BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF051O21

Length=679
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

sp|Q42961.1|PGKH_TOBAC  RecName: Full=Phosphoglycerate kinase, ch...    184   2e-51   Nicotiana tabacum [American tobacco]
ref|XP_009763674.1|  PREDICTED: phosphoglycerate kinase, chloropl...    184   3e-51   Nicotiana sylvestris
ref|XP_009622055.1|  PREDICTED: phosphoglycerate kinase, chloropl...    183   7e-51   Nicotiana tomentosiformis
gb|ABB86255.1|  phosphoglycerate kinase precursor-like                  181   3e-50   Solanum tuberosum [potatoes]
gb|AAC26785.1|  phosphoglycerate kinase precursor                       181   3e-50   Solanum tuberosum [potatoes]
ref|NP_001275227.1|  phosphoglycerate kinase, chloroplastic-like        181   5e-50   Solanum tuberosum [potatoes]
gb|ADR71054.1|  phosphoglycerate kinase                                 179   2e-49   Nicotiana benthamiana
ref|XP_011086346.1|  PREDICTED: phosphoglycerate kinase, chloropl...    179   3e-49   Sesamum indicum [beniseed]
ref|XP_011095719.1|  PREDICTED: phosphoglycerate kinase, chloropl...    178   3e-49   Sesamum indicum [beniseed]
ref|XP_004243968.1|  PREDICTED: phosphoglycerate kinase, chloropl...    176   2e-48   Solanum lycopersicum
ref|XP_006359791.1|  PREDICTED: uncharacterized protein LOC102577647    179   1e-47   
gb|EYU33792.1|  hypothetical protein MIMGU_mgv1a005422mg                162   5e-43   Erythranthe guttata [common monkey flower]
gb|EPS66037.1|  phosphoglycerate kinase, chloroplastic                  160   3e-42   Genlisea aurea
ref|XP_009402843.1|  PREDICTED: phosphoglycerate kinase, chloropl...    148   6e-38   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002513353.1|  phosphoglycerate kinase, putative                  147   9e-38   Ricinus communis
ref|XP_011013857.1|  PREDICTED: phosphoglycerate kinase, chloropl...    146   3e-37   Populus euphratica
ref|XP_004488763.1|  PREDICTED: phosphoglycerate kinase, chloropl...    145   4e-37   Cicer arietinum [garbanzo]
ref|XP_011016496.1|  PREDICTED: phosphoglycerate kinase, chloropl...    145   5e-37   Populus euphratica
ref|XP_002315066.1|  PHOSPHOGLYCERATE KINASE 1 family protein           144   1e-36   
ref|XP_002263796.1|  PREDICTED: phosphoglycerate kinase, chloropl...    144   1e-36   Vitis vinifera
ref|XP_002312238.1|  hypothetical protein POPTR_0008s08410g             143   3e-36   Populus trichocarpa [western balsam poplar]
gb|ABK96267.1|  unknown                                                 143   4e-36   Populus trichocarpa x Populus deltoides
ref|XP_010923458.1|  PREDICTED: phosphoglycerate kinase, chloropl...    139   7e-35   Elaeis guineensis
ref|XP_010269369.1|  PREDICTED: phosphoglycerate kinase, chloropl...    139   7e-35   Nelumbo nucifera [Indian lotus]
gb|KJB14026.1|  hypothetical protein B456_002G107300                    139   9e-35   Gossypium raimondii
gb|ADV16381.1|  chloroplast phosphoglycerate kinase 3                   139   9e-35   Helianthus annuus
gb|KJB14025.1|  hypothetical protein B456_002G107300                    139   9e-35   Gossypium raimondii
ref|XP_008372155.1|  PREDICTED: phosphoglycerate kinase 1, chloro...    137   2e-34   
ref|XP_003596091.1|  Phosphoglycerate kinase                            137   3e-34   Medicago truncatula
ref|XP_008371996.1|  PREDICTED: phosphoglycerate kinase, chloropl...    137   4e-34   
ref|XP_008226130.1|  PREDICTED: phosphoglycerate kinase, chloropl...    137   4e-34   Prunus mume [ume]
ref|XP_008346077.1|  PREDICTED: phosphoglycerate kinase, chloropl...    137   4e-34   
gb|KHG01489.1|  hypothetical protein F383_22605                         137   5e-34   Gossypium arboreum [tree cotton]
ref|XP_008805983.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    136   9e-34   Phoenix dactylifera
ref|XP_009397212.1|  PREDICTED: phosphoglycerate kinase, chloropl...    136   9e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007213965.1|  hypothetical protein PRUPE_ppa005031mg             136   1e-33   Prunus persica
ref|XP_008349091.1|  PREDICTED: phosphoglycerate kinase, chloropl...    136   1e-33   
gb|KDP25067.1|  hypothetical protein JCGZ_22602                         136   1e-33   Jatropha curcas
ref|XP_008383150.1|  PREDICTED: phosphoglycerate kinase, chloropl...    135   1e-33   Malus domestica [apple tree]
gb|KDO61595.1|  hypothetical protein CISIN_1g011942mg                   134   2e-33   Citrus sinensis [apfelsine]
ref|XP_010060861.1|  PREDICTED: phosphoglycerate kinase, chloropl...    135   3e-33   Eucalyptus grandis [rose gum]
ref|XP_008456300.1|  PREDICTED: phosphoglycerate kinase, chloropl...    134   5e-33   Cucumis melo [Oriental melon]
ref|XP_008786111.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    134   6e-33   Phoenix dactylifera
gb|KDO61594.1|  hypothetical protein CISIN_1g011942mg                   134   7e-33   Citrus sinensis [apfelsine]
ref|XP_006422251.1|  hypothetical protein CICLE_v10004891mg             134   7e-33   Citrus clementina [clementine]
ref|XP_004139904.1|  PREDICTED: phosphoglycerate kinase, chloropl...    133   1e-32   Cucumis sativus [cucumbers]
ref|XP_007022578.1|  Phosphoglycerate kinase 1                          133   1e-32   
sp|P29409.2|PGKH_SPIOL  RecName: Full=Phosphoglycerate kinase, ch...    132   2e-32   Spinacia oleracea
ref|XP_003531482.1|  PREDICTED: phosphoglycerate kinase, chloropl...    132   2e-32   Glycine max [soybeans]
ref|XP_010936574.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    132   4e-32   Elaeis guineensis
ref|XP_004306579.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    131   6e-32   Fragaria vesca subsp. vesca
ref|XP_010669994.1|  PREDICTED: phosphoglycerate kinase, chloropl...    130   2e-31   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_187884.1|  phosphoglycerate kinase 1                             129   3e-31   Arabidopsis thaliana [mouse-ear cress]
emb|CDX73803.1|  BnaA03g32440D                                          129   4e-31   
ref|XP_006407295.1|  hypothetical protein EUTSA_v10020621mg             129   4e-31   Eutrema salsugineum [saltwater cress]
ref|XP_010094703.1|  Phosphoglycerate kinase                            128   5e-31   Morus notabilis
ref|XP_009124670.1|  PREDICTED: phosphoglycerate kinase 1, chloro...    128   5e-31   Brassica rapa
ref|XP_010487004.1|  PREDICTED: phosphoglycerate kinase 1, chloro...    128   5e-31   Camelina sativa [gold-of-pleasure]
emb|CDY43401.1|  BnaA01g30320D                                          128   5e-31   Brassica napus [oilseed rape]
emb|CDY24247.1|  BnaC01g38270D                                          128   6e-31   Brassica napus [oilseed rape]
ref|XP_010499471.1|  PREDICTED: phosphoglycerate kinase 1, chloro...    128   6e-31   Camelina sativa [gold-of-pleasure]
ref|XP_009146585.1|  PREDICTED: phosphoglycerate kinase 1, chloro...    128   8e-31   Brassica rapa
tpg|DAA57248.1|  TPA: hypothetical protein ZEAMMB73_321071              123   9e-31   
ref|XP_010465058.1|  PREDICTED: phosphoglycerate kinase 1, chloro...    128   9e-31   Camelina sativa [gold-of-pleasure]
ref|XP_009135249.1|  PREDICTED: phosphoglycerate kinase 1, chloro...    128   9e-31   Brassica rapa
ref|XP_006297559.1|  hypothetical protein CARUB_v10013582mg             127   9e-31   Capsella rubella
ref|XP_002884926.1|  hypothetical protein ARALYDRAFT_478641             127   1e-30   Arabidopsis lyrata subsp. lyrata
ref|XP_002891879.1|  hypothetical protein ARALYDRAFT_474689             127   2e-30   
emb|CDY00798.1|  BnaC03g37820D                                          126   2e-30   
gb|AAF02830.1|AC009894_1  phosphoglycerate kinase                       123   1e-29   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001167912.1|  phosphoglycerate kinase                            123   2e-29   Zea mays [maize]
ref|NP_176015.1|  phosphoglycerate kinase                               123   3e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002456487.1|  hypothetical protein SORBIDRAFT_03g037165          118   4e-29   
emb|CDY52872.1|  BnaCnng23600D                                          124   1e-28   Brassica napus [oilseed rape]
ref|XP_003546820.1|  PREDICTED: phosphoglycerate kinase, chloropl...    121   2e-28   
ref|XP_003568189.1|  PREDICTED: phosphoglycerate kinase, chloropl...    120   5e-28   
gb|AAT07576.1|  putative chloroplast phosphoglycerate kinase            116   4e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007149208.1|  hypothetical protein PHAVU_005G050700g             115   2e-26   Phaseolus vulgaris [French bean]
gb|AFW82396.1|  hypothetical protein ZEAMMB73_945417                    115   3e-26   
gb|AGT16255.1|  phosphoglycerate kinase                                 115   3e-26   Saccharum hybrid cultivar R570
sp|P12782.1|PGKH_WHEAT  RecName: Full=Phosphoglycerate kinase, ch...    115   3e-26   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010544343.1|  PREDICTED: LOW QUALITY PROTEIN: phosphoglyce...    115   3e-26   Tarenaya hassleriana [spider flower]
gb|AGV54662.1|  phosphoglycerate kinase chloroplastic-like protein      114   4e-26   Phaseolus vulgaris [French bean]
ref|XP_002441313.1|  hypothetical protein SORBIDRAFT_09g024340          113   1e-25   Sorghum bicolor [broomcorn]
ref|XP_008656415.1|  PREDICTED: phosphoglycerate kinase, chloropl...    114   2e-25   
ref|XP_004961633.1|  PREDICTED: phosphoglycerate kinase, chloropl...    112   2e-25   Setaria italica
gb|EEC71648.1|  hypothetical protein OsI_04088                          112   3e-25   Oryza sativa Indica Group [Indian rice]
ref|XP_006858226.1|  hypothetical protein AMTR_s00062p00189550          111   7e-25   Amborella trichopoda
ref|XP_004970258.1|  PREDICTED: phosphoglycerate kinase, chloropl...    110   2e-24   Setaria italica
ref|XP_004970259.1|  PREDICTED: phosphoglycerate kinase, chloropl...    110   2e-24   Setaria italica
emb|CBL95264.1|  phosphoglycerate kinase 1                              110   2e-24   Pinus pinaster [cluster pine]
gb|AIZ74346.1|  phosphoglycerate kinase 1                               110   2e-24   Pinus massoniana [Chinese red pine]
ref|NP_001172606.1|  Os01g0800266                                       108   4e-24   
gb|AFW78532.1|  phosphoglycerate kinase                                 109   4e-24   
gb|AFW78533.1|  phosphoglycerate kinase                                 109   4e-24   
gb|EEE55536.1|  hypothetical protein OsJ_03768                          108   4e-24   Oryza sativa Japonica Group [Japonica rice]
gb|ABR16231.1|  unknown                                                 107   2e-23   Picea sitchensis
gb|ABK24564.1|  unknown                                                 107   2e-23   Picea sitchensis
ref|NP_001147628.1|  phosphoglycerate kinase                            106   3e-23   
emb|CDP13574.1|  unnamed protein product                                104   8e-23   Coffea canephora [robusta coffee]
emb|CBI24182.3|  unnamed protein product                                104   1e-22   Vitis vinifera
ref|XP_002971814.1|  hypothetical protein SELMODRAFT_267533             105   1e-22   
gb|EAY98560.1|  hypothetical protein OsI_20474                          102   3e-22   Oryza sativa Indica Group [Indian rice]
gb|EMS54865.1|  Phosphoglycerate kinase, chloroplastic                  102   1e-21   Triticum urartu
ref|XP_006654593.1|  PREDICTED: phosphoglycerate kinase, chloropl...    100   2e-21   Oryza brachyantha
ref|NP_001117503.1|  phosphoglycerate kinase                            100   2e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002972334.1|  hypothetical protein SELMODRAFT_231942           97.4    3e-20   
gb|ACN32155.1|  unknown                                               95.9    1e-19   Zea mays [maize]
ref|XP_006858233.1|  hypothetical protein AMTR_s00062p00191350        95.1    2e-19   Amborella trichopoda
gb|AAB60303.1|  phosphoglycerate kinase                               94.4    3e-19   Arabidopsis thaliana [mouse-ear cress]
gb|AIZ68220.1|  phosphoglycerate kinase                               94.0    5e-19   Ornithogalum longebracteatum [sea-onion]
gb|ADV16380.1|  cytosolic phosphoglycerate kinase 2                   92.0    2e-18   Helianthus annuus
gb|AFW70285.1|  hypothetical protein ZEAMMB73_319281                  89.4    3e-18   
sp|P12783.1|PGKY_WHEAT  RecName: Full=Phosphoglycerate kinase, cy...  91.7    4e-18   Triticum aestivum [Canadian hard winter wheat]
gb|AIN39803.1|  hypothetical protein                                  90.1    5e-18   Zoysia matrella [Japanese carpet grass]
gb|EMS46092.1|  Phosphoglycerate kinase, cytosolic                    90.9    9e-18   Triticum urartu
gb|AAW79325.1|  phosphoglycerate kinase                               90.9    1e-17   Isochrysis galbana
ref|XP_010324204.1|  PREDICTED: phosphoglycerate kinase, cytosolic    90.1    1e-17   
gb|EMT29203.1|  Phosphoglycerate kinase, cytosolic                    91.3    1e-17   
gb|KIY97385.1|  phosphoglycerate kinase                               88.2    1e-17   Monoraphidium neglectum
gb|ABH10990.1|  phosphoglycerate kinase                               88.6    1e-17   Polytomella parva
ref|XP_001699523.1|  phosphoglycerate kinase                          90.5    2e-17   Chlamydomonas reinhardtii
gb|KJB14019.1|  hypothetical protein B456_002G107200                  89.7    2e-17   Gossypium raimondii
ref|XP_005646469.1|  phosphoglycerate kinase precursor                90.1    2e-17   Coccomyxa subellipsoidea C-169
gb|ACJ11718.1|  phosphoglycerate kinase                               89.7    2e-17   Gossypium hirsutum [American cotton]
ref|NP_001058317.1|  Os06g0668200                                     89.7    2e-17   
ref|NP_001142404.1|  uncharacterized protein LOC100274579             89.4    2e-17   Zea mays [maize]
ref|XP_003570108.1|  PREDICTED: phosphoglycerate kinase, cytosolic    89.0    3e-17   Brachypodium distachyon [annual false brome]
ref|XP_009399252.1|  PREDICTED: phosphoglycerate kinase, cytosoli...  89.0    3e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009417722.1|  PREDICTED: phosphoglycerate kinase, cytosolic    89.0    4e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011396717.1|  Phosphoglycerate kinase, chloroplastic           89.4    5e-17   Auxenochlorella protothecoides
ref|XP_002951648.1|  phosphoglycerate kinase                          89.0    5e-17   Volvox carteri f. nagariensis
gb|ABB86242.1|  phosphoglycerate kinase-like                          88.2    6e-17   Solanum tuberosum [potatoes]
emb|CBY84995.1|  phosphoglycerate kinase                              88.6    6e-17   Polytomella sp. Pringsheim 198.80
ref|XP_005851391.1|  hypothetical protein CHLNCDRAFT_48457            88.2    6e-17   Chlorella variabilis
gb|ABI18157.1|  cytosolic phosphoglycerate kinase                     88.2    7e-17   Helianthus annuus
ref|NP_001275451.1|  phosphoglycerate kinase, cytosolic-like          87.8    7e-17   Solanum tuberosum [potatoes]
ref|XP_011086347.1|  PREDICTED: phosphoglycerate kinase, cytosolic    87.8    7e-17   Sesamum indicum [beniseed]
gb|KCW71392.1|  hypothetical protein EUGRSUZ_F04463                   86.7    8e-17   Eucalyptus grandis [rose gum]
ref|XP_006646936.1|  PREDICTED: phosphoglycerate kinase, cytosoli...  87.8    1e-16   Oryza brachyantha
ref|XP_009106677.1|  PREDICTED: phosphoglycerate kinase, cytosolic    87.4    1e-16   Brassica rapa
ref|XP_002263950.1|  PREDICTED: phosphoglycerate kinase, cytosolic    87.4    1e-16   Vitis vinifera
gb|ABI74567.1|  phosphoglycerate kinase                               87.4    1e-16   Oryza sativa Indica Group [Indian rice]
ref|NP_001046020.1|  Os02g0169300                                     87.4    1e-16   
sp|P41758.1|PGKH_CHLRE  RecName: Full=Phosphoglycerate kinase, ch...  88.2    1e-16   Chlamydomonas reinhardtii
ref|XP_004966316.1|  PREDICTED: phosphoglycerate kinase, cytosoli...  87.4    1e-16   Setaria italica
gb|AFW70281.1|  phosphoglycerate kinase                               88.6    1e-16   
ref|XP_004951776.1|  PREDICTED: phosphoglycerate kinase, cytosoli...  87.4    1e-16   Setaria italica
gb|ABF69999.1|  phosphoglycerate kinase, putative                     87.4    1e-16   Musa acuminata [banana]
ref|XP_005757596.1|  phosphoglycerate kinase                          85.1    1e-16   Emiliania huxleyi CCMP1516
gb|KIY97218.1|  Phosphoglycerate kinase                               88.6    1e-16   Monoraphidium neglectum
ref|XP_009414502.1|  PREDICTED: phosphoglycerate kinase, cytosoli...  87.0    1e-16   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU33791.1|  hypothetical protein MIMGU_mgv1a006853mg              87.4    1e-16   Erythranthe guttata [common monkey flower]
ref|XP_010417621.1|  PREDICTED: phosphoglycerate kinase, cytosolic    87.0    2e-16   Camelina sativa [gold-of-pleasure]
emb|CDX88547.1|  BnaC06g39910D                                        86.3    2e-16   
ref|XP_010472814.1|  PREDICTED: phosphoglycerate kinase, cytosoli...  86.7    2e-16   Camelina sativa [gold-of-pleasure]
emb|CDY70232.1|  BnaC02g46710D                                        86.7    2e-16   Brassica napus [oilseed rape]
gb|EWM26407.1|  phosphoglycerate kinase                               87.8    2e-16   Nannochloropsis gaditana
emb|CDY49746.1|  BnaA02g19260D                                        86.7    2e-16   Brassica napus [oilseed rape]
emb|CDP16886.1|  unnamed protein product                              86.7    2e-16   Coffea canephora [robusta coffee]
ref|XP_009128369.1|  PREDICTED: phosphoglycerate kinase, cytosoli...  86.7    2e-16   Brassica rapa
ref|XP_002889253.1|  hypothetical protein ARALYDRAFT_477124           86.7    2e-16   
gb|AAM61185.1|  phosphoglycerate kinase, putative                     86.7    2e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006300323.1|  hypothetical protein CARUB_v10020404mg           86.7    2e-16   
ref|NP_178073.1|  phosphoglycerate kinase                             86.7    2e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009777860.1|  PREDICTED: phosphoglycerate kinase, cytosoli...  86.7    2e-16   Nicotiana sylvestris
emb|CDX67989.1|  BnaA07g20290D                                        85.9    2e-16   
gb|KCW71391.1|  hypothetical protein EUGRSUZ_F04463                   86.3    2e-16   Eucalyptus grandis [rose gum]
ref|XP_006389877.1|  hypothetical protein EUTSA_v10018657mg           86.7    2e-16   Eutrema salsugineum [saltwater cress]
emb|CDX87375.1|  BnaA07g34980D                                        86.7    2e-16   
ref|XP_009791377.1|  PREDICTED: phosphoglycerate kinase, cytosolic    86.7    2e-16   Nicotiana sylvestris
ref|XP_005791258.1|  phosphoglycerate kinase                          85.1    2e-16   Emiliania huxleyi CCMP1516
ref|XP_010064085.1|  PREDICTED: phosphoglycerate kinase, cytosolic    86.7    2e-16   Eucalyptus grandis [rose gum]
ref|XP_010941660.1|  PREDICTED: phosphoglycerate kinase, cytosoli...  86.7    3e-16   
ref|XP_006656354.1|  PREDICTED: phosphoglycerate kinase, cytosoli...  86.3    3e-16   Oryza brachyantha
ref|XP_010941661.1|  PREDICTED: phosphoglycerate kinase, cytosoli...  86.3    3e-16   Elaeis guineensis
ref|XP_008798227.1|  PREDICTED: phosphoglycerate kinase, cytosolic    86.3    3e-16   Phoenix dactylifera
ref|XP_009104523.1|  PREDICTED: phosphoglycerate kinase, cytosoli...  86.3    3e-16   Brassica rapa
ref|XP_010275944.1|  PREDICTED: phosphoglycerate kinase, cytosolic    85.9    4e-16   Nelumbo nucifera [Indian lotus]
emb|CDX79326.1|  BnaC06g19770D                                        85.1    4e-16   
ref|XP_004139837.1|  PREDICTED: phosphoglycerate kinase, cytosoli...  85.9    4e-16   Cucumis sativus [cucumbers]
ref|XP_002500825.1|  phosphoglycerate kinase                          85.9    6e-16   Micromonas commoda
ref|XP_011095716.1|  PREDICTED: phosphoglycerate kinase, cytosoli...  85.5    6e-16   Sesamum indicum [beniseed]
ref|XP_010544342.1|  PREDICTED: phosphoglycerate kinase, cytosoli...  85.1    8e-16   Tarenaya hassleriana [spider flower]
ref|XP_009607754.1|  PREDICTED: phosphoglycerate kinase, cytosolic    85.1    8e-16   Nicotiana tomentosiformis
ref|XP_007022579.1|  Phosphoglycerate kinase isoform 1                85.1    9e-16   
ref|WP_015193656.1|  phosphoglycerate kinase                          84.7    1e-15   Stanieria cyanosphaera
ref|XP_008447095.1|  PREDICTED: phosphoglycerate kinase, cytosolic    84.7    1e-15   Cucumis melo [Oriental melon]
gb|ABI74568.1|  phosphoglycerate kinase                               84.7    1e-15   Oryza sativa Indica Group [Indian rice]
ref|XP_003059407.1|  predicted protein                                84.7    1e-15   Micromonas pusilla CCMP1545
ref|XP_010557291.1|  PREDICTED: phosphoglycerate kinase, cytosolic    85.1    1e-15   Tarenaya hassleriana [spider flower]
ref|XP_002312237.1|  hypothetical protein POPTR_0008s08400g           84.3    1e-15   
gb|ABK92531.1|  unknown                                               84.3    2e-15   Populus trichocarpa [western balsam poplar]
ref|XP_009618219.1|  PREDICTED: phosphoglycerate kinase, cytosoli...  84.0    2e-15   Nicotiana tomentosiformis
ref|WP_006515662.1|  phosphoglycerate kinase                          84.0    2e-15   Leptolyngbya sp. PCC 7375
ref|XP_009384174.1|  PREDICTED: phosphoglycerate kinase, cytosolic    84.0    2e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010936568.1|  PREDICTED: phosphoglycerate kinase, cytosolic    83.6    2e-15   Elaeis guineensis
emb|CAL85629.1|  phosphoglycerate kinase                              81.6    3e-15   Guillardia theta
gb|ACU18322.1|  unknown                                               81.6    3e-15   Glycine max [soybeans]
ref|WP_019507461.1|  phosphoglycerate kinase                          83.6    3e-15   Pleurocapsa sp. PCC 7319
emb|CDP13576.1|  unnamed protein product                              83.6    3e-15   Coffea canephora [robusta coffee]
ref|XP_002977295.1|  hypothetical protein SELMODRAFT_107116           83.6    3e-15   Selaginella moellendorffii
gb|ACJ84593.1|  unknown                                               81.3    3e-15   Medicago truncatula
gb|AAF85975.1|AF275639_1  cytosolic phosphoglycerate kinase           83.2    3e-15   Pisum sativum [garden pea]
ref|XP_011468861.1|  PREDICTED: phosphoglycerate kinase, cytosolic    83.2    4e-15   Fragaria vesca subsp. vesca
ref|WP_023076270.1|  phosphoglycerate kinase                          83.2    4e-15   Leptolyngbya sp. Heron Island J
ref|XP_010537804.1|  PREDICTED: phosphoglycerate kinase, cytosolic    82.8    4e-15   Tarenaya hassleriana [spider flower]
ref|WP_016924803.1|  phosphoglycerate kinase                          82.8    5e-15   Prochlorothrix hollandica
gb|AAO63774.1|  3-phosphoglycerate kinase                             82.8    5e-15   Populus tremuloides
ref|XP_011016588.1|  PREDICTED: phosphoglycerate kinase, cytosolic    82.4    6e-15   Populus euphratica
emb|CDX79325.1|  BnaC06g19780D                                        81.6    6e-15   
ref|XP_002513352.1|  phosphoglycerate kinase, putative                82.4    6e-15   Ricinus communis
ref|XP_005855869.1|  phosphoglycerate kinase                          80.1    7e-15   Nannochloropsis gaditana CCMP526
ref|XP_008383158.1|  PREDICTED: phosphoglycerate kinase, cytosolic    82.4    7e-15   Malus domestica [apple tree]
gb|EPS64076.1|  phosphoglycerate kinase                               82.0    8e-15   Genlisea aurea
ref|WP_040940054.1|  phosphoglycerate kinase                          82.0    9e-15   
ref|WP_040931032.1|  phosphoglycerate kinase                          82.0    9e-15   
ref|WP_015124821.1|  phosphoglycerate kinase                          82.0    1e-14   Synechococcus sp. PCC 6312
ref|XP_001418373.1|  predicted protein                                82.0    1e-14   Ostreococcus lucimarinus CCE9901
dbj|BAA33801.1|  cytosolic phosphoglycerate kinase 1                  81.6    1e-14   Populus nigra [black poplar]
ref|XP_003531483.1|  PREDICTED: phosphoglycerate kinase, cytosolic    81.6    1e-14   
gb|KDO61597.1|  hypothetical protein CISIN_1g040813mg                 81.3    2e-14   Citrus sinensis [apfelsine]
ref|XP_006422250.1|  hypothetical protein CICLE_v10005101mg           81.3    2e-14   Citrus clementina [clementine]
ref|WP_038547249.1|  phosphoglycerate kinase                          81.3    2e-14   Synechococcus sp. KORDI-100
ref|XP_004488762.1|  PREDICTED: phosphoglycerate kinase, cytosoli...  81.3    2e-14   Cicer arietinum [garbanzo]
ref|WP_006528046.1|  phosphoglycerate kinase                          81.3    2e-14   Gloeocapsa sp. PCC 73106
ref|WP_030007016.1|  phosphoglycerate kinase                          80.9    2e-14   Synechococcus sp. NKBG042902
emb|CBN79775.1|  Phosphoglycerate kinase                              80.5    2e-14   Ectocarpus siliculosus
ref|XP_007149209.1|  hypothetical protein PHAVU_005G050800g           80.9    2e-14   Phaseolus vulgaris [French bean]
ref|XP_003546821.1|  PREDICTED: phosphoglycerate kinase, cytosoli...  80.9    2e-14   Glycine max [soybeans]
ref|WP_012626442.1|  phosphoglycerate kinase                          80.9    2e-14   Cyanothece sp. PCC 7425
ref|WP_028953033.1|  phosphoglycerate kinase                          80.9    2e-14   Synechococcus sp. CC9616
ref|XP_002972143.1|  hypothetical protein SELMODRAFT_96742            80.9    2e-14   Selaginella moellendorffii
ref|XP_011013882.1|  PREDICTED: phosphoglycerate kinase, cytosoli...  80.9    2e-14   Populus euphratica
gb|AFK46712.1|  unknown                                               80.9    2e-14   Medicago truncatula
ref|XP_011013868.1|  PREDICTED: phosphoglycerate kinase, cytosoli...  80.9    2e-14   Populus euphratica
ref|WP_041765481.1|  phosphoglycerate kinase                          80.9    2e-14   Leptolyngbya sp. PCC 7376
ref|XP_002315067.1|  cytosolic phosphoglycerate kinase family pro...  80.9    3e-14   
ref|XP_003596092.1|  Phosphoglycerate kinase                          80.9    3e-14   Medicago truncatula
ref|XP_005821497.1|  phosphoglycerate kinase, plastid-targeted        81.3    3e-14   Guillardia theta CCMP2712
ref|XP_010094705.1|  Phosphoglycerate kinase                          80.9    3e-14   Morus notabilis
ref|WP_012307199.1|  phosphoglycerate kinase                          80.5    3e-14   Synechococcus
ref|WP_024545807.1|  phosphoglycerate kinase                          80.5    3e-14   Synechococcus sp. NKBG15041c
ref|WP_008311068.1|  phosphoglycerate kinase                          80.5    3e-14   Leptolyngbya sp. PCC 6406
gb|KDP25066.1|  hypothetical protein JCGZ_22601                       80.5    4e-14   Jatropha curcas
ref|XP_008226131.1|  PREDICTED: phosphoglycerate kinase, cytosolic    80.5    4e-14   Prunus mume [ume]
ref|WP_036484843.1|  phosphoglycerate kinase                          80.1    4e-14   Myxosarcina sp. GI1
dbj|BAA33802.1|  cytosolic phosphoglycerate kinase 1                  80.1    4e-14   Populus nigra [black poplar]
ref|XP_008805982.1|  PREDICTED: phosphoglycerate kinase, cytosolic    80.1    4e-14   Phoenix dactylifera
ref|XP_007213914.1|  hypothetical protein PRUPE_ppa005669mg           80.5    5e-14   
ref|XP_005822051.1|  hypothetical protein GUITHDRAFT_80135            80.1    5e-14   Guillardia theta CCMP2712
ref|XP_011401929.1|  Phosphoglycerate kinase, cytosolic               81.3    6e-14   Auxenochlorella protothecoides
ref|WP_011377868.1|  MULTISPECIES: phosphoglycerate kinase            79.7    6e-14   Synechococcus
ref|WP_036005350.1|  phosphoglycerate kinase                          79.7    6e-14   [Leptolyngbya] sp. JSC-1
ref|WP_006456361.1|  phosphoglycerate kinase                          79.7    6e-14   Synechococcus sp. PCC 7335
ref|WP_011242745.1|  phosphoglycerate kinase                          79.7    7e-14   Synechococcus elongatus
ref|XP_003596093.1|  Phosphoglycerate kinase                          79.7    7e-14   Medicago truncatula
ref|WP_009769345.1|  phosphoglycerate kinase                          78.2    7e-14   Oscillatoriales cyanobacterium JSC-12
ref|WP_010471014.1|  phosphoglycerate kinase                          79.0    1e-13   Acaryochloris sp. CCMEE 5410
ref|WP_012161281.1|  phosphoglycerate kinase                          79.0    1e-13   Acaryochloris marina
ref|WP_024125258.1|  phosphoglycerate kinase                          79.0    1e-13   Thermosynechococcus sp. NK55a
ref|WP_026719925.1|  phosphoglycerate kinase                          79.0    1e-13   Fischerella sp. PCC 9431
ref|WP_035992253.1|  phosphoglycerate kinase                          78.6    1e-13   Leptolyngbya sp. KIOST-1
ref|XP_010669985.1|  PREDICTED: phosphoglycerate kinase, cytosolic    78.6    1e-13   Beta vulgaris subsp. vulgaris [field beet]
gb|AFY38465.1|  phosphoglycerate kinase                               79.0    1e-13   Leptolyngbya sp. PCC 7376
ref|WP_026097925.1|  phosphoglycerate kinase                          78.6    1e-13   Geitlerinema sp. PCC 7105
ref|WP_015110302.1|  phosphoglycerate kinase                          78.6    2e-13   Cyanobium gracile
ref|WP_015162225.1|  phosphoglycerate kinase                          78.2    2e-13   Chamaesiphon minutus
ref|WP_017300589.1|  phosphoglycerate kinase                          78.2    2e-13   Nodosilinea nodulosa
ref|WP_019495207.1|  phosphoglycerate kinase                          78.2    2e-13   Calothrix sp. PCC 7103
ref|WP_008189591.1|  phosphoglycerate kinase                          78.2    2e-13   Moorea producens
ref|WP_015173530.1|  phosphoglycerate kinase                          77.8    2e-13   Geitlerinema sp. PCC 7407
ref|WP_006173249.1|  phosphoglycerate kinase                          77.8    2e-13   Synechococcus sp. WH 5701
ref|WP_039728851.1|  MULTISPECIES: phosphoglycerate kinase            77.8    3e-13   Lyngbya confervoides
ref|WP_017294263.1|  phosphoglycerate kinase                          77.8    3e-13   Geminocystis herdmanii
ref|WP_007304168.1|  phosphoglycerate kinase                          77.8    3e-13   Crocosphaera watsonii
ref|WP_017289328.1|  phosphoglycerate kinase                          77.8    3e-13   Leptolyngbya boryana
ref|WP_007309560.1|  phosphoglycerate kinase                          77.8    3e-13   Crocosphaera watsonii
ref|WP_015204810.1|  phosphoglycerate kinase                          77.8    3e-13   Crinalium epipsammum
ref|WP_006507734.1|  phosphoglycerate kinase                          77.4    3e-13   
emb|CDP13575.1|  unnamed protein product                              79.0    3e-13   
ref|WP_016873269.1|  phosphoglycerate kinase                          77.4    4e-13   
ref|WP_017323648.1|  phosphoglycerate kinase                          77.0    5e-13   
ref|WP_009628155.1|  phosphoglycerate kinase                          77.0    5e-13   
ref|WP_037220338.1|  phosphoglycerate kinase                          77.0    5e-13   
ref|WP_018397328.1|  phosphoglycerate kinase                          77.0    6e-13   
ref|WP_015166011.1|  phosphoglycerate kinase                          76.6    6e-13   
ref|WP_011058101.1|  phosphoglycerate kinase                          76.6    6e-13   
ref|WP_019478026.1|  phosphoglycerate kinase                          76.6    6e-13   
ref|WP_012598967.1|  phosphoglycerate kinase                          76.6    7e-13   
ref|WP_028947361.1|  phosphoglycerate kinase                          76.3    8e-13   
ref|WP_015149149.1|  phosphoglycerate kinase                          76.3    8e-13   
ref|WP_011365387.1|  phosphoglycerate kinase                          76.3    9e-13   
ref|WP_010873144.1|  phosphoglycerate kinase                          76.3    1e-12   
ref|WP_035831895.1|  phosphoglycerate kinase                          76.3    1e-12   
ref|WP_023175125.1|  phosphoglycerate kinase                          76.3    1e-12   
ref|WP_007099195.1|  phosphoglycerate kinase                          75.9    1e-12   
ref|XP_001762684.1|  predicted protein                                75.9    1e-12   
ref|WP_015119342.1|  phosphoglycerate kinase                          75.9    1e-12   
gb|KIE11439.1|  phosphoglycerate kinase                               75.5    2e-12   
ref|WP_009543708.1|  MULTISPECIES: phosphoglycerate kinase            75.5    2e-12   
ref|WP_026734580.1|  phosphoglycerate kinase                          75.5    2e-12   
ref|WP_009454679.1|  MULTISPECIES: phosphoglycerate kinase            75.5    2e-12   
ref|WP_006105635.1|  phosphoglycerate kinase                          75.5    2e-12   
ref|WP_022604954.1|  phosphoglycerate kinase                          75.1    2e-12   
ref|XP_005709175.1|  phosphoglycerate kinase                          75.5    2e-12   
ref|WP_016861411.1|  phosphoglycerate kinase                          75.1    2e-12   
ref|WP_017309094.1|  MULTISPECIES: phosphoglycerate kinase            75.1    2e-12   
gb|ACB53567.1|  phosphoglycerate kinase                               75.1    2e-12   
ref|WP_017303631.1|  phosphoglycerate kinase                          75.1    2e-12   
ref|WP_035157181.1|  phosphoglycerate kinase                          75.1    2e-12   
ref|WP_006042911.1|  phosphoglycerate kinase                          75.1    2e-12   
dbj|BAJ85222.1|  predicted protein                                    75.1    2e-12   
dbj|BAG09537.1|  phosphoglycerate kinase                              75.1    3e-12   
ref|WP_011131834.1|  phosphoglycerate kinase                          75.1    3e-12   
gb|EMS52006.1|  Phosphoglycerate kinase, cytosolic                    75.5    3e-12   
ref|WP_015167138.1|  phosphoglycerate kinase                          74.7    3e-12   
ref|XP_002296228.1|  predicted protein                                75.1    3e-12   
ref|WP_036922086.1|  phosphoglycerate kinase                          74.7    3e-12   
sp|P74421.2|PGK_SYNY3  RecName: Full=Phosphoglycerate kinase          74.7    3e-12   
emb|CBN75623.1|  phosphoglycerate kinase                              75.1    3e-12   
ref|WP_011934238.1|  phosphoglycerate kinase                          74.7    3e-12   
ref|WP_015224558.1|  phosphoglycerate kinase                          74.7    3e-12   
ref|WP_026098466.1|  phosphoglycerate kinase                          74.3    4e-12   
ref|WP_038552523.1|  phosphoglycerate kinase                          74.3    4e-12   
ref|WP_011142310.1|  phosphoglycerate kinase                          74.3    4e-12   
ref|WP_015153171.1|  phosphoglycerate kinase                          74.3    4e-12   
ref|WP_039715776.1|  phosphoglycerate kinase                          74.3    4e-12   
ref|WP_015190859.1|  phosphoglycerate kinase                          74.3    5e-12   
ref|XP_009035517.1|  hypothetical protein AURANDRAFT_71305            75.1    5e-12   
ref|WP_011819547.1|  phosphoglycerate kinase                          74.3    5e-12   
ref|WP_015184203.1|  phosphoglycerate kinase                          74.3    5e-12   
gb|EMT08517.1|  Phosphoglycerate kinase, cytosolic                    74.3    5e-12   
ref|WP_008275737.1|  phosphoglycerate kinase                          74.3    5e-12   
ref|WP_019476955.1|  phosphoglycerate kinase                          74.3    5e-12   
ref|WP_013321558.1|  phosphoglycerate kinase                          73.9    5e-12   
ref|WP_016865730.1|  phosphoglycerate kinase                          73.9    5e-12   
ref|WP_011124376.1|  MULTISPECIES: phosphoglycerate kinase            73.9    6e-12   
ref|WP_009788740.1|  phosphoglycerate kinase                          73.6    6e-12   
dbj|BAJ87335.1|  predicted protein                                    73.6    6e-12   
ref|WP_011360883.1|  phosphoglycerate kinase                          73.9    7e-12   
ref|WP_036916478.1|  MULTISPECIES: phosphoglycerate kinase            73.9    7e-12   
ref|WP_010998270.1|  phosphoglycerate kinase                          73.6    7e-12   
ref|WP_012158829.1|  phosphoglycerate kinase                          73.6    7e-12   
ref|WP_011317630.1|  phosphoglycerate kinase                          73.6    7e-12   
ref|WP_006854064.1|  phosphoglycerate kinase                          73.6    7e-12   
ref|WP_029637902.1|  phosphoglycerate kinase [                        73.6    7e-12   
ref|WP_006199298.1|  phosphoglycerate kinase                          73.6    8e-12   
gb|AHF64875.1|  Phosphoglycerate kinase                               73.6    8e-12   
ref|WP_022483437.1|  phosphoglycerate kinase                          73.6    8e-12   
ref|WP_007101320.1|  phosphoglycerate kinase                          73.6    8e-12   
ref|WP_016949614.1|  phosphoglycerate kinase                          73.6    8e-12   
ref|WP_015221859.1|  phosphoglycerate kinase                          73.6    8e-12   
ref|WP_017803962.1|  phosphoglycerate kinase                          73.6    8e-12   
ref|WP_039739530.1|  phosphoglycerate kinase                          73.6    8e-12   
ref|WP_027714084.1|  phosphoglycerate kinase                          73.2    9e-12   
ref|WP_019224946.1|  MULTISPECIES: phosphoglycerate kinase            73.2    9e-12   
ref|WP_042152714.1|  phosphoglycerate kinase                          73.2    1e-11   
ref|WP_043693415.1|  phosphoglycerate kinase                          72.4    1e-11   
ref|WP_006620004.1|  phosphoglycerate kinase                          73.2    1e-11   
gb|KGG29033.1|  Phosphoglycerate kinase                               73.2    1e-11   
ref|WP_006626244.1|  MULTISPECIES: phosphoglycerate kinase            73.2    1e-11   
ref|WP_026794289.1|  MULTISPECIES: phosphoglycerate kinase            73.2    1e-11   
ref|WP_015205969.1|  phosphoglycerate kinase                          73.2    1e-11   
ref|WP_027249107.1|  phosphoglycerate kinase                          73.2    1e-11   
gb|AAP79195.1|  phosphoglycerate kinase 1                             71.6    1e-11   
ref|WP_035163540.1|  phosphoglycerate kinase                          73.2    1e-11   
ref|WP_011131470.1|  phosphoglycerate kinase                          73.2    1e-11   
ref|WP_009631644.1|  phosphoglycerate kinase                          72.8    1e-11   
ref|WP_010313479.1|  phosphoglycerate kinase                          72.0    1e-11   
ref|WP_009343450.1|  phosphoglycerate kinase                          72.8    1e-11   
ref|WP_011129182.1|  phosphoglycerate kinase                          72.8    1e-11   
ref|WP_014967240.1|  phosphoglycerate kinase                          72.8    1e-11   
ref|WP_023510529.1|  phosphoglycerate kinase                          70.5    1e-11   
ref|WP_015177490.1|  phosphoglycerate kinase                          72.8    1e-11   
ref|WP_015140688.1|  phosphoglycerate kinase                          72.8    1e-11   
ref|WP_009786889.1|  phosphoglycerate kinase                          72.8    2e-11   
ref|WP_006633515.1|  phosphoglycerate kinase                          72.8    2e-11   
ref|WP_015145174.1|  phosphoglycerate kinase                          72.8    2e-11   
ref|WP_017872268.1|  phosphoglycerate kinase                          72.8    2e-11   
ref|WP_017317549.1|  phosphoglycerate kinase                          72.8    2e-11   
ref|WP_041844740.1|  phosphoglycerate kinase                          72.4    2e-11   
ref|WP_026789199.1|  phosphoglycerate kinase                          72.4    2e-11   
ref|YP_002049002.1|  Phosphoglycerate kinase                          72.4    2e-11   
ref|WP_036911068.1|  MULTISPECIES: phosphoglycerate kinase            72.4    2e-11   
ref|WP_023068245.1|  phosphoglycerate kinase                          72.4    2e-11   
ref|WP_011620601.1|  phosphoglycerate kinase                          72.4    2e-11   
ref|WP_002776135.1|  phosphoglycerate kinase                          72.4    2e-11   
ref|WP_002737838.1|  phosphoglycerate kinase                          72.4    2e-11   
ref|WP_015218887.1|  phosphoglycerate kinase                          72.0    2e-11   
ref|WP_034772457.1|  phosphoglycerate kinase                          72.0    2e-11   
ref|WP_015080710.1|  phosphoglycerate kinase                          72.0    2e-11   
ref|WP_041903090.1|  phosphoglycerate kinase                          72.0    2e-11   
ref|WP_006911676.1|  phosphoglycerate kinase                          72.0    2e-11   
ref|WP_015127481.1|  phosphoglycerate kinase                          72.0    2e-11   
ref|XP_001776160.1|  predicted protein                                70.5    2e-11   
ref|XP_005535003.1|  phosphoglycerate kinase                          72.4    2e-11   
ref|WP_011827369.1|  phosphoglycerate kinase                          72.0    3e-11   
ref|WP_027404640.1|  phosphoglycerate kinase                          72.0    3e-11   
gb|AGH55660.1|  phosphoglycerate kinase                               71.6    3e-11   
ref|WP_017888984.1|  phosphoglycerate kinase                          72.0    3e-11   
ref|WP_026827584.1|  phosphoglycerate kinase                          72.0    3e-11   
ref|WP_007352879.1|  MULTISPECIES: phosphoglycerate kinase            72.0    3e-11   
ref|WP_022182979.1|  phosphoglycerate kinase                          72.0    3e-11   
ref|WP_012371262.1|  phosphoglycerate kinase                          71.6    3e-11   
ref|WP_014971163.1|  phosphoglycerate kinase                          71.6    3e-11   
ref|WP_028089947.1|  phosphoglycerate kinase                          71.6    3e-11   
ref|WP_022451887.1|  phosphoglycerate kinase                          71.6    3e-11   
ref|WP_028085373.1|  phosphoglycerate kinase                          71.6    3e-11   
ref|WP_021685516.1|  phosphoglycerate kinase                          71.6    3e-11   
ref|WP_009623623.1|  phosphoglycerate kinase                          71.6    3e-11   
ref|WP_028105778.1|  phosphoglycerate kinase                          71.6    3e-11   
ref|WP_019502041.1|  phosphoglycerate kinase                          71.6    3e-11   
ref|WP_013192657.1|  phosphoglycerate kinase                          71.6    3e-11   
ref|WP_010305334.1|  phosphoglycerate kinase                          70.5    3e-11   
ref|WP_026832174.1|  phosphoglycerate kinase                          71.6    3e-11   
ref|WP_029342478.1|  phosphoglycerate kinase                          71.6    4e-11   
ref|WP_015044861.1|  MULTISPECIES: phosphoglycerate kinase            71.6    4e-11   
ref|WP_034613156.1|  phosphoglycerate kinase                          71.6    4e-11   
ref|WP_026156411.1|  phosphoglycerate kinase                          71.6    4e-11   
ref|WP_042680233.1|  phosphoglycerate kinase                          71.6    4e-11   
gb|EKE04581.1|  hypothetical protein ACD_20C00046G0002                71.2    4e-11   
ref|WP_023469216.1|  phosphoglycerate kinase                          71.2    4e-11   
ref|WP_006696790.1|  phosphoglycerate kinase                          71.2    4e-11   
ref|WP_014254443.1|  phosphoglycerate kinase [                        71.2    4e-11   
ref|WP_008234716.1|  phosphoglycerate kinase                          71.2    4e-11   
ref|WP_013810778.1|  phosphoglycerate kinase                          71.2    5e-11   
ref|WP_003540450.1|  phosphoglycerate kinase                          71.2    5e-11   
ref|WP_036901530.1|  phosphoglycerate kinase                          71.2    5e-11   
ref|WP_027622719.1|  phosphoglycerate kinase [                        71.2    5e-11   
ref|XP_002182409.1|  predicted protein                                71.2    5e-11   
ref|WP_017655761.1|  phosphoglycerate kinase                          71.2    5e-11   
ref|WP_015217208.1|  phosphoglycerate kinase                          71.2    5e-11   
ref|WP_035396304.1|  MULTISPECIES: phosphoglycerate kinase            71.2    5e-11   
gb|AAF45020.1|AF108451_1  phosphoglycerate kinase precursor           71.2    5e-11   
gb|AGL76992.1|  phosphoglycerate kinase                               70.9    5e-11   
ref|WP_006311842.1|  phosphoglycerate kinase                          71.2    5e-11   
ref|WP_026135280.1|  phosphoglycerate kinase                          71.2    5e-11   
gb|AAK40345.1|  phosphoglycerate kinase                               68.6    5e-11   
ref|WP_006693729.1|  phosphoglycerate kinase                          70.9    6e-11   
ref|WP_022343655.1|  phosphoglycerate kinase                          70.9    6e-11   
ref|WP_009728381.1|  phosphoglycerate kinase                          70.9    6e-11   
ref|WP_025892554.1|  phosphoglycerate kinase                          67.8    6e-11   
ref|WP_014829391.1|  phosphoglycerate kinase                          70.9    6e-11   
ref|WP_006278490.1|  phosphoglycerate kinase                          70.9    6e-11   
ref|WP_028051679.1|  phosphoglycerate kinase                          70.9    6e-11   
ref|WP_012194769.1|  phosphoglycerate kinase                          70.9    6e-11   
ref|WP_015111043.1|  phosphoglycerate kinase                          70.9    6e-11   
ref|WP_028976537.1|  phosphoglycerate kinase                          68.2    6e-11   
ref|WP_027842190.1|  phosphoglycerate kinase                          70.9    7e-11   
ref|WP_016251804.1|  phosphoglycerate kinase                          70.5    7e-11   
ref|WP_038288111.1|  phosphoglycerate kinase [                        70.5    8e-11   
ref|WP_025980178.1|  phosphoglycerate kinase                          68.2    8e-11   
ref|WP_011429225.1|  phosphoglycerate kinase                          67.8    8e-11   
dbj|GAE88155.1|  phosphoglycerate kinase [ [                          70.5    8e-11   
ref|WP_032523967.1|  phosphoglycerate kinase                          70.5    8e-11   
ref|WP_016182308.1|  phosphoglycerate kinase                          70.5    8e-11   
ref|XP_005715401.1|  unnamed protein product                          68.2    8e-11   
ref|WP_010196831.1|  phosphoglycerate kinase                          70.5    8e-11   
ref|XP_001777571.1|  predicted protein                                68.6    8e-11   
gb|KIJ83619.1|  phosphoglycerate kinase                               70.5    8e-11   
dbj|BAJ88371.1|  predicted protein                                    70.5    8e-11   
emb|CDX04982.1|  Phosphoglycerate kinase                              70.5    9e-11   
gb|KIA76915.1|  Phosphoglycerate kinase                               70.5    9e-11   
gb|EFB41017.1|  hypothetical protein pah_c161o023                     70.5    9e-11   
ref|WP_011341056.1|  phosphoglycerate kinase                          70.5    9e-11   
ref|WP_009350704.1|  phosphoglycerate kinase                          70.5    9e-11   
ref|WP_009438934.1|  phosphoglycerate kinase                          70.5    9e-11   
ref|WP_035214477.1|  phosphoglycerate kinase                          70.1    1e-10   
emb|CEF98237.1|  Phosphoglycerate kinase, conserved site              70.1    1e-10   
gb|EHL05013.1|  phosphoglycerate kinase                               70.1    1e-10   
ref|WP_035248630.1|  phosphoglycerate kinase                          70.1    1e-10   
gb|AFN75153.1|  phosphoglycerate kinase                               70.1    1e-10   
ref|WP_041356046.1|  phosphoglycerate kinase                          70.1    1e-10   
ref|WP_025747855.1|  phosphoglycerate kinase                          70.1    1e-10   
gb|EMT17446.1|  Phosphoglycerate kinase, cytosolic                    69.7    1e-10   
ref|WP_025980855.1|  phosphoglycerate kinase                          68.2    1e-10   
ref|WP_022412440.1|  phosphoglycerate kinase                          70.1    1e-10   
dbj|GAL95079.1|  phosphoglycerate kinase                              70.1    1e-10   
ref|WP_002747672.1|  phosphoglycerate kinase                          70.1    1e-10   
emb|CDR30363.1|  Phosphoglycerate kinase                              69.7    1e-10   
ref|WP_002757146.1|  phosphoglycerate kinase                          69.7    1e-10   
ref|WP_024969605.1|  phosphoglycerate kinase                          69.7    1e-10   
ref|WP_004162782.1|  phosphoglycerate kinase                          69.7    1e-10   
ref|WP_031458457.1|  phosphoglycerate kinase                          69.7    1e-10   
ref|WP_004161358.1|  phosphoglycerate kinase                          69.7    1e-10   
ref|WP_016516026.1|  phosphoglycerate kinase                          69.7    1e-10   
ref|WP_004162197.1|  phosphoglycerate kinase                          69.7    1e-10   
ref|WP_028459142.1|  phosphoglycerate kinase                          69.7    1e-10   
ref|WP_002802732.1|  phosphoglycerate kinase                          69.7    1e-10   
ref|WP_002750594.1|  phosphoglycerate kinase                          69.7    1e-10   
ref|WP_022258476.1|  phosphoglycerate kinase                          70.1    1e-10   
ref|WP_002772098.1|  phosphoglycerate kinase                          69.7    1e-10   
ref|WP_011936642.1|  phosphoglycerate kinase                          68.6    1e-10   
ref|WP_002781096.1|  phosphoglycerate kinase                          69.7    2e-10   
ref|WP_041032823.1|  phosphoglycerate kinase                          69.7    2e-10   
ref|WP_008206385.1|  phosphoglycerate kinase                          69.7    2e-10   
ref|WP_011343229.1|  phosphoglycerate kinase                          69.7    2e-10   
ref|WP_034811351.1|  phosphoglycerate kinase [                        69.7    2e-10   
ref|WP_025929681.1|  phosphoglycerate kinase                          69.7    2e-10   



>sp|Q42961.1|PGKH_TOBAC RecName: Full=Phosphoglycerate kinase, chloroplastic; Flags: 
Precursor [Nicotiana tabacum]
 emb|CAA88841.1| phosphoglycerate kinase [Nicotiana tabacum]
Length=481

 Score =   184 bits (467),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 111/132 (84%), Gaps = 3/132 (2%)
 Frame = +2

Query  248  AMASASYTFCGIPTTsssaassssssKRAVITRFLPRTPLRSLGFAAAAADPFFSHHVAT  427
            A A+AS+T CGIP TSSS  + + +   A   RFL +TPLR LGFA AAAD  F++HVAT
Sbjct  2    ASATASHTLCGIPATSSSTTNKAIAPSSA---RFLAKTPLRRLGFAGAAADSLFTNHVAT  58

Query  428  QLRSLKASTKPVRGVVSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRA  607
            +LRSLK+S+KP+RGV SMAKKSVGDLTAA+LKGKKVFVRADLNVPLDD Q ITDDTRIRA
Sbjct  59   KLRSLKSSSKPIRGVASMAKKSVGDLTAAELKGKKVFVRADLNVPLDDNQNITDDTRIRA  118

Query  608  AIPTIKHLISNG  643
            A+PTIKHL++NG
Sbjct  119  AVPTIKHLMANG  130



>ref|XP_009763674.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Nicotiana 
sylvestris]
Length=481

 Score =   184 bits (466),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 111/132 (84%), Gaps = 3/132 (2%)
 Frame = +2

Query  248  AMASASYTFCGIPTTsssaassssssKRAVITRFLPRTPLRSLGFAAAAADPFFSHHVAT  427
            A A+AS+T CGIP TSSS  + + +   A   RFL +TPLR LGFA AAAD  F++HVAT
Sbjct  2    ASATASHTLCGIPATSSSTTNKAIAPSSA---RFLVKTPLRRLGFAGAAADSLFTNHVAT  58

Query  428  QLRSLKASTKPVRGVVSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRA  607
            +LRSLK+S+KP+RGV SMAKKSVGDLTAA+LKGKKVFVRADLNVPLDD Q ITDDTRIRA
Sbjct  59   KLRSLKSSSKPIRGVASMAKKSVGDLTAAELKGKKVFVRADLNVPLDDNQNITDDTRIRA  118

Query  608  AIPTIKHLISNG  643
            A+PTIKHL++NG
Sbjct  119  AVPTIKHLMANG  130



>ref|XP_009622055.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Nicotiana 
tomentosiformis]
Length=481

 Score =   183 bits (464),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 110/132 (83%), Gaps = 3/132 (2%)
 Frame = +2

Query  248  AMASASYTFCGIPTTsssaassssssKRAVITRFLPRTPLRSLGFAAAAADPFFSHHVAT  427
            A A+AS+T CGIP TSSS  + + +   A   RFL +TPLR LGFA AAAD  F++HVA 
Sbjct  2    ASATASHTLCGIPATSSSTTNKAIAPSSA---RFLAKTPLRRLGFAGAAADSLFTNHVAA  58

Query  428  QLRSLKASTKPVRGVVSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRA  607
            +LRSLK S+KPVRGV SMAKKSVGDLTAA+LKGKKVFVRADLNVPLDD+Q ITDDTRIRA
Sbjct  59   KLRSLKGSSKPVRGVASMAKKSVGDLTAAELKGKKVFVRADLNVPLDDSQNITDDTRIRA  118

Query  608  AIPTIKHLISNG  643
            A+PTIKHL++NG
Sbjct  119  AVPTIKHLMANG  130



>gb|ABB86255.1| phosphoglycerate kinase precursor-like [Solanum tuberosum]
Length=482

 Score =   181 bits (460),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 113/132 (86%), Gaps = 2/132 (2%)
 Frame = +2

Query  248  AMASASYTFCGIPTTsssaassssssKRAVITRFLPRTPLRSLGFAAAAADPFFSHHVAT  427
            A A+AS+TFCGIPT SSS+ ++ S++  +   RFL +TPLR LGFA A ADP F+ HVAT
Sbjct  2    ASATASHTFCGIPTKSSSSTTNRSTTPSS--ARFLLKTPLRRLGFAGAVADPLFTSHVAT  59

Query  428  QLRSLKASTKPVRGVVSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRA  607
            +LRSLKAS+ PVR VVSMAKKSVGDL++ADLKGKKVFVRADLNVPLDD Q ITDDTRIRA
Sbjct  60   KLRSLKASSNPVRAVVSMAKKSVGDLSSADLKGKKVFVRADLNVPLDDAQNITDDTRIRA  119

Query  608  AIPTIKHLISNG  643
            AIPTIKHLI+NG
Sbjct  120  AIPTIKHLIANG  131



>gb|AAC26785.1| phosphoglycerate kinase precursor [Solanum tuberosum]
Length=482

 Score =   181 bits (459),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 115/132 (87%), Gaps = 2/132 (2%)
 Frame = +2

Query  248  AMASASYTFCGIPTTsssaassssssKRAVITRFLPRTPLRSLGFAAAAADPFFSHHVAT  427
            A A+AS+TFCGIPTTSSS+ ++ S++  +   RFL +TPLR LGFA A ADP F++HVAT
Sbjct  2    ASATASHTFCGIPTTSSSSTTNRSTTHSS--ARFLLKTPLRRLGFAGAVADPLFTNHVAT  59

Query  428  QLRSLKASTKPVRGVVSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRA  607
            +LRSLKAS+ PVR VVSMAKKSVGDL+++DLKGKKVFVRADLNVPLDD Q ITDDTRIRA
Sbjct  60   KLRSLKASSNPVRAVVSMAKKSVGDLSSSDLKGKKVFVRADLNVPLDDAQNITDDTRIRA  119

Query  608  AIPTIKHLISNG  643
            AIPTIKHLI+NG
Sbjct  120  AIPTIKHLIANG  131



>ref|NP_001275227.1| phosphoglycerate kinase, chloroplastic-like [Solanum tuberosum]
 gb|ABB72817.1| phosphoglycerate kinase precursor-like protein [Solanum tuberosum]
Length=482

 Score =   181 bits (458),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 115/132 (87%), Gaps = 2/132 (2%)
 Frame = +2

Query  248  AMASASYTFCGIPTTsssaassssssKRAVITRFLPRTPLRSLGFAAAAADPFFSHHVAT  427
            A A+AS+TFCGIPTTSSS+ ++ S++  +   RFL +TPLR LGFA A ADP F++HVAT
Sbjct  2    ASATASHTFCGIPTTSSSSTTNRSTTHSS--ARFLLKTPLRRLGFAGAVADPLFTNHVAT  59

Query  428  QLRSLKASTKPVRGVVSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRA  607
            +LRSLKAS+ PVR VVSMAKKSVGDL+++DLKGKKVFVRADLNVPLDD Q ITDDTRIRA
Sbjct  60   KLRSLKASSNPVRAVVSMAKKSVGDLSSSDLKGKKVFVRADLNVPLDDAQNITDDTRIRA  119

Query  608  AIPTIKHLISNG  643
            AIPTIKHLI+NG
Sbjct  120  AIPTIKHLIANG  131



>gb|ADR71054.1| phosphoglycerate kinase [Nicotiana benthamiana]
Length=481

 Score =   179 bits (454),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 109/132 (83%), Gaps = 3/132 (2%)
 Frame = +2

Query  248  AMASASYTFCGIPTTsssaassssssKRAVITRFLPRTPLRSLGFAAAAADPFFSHHVAT  427
            A A+AS++ CGIP TSSS  + S +   A   RFL +TP R LGFA AAAD  F++HVAT
Sbjct  2    ASATASHSLCGIPATSSSTTNKSIAPSSA---RFLAKTPPRGLGFAGAAADSLFTNHVAT  58

Query  428  QLRSLKASTKPVRGVVSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRA  607
            +LRSLK+S+KPVRGV SMAKKSVGDLTAA+LKGK VFVRADLNVPLDD Q ITDDTRIRA
Sbjct  59   KLRSLKSSSKPVRGVASMAKKSVGDLTAAELKGKNVFVRADLNVPLDDNQNITDDTRIRA  118

Query  608  AIPTIKHLISNG  643
            A+PTIKHL++NG
Sbjct  119  AVPTIKHLMANG  130



>ref|XP_011086346.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Sesamum indicum]
Length=481

 Score =   179 bits (453),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 99/133 (74%), Positives = 110/133 (83%), Gaps = 4/133 (3%)
 Frame = +2

Query  248  AMASASYTFCGIPTTsssaassssssKRAVITRFLPRTPLRSLGFAAAAADPFFSHHVAT  427
            A ++AS  FCGIP  S++AA +S +   A  TRFL +TPLR LGFAAAAADP  SHHVAT
Sbjct  2    ASSAASPAFCGIPKASTAAARASLT---APTTRFLSKTPLRRLGFAAAAADPLLSHHVAT  58

Query  428  QLRSLK-ASTKPVRGVVSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIR  604
            +L S K AS KPVRGV SMAKKSVGDL+ ADLKGKKVFVRADLNVPLDD+Q ITDDTRIR
Sbjct  59   KLVSFKNASAKPVRGVASMAKKSVGDLSGADLKGKKVFVRADLNVPLDDSQNITDDTRIR  118

Query  605  AAIPTIKHLISNG  643
            AA+PTIKHLISNG
Sbjct  119  AAVPTIKHLISNG  131



>ref|XP_011095719.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Sesamum indicum]
Length=481

 Score =   178 bits (452),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 97/135 (72%), Positives = 109/135 (81%), Gaps = 8/135 (6%)
 Frame = +2

Query  248  AMASASYTFCGIPTTsssaassssssKRAVI--TRFLPRTPLRSLGFAAAAADPFFSHHV  421
            A  +AS  FCGIP  S+S +++     RA I  TRFL + PLR LGF+AAAA+P  SHHV
Sbjct  2    ASTAASPAFCGIPKASTSTSAA-----RASIPATRFLAKNPLRGLGFSAAAAEPLLSHHV  56

Query  422  ATQLRSLKAST-KPVRGVVSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTR  598
            AT+LRS  +S+ KPVRGV SMAKKSVGDLTAADLKGKKVFVRADLNVPLDD Q ITDDTR
Sbjct  57   ATKLRSFGSSSAKPVRGVASMAKKSVGDLTAADLKGKKVFVRADLNVPLDDNQNITDDTR  116

Query  599  IRAAIPTIKHLISNG  643
            IRAA+PTIKHLISNG
Sbjct  117  IRAAVPTIKHLISNG  131



>ref|XP_004243968.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Solanum lycopersicum]
Length=482

 Score =   176 bits (447),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 114/132 (86%), Gaps = 2/132 (2%)
 Frame = +2

Query  248  AMASASYTFCGIPTTsssaassssssKRAVITRFLPRTPLRSLGFAAAAADPFFSHHVAT  427
            A A+AS+T CGIPTTSSS+ ++ S++  +   RFL +TPLR LGFA   ADP F++HVAT
Sbjct  2    ASATASHTLCGIPTTSSSSTTNKSTTYSS--ARFLLKTPLRRLGFAGTVADPLFTNHVAT  59

Query  428  QLRSLKASTKPVRGVVSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRA  607
            +LRS+KAS+ PVR VVSMAKKSVGDL+++DLKGKKVFVRADLNVPLDD+Q ITDDTRIRA
Sbjct  60   KLRSVKASSNPVRAVVSMAKKSVGDLSSSDLKGKKVFVRADLNVPLDDSQNITDDTRIRA  119

Query  608  AIPTIKHLISNG  643
            AIPTIKHLI+NG
Sbjct  120  AIPTIKHLIANG  131



>ref|XP_006359791.1| PREDICTED: uncharacterized protein LOC102577647 [Solanum tuberosum]
Length=1046

 Score =   179 bits (453),  Expect = 1e-47, Method: Composition-based stats.
 Identities = 98/133 (74%), Positives = 115/133 (86%), Gaps = 2/133 (2%)
 Frame = +2

Query  248  AMASASYTFCGIPTTsssaassssssKRAVITRFLPRTPLRSLGFAAAAADPFFSHHVAT  427
            A A+AS+TFCGIPTTSSS+ ++ S++  +   RFL +TPLR LGFA A ADP F++HVAT
Sbjct  2    ASATASHTFCGIPTTSSSSTTNRSTTHSS--ARFLLKTPLRRLGFAGAVADPLFTNHVAT  59

Query  428  QLRSLKASTKPVRGVVSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRA  607
            +LRSLKAS+ PVR VVSMAKKSVGDL+++DLKGKKVFVRADLNVPLDD Q ITDDTRIRA
Sbjct  60   KLRSLKASSNPVRAVVSMAKKSVGDLSSSDLKGKKVFVRADLNVPLDDAQNITDDTRIRA  119

Query  608  AIPTIKHLISNGG  646
            AIPTIKHLI+NG 
Sbjct  120  AIPTIKHLIANGA  132



>gb|EYU33792.1| hypothetical protein MIMGU_mgv1a005422mg [Erythranthe guttata]
Length=484

 Score =   162 bits (410),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 100/125 (80%), Gaps = 3/125 (2%)
 Frame = +2

Query  272  FCGIPTTsssaassssssKRAVITRFLPRTPLRSLGFAAAAADPFFSHHVATQLRSLK-A  448
            FCGIP  S++ A+ +S   +   TRFL +TP R LGFAAAAADP  S HVA ++ SLK  
Sbjct  12   FCGIPKASTATAARASL--KTPTTRFLSKTPTRGLGFAAAAADPLLSRHVAVKMASLKRG  69

Query  449  STKPVRGVVSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKH  628
            S+  VRGV SM KKSVGDLTAA+LKGK+VFVRADLNVPLDD+Q ITDDTRIRAAIPTIKH
Sbjct  70   SSAAVRGVASMVKKSVGDLTAAELKGKRVFVRADLNVPLDDSQNITDDTRIRAAIPTIKH  129

Query  629  LISNG  643
            LISNG
Sbjct  130  LISNG  134



>gb|EPS66037.1| phosphoglycerate kinase, chloroplastic [Genlisea aurea]
Length=487

 Score =   160 bits (404),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 103/133 (77%), Gaps = 3/133 (2%)
 Frame = +2

Query  254  ASASYTFCGIPTTsssaassssssKRAV-ITRFLPRTPLRSLGFAAAAADPFFSHHVATQ  430
            A+AS   CG+P  S+  A+SS S+   V  +RFL RTPLR LGF+AAA DP  +HHVA +
Sbjct  5    AAASPALCGVPKASTGGAASSRSASPCVPGSRFLGRTPLRRLGFSAAAVDPILAHHVAAR  64

Query  431  LRSL--KASTKPVRGVVSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIR  604
              S    A  KP RGVVSMAKKSVGDL+AADLKG++VFVRADLNVPLDD Q ITDDTRIR
Sbjct  65   SASFIRSAGKKPARGVVSMAKKSVGDLSAADLKGRRVFVRADLNVPLDDNQNITDDTRIR  124

Query  605  AAIPTIKHLISNG  643
            AA+PTIKHLI+NG
Sbjct  125  AAVPTIKHLINNG  137



>ref|XP_009402843.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Musa acuminata 
subsp. malaccensis]
Length=480

 Score =   148 bits (373),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 82/97 (85%), Gaps = 1/97 (1%)
 Frame = +2

Query  356  RTPLRSLGFAAAAADPFFSHHVATQLRSLKA-STKPVRGVVSMAKKSVGDLTAADLKGKK  532
            R+PLR LGFA AAADP  + HVA ++RS+   S K  RGV SMAKKSVGDLTAADLKGKK
Sbjct  34   RSPLRRLGFAGAAADPLLAAHVAAKIRSVAGRSGKGSRGVASMAKKSVGDLTAADLKGKK  93

Query  533  VFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            VFVRADLNVPLD+ + ITDDTRIRAA+PTIKHLISNG
Sbjct  94   VFVRADLNVPLDENRNITDDTRIRAAVPTIKHLISNG  130



>ref|XP_002513353.1| phosphoglycerate kinase, putative [Ricinus communis]
 gb|EEF48756.1| phosphoglycerate kinase, putative [Ricinus communis]
Length=479

 Score =   147 bits (372),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 77/95 (81%), Positives = 81/95 (85%), Gaps = 3/95 (3%)
 Frame = +2

Query  359  TPLRSLGFAAAAADPFFSHHVATQLRSLKASTKPVRGVVSMAKKSVGDLTAADLKGKKVF  538
            T LR LGFAAA  DP FSHHVA+++RS   S K  R VVSMAKKSVGDLTAADLKGKKVF
Sbjct  38   TTLRRLGFAAA--DPAFSHHVASKIRSF-GSGKASRAVVSMAKKSVGDLTAADLKGKKVF  94

Query  539  VRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            VRADLNVPLDD QKITDDTRIRAAIPT+KHLI NG
Sbjct  95   VRADLNVPLDDNQKITDDTRIRAAIPTVKHLIQNG  129



>ref|XP_011013857.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Populus euphratica]
Length=481

 Score =   146 bits (368),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 77/103 (75%), Positives = 83/103 (81%), Gaps = 2/103 (2%)
 Frame = +2

Query  335  VITRFLPRTPLRSLGFAAAAADPFFSHHVATQLRSLKASTKPVRGVVSMAKKSVGDLTAA  514
            V T  L  T LR LGF+AA  D  FS HV +++RS K++ K  R VVSMAKKSVGDLTAA
Sbjct  31   VSTSGLRTTSLRGLGFSAA--DTLFSSHVVSKIRSFKSNGKAPRAVVSMAKKSVGDLTAA  88

Query  515  DLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            DLKGKKVFVRADLNVPLDD Q ITDDTRIRAAIPTIKHLISNG
Sbjct  89   DLKGKKVFVRADLNVPLDDNQNITDDTRIRAAIPTIKHLISNG  131



>ref|XP_004488763.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Cicer 
arietinum]
Length=479

 Score =   145 bits (367),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 87/132 (66%), Positives = 101/132 (77%), Gaps = 4/132 (3%)
 Frame = +2

Query  248  AMASASYTFCGIPTTsssaassssssKRAVITRFLPRTPLRSLGFAAAAADPFFSHHVAT  427
            A A+A  T   +PTT SS+ S+S SS R  ++ FL   PLR LGFAAA  DP  +  VA+
Sbjct  2    ASATAPTTLSLLPTTKSSSPSASPSSSRVHLSSFLGARPLRRLGFAAA--DPLLAVQVAS  59

Query  428  QLRSLKASTKPVRGVVSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRA  607
            +LR++  S +  RGVVSMAKKSVGDL+AA+LKGKKVFVRADLNVPLDD Q ITDDTRIRA
Sbjct  60   KLRTV--SGRGARGVVSMAKKSVGDLSAAELKGKKVFVRADLNVPLDDNQNITDDTRIRA  117

Query  608  AIPTIKHLISNG  643
            AIPTIKHLI NG
Sbjct  118  AIPTIKHLIQNG  129



>ref|XP_011016496.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Populus euphratica]
Length=481

 Score =   145 bits (367),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 75/103 (73%), Positives = 85/103 (83%), Gaps = 2/103 (2%)
 Frame = +2

Query  335  VITRFLPRTPLRSLGFAAAAADPFFSHHVATQLRSLKASTKPVRGVVSMAKKSVGDLTAA  514
            V T  L  T LR LGF+AA  DP FS HV +++RS K++ +  R VVSMAKKSVGDLTAA
Sbjct  31   VSTSGLRTTSLRGLGFSAA--DPLFSSHVVSKIRSFKSNGRAPRAVVSMAKKSVGDLTAA  88

Query  515  DLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            DLKGKKVFVRADLNVPLD+ QKITDDTRIRAA+PTIK+LISNG
Sbjct  89   DLKGKKVFVRADLNVPLDENQKITDDTRIRAAVPTIKYLISNG  131



>ref|XP_002315066.1| PHOSPHOGLYCERATE KINASE 1 family protein [Populus trichocarpa]
 gb|EEF01237.1| PHOSPHOGLYCERATE KINASE 1 family protein [Populus trichocarpa]
Length=481

 Score =   144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 76/103 (74%), Positives = 83/103 (81%), Gaps = 2/103 (2%)
 Frame = +2

Query  335  VITRFLPRTPLRSLGFAAAAADPFFSHHVATQLRSLKASTKPVRGVVSMAKKSVGDLTAA  514
            V T  L  T LR LGF+AA  D  FS HV +++RS K++ K  R VVSMAKKSVGDLTAA
Sbjct  31   VSTSGLRTTSLRGLGFSAA--DTLFSSHVVSKIRSFKSNGKAPRAVVSMAKKSVGDLTAA  88

Query  515  DLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            DLKGKKVFVRADLNVPLDD Q ITDDTRIRAAIPTIK+LISNG
Sbjct  89   DLKGKKVFVRADLNVPLDDNQNITDDTRIRAAIPTIKYLISNG  131



>ref|XP_002263796.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Vitis vinifera]
 emb|CAN81990.1| hypothetical protein VITISV_000725 [Vitis vinifera]
Length=478

 Score =   144 bits (363),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 79/98 (81%), Gaps = 2/98 (2%)
 Frame = +2

Query  350  LPRTPLRSLGFAAAAADPFFSHHVATQLRSLKASTKPVRGVVSMAKKSVGDLTAADLKGK  529
            LP  PLR LGFA AAAD   + HVA++ RS +   K  RGVVSMAKKSVGDLT ADLKGK
Sbjct  33   LPTLPLRRLGFAGAAADSLLTLHVASRTRSFRG--KASRGVVSMAKKSVGDLTGADLKGK  90

Query  530  KVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            KVFVR DLNVPLDD QKITDDTR+RAAIPTIK+LI NG
Sbjct  91   KVFVRVDLNVPLDDNQKITDDTRVRAAIPTIKYLIDNG  128



>ref|XP_002312238.1| hypothetical protein POPTR_0008s08410g [Populus trichocarpa]
 dbj|BAA33803.1| chloroplast phosphoglycerate kinase [Populus nigra]
 gb|EEE89605.1| hypothetical protein POPTR_0008s08410g [Populus trichocarpa]
Length=481

 Score =   143 bits (360),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 74/103 (72%), Positives = 84/103 (82%), Gaps = 2/103 (2%)
 Frame = +2

Query  335  VITRFLPRTPLRSLGFAAAAADPFFSHHVATQLRSLKASTKPVRGVVSMAKKSVGDLTAA  514
            V T  L  T LR LGF+AA  DP FS HV +++RS K++ +  R VVSMAKKSVGDLTAA
Sbjct  31   VSTSGLRTTSLRGLGFSAA--DPLFSSHVVSKIRSFKSNGRAPRAVVSMAKKSVGDLTAA  88

Query  515  DLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            DLKGKKVFVRADLNVPLD+ QKITDDTRIRAA+PTIK+LIS G
Sbjct  89   DLKGKKVFVRADLNVPLDENQKITDDTRIRAAVPTIKYLISKG  131



>gb|ABK96267.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ABK96531.1| unknown [Populus trichocarpa x Populus deltoides]
Length=481

 Score =   143 bits (360),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 74/103 (72%), Positives = 84/103 (82%), Gaps = 2/103 (2%)
 Frame = +2

Query  335  VITRFLPRTPLRSLGFAAAAADPFFSHHVATQLRSLKASTKPVRGVVSMAKKSVGDLTAA  514
            V T  L  T LR LGF+AA  DP FS HV +++RS K++ +  R VVSMAKKSVGDLTAA
Sbjct  31   VSTSGLRTTSLRGLGFSAA--DPLFSSHVVSKIRSFKSNGRAPRAVVSMAKKSVGDLTAA  88

Query  515  DLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            DLKGKKVFVRADLNVPLD+ QKITDDTRIRAA+PTIK+LIS G
Sbjct  89   DLKGKKVFVRADLNVPLDENQKITDDTRIRAAVPTIKYLISKG  131



>ref|XP_010923458.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Elaeis 
guineensis]
Length=492

 Score =   139 bits (351),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 69/97 (71%), Positives = 79/97 (81%), Gaps = 1/97 (1%)
 Frame = +2

Query  356  RTPLRSLGFAAAAADPFFSHHVATQLRSLKA-STKPVRGVVSMAKKSVGDLTAADLKGKK  532
            R+P R LGFA AAADP  + HVA ++R++   S +  RGV  MAKKSVGDLTAADLKGK+
Sbjct  46   RSPFRRLGFAGAAADPLLALHVAARIRAVAGRSGRGPRGVAVMAKKSVGDLTAADLKGKR  105

Query  533  VFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            VFVRADLNVPLD+ Q ITDDTRIRAA+PTIKHLI NG
Sbjct  106  VFVRADLNVPLDENQNITDDTRIRAAVPTIKHLIGNG  142



>ref|XP_010269369.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Nelumbo 
nucifera]
Length=486

 Score =   139 bits (351),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 71/96 (74%), Positives = 78/96 (81%), Gaps = 4/96 (4%)
 Frame = +2

Query  356  RTPLRSLGFAAAAADPFFSHHVATQLRSLKASTKPVRGVVSMAKKSVGDLTAADLKGKKV  535
            R PLR LGF+A   DP  S HVA ++R++    K VRGVVSMAKKSVGDLTAADLKGKKV
Sbjct  45   RAPLRRLGFSAV--DPLLSLHVAAKVRAVNG--KGVRGVVSMAKKSVGDLTAADLKGKKV  100

Query  536  FVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            FVRADLNVPLD  Q ITDDTR+RAA+PTIKHLI NG
Sbjct  101  FVRADLNVPLDGNQNITDDTRVRAAVPTIKHLIGNG  136



>gb|KJB14026.1| hypothetical protein B456_002G107300 [Gossypium raimondii]
Length=488

 Score =   139 bits (350),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 75/102 (74%), Positives = 84/102 (82%), Gaps = 4/102 (4%)
 Frame = +2

Query  344  RFLPRTPL-RSLGFAAAAA-DPFFSHHVATQLRSLKASTKPVRGVVSMAKKSVGDLTAAD  517
            R L  +PL  SLGF++AA+ D   S HV++++RS K   K  RGVVSMAKKSVGDLTAAD
Sbjct  39   RHLKSSPLIHSLGFSSAASGDSLLSLHVSSKVRSFKG--KGSRGVVSMAKKSVGDLTAAD  96

Query  518  LKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            LKGKKVFVRADLNVPLDD+Q ITDDTRIRAAIPTIKHLI NG
Sbjct  97   LKGKKVFVRADLNVPLDDSQNITDDTRIRAAIPTIKHLIQNG  138



>gb|ADV16381.1| chloroplast phosphoglycerate kinase 3 [Helianthus annuus]
Length=481

 Score =   139 bits (350),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 74/101 (73%), Positives = 82/101 (81%), Gaps = 3/101 (3%)
 Frame = +2

Query  341  TRFLPRTPLRSLGFAAAAADPFFSHHVATQLRSLKASTKPVRGVVSMAKKSVGDLTAADL  520
            +RFL R+PLR LGFAAA  D  FS HVA++LRS   S KP+   V  AKKSVGDL+ A+L
Sbjct  33   SRFL-RSPLRGLGFAAA--DTAFSAHVASKLRSCSTSVKPISRGVFAAKKSVGDLSPAEL  89

Query  521  KGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            KGKKVFVRADLNVPLDD Q ITDDTRIRAA+PTIKHLISNG
Sbjct  90   KGKKVFVRADLNVPLDDNQNITDDTRIRAAVPTIKHLISNG  130



>gb|KJB14025.1| hypothetical protein B456_002G107300 [Gossypium raimondii]
Length=491

 Score =   139 bits (350),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 75/102 (74%), Positives = 84/102 (82%), Gaps = 4/102 (4%)
 Frame = +2

Query  344  RFLPRTPL-RSLGFAAAAA-DPFFSHHVATQLRSLKASTKPVRGVVSMAKKSVGDLTAAD  517
            R L  +PL  SLGF++AA+ D   S HV++++RS K   K  RGVVSMAKKSVGDLTAAD
Sbjct  39   RHLKSSPLIHSLGFSSAASGDSLLSLHVSSKVRSFKG--KGSRGVVSMAKKSVGDLTAAD  96

Query  518  LKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            LKGKKVFVRADLNVPLDD+Q ITDDTRIRAAIPTIKHLI NG
Sbjct  97   LKGKKVFVRADLNVPLDDSQNITDDTRIRAAIPTIKHLIQNG  138



>ref|XP_008372155.1| PREDICTED: phosphoglycerate kinase 1, chloroplastic-like [Malus 
domestica]
Length=396

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/95 (75%), Positives = 80/95 (84%), Gaps = 3/95 (3%)
 Frame = +2

Query  359  TPLRSLGFAAAAADPFFSHHVATQLRSLKASTKPVRGVVSMAKKSVGDLTAADLKGKKVF  538
            T LR LGF+AA  DP  +  VA+++RS   S K VRGVV+MAKKSVGDL+AA+LKGKKVF
Sbjct  39   TALRRLGFSAA--DPLLALQVASKVRSF-GSGKGVRGVVAMAKKSVGDLSAAELKGKKVF  95

Query  539  VRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            VRADLNVPLDD+Q ITDDTRIRAAIPTIKHLI NG
Sbjct  96   VRADLNVPLDDSQNITDDTRIRAAIPTIKHLIENG  130



>ref|XP_003596091.1| Phosphoglycerate kinase [Medicago truncatula]
 gb|AES66342.1| phosphoglycerate kinase-like protein [Medicago truncatula]
Length=479

 Score =   137 bits (346),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 84/105 (80%), Gaps = 4/105 (4%)
 Frame = +2

Query  329  RAVITRFLPRTPLRSLGFAAAAADPFFSHHVATQLRSLKASTKPVRGVVSMAKKSVGDLT  508
            R  ++ FL   PLR LGFAAA  DP  +  VA+++R++  S + VRGVVSMAKKSVGDL+
Sbjct  29   RIHLSSFLGARPLRRLGFAAA--DPLLAVQVASKVRTV--SGRGVRGVVSMAKKSVGDLS  84

Query  509  AADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
             A+LKGKKVFVRADLNVPLDD Q ITDDTRIRAAIPTIK+LI NG
Sbjct  85   GAELKGKKVFVRADLNVPLDDNQNITDDTRIRAAIPTIKYLIQNG  129



>ref|XP_008371996.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Malus 
domestica]
Length=480

 Score =   137 bits (346),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 71/95 (75%), Positives = 80/95 (84%), Gaps = 3/95 (3%)
 Frame = +2

Query  359  TPLRSLGFAAAAADPFFSHHVATQLRSLKASTKPVRGVVSMAKKSVGDLTAADLKGKKVF  538
            T LR LGF+AA  DP  +  VA+++RS   S K VRGVV+MAKKSVGDL+AA+LKGKKVF
Sbjct  39   TALRRLGFSAA--DPLLALQVASKVRSF-GSGKGVRGVVAMAKKSVGDLSAAELKGKKVF  95

Query  539  VRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            VRADLNVPLDD+Q ITDDTRIRAAIPTIKHLI NG
Sbjct  96   VRADLNVPLDDSQNITDDTRIRAAIPTIKHLIENG  130



>ref|XP_008226130.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Prunus mume]
Length=480

 Score =   137 bits (346),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 71/95 (75%), Positives = 80/95 (84%), Gaps = 3/95 (3%)
 Frame = +2

Query  359  TPLRSLGFAAAAADPFFSHHVATQLRSLKASTKPVRGVVSMAKKSVGDLTAADLKGKKVF  538
            T LR LGF+AA  DP F+  VA+++RS   S K VRGVVSMAK+SVGDL+AADLKGK+VF
Sbjct  39   TTLRRLGFSAA--DPLFALQVASKIRSF-GSGKAVRGVVSMAKRSVGDLSAADLKGKRVF  95

Query  539  VRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            VRADLNVPLDD+Q ITDDTRIRAAIPTIKHLI  G
Sbjct  96   VRADLNVPLDDSQNITDDTRIRAAIPTIKHLIEKG  130



>ref|XP_008346077.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Malus domestica]
Length=480

 Score =   137 bits (345),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 71/95 (75%), Positives = 80/95 (84%), Gaps = 3/95 (3%)
 Frame = +2

Query  359  TPLRSLGFAAAAADPFFSHHVATQLRSLKASTKPVRGVVSMAKKSVGDLTAADLKGKKVF  538
            T LR LGF+AA  DP  +  VA+++RS   S K VRGVV+MAKKSVGDL+AA+LKGKKVF
Sbjct  39   TALRRLGFSAA--DPLLALQVASKVRSF-GSGKGVRGVVAMAKKSVGDLSAAELKGKKVF  95

Query  539  VRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            VRADLNVPLDD+Q ITDDTRIRAAIPTIKHLI NG
Sbjct  96   VRADLNVPLDDSQNITDDTRIRAAIPTIKHLIENG  130



>gb|KHG01489.1| hypothetical protein F383_22605 [Gossypium arboreum]
Length=488

 Score =   137 bits (345),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 71/94 (76%), Positives = 80/94 (85%), Gaps = 3/94 (3%)
 Frame = +2

Query  365  LRSLGFAAAAA-DPFFSHHVATQLRSLKASTKPVRGVVSMAKKSVGDLTAADLKGKKVFV  541
            + SLGF++AA+ D   S HV++++RS K   K  RGVVSMAKKSVGDLTAADLKGKKVFV
Sbjct  47   IHSLGFSSAASGDSLLSLHVSSKVRSFKG--KGSRGVVSMAKKSVGDLTAADLKGKKVFV  104

Query  542  RADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            RADLNVPLDD+Q ITDDTRIRAAIPTIKHLI NG
Sbjct  105  RADLNVPLDDSQNITDDTRIRAAIPTIKHLIQNG  138



>ref|XP_008805983.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Phoenix dactylifera]
 ref|XP_008776889.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Phoenix dactylifera]
Length=488

 Score =   136 bits (343),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 79/97 (81%), Gaps = 1/97 (1%)
 Frame = +2

Query  356  RTPLRSLGFAAAAADPFFSHHVATQLRSLKA-STKPVRGVVSMAKKSVGDLTAADLKGKK  532
            R+PL  LGFA AAADP  + HVA ++ ++   S +  RGV +MAKKSVGDLTAADLKGK+
Sbjct  42   RSPLHRLGFAGAAADPLLAVHVAERIWAVAGRSGRGPRGVATMAKKSVGDLTAADLKGKR  101

Query  533  VFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            VFVRADLNVPLD+ Q ITDDTRIRAA+PTIKHL+ NG
Sbjct  102  VFVRADLNVPLDENQNITDDTRIRAAVPTIKHLMGNG  138



>ref|XP_009397212.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
 gb|ABF70168.1| phosphoglycerate kinase, chloroplast, putative [Musa acuminata]
Length=479

 Score =   136 bits (343),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 70/102 (69%), Positives = 80/102 (78%), Gaps = 1/102 (1%)
 Frame = +2

Query  341  TRFLPRTPLRSLGFAAAAADPFFSHHVATQLRSLKA-STKPVRGVVSMAKKSVGDLTAAD  517
            +R   R+P R LGFA  AAD   + HVA ++R++   S K  RGV  MAKKSVGDLTAAD
Sbjct  28   SRLTLRSPSRRLGFAGVAADSLLAAHVAAKIRTVAGRSGKGPRGVAVMAKKSVGDLTAAD  87

Query  518  LKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            LKGKKVFVRADLNVPLD+ + ITDDTRIRAA+PTIKHLISNG
Sbjct  88   LKGKKVFVRADLNVPLDEDRNITDDTRIRAAVPTIKHLISNG  129



>ref|XP_007213965.1| hypothetical protein PRUPE_ppa005031mg [Prunus persica]
 gb|EMJ15164.1| hypothetical protein PRUPE_ppa005031mg [Prunus persica]
Length=480

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 79/93 (85%), Gaps = 3/93 (3%)
 Frame = +2

Query  365  LRSLGFAAAAADPFFSHHVATQLRSLKASTKPVRGVVSMAKKSVGDLTAADLKGKKVFVR  544
            LR LGF+AA  DP F+  VA+++RS   S K VRGVVSMAK+SVGDL+AADLKGK+VFVR
Sbjct  41   LRRLGFSAA--DPLFALQVASKVRSF-GSGKAVRGVVSMAKRSVGDLSAADLKGKRVFVR  97

Query  545  ADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            ADLNVPLDD+Q ITDDTRIRAAIPTIKHLI  G
Sbjct  98   ADLNVPLDDSQNITDDTRIRAAIPTIKHLIEKG  130



>ref|XP_008349091.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Malus 
domestica]
Length=480

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 71/95 (75%), Positives = 79/95 (83%), Gaps = 3/95 (3%)
 Frame = +2

Query  359  TPLRSLGFAAAAADPFFSHHVATQLRSLKASTKPVRGVVSMAKKSVGDLTAADLKGKKVF  538
            T LR LGF+AA  DP  +  VA+++RS   S K VRGVV+MAKKSVGDLTAA+LKGKKVF
Sbjct  39   TALRRLGFSAA--DPLLALQVASKVRSF-GSGKGVRGVVAMAKKSVGDLTAAELKGKKVF  95

Query  539  VRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            VRADLNVPLDD+Q ITDDTRIRAAIPTIKHLI  G
Sbjct  96   VRADLNVPLDDSQNITDDTRIRAAIPTIKHLIEKG  130



>gb|KDP25067.1| hypothetical protein JCGZ_22602 [Jatropha curcas]
Length=487

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/90 (78%), Positives = 74/90 (82%), Gaps = 3/90 (3%)
 Frame = +2

Query  374  LGFAAAAADPFFSHHVATQLRSLKASTKPVRGVVSMAKKSVGDLTAADLKGKKVFVRADL  553
            LGFA A  DP FSHHVA+++RS     K  R VVSMAKKSVGDLT ADLKGK+VFVRADL
Sbjct  51   LGFAPA--DPLFSHHVASKIRSF-GFGKASRAVVSMAKKSVGDLTGADLKGKRVFVRADL  107

Query  554  NVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            NVPLDD Q ITDDTRIRAAIPTIKHLI NG
Sbjct  108  NVPLDDNQNITDDTRIRAAIPTIKHLIQNG  137



>ref|XP_008383150.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Malus 
domestica]
Length=480

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 71/95 (75%), Positives = 79/95 (83%), Gaps = 3/95 (3%)
 Frame = +2

Query  359  TPLRSLGFAAAAADPFFSHHVATQLRSLKASTKPVRGVVSMAKKSVGDLTAADLKGKKVF  538
            T LR LGF+AA  DP  +  VA+++RS   S K VRGVV+MAKKSVGDLTAA+LKGKKVF
Sbjct  39   TALRRLGFSAA--DPLLALQVASKVRSF-GSGKGVRGVVAMAKKSVGDLTAAELKGKKVF  95

Query  539  VRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            VRADLNVPLDD+Q ITDDTRIRAAIPTIKHLI  G
Sbjct  96   VRADLNVPLDDSQNITDDTRIRAAIPTIKHLIEKG  130



>gb|KDO61595.1| hypothetical protein CISIN_1g011942mg [Citrus sinensis]
 gb|KDO61596.1| hypothetical protein CISIN_1g011942mg [Citrus sinensis]
Length=360

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 84/113 (74%), Gaps = 8/113 (7%)
 Frame = +2

Query  350  LPRTPLRSLGFAAAAADPFFSHHVATQLRSLKASTKPVRGVVSMAKKSVGDLTAADLKGK  529
            +P +  R LGF+AA  DP  + HVA++L S+K  TK  R VVSMAKKSVG+L+ ADLKGK
Sbjct  31   MPTSASRRLGFSAA--DPLLTCHVASRLSSIK--TKGTRAVVSMAKKSVGELSGADLKGK  86

Query  530  KVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGG----*SHSVQPSGT  676
            KVFVRADLNVPLDD Q ITDDTRIRAA+PTIKHLI NG      SH  +P G 
Sbjct  87   KVFVRADLNVPLDDNQNITDDTRIRAAVPTIKHLIQNGAKVILSSHLGRPKGV  139



>ref|XP_010060861.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Eucalyptus 
grandis]
 gb|KCW67742.1| hypothetical protein EUGRSUZ_F01476 [Eucalyptus grandis]
Length=484

 Score =   135 bits (339),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 79/98 (81%), Gaps = 4/98 (4%)
 Frame = +2

Query  350  LPRTPLRSLGFAAAAADPFFSHHVATQLRSLKASTKPVRGVVSMAKKSVGDLTAADLKGK  529
            L  + LR LGFAAA  DPF + HVA++LRSL+   K  RGVVSMAKKSVGDLT   LKGK
Sbjct  41   LRSSGLRRLGFAAA--DPFLAAHVASKLRSLRG--KGSRGVVSMAKKSVGDLTGPALKGK  96

Query  530  KVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            KVFVRADLNVPLDD Q ITDDTR+RAA+PTIK+LI NG
Sbjct  97   KVFVRADLNVPLDDNQNITDDTRVRAAVPTIKYLIQNG  134



>ref|XP_008456300.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Cucumis melo]
Length=485

 Score =   134 bits (337),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 71/90 (79%), Positives = 74/90 (82%), Gaps = 4/90 (4%)
 Frame = +2

Query  374  LGFAAAAADPFFSHHVATQLRSLKASTKPVRGVVSMAKKSVGDLTAADLKGKKVFVRADL  553
            LGFAAA  DP FS HVA+++RS     K  RGVVSMAKKSVGDLTAADLKGKKVFVRADL
Sbjct  50   LGFAAA--DPLFSLHVASKIRSFGG--KASRGVVSMAKKSVGDLTAADLKGKKVFVRADL  105

Query  554  NVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            NVPLDD Q ITDDTRIRAAIPTIKHL   G
Sbjct  106  NVPLDDNQNITDDTRIRAAIPTIKHLTEKG  135



>ref|XP_008786111.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Phoenix dactylifera]
Length=491

 Score =   134 bits (337),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 65/97 (67%), Positives = 78/97 (80%), Gaps = 1/97 (1%)
 Frame = +2

Query  356  RTPLRSLGFAAAAADPFFSHHVATQLRSLKA-STKPVRGVVSMAKKSVGDLTAADLKGKK  532
            R+P R LGF  AAADP  + HVA ++R++   S +  RGV +MAKKSVGDLTA+DLKGK+
Sbjct  45   RSPFRRLGFTGAAADPLLALHVAAKIRAVAGRSGRGPRGVAAMAKKSVGDLTASDLKGKR  104

Query  533  VFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            VFVRADLNVPLD+ Q ITDDTRIRAA+PTIKHL+  G
Sbjct  105  VFVRADLNVPLDENQNITDDTRIRAAVPTIKHLMGKG  141



>gb|KDO61594.1| hypothetical protein CISIN_1g011942mg [Citrus sinensis]
Length=474

 Score =   134 bits (336),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 79/98 (81%), Gaps = 4/98 (4%)
 Frame = +2

Query  350  LPRTPLRSLGFAAAAADPFFSHHVATQLRSLKASTKPVRGVVSMAKKSVGDLTAADLKGK  529
            +P +  R LGF+AA  DP  + HVA++L S+K  TK  R VVSMAKKSVG+L+ ADLKGK
Sbjct  31   MPTSASRRLGFSAA--DPLLTCHVASRLSSIK--TKGTRAVVSMAKKSVGELSGADLKGK  86

Query  530  KVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            KVFVRADLNVPLDD Q ITDDTRIRAA+PTIKHLI NG
Sbjct  87   KVFVRADLNVPLDDNQNITDDTRIRAAVPTIKHLIQNG  124



>ref|XP_006422251.1| hypothetical protein CICLE_v10004891mg [Citrus clementina]
 ref|XP_006493789.1| PREDICTED: phosphoglycerate kinase 2, chloroplastic-like [Citrus 
sinensis]
 gb|ESR35491.1| hypothetical protein CICLE_v10004891mg [Citrus clementina]
Length=474

 Score =   134 bits (336),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 79/98 (81%), Gaps = 4/98 (4%)
 Frame = +2

Query  350  LPRTPLRSLGFAAAAADPFFSHHVATQLRSLKASTKPVRGVVSMAKKSVGDLTAADLKGK  529
            +P +  R LGF+AA  DP  + HVA++L S+K  TK  R VVSMAKKSVG+L+ ADLKGK
Sbjct  31   MPTSASRRLGFSAA--DPLLTCHVASRLSSIK--TKGTRAVVSMAKKSVGELSGADLKGK  86

Query  530  KVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            KVFVRADLNVPLDD Q ITDDTRIRAA+PTIKHLI NG
Sbjct  87   KVFVRADLNVPLDDNQNITDDTRIRAAVPTIKHLIQNG  124



>ref|XP_004139904.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004154567.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Cucumis 
sativus]
 gb|KGN46797.1| hypothetical protein Csa_6G136020 [Cucumis sativus]
Length=485

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/90 (78%), Positives = 74/90 (82%), Gaps = 4/90 (4%)
 Frame = +2

Query  374  LGFAAAAADPFFSHHVATQLRSLKASTKPVRGVVSMAKKSVGDLTAADLKGKKVFVRADL  553
            LGFAAA  DP FS HVA+++RS     K  RGVVSMAKKSVGDL+AADLKGKKVFVRADL
Sbjct  50   LGFAAA--DPLFSLHVASKIRSFGG--KASRGVVSMAKKSVGDLSAADLKGKKVFVRADL  105

Query  554  NVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            NVPLDD Q ITDDTRIRAAIPTIKHL   G
Sbjct  106  NVPLDDNQNITDDTRIRAAIPTIKHLTEKG  135



>ref|XP_007022578.1| Phosphoglycerate kinase 1 [Theobroma cacao]
 gb|EOY14103.1| Phosphoglycerate kinase 1 [Theobroma cacao]
Length=491

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 77/93 (83%), Gaps = 3/93 (3%)
 Frame = +2

Query  368  RSLGFAAAAA-DPFFSHHVATQLRSLKASTKPVRGVVSMAKKSVGDLTAADLKGKKVFVR  544
            +SLGF+AAA+ D   S HV++++RS K   K  RGVVSMAKKSVGDL+ ADLKGKKVFVR
Sbjct  48   QSLGFSAAASGDSLLSLHVSSKVRSFKG--KGSRGVVSMAKKSVGDLSGADLKGKKVFVR  105

Query  545  ADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            AD NVPLDD Q ITDDTR+RAAIPTIKHLI NG
Sbjct  106  ADFNVPLDDNQNITDDTRVRAAIPTIKHLIQNG  138



>sp|P29409.2|PGKH_SPIOL RecName: Full=Phosphoglycerate kinase, chloroplastic; Flags: 
Precursor, partial [Spinacia oleracea]
 emb|CAA48479.1| phosphoglycerate kinase [Spinacia oleracea]
Length=433

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 73/80 (91%), Gaps = 1/80 (1%)
 Frame = +2

Query  407  FSHHVATQLRSLKA-STKPVRGVVSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKI  583
            FS HV +++ S K+ STKP+RGV SMAKKSVGDLT+ADLKGKKVFVRADLNVPLDD+Q I
Sbjct  4    FSLHVLSKINSYKSQSTKPIRGVASMAKKSVGDLTSADLKGKKVFVRADLNVPLDDSQNI  63

Query  584  TDDTRIRAAIPTIKHLISNG  643
            TDDTRIRAAIPTIKHLI+NG
Sbjct  64   TDDTRIRAAIPTIKHLINNG  83



>ref|XP_003531482.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Glycine 
max]
Length=485

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 81/105 (77%), Gaps = 2/105 (2%)
 Frame = +2

Query  329  RAVITRFLPRTPLRSLGFAAAAADPFFSHHVATQLRSLKASTKPVRGVVSMAKKSVGDLT  508
            R  +T  L   PLR LGFAAA  DP  +  VA ++ +++   K  RGVVSMAKKSVGDL+
Sbjct  33   RVQLTSSLRARPLRRLGFAAA--DPLLAASVAARVAAVRGGGKGARGVVSMAKKSVGDLS  90

Query  509  AADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            AADLKGKKVFVRADLNVPLDD Q ITDDTRIRAAIPTIKHLI NG
Sbjct  91   AADLKGKKVFVRADLNVPLDDNQNITDDTRIRAAIPTIKHLIQNG  135



>ref|XP_010936574.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Elaeis guineensis]
Length=490

 Score =   132 bits (331),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 65/97 (67%), Positives = 78/97 (80%), Gaps = 1/97 (1%)
 Frame = +2

Query  356  RTPLRSLGFAAAAADPFFSHHVATQLRSLKA-STKPVRGVVSMAKKSVGDLTAADLKGKK  532
            R+ +  LGFA AAADP  + HVA ++R++   S +  RGV +MAKKSVGDLTAADLKGK+
Sbjct  44   RSAVHRLGFAGAAADPLLAIHVAAKIRAVTGQSGRGPRGVAAMAKKSVGDLTAADLKGKR  103

Query  533  VFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            VFVRADLNVPLD+ Q ITDDTRIRAA+PTIKHL+  G
Sbjct  104  VFVRADLNVPLDENQNITDDTRIRAAVPTIKHLMGKG  140



>ref|XP_004306579.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Fragaria 
vesca subsp. vesca]
Length=480

 Score =   131 bits (329),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 76/92 (83%), Gaps = 3/92 (3%)
 Frame = +2

Query  368  RSLGFAAAAADPFFSHHVATQLRSLKASTKPVRGVVSMAKKSVGDLTAADLKGKKVFVRA  547
            R LGFA A  DP  + HVA ++RS   S KPVRGVV+MAKKSVGDL+ ADLKGKKVFVRA
Sbjct  42   RRLGFAPA--DPLLALHVAAKVRSF-GSAKPVRGVVAMAKKSVGDLSEADLKGKKVFVRA  98

Query  548  DLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            DLNVPLDD+Q ITDDTRIRAA+PTIK+L+  G
Sbjct  99   DLNVPLDDSQNITDDTRIRAAVPTIKYLMDKG  130



>ref|XP_010669994.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=482

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 76/99 (77%), Gaps = 3/99 (3%)
 Frame = +2

Query  356  RTPLRSLGFAAAAADPFFSHHVATQLRSLKASTK---PVRGVVSMAKKSVGDLTAADLKG  526
            R PLR LGFA   AD   S HV  ++ S   S     P+RGV +M KKSVGDLT+A+LKG
Sbjct  34   RPPLRRLGFAGVVADSALSQHVNYKIHSSFKSLSSSKPIRGVATMVKKSVGDLTSAELKG  93

Query  527  KKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            K+VFVRADLNVPLDD+Q ITDDTRIRAAIPTIKHL++NG
Sbjct  94   KRVFVRADLNVPLDDSQNITDDTRIRAAIPTIKHLMNNG  132



>ref|NP_187884.1| phosphoglycerate kinase 1 [Arabidopsis thaliana]
 sp|Q9LD57.1|PGKH1_ARATH RecName: Full=Phosphoglycerate kinase 1, chloroplastic; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAF70258.1|AF247558_1 phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAK25944.1|AF360234_1 putative phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAL16186.1|AF428418_1 AT3g12780/MBK21_14 [Arabidopsis thaliana]
 dbj|BAB02423.1| phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAK73981.1| AT3g12780/MBK21_14 [Arabidopsis thaliana]
 gb|AAL24323.1| phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAL33785.1| putative phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAM16259.1| AT3g12780/MBK21_14 [Arabidopsis thaliana]
 gb|AAM47957.1| phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAM83218.1| AT3g12780/MBK21_14 [Arabidopsis thaliana]
 dbj|BAE99262.1| phosphoglycerate kinase like protein [Arabidopsis thaliana]
 dbj|BAH19627.1| AT3G12780 [Arabidopsis thaliana]
 gb|AEE75246.1| phosphoglycerate kinase 1 [Arabidopsis thaliana]
Length=481

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 75/92 (82%), Gaps = 2/92 (2%)
 Frame = +2

Query  368  RSLGFAAAAADPFFSHHVATQLRSLKASTKPVRGVVSMAKKSVGDLTAADLKGKKVFVRA  547
            R LGF+A      FS HVA+++ S++   K  RGVVSMAKKSVGDLT+ADLKGKKVFVRA
Sbjct  42   RPLGFSATLDSRRFSLHVASKVESVRG--KGSRGVVSMAKKSVGDLTSADLKGKKVFVRA  99

Query  548  DLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            DLNVPLDD Q ITDDTRIRAAIPTIK+LI NG
Sbjct  100  DLNVPLDDNQTITDDTRIRAAIPTIKYLIENG  131



>emb|CDX73803.1| BnaA03g32440D [Brassica napus]
Length=484

 Score =   129 bits (323),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 79/105 (75%), Gaps = 8/105 (8%)
 Frame = +2

Query  347  FLPRTPL------RSLGFAAAAADPFFSHHVATQLRSLKASTKPVRGVVSMAKKSVGDLT  508
             LP TP       R LGF+A      FS HVA+++ S++   +  RGVVSMAKKSVGDLT
Sbjct  32   LLPITPSSKSISPRPLGFSAVLDSHRFSLHVASKVHSVRG--RGTRGVVSMAKKSVGDLT  89

Query  509  AADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            +ADLKGKKVFVRADLNVPLDD Q ITDDTRIRAAIPTIK+LI NG
Sbjct  90   SADLKGKKVFVRADLNVPLDDNQTITDDTRIRAAIPTIKYLIENG  134



>ref|XP_006407295.1| hypothetical protein EUTSA_v10020621mg [Eutrema salsugineum]
 gb|ESQ48748.1| hypothetical protein EUTSA_v10020621mg [Eutrema salsugineum]
Length=481

 Score =   129 bits (323),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 76/92 (83%), Gaps = 2/92 (2%)
 Frame = +2

Query  368  RSLGFAAAAADPFFSHHVATQLRSLKASTKPVRGVVSMAKKSVGDLTAADLKGKKVFVRA  547
            R LGF+A      FS HVA++++S++   K  RGVVSMAKKSVGDL++ADLKGKKVFVRA
Sbjct  42   RPLGFSAVLESRRFSLHVASKVQSVRG--KGSRGVVSMAKKSVGDLSSADLKGKKVFVRA  99

Query  548  DLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            DLNVPLDD Q ITDDTRIRAAIPTIK+LI NG
Sbjct  100  DLNVPLDDNQTITDDTRIRAAIPTIKYLIDNG  131



>ref|XP_010094703.1| Phosphoglycerate kinase [Morus notabilis]
 gb|EXB56749.1| Phosphoglycerate kinase [Morus notabilis]
Length=478

 Score =   128 bits (322),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 75/95 (79%), Gaps = 3/95 (3%)
 Frame = +2

Query  359  TPLRSLGFAAAAADPFFSHHVATQLRSLKASTKPVRGVVSMAKKSVGDLTAADLKGKKVF  538
            T LR LGF+AA  DP  +  V +++RS     K VRGVVSMAKKS GDLTAADLKGKKVF
Sbjct  37   TVLRRLGFSAA--DPLLALTVNSRVRSF-GGKKAVRGVVSMAKKSGGDLTAADLKGKKVF  93

Query  539  VRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            VRADLNVPL D Q ITDDTR+RAA+PTIKHLI NG
Sbjct  94   VRADLNVPLGDNQNITDDTRVRAAVPTIKHLIQNG  128



>ref|XP_009124670.1| PREDICTED: phosphoglycerate kinase 1, chloroplastic-like [Brassica 
rapa]
Length=480

 Score =   128 bits (322),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 76/92 (83%), Gaps = 3/92 (3%)
 Frame = +2

Query  368  RSLGFAAAAADPFFSHHVATQLRSLKASTKPVRGVVSMAKKSVGDLTAADLKGKKVFVRA  547
            R LGF+A   D  F+ HVA++++S +   K  RGVVSMAKKSVGDLT+ADLKGKKVFVRA
Sbjct  42   RPLGFSAVL-DSRFTVHVASKVQSFRG--KGTRGVVSMAKKSVGDLTSADLKGKKVFVRA  98

Query  548  DLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            DLNVPLDD Q ITDDTRIRAAIPTIK+LI NG
Sbjct  99   DLNVPLDDNQTITDDTRIRAAIPTIKYLIENG  130



>ref|XP_010487004.1| PREDICTED: phosphoglycerate kinase 1, chloroplastic-like [Camelina 
sativa]
Length=481

 Score =   128 bits (322),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 75/92 (82%), Gaps = 2/92 (2%)
 Frame = +2

Query  368  RSLGFAAAAADPFFSHHVATQLRSLKASTKPVRGVVSMAKKSVGDLTAADLKGKKVFVRA  547
            R LGF+A      FS HVA+++ S++   K  RGVVSMAKKSVGDLT+ADLKGKKVFVRA
Sbjct  42   RPLGFSATLDARRFSLHVASKVESVRG--KGSRGVVSMAKKSVGDLTSADLKGKKVFVRA  99

Query  548  DLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            DLNVPLDD Q ITDDTRIRAAIPTIK+LI NG
Sbjct  100  DLNVPLDDNQTITDDTRIRAAIPTIKYLIENG  131



>emb|CDY43401.1| BnaA01g30320D [Brassica napus]
Length=480

 Score =   128 bits (322),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 76/92 (83%), Gaps = 3/92 (3%)
 Frame = +2

Query  368  RSLGFAAAAADPFFSHHVATQLRSLKASTKPVRGVVSMAKKSVGDLTAADLKGKKVFVRA  547
            R LGF+A   D  F+ HVA++++S +   K  RGVVSMAKKSVGDLT+ADLKGKKVFVRA
Sbjct  42   RPLGFSAVL-DSRFTVHVASKVQSFRG--KGTRGVVSMAKKSVGDLTSADLKGKKVFVRA  98

Query  548  DLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            DLNVPLDD Q ITDDTRIRAAIPTIK+LI NG
Sbjct  99   DLNVPLDDNQTITDDTRIRAAIPTIKYLIENG  130



>emb|CDY24247.1| BnaC01g38270D [Brassica napus]
Length=481

 Score =   128 bits (322),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 76/92 (83%), Gaps = 3/92 (3%)
 Frame = +2

Query  368  RSLGFAAAAADPFFSHHVATQLRSLKASTKPVRGVVSMAKKSVGDLTAADLKGKKVFVRA  547
            R LGF+A   D  F+ HVA++++S +   K  RGVVSMAKKSVGDLT+ADLKGKKVFVRA
Sbjct  43   RPLGFSAVL-DSRFTVHVASKVQSFRG--KGTRGVVSMAKKSVGDLTSADLKGKKVFVRA  99

Query  548  DLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            DLNVPLDD Q ITDDTRIRAAIPTIK+LI NG
Sbjct  100  DLNVPLDDNQTITDDTRIRAAIPTIKYLIENG  131



>ref|XP_010499471.1| PREDICTED: phosphoglycerate kinase 1, chloroplastic [Camelina 
sativa]
Length=481

 Score =   128 bits (322),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 75/92 (82%), Gaps = 2/92 (2%)
 Frame = +2

Query  368  RSLGFAAAAADPFFSHHVATQLRSLKASTKPVRGVVSMAKKSVGDLTAADLKGKKVFVRA  547
            R LGF+A      FS HVA+++ S++   K  RGVVSMAKKSVGDLT+ADLKGKKVFVRA
Sbjct  42   RPLGFSATLDARRFSLHVASKVESVRG--KGSRGVVSMAKKSVGDLTSADLKGKKVFVRA  99

Query  548  DLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            DLNVPLDD Q ITDDTRIRAAIPTIK+LI NG
Sbjct  100  DLNVPLDDNQTITDDTRIRAAIPTIKYLIENG  131



>ref|XP_009146585.1| PREDICTED: phosphoglycerate kinase 1, chloroplastic [Brassica 
rapa]
Length=477

 Score =   128 bits (321),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 76/92 (83%), Gaps = 3/92 (3%)
 Frame = +2

Query  368  RSLGFAAAAADPFFSHHVATQLRSLKASTKPVRGVVSMAKKSVGDLTAADLKGKKVFVRA  547
            R LGF+A   D  F+ HVA++++S +   K  RGVVSMAKKSVGDLT+ADLKGKKVFVRA
Sbjct  44   RPLGFSAVL-DSRFTVHVASKVQSFRG--KGTRGVVSMAKKSVGDLTSADLKGKKVFVRA  100

Query  548  DLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            DLNVPLDD Q ITDDTRIRAAIPTIK+LI NG
Sbjct  101  DLNVPLDDNQTITDDTRIRAAIPTIKYLIDNG  132



>tpg|DAA57248.1| TPA: hypothetical protein ZEAMMB73_321071 [Zea mays]
Length=199

 Score =   123 bits (309),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 78/108 (72%), Gaps = 4/108 (4%)
 Frame = +2

Query  326  KRAVITRFLPRTPLRSLGFAA--AAADPFFSHHVATQLRSLKASTKPVRGVVSMAKKSVG  499
            +RA +    P  P RSLG     A ADP  + HVA + RS  ++ +  R   +M KKSVG
Sbjct  33   RRAGLATVCP--PERSLGSDCLRAGADPRLAIHVALRCRSASSTGRGTRAAATMTKKSVG  90

Query  500  DLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            DLTAADL+GK+V VRADLNVPLDD+Q ITDDTR+RAAIPTIKHLISNG
Sbjct  91   DLTAADLEGKRVLVRADLNVPLDDSQNITDDTRVRAAIPTIKHLISNG  138



>ref|XP_010465058.1| PREDICTED: phosphoglycerate kinase 1, chloroplastic-like [Camelina 
sativa]
Length=481

 Score =   128 bits (321),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 75/92 (82%), Gaps = 2/92 (2%)
 Frame = +2

Query  368  RSLGFAAAAADPFFSHHVATQLRSLKASTKPVRGVVSMAKKSVGDLTAADLKGKKVFVRA  547
            R LGF+A      FS HVA+++ S++   K  RGVVSMAKKSVGDLT+ADLKGKKVFVRA
Sbjct  42   RPLGFSATLDARRFSLHVASKVESVRG--KGSRGVVSMAKKSVGDLTSADLKGKKVFVRA  99

Query  548  DLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            DLNVPLDD Q ITDDTRIRAAIPTIK+LI NG
Sbjct  100  DLNVPLDDNQTITDDTRIRAAIPTIKYLIDNG  131



>ref|XP_009135249.1| PREDICTED: phosphoglycerate kinase 1, chloroplastic [Brassica 
rapa]
Length=484

 Score =   128 bits (321),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 79/105 (75%), Gaps = 8/105 (8%)
 Frame = +2

Query  347  FLPRTPL------RSLGFAAAAADPFFSHHVATQLRSLKASTKPVRGVVSMAKKSVGDLT  508
             LP TP       R LGF+A      FS HVA+++ S++   +  RGVVSMAKKSVGDLT
Sbjct  32   LLPITPSPKSTSPRPLGFSAVLDSHRFSLHVASKVHSVRG--RGSRGVVSMAKKSVGDLT  89

Query  509  AADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            +ADLKGKKVFVRADLNVPLDD Q ITDDTRIRAAIPTIK+LI NG
Sbjct  90   SADLKGKKVFVRADLNVPLDDNQTITDDTRIRAAIPTIKYLIENG  134



>ref|XP_006297559.1| hypothetical protein CARUB_v10013582mg [Capsella rubella]
 gb|EOA30457.1| hypothetical protein CARUB_v10013582mg [Capsella rubella]
Length=481

 Score =   127 bits (320),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 75/92 (82%), Gaps = 2/92 (2%)
 Frame = +2

Query  368  RSLGFAAAAADPFFSHHVATQLRSLKASTKPVRGVVSMAKKSVGDLTAADLKGKKVFVRA  547
            R LGF+A      FS HVA+++ S++   K  +GVVSMAKKSVGDLT+ADLKGKKVFVRA
Sbjct  42   RPLGFSATLDSRRFSLHVASKVESVRG--KGSKGVVSMAKKSVGDLTSADLKGKKVFVRA  99

Query  548  DLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            DLNVPLDD Q ITDDTRIRAAIPTIK+LI NG
Sbjct  100  DLNVPLDDNQTITDDTRIRAAIPTIKYLIENG  131



>ref|XP_002884926.1| hypothetical protein ARALYDRAFT_478641 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61185.1| hypothetical protein ARALYDRAFT_478641 [Arabidopsis lyrata subsp. 
lyrata]
Length=481

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 75/92 (82%), Gaps = 2/92 (2%)
 Frame = +2

Query  368  RSLGFAAAAADPFFSHHVATQLRSLKASTKPVRGVVSMAKKSVGDLTAADLKGKKVFVRA  547
            R LGF+A      F+ HVA+++ S++   K  RGVVSMAKKSVGDLT+ADLKGKKVFVRA
Sbjct  42   RPLGFSATLDSRRFTLHVASKVESVRG--KGSRGVVSMAKKSVGDLTSADLKGKKVFVRA  99

Query  548  DLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            DLNVPLDD Q ITDDTRIRAAIPTIK+LI NG
Sbjct  100  DLNVPLDDNQTITDDTRIRAAIPTIKYLIDNG  131



>ref|XP_002891879.1| hypothetical protein ARALYDRAFT_474689 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68138.1| hypothetical protein ARALYDRAFT_474689 [Arabidopsis lyrata subsp. 
lyrata]
Length=478

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 76/92 (83%), Gaps = 3/92 (3%)
 Frame = +2

Query  368  RSLGFAAAAADPFFSHHVATQLRSLKASTKPVRGVVSMAKKSVGDLTAADLKGKKVFVRA  547
            R LGF+A   D  FS HVA++++S++   K  RGV++MAKKSVGDLT+ADLKGKKVFVRA
Sbjct  40   RRLGFSAFV-DSRFSVHVASKVQSVRG--KGTRGVITMAKKSVGDLTSADLKGKKVFVRA  96

Query  548  DLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            DLNVPLDD Q ITDDTRIRAAIPTIK LI NG
Sbjct  97   DLNVPLDDNQNITDDTRIRAAIPTIKFLIENG  128



>emb|CDY00798.1| BnaC03g37820D [Brassica napus]
Length=482

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 76/92 (83%), Gaps = 2/92 (2%)
 Frame = +2

Query  368  RSLGFAAAAADPFFSHHVATQLRSLKASTKPVRGVVSMAKKSVGDLTAADLKGKKVFVRA  547
            R LGF+A      FS HV+++++S++   +  RGVVSMAKKSVGDLT+ADLKGKKVFVRA
Sbjct  43   RPLGFSAVLDSRRFSLHVSSKVQSVRG--RGSRGVVSMAKKSVGDLTSADLKGKKVFVRA  100

Query  548  DLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            DLNVPLDD Q ITDDTRIRAA+PTIK+LI NG
Sbjct  101  DLNVPLDDNQTITDDTRIRAAVPTIKYLIENG  132



>gb|AAF02830.1|AC009894_1 phosphoglycerate kinase [Arabidopsis thaliana]
Length=320

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 73/92 (79%), Gaps = 3/92 (3%)
 Frame = +2

Query  368  RSLGFAAAAADPFFSHHVATQLRSLKASTKPVRGVVSMAKKSVGDLTAADLKGKKVFVRA  547
            R LGF+A   D  FS HVA+++ S++   K  RGV++MAKKSVGDL + DLKGKKVFVRA
Sbjct  40   RRLGFSAVV-DSRFSVHVASKVHSVRG--KGARGVITMAKKSVGDLNSVDLKGKKVFVRA  96

Query  548  DLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            DLNVPLDD Q ITDDTRIRAAIPTIK LI NG
Sbjct  97   DLNVPLDDNQNITDDTRIRAAIPTIKFLIENG  128



>ref|NP_001167912.1| phosphoglycerate kinase [Zea mays]
 gb|ACN26497.1| unknown [Zea mays]
 tpg|DAA57247.1| TPA: phosphoglycerate kinase [Zea mays]
Length=371

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 78/108 (72%), Gaps = 4/108 (4%)
 Frame = +2

Query  326  KRAVITRFLPRTPLRSLGFAA--AAADPFFSHHVATQLRSLKASTKPVRGVVSMAKKSVG  499
            +RA +    P  P RSLG     A ADP  + HVA + RS  ++ +  R   +M KKSVG
Sbjct  33   RRAGLATVCP--PERSLGSDCLRAGADPRLAIHVALRCRSASSTGRGTRAAATMTKKSVG  90

Query  500  DLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            DLTAADL+GK+V VRADLNVPLDD+Q ITDDTR+RAAIPTIKHLISNG
Sbjct  91   DLTAADLEGKRVLVRADLNVPLDDSQNITDDTRVRAAIPTIKHLISNG  138



>ref|NP_176015.1| phosphoglycerate kinase [Arabidopsis thaliana]
 sp|P50318.3|PGKH2_ARATH RecName: Full=Phosphoglycerate kinase 2, chloroplastic; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAG50920.1|AC069159_21 phosphoglycerate kinase, putative [Arabidopsis thaliana]
 gb|AAL07140.1| putative phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAM20449.1| phosphoglycerate kinase, putative [Arabidopsis thaliana]
 gb|AAN15569.1| phosphoglycerate kinase, putative [Arabidopsis thaliana]
 gb|AEE33356.1| phosphoglycerate kinase [Arabidopsis thaliana]
Length=478

 Score =   123 bits (309),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 73/92 (79%), Gaps = 3/92 (3%)
 Frame = +2

Query  368  RSLGFAAAAADPFFSHHVATQLRSLKASTKPVRGVVSMAKKSVGDLTAADLKGKKVFVRA  547
            R LGF+A   D  FS HVA+++ S++   K  RGV++MAKKSVGDL + DLKGKKVFVRA
Sbjct  40   RRLGFSAVV-DSRFSVHVASKVHSVRG--KGARGVITMAKKSVGDLNSVDLKGKKVFVRA  96

Query  548  DLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            DLNVPLDD Q ITDDTRIRAAIPTIK LI NG
Sbjct  97   DLNVPLDDNQNITDDTRIRAAIPTIKFLIENG  128



>ref|XP_002456487.1| hypothetical protein SORBIDRAFT_03g037165 [Sorghum bicolor]
 gb|EES01607.1| hypothetical protein SORBIDRAFT_03g037165 [Sorghum bicolor]
Length=177

 Score =   118 bits (295),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 62/97 (64%), Positives = 75/97 (77%), Gaps = 3/97 (3%)
 Frame = +2

Query  362  PLRSLGFAA--AAADPFFSHHVATQLRSLKASTKPVRGVVSMAKK-SVGDLTAADLKGKK  532
            P RSLG  +  A ADP  + HVA++ RS  ++ +  R   +MAKK SVGDL AADL+GK+
Sbjct  41   PERSLGSVSLGAGADPRLAVHVASRRRSAPSAGRGTRAAATMAKKKSVGDLAAADLEGKR  100

Query  533  VFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            V VRADLNVPLDD+Q ITDDTR+RAAIPTIKHLI+NG
Sbjct  101  VLVRADLNVPLDDSQNITDDTRVRAAIPTIKHLINNG  137



>emb|CDY52872.1| BnaCnng23600D [Brassica napus]
Length=797

 Score =   124 bits (310),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 67/93 (72%), Positives = 76/93 (82%), Gaps = 3/93 (3%)
 Frame = +2

Query  368  RSLGFAAAAADPFFSHHVATQLRSLKASTKPVRGVVSMAKKSVGDLTAADLKGKKVFVRA  547
            R LGF+A   D  F+ HVA++++S +   K  RGVVSMAKKSVGDLT+ADLKGKKVFVRA
Sbjct  397  RPLGFSAVL-DSRFTVHVASKVQSFRG--KGTRGVVSMAKKSVGDLTSADLKGKKVFVRA  453

Query  548  DLNVPLDDTQKITDDTRIRAAIPTIKHLISNGG  646
            DLNVPLDD Q ITDDTRIRAAIPTIK+LI NG 
Sbjct  454  DLNVPLDDNQTITDDTRIRAAIPTIKYLIDNGA  486



>ref|XP_003546820.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Glycine max]
Length=483

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 82/106 (77%), Gaps = 4/106 (4%)
 Frame = +2

Query  329  RAVITRFLPRTPL-RSLGFAAAAADPFFSHHVATQLRSLKASTKPVRGVVSMAKKSVGDL  505
            R  ++  L   PL R LGFAAA  DP  + +VA ++ +++   K  RGVVSMAKKSVG+L
Sbjct  31   RVQLSSSLRSRPLARRLGFAAA--DPLLAANVAARVAAVRGG-KGARGVVSMAKKSVGEL  87

Query  506  TAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            +AADLKGKKVFVRADLNVPLDD Q ITDDTRIRAAIPTIKHLI NG
Sbjct  88   SAADLKGKKVFVRADLNVPLDDNQNITDDTRIRAAIPTIKHLIQNG  133



>ref|XP_003568189.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Brachypodium 
distachyon]
Length=482

 Score =   120 bits (300),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 75/95 (79%), Gaps = 2/95 (2%)
 Frame = +2

Query  362  PLRSLGFAAAA-ADPFFSHHVATQLRSLKASTKPVRGVVSMAKKSVGDLTAADLKGKKVF  538
            P RSL FAA   ADP  + HVA++ R+  +S +  R V +MAKKSVGDL  ADL+GK+V 
Sbjct  36   PARSLAFAAGGGADPRLAIHVASRCRA-ASSARGTRAVATMAKKSVGDLGPADLEGKRVL  94

Query  539  VRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            VRADLNVPLDD+Q ITDDTRIRAAIPTIK+L+SNG
Sbjct  95   VRADLNVPLDDSQNITDDTRIRAAIPTIKYLLSNG  129



>gb|AAT07576.1| putative chloroplast phosphoglycerate kinase [Oryza sativa Japonica 
Group]
Length=310

 Score =   116 bits (290),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 77/95 (81%), Gaps = 2/95 (2%)
 Frame = +2

Query  362  PLRSLGFAAAAADPFFSHHVATQLR-SLKASTKPVRGVVSMAKKSVGDLTAADLKGKKVF  538
            P RSL   AAAADP  + HVA++ R +  +S++  R V +MAKKSVGDLTAADL+GK+VF
Sbjct  88   PARSL-AFAAAADPRLATHVASRCRQAASSSSRGTRAVATMAKKSVGDLTAADLEGKRVF  146

Query  539  VRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            VRADLNVPLDD Q ITDDTR+RAAIPTI++LI NG
Sbjct  147  VRADLNVPLDDNQNITDDTRVRAAIPTIQYLIKNG  181



>ref|XP_007149208.1| hypothetical protein PHAVU_005G050700g [Phaseolus vulgaris]
 gb|ESW21202.1| hypothetical protein PHAVU_005G050700g [Phaseolus vulgaris]
Length=477

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 75/92 (82%), Gaps = 3/92 (3%)
 Frame = +2

Query  368  RSLGFAAAAADPFFSHHVATQLRSLKASTKPVRGVVSMAKKSVGDLTAADLKGKKVFVRA  547
            R LGF AA  DP  + +VA ++ ++K   +  RGVVSMAKKSVGDL+AADLKGKKVFVRA
Sbjct  39   RRLGFTAA--DPLLAANVAARVAAVKVG-RGRRGVVSMAKKSVGDLSAADLKGKKVFVRA  95

Query  548  DLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            DLNVPLDD Q ITDDTRIRAAIPTIK+LI NG
Sbjct  96   DLNVPLDDNQNITDDTRIRAAIPTIKYLIQNG  127



>gb|AFW82396.1| hypothetical protein ZEAMMB73_945417 [Zea mays]
Length=477

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 60/96 (63%), Positives = 72/96 (75%), Gaps = 3/96 (3%)
 Frame = +2

Query  356  RTPLRSLGFAAAAADPFFSHHVATQLRSLKASTKPVRGVVSMAKKSVGDLTAADLKGKKV  535
            R P RSL FAA   D   + HVA++ R   +S +  R + +MAKKSVGDLT ADLKGK+V
Sbjct  35   RQPARSLAFAAG--DARLAVHVASRCRQ-ASSARGTRAMATMAKKSVGDLTEADLKGKRV  91

Query  536  FVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            FVRADLNVPLD+ Q ITDDTRIRAAIPTI++L+  G
Sbjct  92   FVRADLNVPLDENQNITDDTRIRAAIPTIQYLLGKG  127



>gb|AGT16255.1| phosphoglycerate kinase [Saccharum hybrid cultivar R570]
Length=489

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 78/108 (72%), Gaps = 4/108 (4%)
 Frame = +2

Query  326  KRAVITRFLPRTPLRSLGF--AAAAADPFFSHHVATQLRSLKASTKPVRGVVSMAKKSVG  499
            +RA +    P  P R LG    +A ADP  + HVA++ RS  ++ +  R   +MAKKSVG
Sbjct  31   RRAGLAAAFP--PERLLGSDSLSAGADPRLAIHVASRCRSASSAGRGTRAAATMAKKSVG  88

Query  500  DLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            DL AA+L+GK+V VRAD NVPLDD+Q ITDDTR+RAAIPTIKHLI+NG
Sbjct  89   DLAAAELEGKRVLVRADRNVPLDDSQNITDDTRVRAAIPTIKHLINNG  136



>sp|P12782.1|PGKH_WHEAT RecName: Full=Phosphoglycerate kinase, chloroplastic; Flags: 
Precursor [Triticum aestivum]
 emb|CAA33303.1| unnamed protein product [Triticum aestivum]
 emb|CAA51931.1| phosphoglycerate kinase [Triticum aestivum]
Length=480

 Score =   115 bits (287),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 76/94 (81%), Gaps = 2/94 (2%)
 Frame = +2

Query  362  PLRSLGFAAAAADPFFSHHVATQLRSLKASTKPVRGVVSMAKKSVGDLTAADLKGKKVFV  541
            P RSL FAA A DP  + HVA++ R+  ++ +  R V +MAKKSVGDLTAADL+GK+V V
Sbjct  36   PARSLAFAAGA-DPRLAVHVASRCRA-ASAARGTRAVATMAKKSVGDLTAADLEGKRVLV  93

Query  542  RADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            RADLNVPLDD Q ITDDTRIRAAIPTIK+L+SNG
Sbjct  94   RADLNVPLDDNQNITDDTRIRAAIPTIKYLLSNG  127



>ref|XP_010544343.1| PREDICTED: LOW QUALITY PROTEIN: phosphoglycerate kinase 1, chloroplastic-like 
[Tarenaya hassleriana]
Length=480

 Score =   115 bits (287),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 72/92 (78%), Gaps = 8/92 (9%)
 Frame = +2

Query  368  RSLGFAAAAADPFFSHHVATQLRSLKASTKPVRGVVSMAKKSVGDLTAADLKGKKVFVRA  547
            R LGF++   D  FS HVA+++RS++   K  RGVVS      GDLT+ADLKGKKVFVRA
Sbjct  45   RRLGFSSVV-DSRFSVHVASKVRSVRG--KGTRGVVSX-----GDLTSADLKGKKVFVRA  96

Query  548  DLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            DLNVPLDD+Q ITDDTRIRAAIPTIK+LI NG
Sbjct  97   DLNVPLDDSQNITDDTRIRAAIPTIKYLIENG  128



>gb|AGV54662.1| phosphoglycerate kinase chloroplastic-like protein [Phaseolus 
vulgaris]
Length=477

 Score =   114 bits (286),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 80/107 (75%), Gaps = 7/107 (7%)
 Frame = +2

Query  368  RSLGFAAAAADPFFSHHVATQLRSLKASTKPVRGVVSMAKKSVGDLTAADLKGKKVFVRA  547
            R LGF AA  DP  + +VA ++ ++K   +  RGVVSMAKKSVGDL+AADLKGKKVFVRA
Sbjct  39   RRLGFTAA--DPLLAANVAARVAAVKVG-RGRRGVVSMAKKSVGDLSAADLKGKKVFVRA  95

Query  548  DLNVPLDDTQKITDDTRIRAAIPTIKHLISNGG----*SHSVQPSGT  676
            DLNVPLDD Q ITDDTRIRAAIPTIK+LI NG      SH  +P G 
Sbjct  96   DLNVPLDDNQNITDDTRIRAAIPTIKYLIQNGAKVILSSHLGRPKGV  142



>ref|XP_002441313.1| hypothetical protein SORBIDRAFT_09g024340 [Sorghum bicolor]
 gb|EES19743.1| hypothetical protein SORBIDRAFT_09g024340 [Sorghum bicolor]
Length=483

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 72/94 (77%), Gaps = 3/94 (3%)
 Frame = +2

Query  362  PLRSLGFAAAAADPFFSHHVATQLRSLKASTKPVRGVVSMAKKSVGDLTAADLKGKKVFV  541
            P RSL FAA   D   + HVA++ R   +S +  R + +MAKKSVGDLT ADL+GK+VFV
Sbjct  43   PARSLAFAAG--DARLAVHVASRCRQ-ASSARGTRAMATMAKKSVGDLTEADLEGKRVFV  99

Query  542  RADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            RADLNVPLD+ Q ITDDTRIRAA+PTI++LIS G
Sbjct  100  RADLNVPLDENQNITDDTRIRAAVPTIQYLISKG  133



>ref|XP_008656415.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Zea mays]
Length=627

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 60/96 (63%), Positives = 72/96 (75%), Gaps = 3/96 (3%)
 Frame = +2

Query  356  RTPLRSLGFAAAAADPFFSHHVATQLRSLKASTKPVRGVVSMAKKSVGDLTAADLKGKKV  535
            R P RSL FAA   D   + HVA++ R   +S +  R + +MAKKSVGDLT ADLKGK+V
Sbjct  185  RQPARSLAFAAG--DARLAVHVASRCRQ-ASSARGTRAMATMAKKSVGDLTEADLKGKRV  241

Query  536  FVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            FVRADLNVPLD+ Q ITDDTRIRAAIPTI++L+  G
Sbjct  242  FVRADLNVPLDENQNITDDTRIRAAIPTIQYLLGKG  277



>ref|XP_004961633.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Setaria 
italica]
Length=480

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 71/94 (76%), Gaps = 3/94 (3%)
 Frame = +2

Query  362  PLRSLGFAAAAADPFFSHHVATQLRSLKASTKPVRGVVSMAKKSVGDLTAADLKGKKVFV  541
            P RSL FAA   D   + HVA++ R   +S +  R V +MAKKSVGDLT ADL+GK+VFV
Sbjct  41   PARSLAFAAG--DARLAVHVASRCRQ-ASSARGTRAVATMAKKSVGDLTEADLEGKRVFV  97

Query  542  RADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            RADLNVPLD+ Q ITDDTR+RAA+PTI++LI  G
Sbjct  98   RADLNVPLDENQNITDDTRVRAAVPTIQYLIGKG  131



>gb|EEC71648.1| hypothetical protein OsI_04088 [Oryza sativa Indica Group]
Length=449

 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 72/94 (77%), Gaps = 2/94 (2%)
 Frame = +2

Query  368  RSLGFAAAAADPFFSHHVATQLRSLKASTKPV--RGVVSMAKKSVGDLTAADLKGKKVFV  541
            RSLGFAA   DP  + HV+++ R+  AS      R V +MAKKSVGDL AADL+GK+V +
Sbjct  44   RSLGFAARGTDPRLAIHVSSRRRAASASAGSRLARAVATMAKKSVGDLAAADLEGKRVLL  103

Query  542  RADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            RADLNVPLD +Q ITDDTR+RAAIPTIKHLI NG
Sbjct  104  RADLNVPLDASQNITDDTRVRAAIPTIKHLIGNG  137



>ref|XP_006858226.1| hypothetical protein AMTR_s00062p00189550 [Amborella trichopoda]
 gb|ERN19693.1| hypothetical protein AMTR_s00062p00189550 [Amborella trichopoda]
Length=481

 Score =   111 bits (277),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 74/106 (70%), Gaps = 17/106 (16%)
 Frame = +2

Query  356  RTPL--RSLGFAAAAADPFFSHHVATQLRSLKAST--------KPVRGVVSMAKKSVGDL  505
            R PL  R LGF+   A       +A+Q R LKA          +  RGVVSM KKSVGDL
Sbjct  33   RMPLDARRLGFSGNGA------SIASQ-RLLKACEMVCGGRRGRGPRGVVSMVKKSVGDL  85

Query  506  TAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            TA+DLKGKKVFVRADLNVPLDD Q ITDDTRIRAA+PTIKHLI NG
Sbjct  86   TASDLKGKKVFVRADLNVPLDDNQNITDDTRIRAAVPTIKHLIGNG  131



>ref|XP_004970258.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like isoform 
X1 [Setaria italica]
Length=485

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 70/96 (73%), Gaps = 2/96 (2%)
 Frame = +2

Query  362  PLRSLG-FAAA-AADPFFSHHVATQLRSLKASTKPVRGVVSMAKKSVGDLTAADLKGKKV  535
            P RSLG F+    AD     HV  + RS  ++ +  R   +MAKKSVGDL AADL+GK+V
Sbjct  44   PARSLGSFSLGDGADRRLPIHVPPRCRSESSAGREARAAATMAKKSVGDLAAADLEGKRV  103

Query  536  FVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
             VRADLNVPLDD Q ITDDTR+RAAIPTIKHL++NG
Sbjct  104  LVRADLNVPLDDRQNITDDTRVRAAIPTIKHLVTNG  139



>ref|XP_004970259.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like isoform 
X2 [Setaria italica]
Length=484

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 70/96 (73%), Gaps = 2/96 (2%)
 Frame = +2

Query  362  PLRSLG-FAAA-AADPFFSHHVATQLRSLKASTKPVRGVVSMAKKSVGDLTAADLKGKKV  535
            P RSLG F+    AD     HV  + RS  ++ +  R   +MAKKSVGDL AADL+GK+V
Sbjct  44   PARSLGSFSLGDGADRRLPIHVPPRCRSESSAGREARAAATMAKKSVGDLAAADLEGKRV  103

Query  536  FVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
             VRADLNVPLDD Q ITDDTR+RAAIPTIKHL++NG
Sbjct  104  LVRADLNVPLDDRQNITDDTRVRAAIPTIKHLVTNG  139



>emb|CBL95264.1| phosphoglycerate kinase 1 [Pinus pinaster]
Length=507

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 67/94 (71%), Gaps = 7/94 (7%)
 Frame = +2

Query  380  FAAAAADPFFSHH------VATQLRSLKASTKPVRGVVSMAKKSVGDLTAADLKGKKVFV  541
            F   AA   F+        VA Q+     + +  RGVVSMAK+SVGDL  +DLKGKKVFV
Sbjct  65   FGLGAASNLFASENDLASAVAAQVGGAN-NGRGCRGVVSMAKRSVGDLKESDLKGKKVFV  123

Query  542  RADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            RADLNVPLD+ Q ITDDTRIRAA+PTIK+LISNG
Sbjct  124  RADLNVPLDENQNITDDTRIRAAVPTIKYLISNG  157



>gb|AIZ74346.1| phosphoglycerate kinase 1 [Pinus massoniana]
Length=507

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 67/94 (71%), Gaps = 7/94 (7%)
 Frame = +2

Query  380  FAAAAADPFFSHH------VATQLRSLKASTKPVRGVVSMAKKSVGDLTAADLKGKKVFV  541
            F   AA   F+        VA Q+     + +  RGVVSMAK+SVGDL  +DLKGKKVFV
Sbjct  65   FGLGAASNLFASENDLASAVAAQVGGAN-NGRGCRGVVSMAKRSVGDLKESDLKGKKVFV  123

Query  542  RADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            RADLNVPLD+ Q ITDDTRIRAA+PTIK+LISNG
Sbjct  124  RADLNVPLDENQNITDDTRIRAAVPTIKYLISNG  157



>ref|NP_001172606.1| Os01g0800266 [Oryza sativa Japonica Group]
 dbj|BAH91336.1| Os01g0800266 [Oryza sativa Japonica Group]
Length=385

 Score =   108 bits (270),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 71/94 (76%), Gaps = 2/94 (2%)
 Frame = +2

Query  368  RSLGFAAAAADPFFSHHVATQLRSLKASTKPV--RGVVSMAKKSVGDLTAADLKGKKVFV  541
            RSLGFAA   DP  + HV+++ R+  AS      R V +MAKKSVGDL AADL+GK+V +
Sbjct  33   RSLGFAARGTDPRLAIHVSSRRRAASASAGSRLARAVATMAKKSVGDLAAADLEGKRVLL  92

Query  542  RADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            RADLNVPLD +Q ITDDTR+ AAIPTIKHLI NG
Sbjct  93   RADLNVPLDASQNITDDTRVIAAIPTIKHLIGNG  126



>gb|AFW78532.1| phosphoglycerate kinase [Zea mays]
Length=480

 Score =   109 bits (272),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 71/94 (76%), Gaps = 3/94 (3%)
 Frame = +2

Query  362  PLRSLGFAAAAADPFFSHHVATQLRSLKASTKPVRGVVSMAKKSVGDLTAADLKGKKVFV  541
            P RSL FAA   D   + HVA++ R    S +  R + +MAKKSVG+LT ADL+GK+VFV
Sbjct  40   PARSLAFAAG--DARLAVHVASRCRQ-AFSGRGTRAMATMAKKSVGELTEADLEGKRVFV  96

Query  542  RADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            RADLNVPLD+ Q ITDDTRIRAAIPTI++++S G
Sbjct  97   RADLNVPLDENQNITDDTRIRAAIPTIQYILSKG  130



>gb|AFW78533.1| phosphoglycerate kinase [Zea mays]
Length=483

 Score =   109 bits (272),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 71/94 (76%), Gaps = 3/94 (3%)
 Frame = +2

Query  362  PLRSLGFAAAAADPFFSHHVATQLRSLKASTKPVRGVVSMAKKSVGDLTAADLKGKKVFV  541
            P RSL FAA   D   + HVA++ R    S +  R + +MAKKSVG+LT ADL+GK+VFV
Sbjct  40   PARSLAFAAG--DARLAVHVASRCRQ-AFSGRGTRAMATMAKKSVGELTEADLEGKRVFV  96

Query  542  RADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            RADLNVPLD+ Q ITDDTRIRAAIPTI++++S G
Sbjct  97   RADLNVPLDENQNITDDTRIRAAIPTIQYILSKG  130



>gb|EEE55536.1| hypothetical protein OsJ_03768 [Oryza sativa Japonica Group]
Length=429

 Score =   108 bits (270),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 71/94 (76%), Gaps = 2/94 (2%)
 Frame = +2

Query  368  RSLGFAAAAADPFFSHHVATQLRSLKASTKPV--RGVVSMAKKSVGDLTAADLKGKKVFV  541
            RSLGFAA   DP  + HV+++ R+  AS      R V +MAKKSVGDL AADL+GK+V +
Sbjct  77   RSLGFAARGTDPRLAIHVSSRRRAASASAGSRLARAVATMAKKSVGDLAAADLEGKRVLL  136

Query  542  RADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            RADLNVPLD +Q ITDDTR+ AAIPTIKHLI NG
Sbjct  137  RADLNVPLDASQNITDDTRVIAAIPTIKHLIGNG  170



>gb|ABR16231.1| unknown [Picea sitchensis]
Length=472

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/60 (83%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +2

Query  464  RGVVSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            RGVVSMAKKSVGDL  +DLKGK+VFVRADLNVPLD+ Q ITDDTRIRAA+PTIK+LI NG
Sbjct  98   RGVVSMAKKSVGDLKESDLKGKRVFVRADLNVPLDENQNITDDTRIRAAVPTIKYLIGNG  157



>gb|ABK24564.1| unknown [Picea sitchensis]
Length=507

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/60 (83%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +2

Query  464  RGVVSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            RGVVSMAKKSVGDL  +DLKGK+VFVRADLNVPLD+ Q ITDDTRIRAA+PTIK+LI NG
Sbjct  98   RGVVSMAKKSVGDLKESDLKGKRVFVRADLNVPLDENQNITDDTRIRAAVPTIKYLIGNG  157



>ref|NP_001147628.1| phosphoglycerate kinase [Zea mays]
 gb|ACG28158.1| phosphoglycerate kinase [Zea mays]
 gb|ACG28313.1| phosphoglycerate kinase [Zea mays]
Length=480

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 70/94 (74%), Gaps = 3/94 (3%)
 Frame = +2

Query  362  PLRSLGFAAAAADPFFSHHVATQLRSLKASTKPVRGVVSMAKKSVGDLTAADLKGKKVFV  541
            P  SL FAA   D   + HVA++ R    S +  R + +MAKKSVG+LT ADL+GK+VFV
Sbjct  40   PAWSLAFAAG--DARLAVHVASRCRQ-AFSGRGTRAMATMAKKSVGELTEADLEGKRVFV  96

Query  542  RADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            RADLNVPLD+ Q ITDDTRIRAAIPTI++++S G
Sbjct  97   RADLNVPLDENQNITDDTRIRAAIPTIQYILSKG  130



>emb|CDP13574.1| unnamed protein product [Coffea canephora]
Length=405

 Score =   104 bits (260),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 50/55 (91%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +2

Query  479  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            MAKKSVGDL AADLKGK VFVRAD NVPLDD Q ITDDTRIRAAIPTIKHLISNG
Sbjct  1    MAKKSVGDLAAADLKGKNVFVRADFNVPLDDNQNITDDTRIRAAIPTIKHLISNG  55



>emb|CBI24182.3| unnamed protein product [Vitis vinifera]
Length=405

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/55 (89%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +2

Query  479  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            MAKKSVGDLT ADLKGKKVFVR DLNVPLDD QKITDDTR+RAAIPTIK+LI NG
Sbjct  1    MAKKSVGDLTGADLKGKKVFVRVDLNVPLDDNQKITDDTRVRAAIPTIKYLIDNG  55



>ref|XP_002971814.1| hypothetical protein SELMODRAFT_267533 [Selaginella moellendorffii]
 gb|EFJ26731.1| hypothetical protein SELMODRAFT_267533 [Selaginella moellendorffii]
Length=472

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +2

Query  464  RGVVSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            RGVV MAKKSVGDL  ADLKGK+VFVRADLNVPLD   KITDDTRIRAA+PTIK+LISNG
Sbjct  56   RGVVCMAKKSVGDLKEADLKGKRVFVRADLNVPLDGDLKITDDTRIRAAVPTIKYLISNG  115



>gb|EAY98560.1| hypothetical protein OsI_20474 [Oryza sativa Indica Group]
Length=284

 Score =   102 bits (254),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 57/70 (81%), Gaps = 4/70 (6%)
 Frame = +2

Query  479  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGG----  646
            MAKKSVGDLTAADL+GK+VFVRADLNVPLDD Q ITDDTR+RAAIPTI++LI NG     
Sbjct  1    MAKKSVGDLTAADLEGKRVFVRADLNVPLDDNQNITDDTRVRAAIPTIQYLIKNGAKVIL  60

Query  647  *SHSVQPSGT  676
             SH  +P G 
Sbjct  61   SSHLGRPKGV  70



>gb|EMS54865.1| Phosphoglycerate kinase, chloroplastic [Triticum urartu]
Length=460

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/55 (87%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +2

Query  479  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            MAKKSVGDLTAADL+GK+V VRADLNVPLDD Q ITDDTRIRAAIPTIK+L+SNG
Sbjct  1    MAKKSVGDLTAADLEGKRVLVRADLNVPLDDNQNITDDTRIRAAIPTIKYLLSNG  55



>ref|XP_006654593.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Oryza 
brachyantha]
Length=405

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +2

Query  479  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            MAKKSVGDLTAADL+GK+VFVRADLNVPLD+ Q ITDDTR+RAAIPTI++LI NG
Sbjct  1    MAKKSVGDLTAADLEGKRVFVRADLNVPLDENQNITDDTRVRAAIPTIQYLIKNG  55



>ref|NP_001117503.1| phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AEE33357.1| phosphoglycerate kinase [Arabidopsis thaliana]
Length=405

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/55 (87%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +2

Query  479  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            MAKKSVGDL + DLKGKKVFVRADLNVPLDD Q ITDDTRIRAAIPTIK LI NG
Sbjct  1    MAKKSVGDLNSVDLKGKKVFVRADLNVPLDDNQNITDDTRIRAAIPTIKFLIENG  55



>ref|XP_002972334.1| hypothetical protein SELMODRAFT_231942 [Selaginella moellendorffii]
 gb|EFJ26420.1| hypothetical protein SELMODRAFT_231942 [Selaginella moellendorffii]
Length=412

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 47/55 (85%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +2

Query  479  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            MAKKSVGDL  ADLKGK+VFVRADLNVPLD   KITDDTRIRAA+PTIK+LISNG
Sbjct  1    MAKKSVGDLKEADLKGKRVFVRADLNVPLDGDLKITDDTRIRAAVPTIKYLISNG  55



>gb|ACN32155.1| unknown [Zea mays]
Length=411

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  476  SMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            +MAKKSVG+LT ADL+GK+VFVRADLNVPLD+ Q ITDDTRIRAAIPTI++++S G
Sbjct  3    TMAKKSVGELTEADLEGKRVFVRADLNVPLDENQNITDDTRIRAAIPTIQYILSKG  58



>ref|XP_006858233.1| hypothetical protein AMTR_s00062p00191350 [Amborella trichopoda]
 gb|ERN19700.1| hypothetical protein AMTR_s00062p00191350 [Amborella trichopoda]
Length=401

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 54/68 (79%), Gaps = 4/68 (6%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGG----*S  652
            KKSVGDL+ +DLKGK+VFVR DLNVPLDD QKITDDTRIRAA+PTIK+L+ NG      S
Sbjct  4    KKSVGDLSPSDLKGKRVFVRVDLNVPLDDNQKITDDTRIRAAVPTIKYLMENGAKVILAS  63

Query  653  HSVQPSGT  676
            H  +P G 
Sbjct  64   HLGRPKGV  71



>gb|AAB60303.1| phosphoglycerate kinase, partial [Arabidopsis thaliana]
Length=399

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/49 (90%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +2

Query  497  GDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            GDLT+ADLKGKKVFVRADLNVPLDD Q ITDDTRIRAAIPTIK+LI NG
Sbjct  1    GDLTSADLKGKKVFVRADLNVPLDDNQTITDDTRIRAAIPTIKYLIENG  49



>gb|AIZ68220.1| phosphoglycerate kinase [Ornithogalum saundersiae]
Length=401

 Score = 94.0 bits (232),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            KKSVG L AADLKGKKVFVR DLNVPLDD QKITDDTRIRAA+PTIK+L+ +G
Sbjct  4    KKSVGSLKAADLKGKKVFVRVDLNVPLDDNQKITDDTRIRAAVPTIKYLMEHG  56



>gb|ADV16380.1| cytosolic phosphoglycerate kinase 2 [Helianthus annuus]
Length=400

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            KKSV  L  ADLKGK+VFVRADLNVPLDDT KITDDTRIRAA+PTIK+L+SNG
Sbjct  4    KKSVSSLKEADLKGKRVFVRADLNVPLDDTFKITDDTRIRAAVPTIKYLMSNG  56



>gb|AFW70285.1| hypothetical protein ZEAMMB73_319281 [Zea mays]
Length=186

 Score = 89.4 bits (220),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 51/68 (75%), Gaps = 4/68 (6%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGG----*S  652
            K+SVG L  ADLKGKKVFVRADLNVPLDD QKITDDTRIRA++PTIK L+  G      S
Sbjct  4    KRSVGTLGEADLKGKKVFVRADLNVPLDDAQKITDDTRIRASVPTIKFLLEKGAKVILAS  63

Query  653  HSVQPSGT  676
            H  +P G 
Sbjct  64   HLGRPKGV  71



>sp|P12783.1|PGKY_WHEAT RecName: Full=Phosphoglycerate kinase, cytosolic [Triticum aestivum]
 emb|CAA33302.1| unnamed protein product [Triticum aestivum]
Length=401

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 52/68 (76%), Gaps = 4/68 (6%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGG----*S  652
            K+SVG L  ADLKGKKVFVRADLNVPLDD QKITDDTRIRA+IPTIK+L+  G      S
Sbjct  4    KRSVGTLGEADLKGKKVFVRADLNVPLDDAQKITDDTRIRASIPTIKYLLEKGAKVILAS  63

Query  653  HSVQPSGT  676
            H  +P G 
Sbjct  64   HLGRPKGV  71



>gb|AIN39803.1| hypothetical protein, partial [Zoysia matrella]
Length=290

 Score = 90.1 bits (222),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 51/68 (75%), Gaps = 4/68 (6%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGG----*S  652
            K+SVG L  ADLKGKKVFVRADLNVPLDD QKITDDTRIRA++PTIK L+  G      S
Sbjct  4    KRSVGSLGEADLKGKKVFVRADLNVPLDDNQKITDDTRIRASVPTIKFLLEKGAKVVLAS  63

Query  653  HSVQPSGT  676
            H  +P G 
Sbjct  64   HLGRPKGV  71



>gb|EMS46092.1| Phosphoglycerate kinase, cytosolic [Triticum urartu]
Length=429

 Score = 90.9 bits (224),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            K+SVG L  ADLKGKKVFVRADLNVPLDD QKITDDTRIRA+IPTIK+L+  G
Sbjct  4    KRSVGTLGEADLKGKKVFVRADLNVPLDDAQKITDDTRIRASIPTIKYLLEKG  56



>gb|AAW79325.1| phosphoglycerate kinase [Isochrysis galbana]
Length=436

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 55/73 (75%), Gaps = 5/73 (7%)
 Frame = +2

Query  473  VSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGG--  646
            + MAKKSVGDLT ADL+GK+V VR DLNVPL D + ITDDTRIRA+IPTIK+LI NG   
Sbjct  35   IEMAKKSVGDLTKADLEGKRVLVRCDLNVPL-DGKTITDDTRIRASIPTIKYLIDNGAKV  93

Query  647  --*SHSVQPSGTP  679
               SH  +P G P
Sbjct  94   LLSSHLGRPKGGP  106



>ref|XP_010324204.1| PREDICTED: phosphoglycerate kinase, cytosolic [Solanum lycopersicum]
 ref|XP_010324205.1| PREDICTED: phosphoglycerate kinase, cytosolic [Solanum lycopersicum]
Length=401

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            KKSVG L  ADLKGK+VFVR DLNVPLDD  KITDDTRIRAA+PTIK+L+ NG
Sbjct  4    KKSVGSLKEADLKGKRVFVRVDLNVPLDDNFKITDDTRIRAAVPTIKYLMQNG  56



>gb|EMT29203.1| Phosphoglycerate kinase, cytosolic [Aegilops tauschii]
Length=494

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            K+SVG L  ADLKGKKVFVRADLNVPLDD QKITDDTRIRA+IPTIK+L+  G
Sbjct  4    KRSVGTLGEADLKGKKVFVRADLNVPLDDAQKITDDTRIRASIPTIKYLLEKG  56



>gb|KIY97385.1| phosphoglycerate kinase [Monoraphidium neglectum]
Length=229

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 53/65 (82%), Gaps = 1/65 (2%)
 Frame = +2

Query  452  TKPVRGVVSMAKKSVGDLTAADLKGKKVFVRADLNVPLD-DTQKITDDTRIRAAIPTIKH  628
             +P + VV  AKKSVGDLT  DL+GK+VFVRADLNVPLD  T  ITDDTRIRAA+PT+K+
Sbjct  25   VRPRKLVVLSAKKSVGDLTKDDLEGKRVFVRADLNVPLDKQTLAITDDTRIRAAVPTLKY  84

Query  629  LISNG  643
            L+ NG
Sbjct  85   LLDNG  89



>gb|ABH10990.1| phosphoglycerate kinase [Polytomella parva]
Length=259

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 51/59 (86%), Gaps = 1/59 (2%)
 Frame = +2

Query  470  VVSMAKKSVGDLTAADLKGKKVFVRADLNVPLD-DTQKITDDTRIRAAIPTIKHLISNG  643
            V + AKKSVGDL+ ADLKGKKVFVRADLNVPLD  T K+TDDTRIRAA PT+K+L+ NG
Sbjct  33   VKTEAKKSVGDLSIADLKGKKVFVRADLNVPLDKKTNKVTDDTRIRAAAPTLKYLLKNG  91



>ref|XP_001699523.1| phosphoglycerate kinase [Chlamydomonas reinhardtii]
 gb|EDO98586.1| phosphoglycerate kinase [Chlamydomonas reinhardtii]
Length=462

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 64/96 (67%), Gaps = 9/96 (9%)
 Frame = +2

Query  407  FSHHVATQLRSLKASTKPVRGVVSMAKKSVGDLTAADLKGKKVFVRADLNVPLDD-TQKI  583
            F+  V+  +R +  S    R VV   KKSVGDL  ADL+GK+VFVRADLNVPLD  T  I
Sbjct  41   FAAEVSVDIRRVGRS----RIVVEAVKKSVGDLHKADLEGKRVFVRADLNVPLDKATLAI  96

Query  584  TDDTRIRAAIPTIKHLISNGG----*SHSVQPSGTP  679
            TDDTRIRAA+PT+K+L+ NG      SH  +P G P
Sbjct  97   TDDTRIRAAVPTLKYLLDNGAKVLLTSHLGRPKGGP  132



>gb|KJB14019.1| hypothetical protein B456_002G107200 [Gossypium raimondii]
 gb|KJB14021.1| hypothetical protein B456_002G107200 [Gossypium raimondii]
 gb|KJB14022.1| hypothetical protein B456_002G107200 [Gossypium raimondii]
 gb|KJB14023.1| hypothetical protein B456_002G107200 [Gossypium raimondii]
 gb|KJB14024.1| hypothetical protein B456_002G107200 [Gossypium raimondii]
Length=401

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            KKSVGDL  ADLKGKKVFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ +G
Sbjct  4    KKSVGDLKEADLKGKKVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLMGHG  56



>ref|XP_005646469.1| phosphoglycerate kinase precursor [Coccomyxa subellipsoidea C-169]
 gb|EIE21925.1| phosphoglycerate kinase precursor [Coccomyxa subellipsoidea C-169]
Length=442

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = +2

Query  410  SHHVATQLRSLKASTKPVRGVVSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITD  589
            S H     R    S +  R VV MAKKSVGDLT +DL+GK V VRADLNVPL+   +ITD
Sbjct  18   SLHAFVAARVNGVSGRRSRLVVQMAKKSVGDLTKSDLEGKTVLVRADLNVPLNKDLEITD  77

Query  590  DTRIRAAIPTIKHLISNG  643
            DTRIRAAIPT+K+L  NG
Sbjct  78   DTRIRAAIPTLKYLTDNG  95



>gb|ACJ11718.1| phosphoglycerate kinase [Gossypium hirsutum]
 gb|KHG14087.1| Phosphoglycerate kinase, cytosolic [Gossypium arboreum]
Length=401

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            KKSVGDL  ADLKGKKVFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ +G
Sbjct  4    KKSVGDLKEADLKGKKVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLMGHG  56



>ref|NP_001058317.1| Os06g0668200 [Oryza sativa Japonica Group]
 dbj|BAD45436.1| putative cytosolic phosphoglycerate kinase 1 [Oryza sativa Japonica 
Group]
 dbj|BAD45421.1| putative cytosolic phosphoglycerate kinase 1 [Oryza sativa Japonica 
Group]
 dbj|BAF20231.1| Os06g0668200 [Oryza sativa Japonica Group]
 gb|EAZ02017.1| hypothetical protein OsI_24050 [Oryza sativa Indica Group]
 gb|EAZ37949.1| hypothetical protein OsJ_22300 [Oryza sativa Japonica Group]
 dbj|BAG95158.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG92099.1| unnamed protein product [Oryza sativa Japonica Group]
Length=401

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +2

Query  482  AKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            +K+SVG LT +DLKGKKVF+RADLNVPLDD+QKITDDTRIRA++PTIK L+  G
Sbjct  3    SKRSVGTLTESDLKGKKVFLRADLNVPLDDSQKITDDTRIRASVPTIKFLMGKG  56



>ref|NP_001142404.1| uncharacterized protein LOC100274579 [Zea mays]
 ref|XP_008681565.1| PREDICTED: uncharacterized protein LOC100274579 isoform X1 [Zea 
mays]
 ref|XP_008681566.1| PREDICTED: uncharacterized protein LOC100274579 isoform X1 [Zea 
mays]
 gb|ACF87897.1| unknown [Zea mays]
 gb|ACF88413.1| unknown [Zea mays]
 gb|ACG36709.1| phosphoglycerate kinase, cytosolic [Zea mays]
 gb|AFW70282.1| phosphoglycerate kinase isoform 1 [Zea mays]
 gb|AFW70283.1| phosphoglycerate kinase isoform 2 [Zea mays]
 gb|AFW70284.1| phosphoglycerate kinase isoform 3 [Zea mays]
Length=402

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 51/67 (76%), Gaps = 4/67 (6%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGG----*S  652
            K+SVG L  ADLKGKKVFVRADLNVPLDD QKITDDTRIRA++PTIK L+  G      S
Sbjct  4    KRSVGTLGEADLKGKKVFVRADLNVPLDDAQKITDDTRIRASVPTIKFLLEKGAKVILAS  63

Query  653  HSVQPSG  673
            H  +P G
Sbjct  64   HLGRPKG  70



>ref|XP_003570108.1| PREDICTED: phosphoglycerate kinase, cytosolic [Brachypodium distachyon]
Length=401

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 51/68 (75%), Gaps = 4/68 (6%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGG----*S  652
            K+SVG L  ADLKGKKVFVRADLNVPLDD QKITDDTRIRA++PTIK L+  G      S
Sbjct  4    KRSVGTLGEADLKGKKVFVRADLNVPLDDAQKITDDTRIRASVPTIKFLLEKGAKVILAS  63

Query  653  HSVQPSGT  676
            H  +P G 
Sbjct  64   HLGRPKGV  71



>ref|XP_009399252.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Musa acuminata 
subsp. malaccensis]
Length=401

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            KKSVG LT ADLKGKKVFVR DLNVPLD+T K+TDDTRIRA++PTIK+L+  G
Sbjct  4    KKSVGALTEADLKGKKVFVRVDLNVPLDETLKVTDDTRIRASVPTIKYLMERG  56



>ref|XP_009417722.1| PREDICTED: phosphoglycerate kinase, cytosolic [Musa acuminata 
subsp. malaccensis]
 ref|XP_009417729.1| PREDICTED: phosphoglycerate kinase, cytosolic [Musa acuminata 
subsp. malaccensis]
Length=401

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            K+SVGDL   DLKGK+VFVR DLNVPLDD+QKITDDTR+RAA+PTIK L+ +G
Sbjct  4    KRSVGDLKEDDLKGKRVFVRVDLNVPLDDSQKITDDTRVRAAVPTIKSLMEHG  56



>ref|XP_011396717.1| Phosphoglycerate kinase, chloroplastic [Auxenochlorella protothecoides]
 gb|KFM23839.1| Phosphoglycerate kinase, chloroplastic [Auxenochlorella protothecoides]
Length=454

 Score = 89.4 bits (220),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +2

Query  473  VSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            V  AKKSV DL+ +DL+GK VFVRADLNVPLD TQ ITDDTRIRAA+PT+++LI NG
Sbjct  54   VEAAKKSVSDLSKSDLEGKVVFVRADLNVPLDGTQNITDDTRIRAAVPTLEYLIKNG  110



>ref|XP_002951648.1| phosphoglycerate kinase [Volvox carteri f. nagariensis]
 sp|Q9SBN4.1|PGKH_VOLCA RecName: Full=Phosphoglycerate kinase, chloroplastic; Flags: 
Precursor [Volvox carteri]
 gb|AAD55564.1|AF110782_1 phosphoglycerate kinase precursor [Volvox carteri f. nagariensis]
 gb|EFJ47459.1| phosphoglycerate kinase [Volvox carteri f. nagariensis]
Length=462

 Score = 89.0 bits (219),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 56/77 (73%), Gaps = 5/77 (6%)
 Frame = +2

Query  464  RGVVSMAKKSVGDLTAADLKGKKVFVRADLNVPLD-DTQKITDDTRIRAAIPTIKHLISN  640
            R VV   KKSVGDL  ADL+GK+VFVRADLNVPLD  T  ITDDTRIRAA+PT+K+L+ N
Sbjct  56   RIVVEAVKKSVGDLGKADLEGKRVFVRADLNVPLDKKTLAITDDTRIRAAVPTLKYLLDN  115

Query  641  GG----*SHSVQPSGTP  679
            G      SH  +P G P
Sbjct  116  GAKVLLTSHLGRPKGGP  132



>gb|ABB86242.1| phosphoglycerate kinase-like [Solanum tuberosum]
Length=402

 Score = 88.2 bits (217),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            KKSVG L  ADLKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ NG
Sbjct  4    KKSVGSLKEADLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLMQNG  56



>emb|CBY84995.1| phosphoglycerate kinase, partial [Polytomella sp. Pringsheim 
198.80]
Length=422

 Score = 88.6 bits (218),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 51/59 (86%), Gaps = 1/59 (2%)
 Frame = +2

Query  470  VVSMAKKSVGDLTAADLKGKKVFVRADLNVPLD-DTQKITDDTRIRAAIPTIKHLISNG  643
            V + AKKSVGDL+ ADLKGKKVFVRADLNVPLD  T K+TDDTRIRAA PT+K+L+ NG
Sbjct  37   VKTEAKKSVGDLSIADLKGKKVFVRADLNVPLDKKTNKVTDDTRIRAAAPTLKYLLKNG  95



>ref|XP_005851391.1| hypothetical protein CHLNCDRAFT_48457 [Chlorella variabilis]
 gb|EFN59289.1| hypothetical protein CHLNCDRAFT_48457 [Chlorella variabilis]
Length=399

 Score = 88.2 bits (217),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 49/55 (89%), Gaps = 1/55 (2%)
 Frame = +2

Query  479  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            MAKKSVGDL+ ADL+GK VFVRADLNVPL D  KITDDTRIRAA+PT+K+L+ NG
Sbjct  1    MAKKSVGDLSKADLEGKVVFVRADLNVPL-DGDKITDDTRIRAAVPTLKYLVDNG  54



>gb|ABI18157.1| cytosolic phosphoglycerate kinase [Helianthus annuus]
Length=401

 Score = 88.2 bits (217),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            KKSV  LT  DLKGK+VFVR DLNVPLDDT KITDDTRIRAA+PTIK+L+S+G
Sbjct  4    KKSVSSLTEGDLKGKRVFVRVDLNVPLDDTFKITDDTRIRAAVPTIKYLMSHG  56



>ref|NP_001275451.1| phosphoglycerate kinase, cytosolic-like [Solanum tuberosum]
 gb|ABB87110.1| unknown [Solanum tuberosum]
Length=401

 Score = 87.8 bits (216),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            KKSVG L  ADLKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ NG
Sbjct  4    KKSVGSLKEADLKGKRVFVRVDLNVPLDDIFNITDDTRIRAAVPTIKYLMQNG  56



>ref|XP_011086347.1| PREDICTED: phosphoglycerate kinase, cytosolic [Sesamum indicum]
Length=401

 Score = 87.8 bits (216),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            KKSVG L  ADLKGK+VFVR DLNVPLDDT  ITDDTRIRAA+PTIK+LI +G
Sbjct  4    KKSVGSLKEADLKGKRVFVRVDLNVPLDDTFHITDDTRIRAAVPTIKYLIDHG  56



>gb|KCW71392.1| hypothetical protein EUGRSUZ_F04463 [Eucalyptus grandis]
Length=304

 Score = 86.7 bits (213),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 52/68 (76%), Gaps = 4/68 (6%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGG----*S  652
            KKSVG L  ADLKGK+VFVR DLNVPLDD+  ITDDTR+RAA+PTIK+L+S+G      S
Sbjct  4    KKSVGSLKEADLKGKRVFVRVDLNVPLDDSFHITDDTRVRAAVPTIKYLMSHGAIVILAS  63

Query  653  HSVQPSGT  676
            H  +P G 
Sbjct  64   HLGRPKGV  71



>ref|XP_006646936.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Oryza brachyantha]
Length=402

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            K+SVG L  ADL+GKKVFVRADLNVPLDD QKITDDTRIRA++PT+K L+  G
Sbjct  4    KRSVGTLGEADLRGKKVFVRADLNVPLDDAQKITDDTRIRASVPTVKFLLEKG  56



>ref|XP_009106677.1| PREDICTED: phosphoglycerate kinase, cytosolic [Brassica rapa]
 ref|XP_009106678.1| PREDICTED: phosphoglycerate kinase, cytosolic [Brassica rapa]
Length=401

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            K+SVG L  ADLKGK VFVR DLNVPLDD   ITDDTRIRAAIPTIK+L+ NG
Sbjct  4    KRSVGTLKEADLKGKSVFVRVDLNVPLDDNSNITDDTRIRAAIPTIKYLMENG  56



>ref|XP_002263950.1| PREDICTED: phosphoglycerate kinase, cytosolic [Vitis vinifera]
 emb|CAN81988.1| hypothetical protein VITISV_000723 [Vitis vinifera]
Length=401

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            K+SVGDL  ADLKGK+VFVR DLNVPLD++ KITDDTR+RAA+PTIK+L+ +G
Sbjct  4    KRSVGDLKEADLKGKRVFVRVDLNVPLDESLKITDDTRVRAAVPTIKYLMGHG  56



>gb|ABI74567.1| phosphoglycerate kinase [Oryza sativa Indica Group]
Length=402

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 51/67 (76%), Gaps = 4/67 (6%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGG----*S  652
            K+SVG L  ADL+GKKVFVRADLNVPLDD QKITDDTRIRA++PT+K L+  G      S
Sbjct  4    KRSVGTLGEADLRGKKVFVRADLNVPLDDAQKITDDTRIRASVPTVKFLLEKGAKVILAS  63

Query  653  HSVQPSG  673
            H  +P G
Sbjct  64   HLGRPKG  70



>ref|NP_001046020.1| Os02g0169300 [Oryza sativa Japonica Group]
 dbj|BAD25722.1| putative phosphoglycerate kinase, cytosolic [Oryza sativa Japonica 
Group]
 dbj|BAF07934.1| Os02g0169300 [Oryza sativa Japonica Group]
 gb|ABL74575.1| phosphoglycerate kinase [Oryza sativa Japonica Group]
 gb|EEC72574.1| hypothetical protein OsI_06015 [Oryza sativa Indica Group]
 gb|EEE56393.1| hypothetical protein OsJ_05543 [Oryza sativa Japonica Group]
Length=402

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 51/67 (76%), Gaps = 4/67 (6%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGG----*S  652
            K+SVG L  ADL+GKKVFVRADLNVPLDD QKITDDTRIRA++PT+K L+  G      S
Sbjct  4    KRSVGTLGEADLRGKKVFVRADLNVPLDDAQKITDDTRIRASVPTVKFLLEKGAKVILAS  63

Query  653  HSVQPSG  673
            H  +P G
Sbjct  64   HLGRPKG  70



>sp|P41758.1|PGKH_CHLRE RecName: Full=Phosphoglycerate kinase, chloroplastic; Flags: 
Precursor [Chlamydomonas reinhardtii]
 gb|AAA70082.1| phosphoglycerate kinase precursor [Chlamydomonas reinhardtii]
 gb|AAQ14241.1| phosphoglycerate kinase [Chlamydomonas reinhardtii]
Length=461

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 55/75 (73%), Gaps = 5/75 (7%)
 Frame = +2

Query  470  VVSMAKKSVGDLTAADLKGKKVFVRADLNVPLDD-TQKITDDTRIRAAIPTIKHLISNGG  646
            VV   KKSVGDL  ADL+GK+VFVRADLNVPLD  T  ITDDTRIRAA+PT+K+L+ NG 
Sbjct  57   VVEAVKKSVGDLHKADLEGKRVFVRADLNVPLDKATLAITDDTRIRAAVPTLKYLLDNGA  116

Query  647  ----*SHSVQPSGTP  679
                 SH  +P G P
Sbjct  117  KVLLTSHLGRPKGGP  131



>ref|XP_004966316.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Setaria italica]
Length=401

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            K+SVG L+ ADLKGKKVF+RADLNVPLDD QKITDD RIRA++PTIK L+  G
Sbjct  4    KRSVGTLSEADLKGKKVFLRADLNVPLDDNQKITDDNRIRASVPTIKFLMEKG  56



>gb|AFW70281.1| phosphoglycerate kinase [Zea mays]
Length=572

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            K+SVG L  ADLKGKKVFVRADLNVPLDD QKITDDTRIRA++PTIK L+  G
Sbjct  174  KRSVGTLGEADLKGKKVFVRADLNVPLDDAQKITDDTRIRASVPTIKFLLEKG  226



>ref|XP_004951776.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Setaria italica]
Length=402

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 51/67 (76%), Gaps = 4/67 (6%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGG----*S  652
            K+SVG L  ADL+GKKVFVRADLNVPLDD QKITDDTRIRA++PT+K L+  G      S
Sbjct  4    KRSVGTLGEADLRGKKVFVRADLNVPLDDAQKITDDTRIRASVPTVKFLLEKGAKVILAS  63

Query  653  HSVQPSG  673
            H  +P G
Sbjct  64   HLGRPKG  70



>gb|ABF69999.1| phosphoglycerate kinase, putative [Musa acuminata]
Length=401

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            KKSVG LT ADLKGKKVFVR DLNVPLD+  K+TDDTRIRA++PTIK+L+  G
Sbjct  4    KKSVGALTEADLKGKKVFVRVDLNVPLDENLKVTDDTRIRASVPTIKYLMERG  56



>ref|XP_005757596.1| phosphoglycerate kinase [Emiliania huxleyi CCMP1516]
 gb|EOD05167.1| phosphoglycerate kinase [Emiliania huxleyi CCMP1516]
Length=192

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 48/57 (84%), Gaps = 1/57 (2%)
 Frame = +2

Query  473  VSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            + MAKKSVGDL+ ADLKGKKV VR DLNVPLD  + ITDDTRIRA++PT+K+L+  G
Sbjct  35   IEMAKKSVGDLSEADLKGKKVLVRCDLNVPLDG-KTITDDTRIRASVPTVKYLVEKG  90



>gb|KIY97218.1| Phosphoglycerate kinase [Monoraphidium neglectum]
Length=596

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 51/61 (84%), Gaps = 1/61 (2%)
 Frame = +2

Query  464  RGVVSMAKKSVGDLTAADLKGKKVFVRADLNVPLD-DTQKITDDTRIRAAIPTIKHLISN  640
            R VV   KKSVGDLT ADL+GK+VFVRADLNVPLD  T  ITDDTRIRAA+PT+K+L+ N
Sbjct  473  RLVVKAVKKSVGDLTKADLEGKRVFVRADLNVPLDKQTLAITDDTRIRAAVPTLKYLLDN  532

Query  641  G  643
            G
Sbjct  533  G  533



>ref|XP_009414502.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Musa acuminata 
subsp. malaccensis]
Length=401

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            K+SVGDL   DLKGK+VFVR DLNVPLDD  KITDDTR+RAA+PTIK+L+ +G
Sbjct  4    KRSVGDLKGDDLKGKRVFVRVDLNVPLDDNLKITDDTRVRAAVPTIKYLLEHG  56



>gb|EYU33791.1| hypothetical protein MIMGU_mgv1a006853mg [Erythranthe guttata]
Length=429

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISN  640
            KKSVG L  ADLKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+LI N
Sbjct  4    KKSVGSLKEADLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLIGN  55



>ref|XP_010417621.1| PREDICTED: phosphoglycerate kinase, cytosolic [Camelina sativa]
 ref|XP_010429848.1| PREDICTED: phosphoglycerate kinase, cytosolic [Camelina sativa]
 ref|XP_010429849.1| PREDICTED: phosphoglycerate kinase, cytosolic [Camelina sativa]
Length=401

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            K+SVG L  ADLKGK VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ NG
Sbjct  4    KRSVGTLKEADLKGKSVFVRVDLNVPLDDNSNITDDTRIRAAVPTIKYLMGNG  56



>emb|CDX88547.1| BnaC06g39910D [Brassica napus]
Length=352

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            K+SVG L  ADLKGK VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ NG
Sbjct  4    KRSVGTLKEADLKGKSVFVRVDLNVPLDDNSNITDDTRIRAAVPTIKYLMGNG  56



>ref|XP_010472814.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Camelina 
sativa]
Length=401

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            K+SVG L  ADLKGK VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ NG
Sbjct  4    KRSVGTLKEADLKGKSVFVRVDLNVPLDDNSNITDDTRIRAAVPTIKYLMGNG  56



>emb|CDY70232.1| BnaC02g46710D [Brassica napus]
Length=401

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            K+SVG L  ADLKGK VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ NG
Sbjct  4    KRSVGTLKEADLKGKSVFVRVDLNVPLDDNSNITDDTRIRAAVPTIKYLMGNG  56



>gb|EWM26407.1| phosphoglycerate kinase [Nannochloropsis gaditana]
Length=486

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 59/86 (69%), Gaps = 7/86 (8%)
 Frame = +2

Query  404  FFSHHVATQLRSLKASTKPV------RGVVSMAKKSVGDLTAADLKGKKVFVRADLNVPL  565
            FF    A  +    A  +PV      RGV++MAKKSVG L  ADLKGK+VFVR DLNVPL
Sbjct  57   FFKAPSAGAMTGSAAVAEPVCPSTSRRGVMTMAKKSVGSLADADLKGKRVFVRCDLNVPL  116

Query  566  DDTQKITDDTRIRAAIPTIKHLISNG  643
            D  + ITDDTRIRA++PTI++L S G
Sbjct  117  DG-KTITDDTRIRASVPTIEYLASKG  141



>emb|CDY49746.1| BnaA02g19260D [Brassica napus]
Length=388

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            K+SVG L  ADLKGK VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ NG
Sbjct  40   KRSVGTLKEADLKGKSVFVRVDLNVPLDDNSNITDDTRIRAAVPTIKYLMGNG  92



>emb|CDP16886.1| unnamed protein product [Coffea canephora]
Length=401

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            KKSVG L  ADLKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+LI +G
Sbjct  4    KKSVGSLKEADLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLIGHG  56



>ref|XP_009128369.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Brassica 
rapa]
Length=401

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            K+SVG L  ADLKGK VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ NG
Sbjct  4    KRSVGTLKEADLKGKSVFVRVDLNVPLDDNSNITDDTRIRAAVPTIKYLMGNG  56



>ref|XP_002889253.1| hypothetical protein ARALYDRAFT_477124 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65512.1| hypothetical protein ARALYDRAFT_477124 [Arabidopsis lyrata subsp. 
lyrata]
Length=401

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            K+SVG L  ADLKGK VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ NG
Sbjct  4    KRSVGTLKEADLKGKSVFVRVDLNVPLDDNSNITDDTRIRAAVPTIKYLMGNG  56



>gb|AAM61185.1| phosphoglycerate kinase, putative [Arabidopsis thaliana]
Length=401

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            K+SVG L  ADLKGK VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ NG
Sbjct  4    KRSVGTLKEADLKGKSVFVRVDLNVPLDDNSNITDDTRIRAAVPTIKYLMGNG  56



>ref|XP_006300323.1| hypothetical protein CARUB_v10020404mg [Capsella rubella]
 ref|XP_006300324.1| hypothetical protein CARUB_v10020404mg [Capsella rubella]
 gb|EOA33221.1| hypothetical protein CARUB_v10020404mg [Capsella rubella]
 gb|EOA33222.1| hypothetical protein CARUB_v10020404mg [Capsella rubella]
Length=401

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            K+SVG L  ADLKGK VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ NG
Sbjct  4    KRSVGTLKEADLKGKSVFVRVDLNVPLDDNSNITDDTRIRAAVPTIKYLMGNG  56



>ref|NP_178073.1| phosphoglycerate kinase [Arabidopsis thaliana]
 ref|NP_849907.1| phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAD30221.1|AC007202_3 Is a member of the PF|00162 Phosphoglycerate kinase family. ESTs 
gb|N38721, gb|T22178, gb|R90345, gb|R90715, gb|T21140, gb|T46295, 
gb|H37082, gb|T46076, gb|N37132, gb|AA597649, gb|AI100648 
and gb|Z48462 come from this gene [Arabidopsis thaliana]
 gb|AAF70260.1|AF247560_1 cytosolic phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAK15553.1|AF348582_1 putative phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAL32941.1| Unknown protein [Arabidopsis thaliana]
 gb|AAP37845.1| At1g79550 [Arabidopsis thaliana]
 gb|AEE36262.1| phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AEE36263.1| phosphoglycerate kinase [Arabidopsis thaliana]
Length=401

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            K+SVG L  ADLKGK VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ NG
Sbjct  4    KRSVGTLKEADLKGKSVFVRVDLNVPLDDNSNITDDTRIRAAVPTIKYLMGNG  56



>ref|XP_009777860.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Nicotiana 
sylvestris]
Length=401

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 49/62 (79%), Gaps = 2/62 (3%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGG*SHSVQ  664
            KKSVG L  ADLKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ +G  SH + 
Sbjct  4    KKSVGSLKEADLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLMQHG--SHVIL  61

Query  665  PS  670
             S
Sbjct  62   AS  63



>emb|CDX67989.1| BnaA07g20290D [Brassica napus]
Length=348

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            K+SVG L  ADLKGK VFVR DLNVPLDD   ITDDTRIRAA+PT+K+L+ NG
Sbjct  4    KRSVGTLKEADLKGKSVFVRVDLNVPLDDNSNITDDTRIRAAVPTVKYLMENG  56



>gb|KCW71391.1| hypothetical protein EUGRSUZ_F04463 [Eucalyptus grandis]
Length=378

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            KKSVG L  ADLKGK+VFVR DLNVPLDD+  ITDDTR+RAA+PTIK+L+S+G
Sbjct  4    KKSVGSLKEADLKGKRVFVRVDLNVPLDDSFHITDDTRVRAAVPTIKYLMSHG  56



>ref|XP_006389877.1| hypothetical protein EUTSA_v10018657mg [Eutrema salsugineum]
 gb|ESQ27163.1| hypothetical protein EUTSA_v10018657mg [Eutrema salsugineum]
Length=401

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            K+SVG L  ADLKGK VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ NG
Sbjct  4    KRSVGTLKEADLKGKSVFVRVDLNVPLDDNSNITDDTRIRAAVPTIKYLMGNG  56



>emb|CDX87375.1| BnaA07g34980D [Brassica napus]
Length=401

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            K+SVG L  ADLKGK VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ NG
Sbjct  4    KRSVGTLKEADLKGKSVFVRVDLNVPLDDNSNITDDTRIRAAVPTIKYLMGNG  56



>ref|XP_009791377.1| PREDICTED: phosphoglycerate kinase, cytosolic [Nicotiana sylvestris]
Length=401

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 49/62 (79%), Gaps = 2/62 (3%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGG*SHSVQ  664
            KKSVG L  ADLKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ +G  SH + 
Sbjct  4    KKSVGSLKEADLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLMQHG--SHVIL  61

Query  665  PS  670
             S
Sbjct  62   AS  63



>ref|XP_005791258.1| phosphoglycerate kinase, partial [Emiliania huxleyi CCMP1516]
 gb|EOD38829.1| phosphoglycerate kinase, partial [Emiliania huxleyi CCMP1516]
Length=269

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 48/57 (84%), Gaps = 1/57 (2%)
 Frame = +2

Query  473  VSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            + MAKKSVGDL+ ADLKGKKV VR DLNVPL D + ITDDTRIRA++PT+K+L+  G
Sbjct  35   IEMAKKSVGDLSEADLKGKKVLVRCDLNVPL-DGKTITDDTRIRASVPTVKYLVEKG  90



>ref|XP_010064085.1| PREDICTED: phosphoglycerate kinase, cytosolic [Eucalyptus grandis]
 gb|KCW71390.1| hypothetical protein EUGRSUZ_F04463 [Eucalyptus grandis]
Length=401

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            KKSVG L  ADLKGK+VFVR DLNVPLDD+  ITDDTR+RAA+PTIK+L+S+G
Sbjct  4    KKSVGSLKEADLKGKRVFVRVDLNVPLDDSFHITDDTRVRAAVPTIKYLMSHG  56



>ref|XP_010941660.1| PREDICTED: phosphoglycerate kinase, cytosolic isoform X1 [Elaeis 
guineensis]
Length=409

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 49/58 (84%), Gaps = 1/58 (2%)
 Frame = +2

Query  473  VSMA-KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            + MA K+SV  LT ADLKGKKVFVR DLNVPLDD  KITDDTR+RAA+PTIK+L+ +G
Sbjct  7    IKMATKRSVSTLTGADLKGKKVFVRVDLNVPLDDNLKITDDTRVRAAVPTIKYLMEHG  64



>ref|XP_006656354.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Oryza brachyantha]
Length=401

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            K+SV  L  +DLKGKKVFVRADLNVPLDD QKITDDTRIRA++PTIK+L+  G
Sbjct  4    KRSVSTLAESDLKGKKVFVRADLNVPLDDGQKITDDTRIRASVPTIKYLMEKG  56



>ref|XP_010941661.1| PREDICTED: phosphoglycerate kinase, cytosolic isoform X2 [Elaeis 
guineensis]
Length=401

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            K+SV  LT ADLKGKKVFVR DLNVPLDD  KITDDTR+RAA+PTIK+L+ +G
Sbjct  4    KRSVSTLTGADLKGKKVFVRVDLNVPLDDNLKITDDTRVRAAVPTIKYLMEHG  56



>ref|XP_008798227.1| PREDICTED: phosphoglycerate kinase, cytosolic [Phoenix dactylifera]
Length=401

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            K+SV  LT ADLKGKKVFVR DLNVPLDD  KITDDTR+RAA+PTIK+L+ +G
Sbjct  4    KRSVSTLTGADLKGKKVFVRVDLNVPLDDNLKITDDTRVRAAVPTIKYLMQHG  56



>ref|XP_009104523.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Brassica 
rapa]
Length=401

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            K+SVG L  ADLKGK VFVR DLNVPLDD   ITDDTRIRAA+PT+K+L+ NG
Sbjct  4    KRSVGTLKEADLKGKSVFVRVDLNVPLDDNSNITDDTRIRAAVPTVKYLMENG  56



>ref|XP_010275944.1| PREDICTED: phosphoglycerate kinase, cytosolic [Nelumbo nucifera]
Length=402

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISN  640
            K+SVGDL  ADLKGKKVFVR DLNVPLD+  KITDDTR+RAA+PTIK+L+ +
Sbjct  4    KRSVGDLKEADLKGKKVFVRVDLNVPLDENLKITDDTRVRAAVPTIKYLMGH  55



>emb|CDX79326.1| BnaC06g19770D [Brassica napus]
Length=353

 Score = 85.1 bits (209),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            K++VG L  ADLKGK VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ NG
Sbjct  4    KRNVGTLKEADLKGKSVFVRVDLNVPLDDNSNITDDTRIRAAVPTIKYLMGNG  56



>ref|XP_004139837.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Cucumis sativus]
 ref|XP_004159164.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Cucumis sativus]
 gb|KGN44288.1| hypothetical protein Csa_7G239010 [Cucumis sativus]
Length=401

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            KKSVG L  ADLKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTI++L+S+G
Sbjct  4    KKSVGTLKEADLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTIQYLLSHG  56



>ref|XP_002500825.1| phosphoglycerate kinase [Micromonas sp. RCC299]
 gb|ACO62083.1| phosphoglycerate kinase [Micromonas sp. RCC299]
Length=437

 Score = 85.9 bits (211),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +2

Query  473  VSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            V   KKSVGDL  ADL+GK VFVR DLNVPLD   KITDDTRIRAAIPT+++L+ NG
Sbjct  38   VEAKKKSVGDLKKADLEGKTVFVRCDLNVPLDKDLKITDDTRIRAAIPTLEYLVENG  94



>ref|XP_011095716.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Sesamum indicum]
 ref|XP_011095717.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Sesamum indicum]
 ref|XP_011095718.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Sesamum indicum]
Length=401

 Score = 85.5 bits (210),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            KKSVG L  ADLKGK+V VR DLNVPLDD  KITDDTRIRAA+PTIK+L+ +G
Sbjct  4    KKSVGSLKEADLKGKRVLVRVDLNVPLDDNLKITDDTRIRAAVPTIKYLMEHG  56



>ref|XP_010544342.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Tarenaya 
hassleriana]
Length=401

 Score = 85.1 bits (209),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            K+SVG L  ADLKGK+VFVR DLNVPLD++  ITDDTRIRAA+PTI +LI NG
Sbjct  4    KRSVGTLKEADLKGKRVFVRVDLNVPLDESFNITDDTRIRAAVPTINYLIQNG  56



>ref|XP_009607754.1| PREDICTED: phosphoglycerate kinase, cytosolic [Nicotiana tomentosiformis]
 sp|Q42962.1|PGKY_TOBAC RecName: Full=Phosphoglycerate kinase, cytosolic [Nicotiana tabacum]
 emb|CAA88840.1| phosphoglycerate kinase (PGK) [Nicotiana tabacum]
Length=401

 Score = 85.1 bits (209),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 49/62 (79%), Gaps = 2/62 (3%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGG*SHSVQ  664
            KKSVG L  ADLKGK+VFVR DLNVPLD+   ITDDTRIRAA+PTIK+L+ +G  SH + 
Sbjct  4    KKSVGSLKEADLKGKRVFVRVDLNVPLDENFNITDDTRIRAAVPTIKYLMQHG--SHVIL  61

Query  665  PS  670
             S
Sbjct  62   AS  63



>ref|XP_007022579.1| Phosphoglycerate kinase isoform 1 [Theobroma cacao]
 ref|XP_007022580.1| Phosphoglycerate kinase isoform 1 [Theobroma cacao]
 ref|XP_007022581.1| Phosphoglycerate kinase isoform 1 [Theobroma cacao]
 gb|EOY14104.1| Phosphoglycerate kinase isoform 1 [Theobroma cacao]
 gb|EOY14105.1| Phosphoglycerate kinase isoform 1 [Theobroma cacao]
 gb|EOY14106.1| Phosphoglycerate kinase isoform 1 [Theobroma cacao]
Length=401

 Score = 85.1 bits (209),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            KKSVG L  ADLKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ +G
Sbjct  4    KKSVGALKEADLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLMGHG  56



>ref|WP_015193656.1| phosphoglycerate kinase [Stanieria cyanosphaera]
 gb|AFZ35988.1| phosphoglycerate kinase [Stanieria cyanosphaera PCC 7437]
Length=399

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 51/69 (74%), Gaps = 4/69 (6%)
 Frame = +2

Query  479  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGG----  646
            M+KKSV  LT AD+ GK+V VRAD NVPLDD+  ITDDTRIRAA+PT+K LIS GG    
Sbjct  1    MSKKSVASLTEADVAGKRVLVRADFNVPLDDSGNITDDTRIRAALPTVKDLISKGGKVIL  60

Query  647  *SHSVQPSG  673
             SH  +P G
Sbjct  61   CSHMGRPKG  69



>ref|XP_008447095.1| PREDICTED: phosphoglycerate kinase, cytosolic [Cucumis melo]
Length=401

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            K+SVG L  ADLKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTI++L+S+G
Sbjct  4    KRSVGTLKEADLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTIQYLLSHG  56



>gb|ABI74568.1| phosphoglycerate kinase [Oryza sativa Indica Group]
Length=402

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 50/67 (75%), Gaps = 4/67 (6%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGG----*S  652
            K+SV  L  ADL+GKKVFVRADLNVPLDD QKITDDTRIRA++PT+K L+  G      S
Sbjct  4    KRSVWTLGEADLRGKKVFVRADLNVPLDDAQKITDDTRIRASVPTVKFLLEKGAKVILAS  63

Query  653  HSVQPSG  673
            H  +P G
Sbjct  64   HLGRPKG  70



>ref|XP_003059407.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH56539.1| predicted protein [Micromonas pusilla CCMP1545]
Length=406

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 47/57 (82%), Gaps = 1/57 (2%)
 Frame = +2

Query  473  VSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            V  AKKSVGDL  ADLKGK VF+R DLNVPL D  KITDDTRIRAAIPT+++L+ NG
Sbjct  8    VEAAKKSVGDLKEADLKGKTVFIRCDLNVPL-DGAKITDDTRIRAAIPTLEYLVKNG  63



>ref|XP_010557291.1| PREDICTED: phosphoglycerate kinase, cytosolic [Tarenaya hassleriana]
Length=432

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 56/78 (72%), Gaps = 1/78 (1%)
 Frame = +2

Query  413  HHVATQLRSLKASTKPVRGVVSMA-KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITD  589
            + + +Q+  L  S+     + +MA K+SVG L  ADLKGK+VFVR DLNVPLDD   ITD
Sbjct  10   NSIRSQISHLPLSSDLPFALAAMATKRSVGTLKEADLKGKRVFVRVDLNVPLDDNFNITD  69

Query  590  DTRIRAAIPTIKHLISNG  643
            DTRIRAA+PTI +L+ NG
Sbjct  70   DTRIRAAVPTISYLMQNG  87



>ref|XP_002312237.1| hypothetical protein POPTR_0008s08400g [Populus trichocarpa]
 gb|EEE89604.1| hypothetical protein POPTR_0008s08400g [Populus trichocarpa]
Length=401

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            KKSV  L  ADLKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+S+G
Sbjct  4    KKSVSSLKEADLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLMSHG  56



>gb|ABK92531.1| unknown [Populus trichocarpa]
Length=401

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            KKSV  L  ADLKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+S+G
Sbjct  4    KKSVSSLKEADLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLMSHG  56



>ref|XP_009618219.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Nicotiana 
tomentosiformis]
Length=401

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            KKSVG L   DLKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ +G
Sbjct  4    KKSVGSLKEGDLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLMQHG  56



>ref|WP_006515662.1| phosphoglycerate kinase [Leptolyngbya sp. PCC 7375]
 gb|EKV01261.1| 3-phosphoglycerate kinase [Leptolyngbya sp. PCC 7375]
Length=402

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +2

Query  479  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            MAKKSV DL+AADL GK+V +RAD NVPLDD  KITDDTRIRAA+PTI+ L S G
Sbjct  1    MAKKSVTDLSAADLSGKRVLMRADFNVPLDDQGKITDDTRIRAALPTIQALTSKG  55



>ref|XP_009384174.1| PREDICTED: phosphoglycerate kinase, cytosolic [Musa acuminata 
subsp. malaccensis]
Length=401

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            K+SVGDL  AD+KGK+VFVR DLNVPLD+  K+TDDTRIRA +PTIK+L+  G
Sbjct  4    KRSVGDLKEADVKGKRVFVRVDLNVPLDENLKVTDDTRIRATVPTIKYLMERG  56



>ref|XP_010936568.1| PREDICTED: phosphoglycerate kinase, cytosolic [Elaeis guineensis]
Length=401

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            K+SV  LT ADLKGK+VFVR DLNVPLDD  KITDDTRIRAA+PTI++L+  G
Sbjct  4    KRSVSTLTEADLKGKRVFVRVDLNVPLDDNLKITDDTRIRAAVPTIEYLMDRG  56



>emb|CAL85629.1| phosphoglycerate kinase [Guillardia theta]
Length=221

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 48/57 (84%), Gaps = 1/57 (2%)
 Frame = +2

Query  473  VSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            +S  KKSV DLT A+LKGKKV +R DLNVPLD  +KITDDTRIRA++PTIK+L+ NG
Sbjct  66   MSAKKKSVKDLTPAELKGKKVLIRCDLNVPLDG-KKITDDTRIRASVPTIKYLLDNG  121



>gb|ACU18322.1| unknown [Glycine max]
Length=233

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 48/68 (71%), Gaps = 4/68 (6%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGG----*S  652
            K+SVG L   DLKGK+VFVR DLNVPLDD   ITDDTR+RAA+PTIK+L  +G      S
Sbjct  4    KRSVGTLKEGDLKGKRVFVRVDLNVPLDDNLNITDDTRVRAAVPTIKYLTGHGAKVILSS  63

Query  653  HSVQPSGT  676
            H  +P G 
Sbjct  64   HLGRPKGV  71



>ref|WP_019507461.1| phosphoglycerate kinase [Pleurocapsa sp. PCC 7319]
Length=399

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 50/69 (72%), Gaps = 4/69 (6%)
 Frame = +2

Query  479  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGG----  646
            MAKK+V  LT AD+ GKKV VRAD NVPLDD+  ITDDTRI+AA+PTIK L+  GG    
Sbjct  1    MAKKTVASLTEADVSGKKVLVRADFNVPLDDSGNITDDTRIKAALPTIKDLVGKGGKVIL  60

Query  647  *SHSVQPSG  673
             SH  +P G
Sbjct  61   CSHMGRPKG  69



>emb|CDP13576.1| unnamed protein product [Coffea canephora]
Length=401

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLIS  637
            KKSVG L  ADLKGKKVFVR DLNVPLDD   ITDDTRIRAA+PTI +LI 
Sbjct  4    KKSVGSLKEADLKGKKVFVRVDLNVPLDDNFNITDDTRIRAAVPTINYLIG  54



>ref|XP_002977295.1| hypothetical protein SELMODRAFT_107116 [Selaginella moellendorffii]
 gb|EFJ21299.1| hypothetical protein SELMODRAFT_107116 [Selaginella moellendorffii]
Length=402

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +2

Query  473  VSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHL  631
            +++ KKSVGDLTAAD+KGK+VF+RADLNVPLD    ITDDTR+RA++PTI+HL
Sbjct  1    MAVTKKSVGDLTAADVKGKRVFLRADLNVPLDAEFNITDDTRLRASVPTIQHL  53



>gb|ACJ84593.1| unknown [Medicago truncatula]
Length=226

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 48/68 (71%), Gaps = 4/68 (6%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGG----*S  652
            K+SVG L  A+LKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L   G      S
Sbjct  4    KRSVGTLKEAELKGKRVFVRVDLNVPLDDNLNITDDTRIRAAVPTIKYLTGYGAKVILSS  63

Query  653  HSVQPSGT  676
            H  +P G 
Sbjct  64   HLGRPKGV  71



>gb|AAF85975.1|AF275639_1 cytosolic phosphoglycerate kinase [Pisum sativum]
Length=401

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            K+SVG L  ADLKGK+VFVR DLNVPLDD   ITDDTRIRAAIPTIK+L   G
Sbjct  4    KRSVGTLKEADLKGKRVFVRVDLNVPLDDNLNITDDTRIRAAIPTIKYLTGYG  56



>ref|XP_011468861.1| PREDICTED: phosphoglycerate kinase, cytosolic [Fragaria vesca 
subsp. vesca]
Length=401

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            K+SV  L  ADLKGK+VFVR DLNVPLD++ KITDDTRIRAA+PTIK+L  NG
Sbjct  4    KRSVSTLKEADLKGKRVFVRVDLNVPLDESCKITDDTRIRAAVPTIKYLQGNG  56



>ref|WP_023076270.1| phosphoglycerate kinase [Leptolyngbya sp. Heron Island J]
 gb|ESA32821.1| phosphoglycerate kinase [Leptolyngbya sp. Heron Island J]
Length=401

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +2

Query  479  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            MAKKSV DL+AADL GK+V +RAD NVPLDD   ITDDTRIRAA+PTI+ L S G
Sbjct  1    MAKKSVADLSAADLSGKRVLMRADFNVPLDDQGNITDDTRIRAALPTIQALTSKG  55



>ref|XP_010537804.1| PREDICTED: phosphoglycerate kinase, cytosolic [Tarenaya hassleriana]
 ref|XP_010537805.1| PREDICTED: phosphoglycerate kinase, cytosolic [Tarenaya hassleriana]
Length=401

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +2

Query  491  SVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            SV  L  ADLKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+SNG
Sbjct  6    SVSTLKEADLKGKRVFVRVDLNVPLDDHSNITDDTRIRAAVPTIKYLMSNG  56



>ref|WP_016924803.1| phosphoglycerate kinase [Prochlorothrix hollandica]
Length=401

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +2

Query  479  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            MAKKSV  LTA D+ GK+V VRAD NVPLDD  +ITDDTRIRAA+PTI+ L+S G
Sbjct  1    MAKKSVAQLTAQDVAGKRVLVRADFNVPLDDAGQITDDTRIRAALPTIQDLVSKG  55



>gb|AAO63774.1| 3-phosphoglycerate kinase [Populus tremuloides]
Length=401

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            KKSV  L  ADLKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ +G
Sbjct  4    KKSVSSLKEADLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLMGHG  56



>ref|XP_011016588.1| PREDICTED: phosphoglycerate kinase, cytosolic [Populus euphratica]
Length=401

 Score = 82.4 bits (202),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            KKSV  L  ADLKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ +G
Sbjct  4    KKSVSSLKEADLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLMGHG  56



>emb|CDX79325.1| BnaC06g19780D [Brassica napus]
Length=334

 Score = 81.6 bits (200),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            K+SVG L  ADLKGK VFV  DL+VPLDD   ITDDTRIRAA+PTIK+L+ NG
Sbjct  4    KRSVGTLKEADLKGKSVFVSVDLSVPLDDNSNITDDTRIRAAVPTIKYLMGNG  56



>ref|XP_002513352.1| phosphoglycerate kinase, putative [Ricinus communis]
 gb|EEF48755.1| phosphoglycerate kinase, putative [Ricinus communis]
Length=401

 Score = 82.4 bits (202),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            KKSV  L  ADLKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ +G
Sbjct  4    KKSVSSLKEADLKGKRVFVRVDLNVPLDDNLNITDDTRIRAAVPTIKYLMDHG  56



>ref|XP_005855869.1| phosphoglycerate kinase, partial [Nannochloropsis gaditana CCMP526]
 gb|EKU20494.1| phosphoglycerate kinase, partial [Nannochloropsis gaditana CCMP526]
Length=197

 Score = 80.1 bits (196),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 51/69 (74%), Gaps = 5/69 (7%)
 Frame = +2

Query  479  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGG----  646
            MAKKSVG L  ADLKGK+VFVR DLNVPL D + ITDDTRIRA++PTI++L S G     
Sbjct  1    MAKKSVGSLADADLKGKRVFVRCDLNVPL-DGKTITDDTRIRASVPTIEYLASKGAKVLL  59

Query  647  *SHSVQPSG  673
             SH  +P G
Sbjct  60   TSHLGRPKG  68



>ref|XP_008383158.1| PREDICTED: phosphoglycerate kinase, cytosolic [Malus domestica]
Length=401

 Score = 82.4 bits (202),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            KKSV  L  A+LKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ +G
Sbjct  4    KKSVSTLKEAELKGKRVFVRVDLNVPLDDNSNITDDTRIRAAVPTIKYLLGHG  56



>gb|EPS64076.1| phosphoglycerate kinase [Genlisea aurea]
Length=401

 Score = 82.0 bits (201),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            KKSVG L  ADLKGK+V VR DLNVPLDD   ITDDTRIRAA+PTI +LI +G
Sbjct  4    KKSVGSLKEADLKGKRVLVRVDLNVPLDDNFNITDDTRIRAAVPTINYLIGHG  56



>ref|WP_040940054.1| phosphoglycerate kinase [Prochloron didemni]
Length=401

 Score = 82.0 bits (201),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 49/69 (71%), Gaps = 4/69 (6%)
 Frame = +2

Query  479  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGG----  646
            M+KK+V +L AADL GK+V VR D NVPLDD  KITDDTRIRAA+PTIK LI  G     
Sbjct  1    MSKKTVANLAAADLTGKRVLVRVDFNVPLDDAGKITDDTRIRAALPTIKDLIKKGAKVIL  60

Query  647  *SHSVQPSG  673
             SH  +P G
Sbjct  61   CSHMGRPKG  69



>ref|WP_040931032.1| phosphoglycerate kinase [Prochloron didemni]
Length=401

 Score = 82.0 bits (201),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 49/69 (71%), Gaps = 4/69 (6%)
 Frame = +2

Query  479  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGG----  646
            M+KK+V +L AADL GK+V VR D NVPLDD  KITDDTRIRAA+PTIK LI  G     
Sbjct  1    MSKKTVANLAAADLTGKRVLVRVDFNVPLDDAGKITDDTRIRAALPTIKDLIKKGAKVIL  60

Query  647  *SHSVQPSG  673
             SH  +P G
Sbjct  61   CSHMGRPKG  69



>ref|WP_015124821.1| phosphoglycerate kinase [Synechococcus sp. PCC 6312]
 gb|AFY61278.1| 3-phosphoglycerate kinase [Synechococcus sp. PCC 6312]
Length=400

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +2

Query  479  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            M+KK++ DLTAADL GK+V VRAD NVPLD T  ITDDTRIRAA+PTI++L S G
Sbjct  1    MSKKTLADLTAADLDGKRVLVRADFNVPLDGTGAITDDTRIRAALPTIQNLTSKG  55



>ref|XP_001418373.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO96666.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=435

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +2

Query  470  VVSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            VV   KKSVGDL  +DLKG+ VFVR DLNVP+D    ITDDTRIRAAIPT+++L  NG
Sbjct  35   VVEAKKKSVGDLAESDLKGQTVFVRCDLNVPMDADLNITDDTRIRAAIPTLEYLAKNG  92



>dbj|BAA33801.1| cytosolic phosphoglycerate kinase 1 [Populus nigra]
Length=401

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            KKSV  L  ADLKGK VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ +G
Sbjct  4    KKSVSSLKEADLKGKSVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLMGHG  56



>ref|XP_003531483.1| PREDICTED: phosphoglycerate kinase, cytosolic [Glycine max]
 gb|KHN21385.1| Phosphoglycerate kinase, cytosolic [Glycine soja]
Length=401

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            K+SVG L   DLKGK+VFVR DLNVPLDD   ITDDTR+RAA+PTIK+L  +G
Sbjct  4    KRSVGTLKEGDLKGKRVFVRVDLNVPLDDNLNITDDTRVRAAVPTIKYLTGHG  56



>gb|KDO61597.1| hypothetical protein CISIN_1g040813mg [Citrus sinensis]
Length=401

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +2

Query  482  AKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            AKKSV  L  ADLKGK+VFVR DLNVPLDD   ITDD R+RAA+PTIK+L+ +G
Sbjct  3    AKKSVSVLKEADLKGKRVFVRVDLNVPLDDNLNITDDNRVRAAVPTIKYLMGHG  56



>ref|XP_006422250.1| hypothetical protein CICLE_v10005101mg [Citrus clementina]
 ref|XP_006493790.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Citrus sinensis]
 gb|ESR35490.1| hypothetical protein CICLE_v10005101mg [Citrus clementina]
Length=401

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +2

Query  482  AKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            AKKSV  L  ADLKGK+VFVR DLNVPLDD   ITDD R+RAA+PTIK+L+ +G
Sbjct  3    AKKSVSVLKEADLKGKRVFVRVDLNVPLDDNLNITDDNRVRAAVPTIKYLMGHG  56



>ref|WP_038547249.1| phosphoglycerate kinase [Synechococcus sp. KORDI-100]
 gb|AII44688.1| phosphoglycerate kinase [Synechococcus sp. KORDI-100]
Length=402

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +2

Query  479  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            MAK+S+  L A DLKGK+V VR D NVPLDD+  ITDDTRIRAA+PTI+ LIS G
Sbjct  1    MAKRSLASLNAGDLKGKRVLVRVDFNVPLDDSGAITDDTRIRAALPTIQDLISKG  55



>ref|XP_004488762.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Cicer arietinum]
Length=401

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHL  631
            K+SVG L   DLKGKKVFVR DLNVPLDD   ITDDTRIRAA+PTIK+L
Sbjct  4    KRSVGTLKEGDLKGKKVFVRVDLNVPLDDNLNITDDTRIRAAVPTIKYL  52



>ref|WP_006528046.1| phosphoglycerate kinase [Gloeocapsa sp. PCC 73106]
 gb|ELR99128.1| 3-phosphoglycerate kinase [Gloeocapsa sp. PCC 73106]
Length=401

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 51/69 (74%), Gaps = 4/69 (6%)
 Frame = +2

Query  479  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGG----  646
            M+KK++ +L+ ADL GKKV VRAD NVPLDD ++ITDDTRIRAA+PTI++L   G     
Sbjct  1    MSKKTIANLSEADLAGKKVLVRADFNVPLDDNRQITDDTRIRAALPTIEYLREKGAKVIL  60

Query  647  *SHSVQPSG  673
             SH  +P G
Sbjct  61   CSHFGRPQG  69



>ref|WP_030007016.1| phosphoglycerate kinase [Synechococcus sp. NKBG042902]
Length=398

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +2

Query  479  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            MAKKSV +LT ADL GK+VFVR D NVPL+++  ITDDTRIRAA+PTIK+L   G
Sbjct  1    MAKKSVANLTEADLNGKRVFVRVDFNVPLNESGVITDDTRIRAALPTIKYLTEKG  55



>emb|CBN79775.1| Phosphoglycerate kinase [Ectocarpus siliculosus]
Length=485

 Score = 80.5 bits (197),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 56/88 (64%), Gaps = 3/88 (3%)
 Frame = +2

Query  386  AAAADPFFSHHVATQLRSLKASTKPVRGVVSMAK--KSVGDLTAADLKGKKVFVRADLNV  559
            AA  +P+F    A  L  L    +     +S  K  KSVGDLT+ DLKGK+V VR DLNV
Sbjct  54   AAVEEPWFDEAKANVLLDLDELERASDMTLSSDKPKKSVGDLTSEDLKGKRVLVRCDLNV  113

Query  560  PLDDTQKITDDTRIRAAIPTIKHLISNG  643
            PLD +  ITDDTRIRA+IPT+K L+  G
Sbjct  114  PLDGST-ITDDTRIRASIPTVKFLVDKG  140


 Score = 25.8 bits (55),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 11/12 (92%), Positives = 12/12 (100%), Gaps = 0/12 (0%)
 Frame = +3

Query  642  GAKVILSSHLGR  677
            GAKV+LSSHLGR
Sbjct  140  GAKVLLSSHLGR  151



>ref|XP_007149209.1| hypothetical protein PHAVU_005G050800g [Phaseolus vulgaris]
 ref|XP_007149210.1| hypothetical protein PHAVU_005G050800g [Phaseolus vulgaris]
 gb|ESW21203.1| hypothetical protein PHAVU_005G050800g [Phaseolus vulgaris]
 gb|ESW21204.1| hypothetical protein PHAVU_005G050800g [Phaseolus vulgaris]
Length=401

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            K+SVG L   DLKGK+VFVR DLNVPLDD   ITDDTR+RAA+PTIK+L   G
Sbjct  4    KRSVGTLKEGDLKGKRVFVRVDLNVPLDDNLNITDDTRVRAAVPTIKYLTGYG  56



>ref|XP_003546821.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Glycine max]
 gb|KHN48876.1| Phosphoglycerate kinase, cytosolic [Glycine soja]
Length=401

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            K+SVG L   DLKGK+VFVR DLNVPLDD   ITDDTR+RAA+PTIK+L   G
Sbjct  4    KRSVGTLKEGDLKGKRVFVRVDLNVPLDDNLNITDDTRVRAAVPTIKYLTGYG  56



>ref|WP_012626442.1| phosphoglycerate kinase [Cyanothece sp. PCC 7425]
 sp|B8HXQ5.1|PGK_CYAP4 RecName: Full=Phosphoglycerate kinase [Cyanothece sp. PCC 7425]
 gb|ACL43344.1| Phosphoglycerate kinase [Cyanothece sp. PCC 7425]
Length=406

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +2

Query  479  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            M+KK+V +L+AADL GK+V VR D NVPLDD  KITDDTRIRAA+PTI+ L S G
Sbjct  1    MSKKTVANLSAADLAGKRVLVRVDFNVPLDDQGKITDDTRIRAALPTIQDLTSKG  55



>ref|WP_028953033.1| phosphoglycerate kinase [Synechococcus sp. CC9616]
Length=402

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +2

Query  479  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            MAK+S+  L A DLKGK+V VR D NVPLDD+  ITDDTRIRAA+PTI+ LIS G
Sbjct  1    MAKRSLASLNAGDLKGKRVLVRVDFNVPLDDSGAITDDTRIRAALPTIQDLISKG  55



>ref|XP_002972143.1| hypothetical protein SELMODRAFT_96742 [Selaginella moellendorffii]
 gb|EFJ27060.1| hypothetical protein SELMODRAFT_96742 [Selaginella moellendorffii]
Length=402

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +2

Query  473  VSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHL  631
            +++ KKSVGDLT AD+KGK+VF+RADLNVPLD    ITDDTR+RAA+PTI++L
Sbjct  1    MAVTKKSVGDLTEADVKGKRVFLRADLNVPLDAEFNITDDTRLRAAVPTIQYL  53



>ref|XP_011013882.1| PREDICTED: phosphoglycerate kinase, cytosolic-like isoform X2 
[Populus euphratica]
Length=401

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            KKSV  L   DLKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ +G
Sbjct  4    KKSVSSLKETDLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLMDHG  56



>gb|AFK46712.1| unknown [Medicago truncatula]
Length=401

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            K+SVG L  A+LKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L   G
Sbjct  4    KRSVGTLKEAELKGKRVFVRVDLNVPLDDNLNITDDTRIRAAVPTIKYLTGYG  56



>ref|XP_011013868.1| PREDICTED: phosphoglycerate kinase, cytosolic-like isoform X1 
[Populus euphratica]
 ref|XP_011013875.1| PREDICTED: phosphoglycerate kinase, cytosolic-like isoform X1 
[Populus euphratica]
Length=429

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            KKSV  L   DLKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ +G
Sbjct  4    KKSVSSLKETDLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLMDHG  56



>ref|WP_041765481.1| phosphoglycerate kinase [Leptolyngbya sp. PCC 7376]
Length=398

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +2

Query  479  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            MAKK+V +LT +DL+GKKVFVR D NVPL D+  ITDDTRIRAA+PTIK+L   G
Sbjct  1    MAKKTVANLTQSDLEGKKVFVRVDFNVPLTDSGVITDDTRIRAALPTIKYLTEKG  55



>ref|XP_002315067.1| cytosolic phosphoglycerate kinase family protein [Populus trichocarpa]
 gb|EEF01238.1| cytosolic phosphoglycerate kinase family protein [Populus trichocarpa]
Length=401

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            KKSV  L   DLKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ +G
Sbjct  4    KKSVSSLKETDLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLMDHG  56



>ref|XP_003596092.1| Phosphoglycerate kinase [Medicago truncatula]
 gb|AES66343.1| phosphoglycerate kinase-like protein [Medicago truncatula]
Length=401

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            K+SVG L  A+LKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L   G
Sbjct  4    KRSVGTLKEAELKGKRVFVRVDLNVPLDDNLNITDDTRIRAAVPTIKYLTGYG  56



>ref|XP_005821497.1| phosphoglycerate kinase, plastid-targeted [Guillardia theta CCMP2712]
 gb|EKX34517.1| phosphoglycerate kinase, plastid-targeted [Guillardia theta CCMP2712]
Length=497

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 48/57 (84%), Gaps = 1/57 (2%)
 Frame = +2

Query  473  VSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            +S  KKSV DLT A+LKGKKV +R DLNVPL D +KITDDTRIRA++PTIK+L+ NG
Sbjct  66   MSAKKKSVKDLTPAELKGKKVLIRCDLNVPL-DGKKITDDTRIRASVPTIKYLLDNG  121



>ref|XP_010094705.1| Phosphoglycerate kinase [Morus notabilis]
 gb|EXB56751.1| Phosphoglycerate kinase [Morus notabilis]
Length=401

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            K+SVG L  A+LKGK+VFVR DLNVPLDD   ITDDTRIR A+PTI++LI  G
Sbjct  4    KRSVGTLKEAELKGKRVFVRVDLNVPLDDNLNITDDTRIRGALPTIQYLIGYG  56



>ref|WP_012307199.1| phosphoglycerate kinase [Synechococcus sp. PCC 7002]
 sp|B1XNQ1.1|PGK_SYNP2 RecName: Full=Phosphoglycerate kinase [Synechococcus sp. PCC 
7002]
 gb|ACA99576.1| phosphoglycerate kinase [Synechococcus sp. PCC 7002]
Length=398

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +2

Query  479  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            MAKKSV +LT ADL GK+VFVR D NVPL+++  ITDDTRIRAA+PTIK+L   G
Sbjct  1    MAKKSVANLTEADLSGKRVFVRVDFNVPLNESGVITDDTRIRAALPTIKYLTEKG  55



>ref|WP_024545807.1| phosphoglycerate kinase [Synechococcus sp. NKBG15041c]
Length=398

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +2

Query  479  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            MAKKSV +LT ADL GK+VFVR D NVPL+++  ITDDTRIRAA+PTI++L   G
Sbjct  1    MAKKSVANLTEADLSGKRVFVRVDFNVPLNESGAITDDTRIRAALPTIQYLTGKG  55



>ref|WP_008311068.1| phosphoglycerate kinase [Leptolyngbya sp. PCC 6406]
Length=401

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +2

Query  479  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            MAKK+V  LTAADL GK+V VRAD NVPLD+   ITDDTRIRAA+PTI+ L S G
Sbjct  1    MAKKTVATLTAADLSGKRVLVRADFNVPLDEQGNITDDTRIRAALPTIQDLTSKG  55



>gb|KDP25066.1| hypothetical protein JCGZ_22601 [Jatropha curcas]
Length=401

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            KKSV  L  ADLKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L  +G
Sbjct  4    KKSVSSLKEADLKGKRVFVRVDLNVPLDDNLNITDDTRIRAAVPTIKYLRDHG  56



>ref|XP_008226131.1| PREDICTED: phosphoglycerate kinase, cytosolic [Prunus mume]
Length=401

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            K+SV  L  A+LKGK+VFVR DLNVPLDD  KITDDTR+RAA+PTIK+L  +G
Sbjct  4    KRSVSTLKEAELKGKRVFVRVDLNVPLDDNSKITDDTRVRAAVPTIKYLQGHG  56



>ref|WP_036484843.1| phosphoglycerate kinase [Myxosarcina sp. GI1]
Length=399

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 50/69 (72%), Gaps = 4/69 (6%)
 Frame = +2

Query  479  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGG----  646
            MAKK+V  LT AD+ GK+V VRAD NVPLDD+  I+DDTRI+AA+PTI+ LI  GG    
Sbjct  1    MAKKTVASLTEADVAGKRVLVRADFNVPLDDSGNISDDTRIKAALPTIEDLIGKGGKVIL  60

Query  647  *SHSVQPSG  673
             SH  +P G
Sbjct  61   CSHMGRPKG  69



>dbj|BAA33802.1| cytosolic phosphoglycerate kinase 1 [Populus nigra]
Length=401

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            KKSV  L   DLKGK+VFVR DLNVPLDD   ITDDTRIRAA+PT+K+L+ +G
Sbjct  4    KKSVSSLKETDLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTVKYLMDHG  56



>ref|XP_008805982.1| PREDICTED: phosphoglycerate kinase, cytosolic [Phoenix dactylifera]
 ref|XP_008776888.1| PREDICTED: phosphoglycerate kinase, cytosolic [Phoenix dactylifera]
Length=400

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            K+SV  L  ADLKGK+VFVR DLNVPLDD+  ITDD RIRAA+PTIK+L+ +G
Sbjct  4    KRSVSTLKEADLKGKRVFVRVDLNVPLDDSLNITDDNRIRAAVPTIKYLMDHG  56



>ref|XP_007213914.1| hypothetical protein PRUPE_ppa005669mg [Prunus persica]
 gb|EMJ15113.1| hypothetical protein PRUPE_ppa005669mg [Prunus persica]
Length=449

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +2

Query  473  VSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            V   K+SV  L  A+LKGK+VFVR DLNVPLDD  KITDDTR+RAA+PTIK+L  +G
Sbjct  48   VMATKRSVSTLKEAELKGKRVFVRVDLNVPLDDNSKITDDTRVRAAVPTIKYLQGHG  104



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1104504643240