ I 
Sbjct  84   -KIVASGSSGVAVASGIYNYMKYFCNCHVSW---SGDQLD-LPRP--LPKLT--GVLRIN  134

Query  543  RPVPWNYYQNVVTSSYSYVWWDW  611
             P  + YYQNV T SYS VWW+W
Sbjct  135  TPHRFRYYQNVCTFSYSSVWWNW  157



>ref|XP_006638268.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Lepisosteus oculatus]
Length=769

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 71/135 (53%), Gaps = 12/135 (9%)
 Frame = +3

Query  210  SNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKSSSGDSPQILIQGT  389
            S+  Q  A   +L RL+      F +  V++ +             S+ GD  +I + G+
Sbjct  38   SDDTQARAVGDLLTRLIGQRAGDFIVS-VNRSLAQANGSPDACELWSAKGD--KIAVVGS  94

Query  390  TAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVM-IQRPVPWNYY  566
            T +   +G++ YLKY+C  H+SW    G Q+N VP P  LP ++  GV+ I  P  + YY
Sbjct  95   TGVAAAAGVYTYLKYFCNCHVSWT---GRQLN-VPSP--LPPIT--GVLRISSPHRFRYY  146

Query  567  QNVVTSSYSYVWWDW  611
            QNV T SYS VWWDW
Sbjct  147  QNVCTQSYSMVWWDW  161



>ref|XP_003131436.1| PREDICTED: alpha-N-acetylglucosaminidase [Sus scrofa]
Length=744

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 47/132 (36%), Positives = 72/132 (55%), Gaps = 13/132 (10%)
 Frame = +3

Query  222  QESAAKGVLQRLL-PTHLSSFELKIVSKDVC-GGQSCFRVTNFKSSSGDSPQILIQGTTA  395
            + +A + +L RLL P   +SF + +        G   +R+    S  G   Q+ + G+T 
Sbjct  28   EAAAVRELLARLLGPGPAASFSVSVERALAAESGLDTYRL----SGGGPGAQVRVIGSTG  83

Query  396  IEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVMIQRPVPWNYYQNV  575
            +   +GLH YL+ +CG H++W    G Q+  +P+P  LP+V  E +    P  + YYQNV
Sbjct  84   VAAAAGLHRYLRDFCGCHVAWS---GSQLR-LPQP--LPAVPEE-LTEATPNRYRYYQNV  136

Query  576  VTSSYSYVWWDW  611
             T SYS+VWWDW
Sbjct  137  CTQSYSFVWWDW  148



>ref|WP_029711569.1| hypothetical protein [BRC1 bacterium SCGC AAA257-C11]
Length=740

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 51/151 (34%), Positives = 75/151 (50%), Gaps = 27/151 (18%)
 Frame = +3

Query  159  ESEAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVT  338
            E+E  ES+L             ++AA  VL+RL+P H+  F L+ + +D   G   F + 
Sbjct  32   ETETTESMLP------------QTAAGNVLERLIPQHVHQFVLETIPQD--KGCDVFEI-  76

Query  339  NFKSSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSV  518
                S G   +I+++G+  + I S L+WYLKY C AH+SW    G Q++    P  LP V
Sbjct  77   ---ESRGK--KIVLRGSNGVSICSALNWYLKYHCQAHVSW---NGSQLHL---PESLPVV  125

Query  519  STEGVMIQRPVPWNYYQNVVTSSYSYVWWDW  611
              E +    P  + Y+ N     YS  WWDW
Sbjct  126  K-EKIRRVSPHKYRYFFNYCCFGYSLAWWDW  155



>ref|XP_004655806.1| PREDICTED: alpha-N-acetylglucosaminidase [Jaculus jaculus]
Length=744

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/145 (31%), Positives = 80/145 (55%), Gaps = 11/145 (8%)
 Frame = +3

Query  180  LLSRLDSKRPSNSVQESAAKGVLQRLL-PTHLSSFELKIVSKDVCGGQSCFRVTNFKSSS  356
            LL+ + +     + +E+A + ++ RLL P   ++F + +  +     +S     +     
Sbjct  14   LLAWVGASAGDEAREEAAVRALVARLLGPGPAANFSVSV--ERALAAESGLDTYSLSGGG  71

Query  357  GDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVM  536
            G +P + ++G+T +   +GLH YL+ +CG  ++W    G Q++ +P+P  LP+V  E + 
Sbjct  72   GGAP-VRVRGSTGVAAAAGLHRYLRDFCGCQVAWS---GSQLH-LPRP--LPAVPGE-LT  123

Query  537  IQRPVPWNYYQNVVTSSYSYVWWDW  611
               P  + YYQNV T SYS+VWWDW
Sbjct  124  EATPNRYRYYQNVCTHSYSFVWWDW  148



>ref|XP_006924662.1| PREDICTED: alpha-N-acetylglucosaminidase [Pteropus alecto]
 gb|ELK01481.1| Alpha-N-acetylglucosaminidase [Pteropus alecto]
Length=740

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 47/152 (31%), Positives = 75/152 (49%), Gaps = 30/152 (20%)
 Frame = +3

Query  156  QESEAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRV  335
            +E+EA+ +LL+RL    P+ +   S  + +                       G   +R+
Sbjct  23   REAEAVRALLARLLGPGPAAAFSVSVERALAAE-------------------SGLDTYRL  63

Query  336  TNFKSSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPS  515
                S  G   ++ + G+T +   +GLH YL+ +CG H++W    G Q+  +P+P  LP+
Sbjct  64   ----SGGGAGARVQVLGSTGVAAAAGLHRYLRDFCGCHVAWS---GSQLR-LPQP--LPA  113

Query  516  VSTEGVMIQRPVPWNYYQNVVTSSYSYVWWDW  611
            V  E +    P  + YYQNV T SYS+VWWDW
Sbjct  114  VPEE-LTEATPNRYRYYQNVCTQSYSFVWWDW  144



>ref|XP_011379506.1| PREDICTED: alpha-N-acetylglucosaminidase [Pteropus vampyrus]
Length=740

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 47/152 (31%), Positives = 75/152 (49%), Gaps = 30/152 (20%)
 Frame = +3

Query  156  QESEAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRV  335
            +E+EA+ +LL+RL    P+ +   S  + +                       G   +R+
Sbjct  23   REAEAVRALLARLLGPGPAAAFSVSVERALAAE-------------------SGLDTYRL  63

Query  336  TNFKSSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPS  515
                S  G   ++ + G+T +   +GLH YL+ +CG H++W    G Q+  +P+P  LP+
Sbjct  64   ----SGGGAGTRVQVLGSTGVAAAAGLHRYLRDFCGCHVAWS---GSQLR-LPQP--LPA  113

Query  516  VSTEGVMIQRPVPWNYYQNVVTSSYSYVWWDW  611
            V  E +    P  + YYQNV T SYS+VWWDW
Sbjct  114  VPEE-LTEATPNRYRYYQNVCTQSYSFVWWDW  144



>ref|XP_003786703.1| PREDICTED: alpha-N-acetylglucosaminidase [Otolemur garnettii]
Length=756

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 46/152 (30%), Positives = 76/152 (50%), Gaps = 31/152 (20%)
 Frame = +3

Query  156  QESEAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRV  335
            +E+EA+ +L++RL    P+     S  + +      + L ++ L                
Sbjct  27   REAEAVRALVARLLGPGPAADFSVSVERALAAE---SGLDTYSL----------------  67

Query  336  TNFKSSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPS  515
                 S G   ++ ++G+T +   +GLH YL+ +CG H++W    G Q+  +P+P  LP+
Sbjct  68   -----SGGGGARVRVRGSTGVAAAAGLHRYLRDFCGCHVAWS---GSQLR-LPRP--LPA  116

Query  516  VSTEGVMIQRPVPWNYYQNVVTSSYSYVWWDW  611
            V  E +    P  + YYQNV T SYS+VWWDW
Sbjct  117  VPEE-LTEATPNRYRYYQNVCTQSYSFVWWDW  147



>ref|XP_007535086.1| PREDICTED: alpha-N-acetylglucosaminidase [Erinaceus europaeus]
Length=744

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 49/136 (36%), Positives = 77/136 (57%), Gaps = 14/136 (10%)
 Frame = +3

Query  213  NSVQES-AAKGVLQRLL-PTHLSSFELKIV-SKDVCGGQSCFRVTNFKSSSGDSPQILIQ  383
            N V+E+ A + +L RLL P   +SF + +  +     G   +R+    S  G   ++ + 
Sbjct  24   NEVRETEAVRELLARLLGPELAASFSVWVKRALAAASGLDTYRL----SGGGAGARVQVL  79

Query  384  GTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVMIQRPVPWNY  563
            G+T +   +GLH YL+ +CG H++W    G Q++ +P+P  LP+V  E +    P  + Y
Sbjct  80   GSTGVAAAAGLHRYLRDFCGCHVAWS---GSQLH-LPQP--LPAVPGE-LTETTPNRYRY  132

Query  564  YQNVVTSSYSYVWWDW  611
            YQNV T SYS+VWWDW
Sbjct  133  YQNVCTQSYSFVWWDW  148



>ref|XP_001081442.1| PREDICTED: alpha-N-acetylglucosaminidase [Rattus norvegicus]
 ref|XP_002727861.2| PREDICTED: alpha-N-acetylglucosaminidase [Rattus norvegicus]
 gb|EDM06079.1| rCG33377, isoform CRA_b [Rattus norvegicus]
Length=739

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 36/90 (40%), Positives = 56/90 (62%), Gaps = 7/90 (8%)
 Frame = +3

Query  342  FKSSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVS  521
            +  S G    +L++G++ +   +GLH YL+ +CG HI+W  +   Q++ +P P  LP+V 
Sbjct  63   YSLSGGGGVPVLVRGSSGVAAAAGLHRYLRDFCGCHIAWSSS---QLH-LPSP--LPAVP  116

Query  522  TEGVMIQRPVPWNYYQNVVTSSYSYVWWDW  611
             +G+    P  + YYQNV T SYS+VWWDW
Sbjct  117  -DGLTEATPNRYRYYQNVCTHSYSFVWWDW  145



>gb|KFH63695.1| hypothetical protein MVEG_10388 [Mortierella verticillata NRRL 
6337]
Length=968

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/142 (35%), Positives = 74/142 (52%), Gaps = 13/142 (9%)
 Frame = +3

Query  216  SVQESAAKGVLQRLLPTHLSS---FELK--IVSKDVCGGQSCFRVTNFKSSSGDSPQILI  380
             + E     +++RLLP    +   F+L+  +V          FR++N  SS GD  +IL+
Sbjct  76   DLSEQPLYDLIERLLPQAYHAHFVFQLQPGLVLSSATNIHDTFRISN--SSDGD--KILV  131

Query  381  QGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPK--PGLLPSVSTEGVMIQRP--  548
            QG T   + +GL++YLKY C   +SW        N +P   P +  +V+T+   I R   
Sbjct  132  QGATLSGLGAGLNYYLKYVCKVEMSWSGDRFSGTNGIPAVPPLITANVTTDPAGITRASF  191

Query  549  VPWNYYQNVVTSSYSYVWWDWQ  614
            VP+ YY NVVT  YS  +WDW+
Sbjct  192  VPFRYYMNVVTFGYSSAFWDWE  213



>ref|XP_004209763.1| PREDICTED: alpha-N-acetylglucosaminidase-like, partial [Hydra 
vulgaris]
Length=220

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/138 (34%), Positives = 71/138 (51%), Gaps = 15/138 (11%)
 Frame = +3

Query  204  RPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKSSSGDSPQILIQ  383
            + S S Q+ +   +++RL+P H S F + I    V    + +    F+  S  +  I + 
Sbjct  43   KSSPSEQKESVIQLIKRLVPAHASKFIISINKNYVDSEFADY----FEIVSTTNGNIKVT  98

Query  384  GTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVST--EGVMIQRPVPW  557
            G+T +   +G + YLKYWC AHISW        N +  P  LP V +  + V  +R   +
Sbjct  99   GSTGVAAAAGFYHYLKYWCFAHISWSG------NHLNIPINLPLVHSPVKKVFYER---F  149

Query  558  NYYQNVVTSSYSYVWWDW  611
             YYQNV T SYS V+W+W
Sbjct  150  RYYQNVCTVSYSMVFWNW  167



>ref|XP_002605948.1| hypothetical protein BRAFLDRAFT_132235 [Branchiostoma floridae]
 gb|EEN61958.1| hypothetical protein BRAFLDRAFT_132235 [Branchiostoma floridae]
Length=673

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 67/134 (50%), Gaps = 13/134 (10%)
 Frame = +3

Query  210  SNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKSSSGDSPQILIQGT  389
             ++ Q+   + ++ R +    S F + + S  +  G+  F++    S      +I+I+GT
Sbjct  191  DDATQQQTVEDMIFRTVGDRFSDFSVVVDSSFLPMGKEAFQLDTVGS------KIVIRGT  244

Query  390  TAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVMIQRPVPWNYYQ  569
            T +    G + YLKY+    +SW       +  V  PG+LP V T  V I     + YYQ
Sbjct  245  TGVAAAHGFNHYLKYYARCQVSWT------VQQVHLPGVLPPV-TPAVTIVTVNRYRYYQ  297

Query  570  NVVTSSYSYVWWDW  611
            NV T SYS+VWWDW
Sbjct  298  NVCTVSYSFVWWDW  311



>ref|XP_004859890.1| PREDICTED: alpha-N-acetylglucosaminidase [Heterocephalus glaber]
Length=748

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 35/86 (41%), Positives = 54/86 (63%), Gaps = 7/86 (8%)
 Frame = +3

Query  354  SGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGV  533
            SG   ++ ++G++ +   +GLH YL+ +CG H++W    G Q+  +P+P  LP+V  E +
Sbjct  74   SGGGARVRVRGSSGVAAAAGLHRYLRDFCGCHVAWS---GAQLR-LPRP--LPAVPGE-L  126

Query  534  MIQRPVPWNYYQNVVTSSYSYVWWDW  611
                P  + YYQNV T SYS+VWWDW
Sbjct  127  TEASPYRYRYYQNVCTHSYSFVWWDW  152



>ref|XP_010899528.1| PREDICTED: alpha-N-acetylglucosaminidase [Esox lucius]
Length=755

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 72/135 (53%), Gaps = 14/135 (10%)
 Frame = +3

Query  210  SNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKSSSGDSPQILIQGT  389
            ++  Q  A   +L+RLL      F   IVS +             +S+  +  +I+  G+
Sbjct  35   NDKTQGRAVVELLKRLLGNRSREF---IVSVNRTLSNDSLEACELRSAKNN--KIIATGS  89

Query  390  TAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVM-IQRPVPWNYY  566
            T + + SG++ YLKY+C  HISW    G Q+N +P+P  LP ++  GV+ I     + YY
Sbjct  90   TGVAVASGIYNYLKYFCNCHISW---SGNQLN-IPRP--LPQLT--GVLRISTQHRFRYY  141

Query  567  QNVVTSSYSYVWWDW  611
            QNV T SYS VWWDW
Sbjct  142  QNVCTQSYSTVWWDW  156



>ref|XP_010980090.1| PREDICTED: alpha-N-acetylglucosaminidase [Camelus dromedarius]
Length=744

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 45/132 (34%), Positives = 72/132 (55%), Gaps = 13/132 (10%)
 Frame = +3

Query  222  QESAAKGVLQRLL-PTHLSSFELKIVSKDVC-GGQSCFRVTNFKSSSGDSPQILIQGTTA  395
            + +A + +L RLL P   ++F + +        G   +R+    S  G   Q+ + G+T 
Sbjct  28   EAAAVRELLARLLGPGPAAAFSVSVERALAAESGLDTYRL----SGGGAGAQVRVLGSTG  83

Query  396  IEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVMIQRPVPWNYYQNV  575
            +   +GLH YL+ +CG H++W  +   Q+  +P+P  LP+V  E +    P  + YYQNV
Sbjct  84   VAAAAGLHRYLRDFCGCHVAWSSS---QLR-LPQP--LPAVPEE-LTEATPNRYRYYQNV  136

Query  576  VTSSYSYVWWDW  611
             T SYS+VWWDW
Sbjct  137  CTQSYSFVWWDW  148



>ref|XP_004685005.1| PREDICTED: alpha-N-acetylglucosaminidase [Condylura cristata]
Length=746

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 36/88 (41%), Positives = 54/88 (61%), Gaps = 7/88 (8%)
 Frame = +3

Query  348  SSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTE  527
            S  G   ++ ++G+T +   +GLH YL+ +CG H++W    G Q+  +P+P  LP+V  E
Sbjct  70   SGGGAGARVQVRGSTGVAAAAGLHRYLRDFCGCHVAWS---GSQLR-LPRP--LPAVPEE  123

Query  528  GVMIQRPVPWNYYQNVVTSSYSYVWWDW  611
             +    P  + YYQNV T SYS+VWWDW
Sbjct  124  -LTEATPNRYRYYQNVCTQSYSFVWWDW  150



>ref|XP_548088.2| PREDICTED: alpha-N-acetylglucosaminidase [Canis lupus familiaris]
Length=747

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 37/89 (42%), Positives = 53/89 (60%), Gaps = 9/89 (10%)
 Frame = +3

Query  348  SSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKP-GLLPSVST  524
            S  G   ++L+ G+T +   +GLH YL+ +CG H++W    G Q+  +P+P   +P V T
Sbjct  68   SGGGAGTRVLVLGSTGVAAAAGLHRYLRDFCGCHVAWS---GSQLR-LPEPLPAVPQVLT  123

Query  525  EGVMIQRPVPWNYYQNVVTSSYSYVWWDW  611
            E      P  + YYQNV T SYS+VWWDW
Sbjct  124  EAT----PNRYRYYQNVCTHSYSFVWWDW  148



>gb|ERL93790.1| hypothetical protein D910_11076 [Dendroctonus ponderosae]
Length=789

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 50/154 (32%), Positives = 81/154 (53%), Gaps = 16/154 (10%)
 Frame = +3

Query  153  VQESEAIESLLSRLDSKRPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFR  332
            V E    ++ L  L ++  S+ VQ+ A + +++R+LP     F   + S     G+  F+
Sbjct  19   VAEFYKFQNTLGHLKAQTSSD-VQQIAVENLIKRILPDRGGEFTAVVNSSFNLNGKEAFK  77

Query  333  VTNFKSSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLP  512
            ++  +       +I I GTT + + +G ++YLKY+C AHISWE      ++ +  P  LP
Sbjct  78   ISKVEG------KIAITGTTGVTVATGFNYYLKYYCSAHISWE------LSQLQLPKELP  125

Query  513  SVSTEGVMIQRPVPWNYYQNVVTSSYSYVWWDWQ  614
                  V I     + YYQNV T+SYS+VWW W+
Sbjct  126  EAD---VSIALNDQFRYYQNVCTTSYSFVWWTWE  156



>ref|XP_005111892.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Aplysia californica]
Length=792

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 47/136 (35%), Positives = 71/136 (52%), Gaps = 12/136 (9%)
 Frame = +3

Query  204  RPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKSSSGDSPQILIQ  383
            + S  VQ  AA  V+ RL+    S FE++ V ++V           FK SS +  +ILI+
Sbjct  32   KTSAQVQREAALDVIGRLVRDRASDFEVR-VDQNVGPKDK----DTFKLSSIEGGRILIE  86

Query  384  GTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVMIQRPVPWNY  563
            GT+ + ++ G + YLKYWC A  +W    G Q      P  LP +  + V++     + Y
Sbjct  87   GTSGVAVSMGFYHYLKYWCNAQRTW---AGQQTE---LPATLPLLD-KPVVVTTHDKFRY  139

Query  564  YQNVVTSSYSYVWWDW  611
            Y+NV T SYS+ +W W
Sbjct  140  YKNVCTESYSFAFWQW  155



>emb|CDQ63621.1| unnamed protein product [Oncorhynchus mykiss]
Length=751

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 48/135 (36%), Positives = 73/135 (54%), Gaps = 14/135 (10%)
 Frame = +3

Query  210  SNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKSSSGDSPQILIQGT  389
            ++  Q  A   +L+RLL      F   IVS +         V   +S+  +  +I+  G+
Sbjct  35   NDKTQGRAVVELLRRLLGNRSREF---IVSVNRTLSNDNLEVCELRSAKNN--KIIATGS  89

Query  390  TAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVM-IQRPVPWNYY  566
            T + + SG++ YLKY+C  H+SW    G Q+N +P+P  LP ++  GV+ I     + YY
Sbjct  90   TGVAVASGIYNYLKYFCNCHVSW---SGNQLN-IPRP--LPQLT--GVLRISTQHRFRYY  141

Query  567  QNVVTSSYSYVWWDW  611
            QNV T SYS +WWDW
Sbjct  142  QNVCTQSYSTLWWDW  156



>gb|KFB50231.1| AGAP011750-PA-like protein [Anopheles sinensis]
Length=776

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 75/137 (55%), Gaps = 16/137 (12%)
 Frame = +3

Query  204  RPSNSVQESAAKGVLQRLLPTHLSS-FELKIVSKDVCGGQSCFRVTNFKSSSGDSPQILI  380
            R S   Q+ AA  V+ RL+    +  F + +   D    ++ F++  FK S+GD P + I
Sbjct  43   RSSEETQQQAALEVIGRLISEEQAKQFHVNV---DSTTERNSFQI--FKESAGDQP-VEI  96

Query  381  QGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVMIQRPVPWN  560
            + ++ I  T   + YLKY+CG  ++WE   G Q+  +PKP  LP+++   V I  P    
Sbjct  97   RASSGIAATKAFYHYLKYFCGCLVAWE---GSQLQ-LPKP--LPAIN---VSIIAPSSIV  147

Query  561  YYQNVVTSSYSYVWWDW  611
            YYQNV T SYS+ WW W
Sbjct  148  YYQNVCTWSYSFTWWRW  164



>ref|XP_003279518.1| PREDICTED: LOW QUALITY PROTEIN: alpha-N-acetylglucosaminidase 
[Nomascus leucogenys]
Length=736

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 35/85 (41%), Positives = 54/85 (64%), Gaps = 7/85 (8%)
 Frame = +3

Query  357  GDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVM  536
            G + ++ ++G+T +   +GLH YL+ +CG H++W    G Q+  +P+P  LP+V  E + 
Sbjct  70   GGAARVRVRGSTGVAAAAGLHRYLRDFCGCHVAWS---GSQLR-LPRP--LPAVPGE-LT  122

Query  537  IQRPVPWNYYQNVVTSSYSYVWWDW  611
               P  + YYQNV T SYS+VWWDW
Sbjct  123  EATPNRYRYYQNVCTQSYSFVWWDW  147



>ref|XP_002719212.1| PREDICTED: alpha-N-acetylglucosaminidase [Oryctolagus cuniculus]
Length=743

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 35/90 (39%), Positives = 56/90 (62%), Gaps = 7/90 (8%)
 Frame = +3

Query  342  FKSSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVS  521
            +  S G + ++ ++G++ +   +GLH YL+ +CG H++W    G Q++ +P P  LP+V 
Sbjct  65   YSLSGGGAARVRVRGSSGVAAAAGLHRYLRDFCGCHVAWS---GSQLH-LPHP--LPAVP  118

Query  522  TEGVMIQRPVPWNYYQNVVTSSYSYVWWDW  611
             E +    P  + YYQNV T SYS+VWWDW
Sbjct  119  EE-LTEATPHRYRYYQNVCTQSYSFVWWDW  147



>ref|XP_004472516.1| PREDICTED: LOW QUALITY PROTEIN: alpha-N-acetylglucosaminidase 
[Dasypus novemcinctus]
Length=744

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 36/88 (41%), Positives = 53/88 (60%), Gaps = 7/88 (8%)
 Frame = +3

Query  348  SSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTE  527
            S  G   ++ + G+T +   +GLH YL+ +CG H++W    G Q+  +P+P  LP+V  E
Sbjct  68   SGGGAGTRVRVAGSTGVAAAAGLHRYLRDFCGGHVAWS---GAQLR-LPQP--LPAVPGE  121

Query  528  GVMIQRPVPWNYYQNVVTSSYSYVWWDW  611
             +    P  + YYQNV T SYS+VWWDW
Sbjct  122  -LTEATPSRYRYYQNVCTQSYSFVWWDW  148



>ref|XP_001606979.1| PREDICTED: alpha-N-acetylglucosaminidase [Nasonia vitripennis]
Length=755

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 47/147 (32%), Positives = 72/147 (49%), Gaps = 16/147 (11%)
 Frame = +3

Query  177  SLLSRLDSKRPSNS--VQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKS  350
            S  + L    P NS  VQ SA + ++ R+L      F++ +       G+  F +   K 
Sbjct  32   SFQNTLGHLHPENSAEVQTSAVENLVVRVLGKDADLFKVTLDPDLGPKGKDTFNLKKLKD  91

Query  351  SSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEG  530
            +     +++I GT+ + +  GLH+YL  +C  H+SWE   G Q+N    P +LP V+   
Sbjct  92   N-----KVIITGTSGVAVAWGLHYYLTTYCNCHVSWE---GSQLNL---PKILPDVNETV  140

Query  531  VMIQRPVPWNYYQNVVTSSYSYVWWDW  611
                R   + YYQNV T+ YS  WW W
Sbjct  141  SSNDR---FRYYQNVCTAGYSSAWWKW  164



>ref|XP_007102204.1| PREDICTED: alpha-N-acetylglucosaminidase [Physeter catodon]
Length=744

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 46/134 (34%), Positives = 75/134 (56%), Gaps = 17/134 (13%)
 Frame = +3

Query  222  QESAAKGVLQRLL-PTHLSSFELKI---VSKDVCGGQSCFRVTNFKSSSGDSPQILIQGT  389
            + +A + +L RLL P   ++F + +   ++ D   G   +R+    S  G   ++ + G+
Sbjct  28   EAAAVRELLARLLGPGPAAAFSVSVERALAAD--SGLDTYRL----SGGGVGARVQVLGS  81

Query  390  TAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVMIQRPVPWNYYQ  569
            T +   +GLH YL+ +CG H++W    G Q+  +P+P  LP+V  E +    P  + YYQ
Sbjct  82   TGVAAAAGLHRYLRDFCGCHVAWS---GSQLR-LPQP--LPAVPEE-LTEATPNRYRYYQ  134

Query  570  NVVTSSYSYVWWDW  611
            NV T SYS+VWWDW
Sbjct  135  NVCTQSYSFVWWDW  148



>ref|WP_010802636.1| MULTISPECIES: hypothetical protein [Parabacteroides]
 gb|EMZ31117.1| hypothetical protein C825_04002 [Parabacteroides sp. ASF519]
 gb|EOS19442.1| hypothetical protein C803_00121 [Parabacteroides goldsteinii 
dnLKV18]
Length=739

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 74/133 (56%), Gaps = 21/133 (16%)
 Frame = +3

Query  225  ESAAKGVLQRLLPTHLSSFELKIVS-KDVCGGQSCFRVTNFKSSSGDSPQILIQGTTAIE  401
              A++ +++R++P   SSF++++   KD   G+ CF +     S G+  +I+++G   + 
Sbjct  24   RKASEALIKRVIPEKASSFKVEMFQPKD---GKDCFEI----ESKGN--KIILRGNNGVS  74

Query  402  ITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVMIQRPVPWNY--YQNV  575
            + S L+ YLKY+C AHISW    G  +N    P  LP V  +   I RP  +++  Y N 
Sbjct  75   VASALYHYLKYYCNAHISW---NGDNLNL---PSRLPEVPKK---ITRPTAFDHRVYLNY  125

Query  576  VTSSYSYVWWDWQ  614
             T SY+  WW+W+
Sbjct  126  CTISYTMAWWNWE  138



>ref|XP_004342501.1| AlphaN-acetylglucosaminidase, putative, partial [Acanthamoeba 
castellanii str. Neff]
 gb|ELR20307.1| AlphaN-acetylglucosaminidase, putative, partial [Acanthamoeba 
castellanii str. Neff]
Length=389

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 47/154 (31%), Positives = 76/154 (49%), Gaps = 9/154 (6%)
 Frame = +3

Query  168  AIESLLSRLDSKRPSN--SVQESAAKGVLQRLL-PTHLSSFELKIV---SKDVCGGQSCF  329
            ++E + SR   ++ +    VQ  A +G++ RLL  +++  F+L I     +D        
Sbjct  41   SVEGVASRFPMRKSTTPPEVQVQAVQGLIGRLLGASYVPRFQLSISPTPQEDESSTSDHD  100

Query  330  RVTNFKSSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLL  509
              T   ++ G   Q+ IQG++ + + SGLHWYLKY C   +SW   G     +       
Sbjct  101  FYTLSTTTVGGVTQVQIQGSSGVALASGLHWYLKYSCNCSVSWGVAGS---GNNLALPSS  157

Query  510  PSVSTEGVMIQRPVPWNYYQNVVTSSYSYVWWDW  611
              + ++ + +Q PV + YY N  T SYS VWW W
Sbjct  158  LPLLSKPLTMQSPVKYRYYLNTCTHSYSSVWWQW  191



>ref|XP_004772740.1| PREDICTED: alpha-N-acetylglucosaminidase isoform X2 [Mustela 
putorius furo]
Length=743

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 44/131 (34%), Positives = 72/131 (55%), Gaps = 12/131 (9%)
 Frame = +3

Query  222  QESAAKGVLQRLL-PTHLSSFELKIVSKDVCGGQSCFRVTNFKSSSGDSPQILIQGTTAI  398
            + +A + +L RLL P   ++F +  V + +        +  ++ S G    + + G+T +
Sbjct  28   EAAAVRELLARLLGPGPAAAFSVS-VQRSLAAESG---LDTYRLSGGAGAPVRVLGSTGV  83

Query  399  EITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVMIQRPVPWNYYQNVV  578
               +GLH YL+ +CG H++W    G Q+  +P+P  LP+V  E +    P  + YYQNV 
Sbjct  84   AAAAGLHRYLRDFCGCHVAWS---GSQLR-LPEP--LPAVPEE-LTEATPNRYRYYQNVC  136

Query  579  TSSYSYVWWDW  611
            T SYS+VWWDW
Sbjct  137  THSYSFVWWDW  147



>ref|XP_002827555.2| PREDICTED: alpha-N-acetylglucosaminidase [Pongo abelii]
Length=743

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 35/85 (41%), Positives = 54/85 (64%), Gaps = 7/85 (8%)
 Frame = +3

Query  357  GDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVM  536
            G + ++ ++G+T +   +GLH YL+ +CG H++W    G Q+  +P+P  LP+V  E + 
Sbjct  70   GGAARVRVRGSTGVAAAAGLHRYLRDFCGCHVAWS---GSQLR-LPRP--LPAVPGE-LT  122

Query  537  IQRPVPWNYYQNVVTSSYSYVWWDW  611
               P  + YYQNV T SYS+VWWDW
Sbjct  123  EATPNRYRYYQNVCTQSYSFVWWDW  147



>ref|NP_000254.2| alpha-N-acetylglucosaminidase precursor [Homo sapiens]
 sp|P54802.2|ANAG_HUMAN RecName: Full=Alpha-N-acetylglucosaminidase; AltName: Full=N-acetyl-alpha-glucosaminidase; 
Short=NAG; Contains: RecName: 
Full=Alpha-N-acetylglucosaminidase 82 kDa form; Contains: RecName: 
Full=Alpha-N-acetylglucosaminidase 77 kDa form; Flags: 
Precursor [Homo sapiens]
Length=743

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 35/85 (41%), Positives = 54/85 (64%), Gaps = 7/85 (8%)
 Frame = +3

Query  357  GDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVM  536
            G + ++ ++G+T +   +GLH YL+ +CG H++W    G Q+  +P+P  LP+V  E + 
Sbjct  70   GGAARVRVRGSTGVAAAAGLHRYLRDFCGCHVAWS---GSQLR-LPRP--LPAVPGE-LT  122

Query  537  IQRPVPWNYYQNVVTSSYSYVWWDW  611
               P  + YYQNV T SYS+VWWDW
Sbjct  123  EATPNRYRYYQNVCTQSYSFVWWDW  147



>ref|XP_523654.2| PREDICTED: alpha-N-acetylglucosaminidase [Pan troglodytes]
Length=743

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 35/85 (41%), Positives = 54/85 (64%), Gaps = 7/85 (8%)
 Frame = +3

Query  357  GDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVM  536
            G + ++ ++G+T +   +GLH YL+ +CG H++W    G Q+  +P+P  LP+V  E + 
Sbjct  70   GGAARVRVRGSTGVAAAAGLHRYLRDFCGCHVAWS---GSQLR-LPRP--LPAVPGE-LT  122

Query  537  IQRPVPWNYYQNVVTSSYSYVWWDW  611
               P  + YYQNV T SYS+VWWDW
Sbjct  123  EATPNRYRYYQNVCTQSYSFVWWDW  147



>ref|XP_004410599.1| PREDICTED: alpha-N-acetylglucosaminidase [Odobenus rosmarus divergens]
Length=744

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 36/88 (41%), Positives = 53/88 (60%), Gaps = 7/88 (8%)
 Frame = +3

Query  348  SSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTE  527
            S  G   ++ + G+T +   +GLH YL+ +CG H++W    G Q+  +P+P  LP+V  E
Sbjct  68   SGGGAGARVRVLGSTGVAAAAGLHRYLRDFCGCHVAWS---GSQLR-LPEP--LPAVQEE  121

Query  528  GVMIQRPVPWNYYQNVVTSSYSYVWWDW  611
             +    P  + YYQNV T SYS+VWWDW
Sbjct  122  -LTETTPNRYRYYQNVCTHSYSFVWWDW  148



>ref|XP_010384417.1| PREDICTED: alpha-N-acetylglucosaminidase [Rhinopithecus roxellana]
Length=743

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 35/85 (41%), Positives = 54/85 (64%), Gaps = 7/85 (8%)
 Frame = +3

Query  357  GDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVM  536
            G + ++ ++G+T +   +GLH YL+ +CG H++W    G Q+  +P+P  LP+V  E + 
Sbjct  70   GGAARVRVRGSTGVAAAAGLHRYLRDFCGCHVAWS---GSQLR-LPRP--LPAVPGE-LT  122

Query  537  IQRPVPWNYYQNVVTSSYSYVWWDW  611
               P  + YYQNV T SYS+VWWDW
Sbjct  123  EATPNRYRYYQNVCTQSYSFVWWDW  147



>gb|AAC50512.1| alpha-N-acetylglucosaminidase [Homo sapiens]
 gb|AAC50513.1| alpha-N-acetylglucosaminidase [Homo sapiens]
 gb|AAB06188.1| alpha-N-acetylglucosaminidase [Homo sapiens]
 gb|AAB36604.1| alpha-N-acetylglucosaminidase [Homo sapiens]
 gb|AAH53991.1| N-acetylglucosaminidase, alpha- [Homo sapiens]
 gb|EAW60833.1| N-acetylglucosaminidase, alpha- (Sanfilippo disease IIIB), isoform 
CRA_b [Homo sapiens]
Length=743

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 35/85 (41%), Positives = 54/85 (64%), Gaps = 7/85 (8%)
 Frame = +3

Query  357  GDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVM  536
            G + ++ ++G+T +   +GLH YL+ +CG H++W    G Q+  +P+P  LP+V  E + 
Sbjct  70   GGAARVRVRGSTGVAAAAGLHRYLRDFCGCHVAWS---GSQLR-LPRP--LPAVPGE-LT  122

Query  537  IQRPVPWNYYQNVVTSSYSYVWWDW  611
               P  + YYQNV T SYS+VWWDW
Sbjct  123  EATPNRYRYYQNVCTQSYSFVWWDW  147



>ref|XP_005584302.1| PREDICTED: alpha-N-acetylglucosaminidase [Macaca fascicularis]
Length=743

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 35/85 (41%), Positives = 54/85 (64%), Gaps = 7/85 (8%)
 Frame = +3

Query  357  GDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVM  536
            G + ++ ++G+T +   +GLH YL+ +CG H++W    G Q+  +P+P  LP+V  E + 
Sbjct  70   GGAARVRVRGSTGVAAAAGLHRYLRDFCGCHVAWS---GSQLR-LPRP--LPAVPGE-LT  122

Query  537  IQRPVPWNYYQNVVTSSYSYVWWDW  611
               P  + YYQNV T SYS+VWWDW
Sbjct  123  EATPNRYRYYQNVCTQSYSFVWWDW  147



>ref|XP_007449909.1| PREDICTED: alpha-N-acetylglucosaminidase [Lipotes vexillifer]
Length=744

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 37/88 (42%), Positives = 52/88 (59%), Gaps = 7/88 (8%)
 Frame = +3

Query  348  SSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTE  527
            S  G   Q+ + G+T +   +GLH YL+ +CG H++W    G Q+  +P+P  LP V  E
Sbjct  68   SGGGVGAQVRVLGSTGVAAAAGLHRYLRDFCGCHVAWS---GSQLR-LPQP--LPVVPEE  121

Query  528  GVMIQRPVPWNYYQNVVTSSYSYVWWDW  611
             +    P  + YYQNV T SYS+VWWDW
Sbjct  122  -LTEATPNRYRYYQNVCTQSYSFVWWDW  148



>ref|XP_004041658.1| PREDICTED: alpha-N-acetylglucosaminidase [Gorilla gorilla gorilla]
Length=743

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 35/85 (41%), Positives = 54/85 (64%), Gaps = 7/85 (8%)
 Frame = +3

Query  357  GDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVM  536
            G + ++ ++G+T +   +GLH YL+ +CG H++W    G Q+  +P+P  LP+V  E + 
Sbjct  70   GGAARVRVRGSTGVAAAAGLHRYLRDFCGCHVAWS---GSQLR-LPRP--LPAVPGE-LT  122

Query  537  IQRPVPWNYYQNVVTSSYSYVWWDW  611
               P  + YYQNV T SYS+VWWDW
Sbjct  123  EATPNRYRYYQNVCTQSYSFVWWDW  147



>ref|XP_003913130.1| PREDICTED: alpha-N-acetylglucosaminidase [Papio anubis]
Length=743

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 35/85 (41%), Positives = 54/85 (64%), Gaps = 7/85 (8%)
 Frame = +3

Query  357  GDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVM  536
            G + ++ ++G+T +   +GLH YL+ +CG H++W    G Q+  +P+P  LP+V  E + 
Sbjct  70   GGAARVRVRGSTGVAAAAGLHRYLRDFCGCHVAWS---GSQLR-LPRP--LPAVPGE-LT  122

Query  537  IQRPVPWNYYQNVVTSSYSYVWWDW  611
               P  + YYQNV T SYS+VWWDW
Sbjct  123  EATPNRYRYYQNVCTQSYSFVWWDW  147



>ref|XP_008010821.1| PREDICTED: alpha-N-acetylglucosaminidase [Chlorocebus sabaeus]
Length=797

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 35/85 (41%), Positives = 54/85 (64%), Gaps = 7/85 (8%)
 Frame = +3

Query  357  GDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVM  536
            G + ++ ++G+T +   +GLH YL+ +CG H++W    G Q+  +P+P  LP+V  E + 
Sbjct  124  GGAARVRVRGSTGVAAAAGLHRYLRDFCGCHVAWS---GSQLR-LPRP--LPAVPGE-LT  176

Query  537  IQRPVPWNYYQNVVTSSYSYVWWDW  611
               P  + YYQNV T SYS+VWWDW
Sbjct  177  EATPNRYRYYQNVCTQSYSFVWWDW  201



>ref|XP_004772739.1| PREDICTED: alpha-N-acetylglucosaminidase isoform X1 [Mustela 
putorius furo]
Length=805

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 44/131 (34%), Positives = 72/131 (55%), Gaps = 12/131 (9%)
 Frame = +3

Query  222  QESAAKGVLQRLL-PTHLSSFELKIVSKDVCGGQSCFRVTNFKSSSGDSPQILIQGTTAI  398
            + +A + +L RLL P   ++F +  V + +        +  ++ S G    + + G+T +
Sbjct  28   EAAAVRELLARLLGPGPAAAFSVS-VQRSLAAESG---LDTYRLSGGAGAPVRVLGSTGV  83

Query  399  EITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVMIQRPVPWNYYQNVV  578
               +GLH YL+ +CG H++W    G Q+  +P+P  LP+V  E +    P  + YYQNV 
Sbjct  84   AAAAGLHRYLRDFCGCHVAWS---GSQLR-LPEP--LPAVPEE-LTEATPNRYRYYQNVC  136

Query  579  TSSYSYVWWDW  611
            T SYS+VWWDW
Sbjct  137  THSYSFVWWDW  147



>ref|XP_001095618.2| PREDICTED: alpha-N-acetylglucosaminidase-like [Macaca mulatta]
Length=691

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 35/85 (41%), Positives = 54/85 (64%), Gaps = 7/85 (8%)
 Frame = +3

Query  357  GDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVM  536
            G + ++ ++G+T +   +GLH YL+ +CG H++W    G Q+  +P+P  LP+V  E + 
Sbjct  70   GGAARVRVRGSTGVAAAAGLHRYLRDFCGCHVAWS---GSQLR-LPRP--LPAVPGE-LT  122

Query  537  IQRPVPWNYYQNVVTSSYSYVWWDW  611
               P  + YYQNV T SYS+VWWDW
Sbjct  123  EATPNRYRYYQNVCTQSYSFVWWDW  147



>ref|XP_004390347.1| PREDICTED: alpha-N-acetylglucosaminidase [Trichechus manatus 
latirostris]
Length=744

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 36/88 (41%), Positives = 52/88 (59%), Gaps = 7/88 (8%)
 Frame = +3

Query  348  SSSGDSPQILIQGTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTE  527
            S  G   ++ + G+T +   +GLH YL+ +CG H++W    G Q+  +P+P  LP V  E
Sbjct  68   SGGGAGARVRVSGSTGVAAAAGLHRYLRDFCGCHVAWS---GSQLR-LPQP--LPVVPKE  121

Query  528  GVMIQRPVPWNYYQNVVTSSYSYVWWDW  611
             +    P  + YYQNV T SYS+VWWDW
Sbjct  122  -LTEATPNRYRYYQNVCTHSYSFVWWDW  148



>gb|EFX83393.1| hypothetical protein DAPPUDRAFT_301977 [Daphnia pulex]
Length=799

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 65/136 (48%), Gaps = 13/136 (10%)
 Frame = +3

Query  204  RPSNSVQESAAKGVLQRLLPTHLSSFELKIVSKDVCGGQSCFRVTNFKSSSGDSPQILIQ  383
            R S  +Q  A + +++RLLP   S F +K+    +      F+V      S ++  + +Q
Sbjct  33   RTSVDIQAQAVRDLIERLLPERASEFNVKVEPGLLEEENGYFQVI----KSPENTTVFLQ  88

Query  384  GTTAIEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVMIQRPVPWNY  563
            G+T +    G H+YL   C   +SW+       + +  P +LP VS     + +   + Y
Sbjct  89   GSTGVMAAWGFHYYLTQLCHCQVSWDA------DQLDLPVILPEVSVRITSLDK---FRY  139

Query  564  YQNVVTSSYSYVWWDW  611
            YQN  T SYS+ WW W
Sbjct  140  YQNTCTFSYSFAWWKW  155



>ref|XP_004994842.1| lysosomal alpha-N-acetyl glucosaminidase [Salpingoeca rosetta]
 gb|EGD83338.1| lysosomal alpha-N-acetyl glucosaminidase [Salpingoeca rosetta]
Length=820

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 68/131 (52%), Gaps = 14/131 (11%)
 Frame = +3

Query  228  SAAKGVLQRLLPTHLS-SFELKIVSKDVCGGQSCFRVTNFKSSSGDSPQILIQGTTAIEI  404
            + A+GV +R+L   ++ +   + +  +V  G   F +           Q++I+G TA+ +
Sbjct  39   AGAEGVARRVLGEEVALNIVFQEIPPNVADGHDVFEIETVDG------QLVIRGNTAVAM  92

Query  405  TSGLHWYLKYWCGAHISWE-KTGGIQIN-SVPKPGLLPSVSTEGVMIQRPVPWNYYQNVV  578
            +SGL+WYL+Y+C + ++W     G QIN S   P + P V          V + YY NV 
Sbjct  93   SSGLYWYLRYYCNSQVTWGVNDSGRQINVSAQLPVVKPMVRK-----VNQVRFRYYMNVC  147

Query  579  TSSYSYVWWDW  611
            T SYS  WW+W
Sbjct  148  TVSYSMAWWNW  158



>ref|XP_004319191.1| PREDICTED: alpha-N-acetylglucosaminidase [Tursiops truncatus]
Length=744

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 46/132 (35%), Positives = 71/132 (54%), Gaps = 13/132 (10%)
 Frame = +3

Query  222  QESAAKGVLQRLL-PTHLSSFELKIVSKDVC-GGQSCFRVTNFKSSSGDSPQILIQGTTA  395
            + +A + +L RLL P   +SF + +        G   +R+    S  G   ++ + G+T 
Sbjct  28   EAAAVRELLVRLLGPGPAASFSVSVERALAAESGLDTYRL----SGGGVGTRVRVLGSTG  83

Query  396  IEITSGLHWYLKYWCGAHISWEKTGGIQINSVPKPGLLPSVSTEGVMIQRPVPWNYYQNV  575
            +   +GLH YL+ +CG H++W    G Q+  +P+P  LP V  E +    P  + YYQNV
Sbjct  84   VAAAAGLHHYLRDFCGCHVAWS---GSQLR-LPQP--LPVVPEE-LTEATPNRYRYYQNV  136

Query  576  VTSSYSYVWWDW  611
             T SYS+VWWDW
Sbjct  137  CTQSYSFVWWDW  148



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 856559115090