BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF051N15

Length=671
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009778973.1|  PREDICTED: katanin p80 WD40 repeat-containin...    315   1e-96   Nicotiana sylvestris
ref|XP_009593301.1|  PREDICTED: katanin p80 WD40 repeat-containin...    314   2e-96   Nicotiana tomentosiformis
ref|XP_006347178.1|  PREDICTED: katanin p80 WD40 repeat-containin...    313   1e-95   
ref|XP_004232826.1|  PREDICTED: katanin p80 WD40 repeat-containin...    311   3e-95   Solanum lycopersicum
ref|XP_011096279.1|  PREDICTED: katanin p80 WD40 repeat-containin...    307   5e-95   Sesamum indicum [beniseed]
gb|EYU27954.1|  hypothetical protein MIMGU_mgv1a001351mg                302   4e-93   Erythranthe guttata [common monkey flower]
emb|CDO99605.1|  unnamed protein product                                299   2e-92   Coffea canephora [robusta coffee]
emb|CBI38493.3|  unnamed protein product                                289   2e-91   Vitis vinifera
ref|XP_010647331.1|  PREDICTED: katanin p80 WD40 repeat-containin...    293   5e-90   
gb|KDP20912.1|  hypothetical protein JCGZ_21383                         293   4e-89   Jatropha curcas
ref|XP_008442143.1|  PREDICTED: katanin p80 WD40 repeat-containin...    293   5e-89   Cucumis melo [Oriental melon]
ref|XP_008442151.1|  PREDICTED: katanin p80 WD40 repeat-containin...    292   5e-89   Cucumis melo [Oriental melon]
ref|XP_004146637.1|  PREDICTED: katanin p80 WD40 repeat-containin...    292   9e-89   
gb|KGN64638.1|  hypothetical protein Csa_1G072490                       293   1e-88   Cucumis sativus [cucumbers]
gb|KJB69457.1|  hypothetical protein B456_011G024400                    291   1e-88   Gossypium raimondii
gb|EPS68225.1|  hypothetical protein M569_06544                         288   1e-88   Genlisea aurea
ref|XP_007025739.1|  Transducin/WD40 repeat-like superfamily prot...    290   1e-88   
ref|XP_007148216.1|  hypothetical protein PHAVU_006G189900g             290   2e-88   Phaseolus vulgaris [French bean]
ref|XP_007025735.1|  Katanin P80 subunit, putative isoform 3            291   2e-88   
ref|XP_007025737.1|  Transducin/WD40 repeat-like superfamily prot...    290   2e-88   
ref|XP_007025736.1|  Transducin/WD40 repeat-like superfamily prot...    291   2e-88   
ref|XP_007025734.1|  Transducin/WD40 repeat-like superfamily prot...    290   2e-88   
ref|XP_007025733.1|  Katanin P80 subunit, putative isoform 1            291   2e-88   
gb|KJB69456.1|  hypothetical protein B456_011G024400                    292   2e-88   Gossypium raimondii
ref|XP_008224985.1|  PREDICTED: katanin p80 WD40 repeat-containin...    289   3e-88   Prunus mume [ume]
ref|XP_008224983.1|  PREDICTED: katanin p80 WD40 repeat-containin...    289   3e-88   Prunus mume [ume]
ref|XP_008224984.1|  PREDICTED: katanin p80 WD40 repeat-containin...    289   3e-88   Prunus mume [ume]
gb|AES63731.2|  katanin p80 WD40 repeat subunit B1-like protein         293   4e-88   Medicago truncatula
gb|KEH36528.1|  katanin p80 WD40 repeat subunit B1-like protein         291   4e-88   Medicago truncatula
ref|XP_007213652.1|  hypothetical protein PRUPE_ppa001393mg             288   1e-87   Prunus persica
gb|KHG08287.1|  hypothetical protein F383_16149                         290   1e-87   Gossypium arboreum [tree cotton]
ref|XP_003545861.1|  PREDICTED: katanin p80 WD40 repeat-containin...    286   3e-87   Glycine max [soybeans]
ref|XP_011043252.1|  PREDICTED: katanin p80 WD40 repeat-containin...    288   3e-87   Populus euphratica
ref|XP_003543076.1|  PREDICTED: katanin p80 WD40 repeat-containin...    286   5e-87   Glycine max [soybeans]
gb|KJB68609.1|  hypothetical protein B456_010G254700                    287   8e-87   Gossypium raimondii
gb|KJB68608.1|  hypothetical protein B456_010G254700                    286   8e-87   Gossypium raimondii
ref|XP_006377307.1|  hypothetical protein POPTR_0011s04530g             287   1e-86   Populus trichocarpa [western balsam poplar]
gb|KHG05933.1|  hypothetical protein F383_10434                         286   1e-86   Gossypium arboreum [tree cotton]
ref|XP_010109595.1|  Katanin p80 WD40 repeat-containing subunit B...    265   3e-86   
ref|XP_008371310.1|  PREDICTED: katanin p80 WD40 repeat-containin...    282   9e-86   
ref|XP_006467861.1|  PREDICTED: katanin p80 WD40 repeat-containin...    285   1e-85   Citrus sinensis [apfelsine]
ref|XP_010278330.1|  PREDICTED: katanin p80 WD40 repeat-containin...    280   2e-85   Nelumbo nucifera [Indian lotus]
ref|XP_006449267.1|  hypothetical protein CICLE_v10014112mg             284   3e-85   Citrus clementina [clementine]
ref|XP_010057471.1|  PREDICTED: katanin p80 WD40 repeat-containin...    283   5e-85   Eucalyptus grandis [rose gum]
gb|KDO75817.1|  hypothetical protein CISIN_1g001462mg                   283   6e-85   Citrus sinensis [apfelsine]
gb|KDO75818.1|  hypothetical protein CISIN_1g001462mg                   283   6e-85   Citrus sinensis [apfelsine]
ref|XP_004293499.1|  PREDICTED: katanin p80 WD40 repeat-containin...    278   1e-84   Fragaria vesca subsp. vesca
ref|XP_004158060.1|  PREDICTED: katanin p80 WD40 repeat-containin...    280   1e-84   
ref|XP_010533875.1|  PREDICTED: katanin p80 WD40 repeat-containin...    281   2e-84   Tarenaya hassleriana [spider flower]
ref|XP_010533874.1|  PREDICTED: katanin p80 WD40 repeat-containin...    281   2e-84   Tarenaya hassleriana [spider flower]
ref|XP_010696578.1|  PREDICTED: katanin p80 WD40 repeat-containin...    278   2e-84   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010696579.1|  PREDICTED: katanin p80 WD40 repeat-containin...    278   2e-84   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010696580.1|  PREDICTED: katanin p80 WD40 repeat-containin...    278   2e-84   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010533878.1|  PREDICTED: katanin p80 WD40 repeat-containin...    280   3e-84   Tarenaya hassleriana [spider flower]
ref|XP_010533877.1|  PREDICTED: katanin p80 WD40 repeat-containin...    280   3e-84   Tarenaya hassleriana [spider flower]
ref|XP_002521412.1|  katanin P80 subunit, putative                      278   9e-84   
ref|XP_003593480.1|  Katanin p80 WD40-containing subunit B1             280   2e-83   
gb|EYU24725.1|  hypothetical protein MIMGU_mgv1a018894mg                258   2e-83   Erythranthe guttata [common monkey flower]
ref|XP_008350805.1|  PREDICTED: katanin p80 WD40 repeat-containin...    257   7e-83   
ref|XP_010473326.1|  PREDICTED: katanin p80 WD40 repeat-containin...    278   7e-83   Camelina sativa [gold-of-pleasure]
ref|XP_010473325.1|  PREDICTED: katanin p80 WD40 repeat-containin...    278   8e-83   Camelina sativa [gold-of-pleasure]
ref|XP_011087019.1|  PREDICTED: katanin p80 WD40 repeat-containin...    276   8e-83   Sesamum indicum [beniseed]
ref|XP_010418088.1|  PREDICTED: katanin p80 WD40 repeat-containin...    278   1e-82   Camelina sativa [gold-of-pleasure]
ref|XP_010430118.1|  PREDICTED: katanin p80 WD40 repeat-containin...    277   1e-82   
ref|XP_010418089.1|  PREDICTED: katanin p80 WD40 repeat-containin...    277   1e-82   Camelina sativa [gold-of-pleasure]
ref|XP_006594334.1|  PREDICTED: katanin p80 WD40 repeat-containin...    273   1e-82   Glycine max [soybeans]
ref|NP_176316.4|  protein DWD hypersensitive to ABA 3                   277   1e-82   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001185277.1|  protein DWD hypersensitive to ABA 3                277   2e-82   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003541552.1|  PREDICTED: katanin p80 WD40 repeat-containin...    273   2e-82   
ref|XP_010547289.1|  PREDICTED: katanin p80 WD40 repeat-containin...    275   3e-82   Tarenaya hassleriana [spider flower]
ref|XP_010547296.1|  PREDICTED: katanin p80 WD40 repeat-containin...    275   3e-82   Tarenaya hassleriana [spider flower]
ref|XP_010547304.1|  PREDICTED: katanin p80 WD40 repeat-containin...    275   3e-82   Tarenaya hassleriana [spider flower]
ref|XP_010547314.1|  PREDICTED: katanin p80 WD40 repeat-containin...    275   3e-82   Tarenaya hassleriana [spider flower]
ref|XP_007159273.1|  hypothetical protein PHAVU_002G224100g             269   3e-82   Phaseolus vulgaris [French bean]
gb|KFK40725.1|  hypothetical protein AALP_AA2G032800                    276   5e-82   Arabis alpina [alpine rockcress]
gb|KFK40724.1|  hypothetical protein AALP_AA2G032800                    276   6e-82   Arabis alpina [alpine rockcress]
ref|XP_009378573.1|  PREDICTED: katanin p80 WD40 repeat-containin...    273   6e-82   Pyrus x bretschneideri [bai li]
ref|XP_009378641.1|  PREDICTED: katanin p80 WD40 repeat-containin...    273   6e-82   Pyrus x bretschneideri [bai li]
ref|XP_007159274.1|  hypothetical protein PHAVU_002G224100g             270   8e-82   Phaseolus vulgaris [French bean]
gb|AAD49999.1|AC007259_12  Hypothetical protein                         273   1e-81   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010905606.1|  PREDICTED: katanin p80 WD40 repeat-containin...    270   2e-81   
ref|NP_172582.2|  WD40 domain-containing protein                        273   3e-81   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010905607.1|  PREDICTED: katanin p80 WD40 repeat-containin...    270   3e-81   Elaeis guineensis
ref|XP_010905604.1|  PREDICTED: katanin p80 WD40 repeat-containin...    270   4e-81   Elaeis guineensis
ref|XP_010240610.1|  PREDICTED: katanin p80 WD40 repeat-containin...    271   6e-81   Brachypodium distachyon [annual false brome]
ref|XP_010240609.1|  PREDICTED: katanin p80 WD40 repeat-containin...    271   7e-81   Brachypodium distachyon [annual false brome]
gb|KFK43409.1|  hypothetical protein AALP_AA1G122100                    271   7e-81   Arabis alpina [alpine rockcress]
ref|XP_006300659.1|  hypothetical protein CARUB_v10019681mg             272   7e-81   Capsella rubella
emb|CDY03812.1|  BnaC01g29290D                                          272   8e-81   
emb|CAE05767.2|  OSJNBa0064G10.18                                       271   8e-81   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009104469.1|  PREDICTED: katanin p80 WD40 repeat-containin...    272   8e-81   Brassica rapa
gb|KFK43408.1|  hypothetical protein AALP_AA1G122100                    271   9e-81   Arabis alpina [alpine rockcress]
ref|XP_009104461.1|  PREDICTED: katanin p80 WD40 repeat-containin...    272   9e-81   Brassica rapa
ref|XP_010274906.1|  PREDICTED: katanin p80 WD40 repeat-containin...    268   2e-80   Nelumbo nucifera [Indian lotus]
emb|CDY52222.1|  BnaA01g35940D                                          270   6e-80   Brassica napus [oilseed rape]
ref|XP_010935618.1|  PREDICTED: katanin p80 WD40 repeat-containin...    264   7e-80   Elaeis guineensis
ref|XP_011033110.1|  PREDICTED: katanin p80 WD40 repeat-containin...    263   7e-80   Populus euphratica
ref|XP_002889852.1|  hypothetical protein ARALYDRAFT_471250             269   7e-80   
ref|XP_009392835.1|  PREDICTED: katanin p80 WD40 repeat-containin...    265   8e-80   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008668688.1|  PREDICTED: katanin p80 WD40 repeat-containin...    268   8e-80   Zea mays [maize]
ref|XP_009418645.1|  PREDICTED: katanin p80 WD40 repeat-containin...    265   8e-80   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFW59905.1|  hypothetical protein ZEAMMB73_759012                    264   1e-79   
ref|XP_010935617.1|  PREDICTED: katanin p80 WD40 repeat-containin...    265   1e-79   Elaeis guineensis
gb|AAB71474.1|  contains beta-transducin motif                          269   1e-79   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009351341.1|  PREDICTED: katanin p80 WD40 repeat-containin...    260   1e-79   Pyrus x bretschneideri [bai li]
ref|XP_009392833.1|  PREDICTED: katanin p80 WD40 repeat-containin...    265   1e-79   
ref|XP_006306661.1|  hypothetical protein CARUB_v10008176mg             268   1e-79   
gb|KHG16229.1|  hypothetical protein F383_04189                         266   1e-79   Gossypium arboreum [tree cotton]
gb|KDP33053.1|  hypothetical protein JCGZ_13639                         265   1e-79   Jatropha curcas
gb|AFW59901.1|  hypothetical protein ZEAMMB73_759012                    263   2e-79   
ref|XP_008800146.1|  PREDICTED: katanin p80 WD40 repeat-containin...    265   2e-79   Phoenix dactylifera
ref|XP_006653028.1|  PREDICTED: katanin p80 WD40 repeat-containin...    266   2e-79   Oryza brachyantha
ref|XP_008802561.1|  PREDICTED: LOW QUALITY PROTEIN: katanin p80 ...    264   2e-79   Phoenix dactylifera
gb|AFW59902.1|  hypothetical protein ZEAMMB73_759012                    265   3e-79   
ref|XP_009351775.1|  PREDICTED: katanin p80 WD40 repeat-containin...    263   3e-79   
ref|XP_006468674.1|  PREDICTED: katanin p80 WD40 repeat-containin...    264   4e-79   Citrus sinensis [apfelsine]
gb|KDO77056.1|  hypothetical protein CISIN_1g003448mg                   264   4e-79   Citrus sinensis [apfelsine]
ref|XP_010940397.1|  PREDICTED: katanin p80 WD40 repeat-containin...    261   4e-79   Elaeis guineensis
ref|XP_002311885.1|  hypothetical protein POPTR_0008s00290g             264   4e-79   
gb|KDO77057.1|  hypothetical protein CISIN_1g003448mg                   264   4e-79   Citrus sinensis [apfelsine]
ref|XP_006468673.1|  PREDICTED: katanin p80 WD40 repeat-containin...    264   4e-79   Citrus sinensis [apfelsine]
ref|XP_006468672.1|  PREDICTED: katanin p80 WD40 repeat-containin...    264   4e-79   Citrus sinensis [apfelsine]
gb|KDO77058.1|  hypothetical protein CISIN_1g003448mg                   264   5e-79   Citrus sinensis [apfelsine]
ref|XP_006448506.1|  hypothetical protein CICLE_v10014294mg             264   5e-79   Citrus clementina [clementine]
ref|XP_011033108.1|  PREDICTED: katanin p80 WD40 repeat-containin...    264   6e-79   Populus euphratica
ref|XP_011463422.1|  PREDICTED: katanin p80 WD40 repeat-containin...    263   6e-79   Fragaria vesca subsp. vesca
ref|XP_011463423.1|  PREDICTED: katanin p80 WD40 repeat-containin...    263   6e-79   Fragaria vesca subsp. vesca
gb|KJB34818.1|  hypothetical protein B456_006G086000                    263   6e-79   Gossypium raimondii
gb|KJB34817.1|  hypothetical protein B456_006G086000                    263   6e-79   Gossypium raimondii
ref|XP_009622381.1|  PREDICTED: katanin p80 WD40 repeat-containin...    263   7e-79   Nicotiana tomentosiformis
ref|XP_009351774.1|  PREDICTED: katanin p80 WD40 repeat-containin...    263   8e-79   Pyrus x bretschneideri [bai li]
ref|XP_009622380.1|  PREDICTED: katanin p80 WD40 repeat-containin...    263   8e-79   Nicotiana tomentosiformis
ref|XP_009622378.1|  PREDICTED: katanin p80 WD40 repeat-containin...    263   8e-79   
ref|XP_008663730.1|  PREDICTED: katanin p80 WD40 repeat-containin...    265   8e-79   Zea mays [maize]
ref|XP_009351770.1|  PREDICTED: katanin p80 WD40 repeat-containin...    263   8e-79   Pyrus x bretschneideri [bai li]
ref|XP_006603797.1|  PREDICTED: katanin p80 WD40 repeat-containin...    262   8e-79   Glycine max [soybeans]
ref|XP_008340406.1|  PREDICTED: katanin p80 WD40 repeat-containin...    263   9e-79   Malus domestica [apple tree]
ref|XP_007221941.1|  hypothetical protein PRUPE_ppa001553mg             263   9e-79   Prunus persica
ref|XP_008340409.1|  PREDICTED: katanin p80 WD40 repeat-containin...    263   9e-79   Malus domestica [apple tree]
ref|XP_007150863.1|  hypothetical protein PHAVU_004G000600g             262   9e-79   Phaseolus vulgaris [French bean]
ref|XP_010476017.1|  PREDICTED: katanin p80 WD40 repeat-containin...    266   1e-78   Camelina sativa [gold-of-pleasure]
ref|XP_010476018.1|  PREDICTED: katanin p80 WD40 repeat-containin...    265   1e-78   Camelina sativa [gold-of-pleasure]
ref|XP_010319353.1|  PREDICTED: katanin p80 WD40 repeat-containin...    263   1e-78   Solanum lycopersicum
ref|XP_008221115.1|  PREDICTED: katanin p80 WD40 repeat-containin...    263   1e-78   Prunus mume [ume]
ref|XP_004236878.1|  PREDICTED: katanin p80 WD40 repeat-containin...    263   1e-78   Solanum lycopersicum
ref|XP_008221114.1|  PREDICTED: katanin p80 WD40 repeat-containin...    263   1e-78   Prunus mume [ume]
ref|XP_011070501.1|  PREDICTED: katanin p80 WD40 repeat-containin...    263   1e-78   Sesamum indicum [beniseed]
ref|XP_002316424.2|  hypothetical protein POPTR_0010s26190g             261   1e-78   
gb|KHG00735.1|  hypothetical protein F383_07474                         263   1e-78   Gossypium arboreum [tree cotton]
gb|KJB12376.1|  hypothetical protein B456_002G014900                    263   1e-78   Gossypium raimondii
gb|KJB12377.1|  hypothetical protein B456_002G014900                    263   2e-78   Gossypium raimondii
ref|XP_006360856.1|  PREDICTED: katanin p80 WD40 repeat-containin...    263   2e-78   Solanum tuberosum [potatoes]
ref|XP_010458498.1|  PREDICTED: katanin p80 WD40 repeat-containin...    265   2e-78   Camelina sativa [gold-of-pleasure]
gb|KJB12372.1|  hypothetical protein B456_002G014900                    263   2e-78   Gossypium raimondii
gb|KJB12373.1|  hypothetical protein B456_002G014900                    263   2e-78   Gossypium raimondii
ref|XP_010458499.1|  PREDICTED: katanin p80 WD40 repeat-containin...    265   2e-78   Camelina sativa [gold-of-pleasure]
gb|KJB12375.1|  hypothetical protein B456_002G014900                    263   2e-78   Gossypium raimondii
gb|KJB12374.1|  hypothetical protein B456_002G014900                    263   2e-78   Gossypium raimondii
ref|XP_010655954.1|  PREDICTED: katanin p80 WD40 repeat-containin...    262   2e-78   Vitis vinifera
gb|KEH24722.1|  katanin p80 WD40 repeat subunit B1-like protein         261   2e-78   Medicago truncatula
ref|XP_010655958.1|  PREDICTED: katanin p80 WD40 repeat-containin...    262   2e-78   Vitis vinifera
ref|XP_010940396.1|  PREDICTED: katanin p80 WD40 repeat-containin...    262   2e-78   Elaeis guineensis
ref|XP_009790405.1|  PREDICTED: katanin p80 WD40 repeat-containin...    259   2e-78   Nicotiana sylvestris
ref|XP_004231535.1|  PREDICTED: katanin p80 WD40 repeat-containin...    262   2e-78   Solanum lycopersicum
ref|XP_010067050.1|  PREDICTED: katanin p80 WD40 repeat-containin...    262   2e-78   Eucalyptus grandis [rose gum]
ref|XP_010067049.1|  PREDICTED: katanin p80 WD40 repeat-containin...    262   2e-78   Eucalyptus grandis [rose gum]
ref|XP_006361541.1|  PREDICTED: katanin p80 WD40 repeat-containin...    262   2e-78   Solanum tuberosum [potatoes]
ref|XP_006392030.1|  hypothetical protein EUTSA_v10023227mg             265   3e-78   
ref|XP_008776609.1|  PREDICTED: katanin p80 WD40 repeat-containin...    260   3e-78   
ref|XP_004489186.1|  PREDICTED: katanin p80 WD40 repeat-containin...    260   4e-78   Cicer arietinum [garbanzo]
ref|XP_011046586.1|  PREDICTED: katanin p80 WD40 repeat-containin...    260   4e-78   Populus euphratica
ref|XP_004489185.1|  PREDICTED: katanin p80 WD40 repeat-containin...    260   4e-78   Cicer arietinum [garbanzo]
ref|XP_011013727.1|  PREDICTED: katanin p80 WD40 repeat-containin...    260   5e-78   Populus euphratica
ref|XP_011046585.1|  PREDICTED: katanin p80 WD40 repeat-containin...    260   5e-78   Populus euphratica
ref|XP_011046583.1|  PREDICTED: katanin p80 WD40 repeat-containin...    260   5e-78   Populus euphratica
ref|XP_011013729.1|  PREDICTED: katanin p80 WD40 repeat-containin...    260   5e-78   Populus euphratica
ref|XP_011013730.1|  PREDICTED: katanin p80 WD40 repeat-containin...    260   5e-78   Populus euphratica
ref|XP_003525689.2|  PREDICTED: katanin p80 WD40 repeat-containin...    260   5e-78   Glycine max [soybeans]
gb|KJB47120.1|  hypothetical protein B456_008G011900                    261   8e-78   Gossypium raimondii
gb|KJB47122.1|  hypothetical protein B456_008G011900                    261   8e-78   Gossypium raimondii
gb|KJB47118.1|  hypothetical protein B456_008G011900                    261   8e-78   Gossypium raimondii
gb|KJB47123.1|  hypothetical protein B456_008G011900                    261   9e-78   Gossypium raimondii
ref|XP_008776508.1|  PREDICTED: katanin p80 WD40 repeat-containin...    261   9e-78   Phoenix dactylifera
ref|XP_009395414.1|  PREDICTED: katanin p80 WD40 repeat-containin...    259   1e-77   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB47121.1|  hypothetical protein B456_008G011900                    261   1e-77   Gossypium raimondii
ref|XP_009597532.1|  PREDICTED: katanin p80 WD40 repeat-containin...    260   1e-77   Nicotiana tomentosiformis
gb|KJB47119.1|  hypothetical protein B456_008G011900                    261   1e-77   Gossypium raimondii
ref|XP_009790404.1|  PREDICTED: katanin p80 WD40 repeat-containin...    260   1e-77   Nicotiana sylvestris
gb|KHG19796.1|  hypothetical protein F383_00950                         260   2e-77   Gossypium arboreum [tree cotton]
ref|XP_010688601.1|  PREDICTED: katanin p80 WD40 repeat-containin...    259   2e-77   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010688600.1|  PREDICTED: katanin p80 WD40 repeat-containin...    259   2e-77   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008778233.1|  PREDICTED: LOW QUALITY PROTEIN: katanin p80 ...    259   2e-77   Phoenix dactylifera
gb|KHN46320.1|  Katanin p80 WD40 repeat-containing subunit B1 like 1    259   3e-77   Glycine soja [wild soybean]
emb|CBI35338.3|  unnamed protein product                                261   3e-77   Vitis vinifera
ref|XP_007043149.1|  Transducin/WD40 repeat-like superfamily protein    262   3e-77   
ref|XP_001768341.1|  predicted protein                                  246   4e-77   
ref|XP_010933310.1|  PREDICTED: katanin p80 WD40 repeat-containin...    258   4e-77   Elaeis guineensis
emb|CDP16884.1|  unnamed protein product                                260   4e-77   Coffea canephora [robusta coffee]
ref|XP_010933311.1|  PREDICTED: katanin p80 WD40 repeat-containin...    255   5e-77   Elaeis guineensis
ref|XP_010492441.1|  PREDICTED: katanin p80 WD40 repeat-containin...    261   6e-77   Camelina sativa [gold-of-pleasure]
ref|XP_010492410.1|  PREDICTED: katanin p80 WD40 repeat-containin...    261   7e-77   
ref|XP_010492426.1|  PREDICTED: katanin p80 WD40 repeat-containin...    260   7e-77   
ref|XP_010492433.1|  PREDICTED: katanin p80 WD40 repeat-containin...    260   7e-77   Camelina sativa [gold-of-pleasure]
ref|XP_009392423.1|  PREDICTED: katanin p80 WD40 repeat-containin...    256   7e-77   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEC78255.1|  hypothetical protein OsI_17928                          260   7e-77   Oryza sativa Indica Group [Indian rice]
ref|XP_010492418.1|  PREDICTED: katanin p80 WD40 repeat-containin...    260   7e-77   
gb|EEE61907.1|  hypothetical protein OsJ_16629                          260   8e-77   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010492450.1|  PREDICTED: katanin p80 WD40 repeat-containin...    260   8e-77   Camelina sativa [gold-of-pleasure]
ref|XP_009392834.1|  PREDICTED: katanin p80 WD40 repeat-containin...    257   9e-77   
ref|XP_002972963.1|  hypothetical protein SELMODRAFT_98102              246   1e-76   
ref|XP_004147132.1|  PREDICTED: katanin p80 WD40 repeat-containin...    258   1e-76   
gb|KGN51580.1|  hypothetical protein Csa_5G580650                       258   1e-76   Cucumis sativus [cucumbers]
ref|XP_009392832.1|  PREDICTED: katanin p80 WD40 repeat-containin...    257   1e-76   
ref|XP_004960069.1|  PREDICTED: katanin p80 WD40 repeat-containin...    259   2e-76   
ref|XP_008445915.1|  PREDICTED: katanin p80 WD40 repeat-containin...    258   2e-76   Cucumis melo [Oriental melon]
ref|XP_008445914.1|  PREDICTED: katanin p80 WD40 repeat-containin...    258   2e-76   Cucumis melo [Oriental melon]
ref|XP_002874130.1|  transducin family protein                          257   2e-76   
ref|XP_010546257.1|  PREDICTED: katanin p80 WD40 repeat-containin...    257   2e-76   Tarenaya hassleriana [spider flower]
ref|XP_010933309.1|  PREDICTED: katanin p80 WD40 repeat-containin...    256   3e-76   Elaeis guineensis
ref|XP_010521766.1|  PREDICTED: katanin p80 WD40 repeat-containin...    257   3e-76   
ref|NP_197734.2|  Katanin p80 WD40 repeat-containing subunit B1-1       257   3e-76   Arabidopsis thaliana [mouse-ear cress]
ref|NP_851064.1|  Katanin p80 WD40 repeat-containing subunit B1-1       257   3e-76   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009392416.1|  PREDICTED: katanin p80 WD40 repeat-containin...    256   3e-76   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006848621.1|  hypothetical protein AMTR_s00171p00033150          256   3e-76   
ref|XP_010933308.1|  PREDICTED: katanin p80 WD40 repeat-containin...    256   3e-76   Elaeis guineensis
ref|XP_009392408.1|  PREDICTED: katanin p80 WD40 repeat-containin...    256   4e-76   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAJ86235.1|  H0402C08.11                                            258   4e-76   Oryza sativa [red rice]
emb|CAJ86243.1|  H0801D08.1                                             257   4e-76   Oryza sativa [red rice]
ref|XP_009793706.1|  PREDICTED: katanin p80 WD40 repeat-containin...    256   4e-76   Nicotiana sylvestris
ref|XP_010933307.1|  PREDICTED: katanin p80 WD40 repeat-containin...    256   5e-76   Elaeis guineensis
ref|XP_009793704.1|  PREDICTED: katanin p80 WD40 repeat-containin...    256   6e-76   Nicotiana sylvestris
ref|XP_009793705.1|  PREDICTED: katanin p80 WD40 repeat-containin...    256   6e-76   Nicotiana sylvestris
ref|XP_006287049.1|  hypothetical protein CARUB_v10000197mg             256   7e-76   
gb|EMS67191.1|  Katanin p80 WD40 repeat-containing subunit B1-lik...    257   8e-76   Triticum urartu
tpg|DAA35346.1|  TPA: hypothetical protein ZEAMMB73_159052              255   2e-75   
ref|XP_010454626.1|  PREDICTED: katanin p80 WD40 repeat-containin...    254   2e-75   
ref|XP_010452825.1|  PREDICTED: katanin p80 WD40 repeat-containin...    254   2e-75   Camelina sativa [gold-of-pleasure]
ref|XP_010454622.1|  PREDICTED: katanin p80 WD40 repeat-containin...    254   2e-75   Camelina sativa [gold-of-pleasure]
ref|XP_010105192.1|  Katanin p80 WD40 repeat-containing subunit B...    249   3e-75   
ref|XP_006399331.1|  hypothetical protein EUTSA_v10012683mg             254   3e-75   Eutrema salsugineum [saltwater cress]
emb|CDY34658.1|  BnaC08g42170D                                          253   3e-75   Brassica napus [oilseed rape]
ref|XP_006287083.1|  hypothetical protein CARUB_v10000243mg             254   3e-75   
ref|XP_009131065.1|  PREDICTED: katanin p80 WD40 repeat-containin...    254   4e-75   Brassica rapa
ref|XP_010491476.1|  PREDICTED: katanin p80 WD40 repeat-containin...    253   5e-75   Camelina sativa [gold-of-pleasure]
ref|XP_010491474.1|  PREDICTED: katanin p80 WD40 repeat-containin...    253   5e-75   Camelina sativa [gold-of-pleasure]
ref|XP_010423095.1|  PREDICTED: katanin p80 WD40 repeat-containin...    253   6e-75   Camelina sativa [gold-of-pleasure]
ref|XP_011463420.1|  PREDICTED: katanin p80 WD40 repeat-containin...    253   6e-75   Fragaria vesca subsp. vesca
ref|XP_010423097.1|  PREDICTED: katanin p80 WD40 repeat-containin...    253   6e-75   Camelina sativa [gold-of-pleasure]
ref|XP_011463421.1|  PREDICTED: katanin p80 WD40 repeat-containin...    253   6e-75   Fragaria vesca subsp. vesca
ref|XP_011463419.1|  PREDICTED: katanin p80 WD40 repeat-containin...    253   6e-75   Fragaria vesca subsp. vesca
gb|EMT21321.1|  hypothetical protein F775_02319                         257   8e-75   
ref|XP_002871324.1|  hypothetical protein ARALYDRAFT_487674             253   8e-75   Arabidopsis lyrata subsp. lyrata
ref|NP_568194.2|  transducin/WD40 repeat-like superfamily protein       253   1e-74   Arabidopsis thaliana [mouse-ear cress]
dbj|BAE98997.1|  katanin p80 subunit - like protein                     253   1e-74   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009150876.1|  PREDICTED: katanin p80 WD40 repeat-containin...    252   1e-74   Brassica rapa
ref|XP_010421148.1|  PREDICTED: katanin p80 WD40 repeat-containin...    252   1e-74   Camelina sativa [gold-of-pleasure]
ref|XP_010421146.1|  PREDICTED: katanin p80 WD40 repeat-containin...    252   1e-74   Camelina sativa [gold-of-pleasure]
emb|CDX88026.1|  BnaA06g26170D                                          252   2e-74   
ref|XP_010421144.1|  PREDICTED: katanin p80 WD40 repeat-containin...    252   2e-74   Camelina sativa [gold-of-pleasure]
emb|CDY60225.1|  BnaA03g55700D                                          251   3e-74   Brassica napus [oilseed rape]
ref|XP_010493465.1|  PREDICTED: katanin p80 WD40 repeat-containin...    251   3e-74   Camelina sativa [gold-of-pleasure]
ref|XP_002513719.1|  katanin P80 subunit, putative                      251   4e-74   
emb|CDX81101.1|  BnaC03g03550D                                          251   4e-74   
ref|XP_006661901.1|  PREDICTED: katanin p80 WD40 repeat-containin...    251   4e-74   
gb|KHN19710.1|  Katanin p80 WD40 repeat-containing subunit B1 like 1    250   5e-74   Glycine soja [wild soybean]
gb|EEC67235.1|  hypothetical protein OsI_34162                          251   8e-74   Oryza sativa Indica Group [Indian rice]
gb|EEE51202.1|  hypothetical protein OsJ_32015                          251   8e-74   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001064946.1|  Os10g0494800                                       251   9e-74   
ref|XP_002978720.1|  hypothetical protein SELMODRAFT_443995             248   2e-73   
ref|XP_002975481.1|  hypothetical protein SELMODRAFT_442850             248   2e-73   
dbj|BAB09559.1|  unnamed protein product                                250   3e-73   Arabidopsis thaliana [mouse-ear cress]
gb|KCW65114.1|  hypothetical protein EUGRSUZ_G02621                     248   7e-73   Eucalyptus grandis [rose gum]
ref|XP_010918467.1|  PREDICTED: katanin p80 WD40 repeat-containin...    244   9e-73   
ref|XP_009118199.1|  PREDICTED: katanin p80 WD40 repeat-containin...    248   1e-72   Brassica rapa
emb|CDY34846.1|  BnaA09g47720D                                          248   1e-72   Brassica napus [oilseed rape]
ref|XP_009118200.1|  PREDICTED: katanin p80 WD40 repeat-containin...    248   1e-72   Brassica rapa
gb|EPS62586.1|  hypothetical protein M569_12203                         250   2e-72   Genlisea aurea
ref|XP_010234861.1|  PREDICTED: katanin p80 WD40 repeat-containin...    245   6e-72   
ref|XP_003564353.1|  PREDICTED: katanin p80 WD40 repeat-containin...    244   1e-71   
ref|XP_010232433.1|  PREDICTED: katanin p80 WD40 repeat-containin...    244   1e-71   
ref|XP_002456444.1|  hypothetical protein SORBIDRAFT_03g036400          244   1e-71   
ref|XP_002993384.1|  hypothetical protein SELMODRAFT_431447             241   3e-71   
gb|AFN42836.1|  katanin-like protein                                    238   4e-71   
emb|CAC08339.1|  katanin p80 subunit-like protein                       243   5e-71   
ref|XP_004970183.1|  PREDICTED: katanin p80 WD40 repeat-containin...    242   9e-71   
ref|XP_004982743.1|  PREDICTED: katanin p80 WD40 repeat-containin...    240   4e-70   
ref|XP_004982744.1|  PREDICTED: katanin p80 WD40 repeat-containin...    240   4e-70   
ref|XP_004982742.1|  PREDICTED: katanin p80 WD40 repeat-containin...    240   5e-70   
ref|NP_001044436.1|  Os01g0780400                                       240   5e-70   
gb|AFN42837.1|  katanin-like protein                                    239   5e-70   
emb|CDX80363.1|  BnaC07g30810D                                          240   7e-70   
emb|CDM83145.1|  unnamed protein product                                239   9e-70   
ref|XP_001753545.1|  predicted protein                                  226   3e-69   
ref|XP_006394609.1|  hypothetical protein EUTSA_v10005394mg             237   5e-69   
ref|XP_008655324.1|  PREDICTED: uncharacterized protein LOC100384...    237   6e-69   
ref|XP_006646391.1|  PREDICTED: katanin p80 WD40 repeat-containin...    236   2e-68   
dbj|BAK00426.1|  predicted protein                                      235   3e-68   
gb|EMS68408.1|  Katanin p80 WD40 repeat-containing subunit B1-lik...    234   1e-67   
emb|CDY15006.1|  BnaCnng04090D                                          232   9e-67   
gb|EEC71594.1|  hypothetical protein OsI_03978                          231   1e-66   
ref|XP_006816983.1|  PREDICTED: katanin p80 WD40 repeat-containin...    228   1e-66   
ref|XP_008664807.1|  PREDICTED: katanin p80 WD40 repeat-containin...    231   2e-66   
emb|CAN69414.1|  hypothetical protein VITISV_026914                     223   4e-65   
ref|XP_008655323.1|  PREDICTED: uncharacterized protein LOC100384...    226   5e-65   
ref|XP_008655322.1|  PREDICTED: uncharacterized protein LOC100384...    226   6e-65   
ref|XP_008655321.1|  PREDICTED: uncharacterized protein LOC100384...    226   6e-65   
ref|XP_002602850.1|  hypothetical protein BRAFLDRAFT_128944             222   1e-64   
ref|XP_002108211.1|  hypothetical protein TRIADDRAFT_63553              221   2e-64   
ref|XP_002501939.1|  katanin p80 subunit-like protein                   224   5e-64   
ref|XP_001624557.1|  predicted protein                                  221   9e-64   
gb|ELT94847.1|  hypothetical protein CAPTEDRAFT_177482                  220   2e-63   
ref|XP_005826320.1|  hypothetical protein GUITHDRAFT_76506              207   2e-63   
gb|KJB31921.1|  hypothetical protein B456_005G214400                    218   7e-62   
ref|XP_001198210.2|  PREDICTED: katanin p80 WD40-containing subun...    214   2e-61   
ref|NP_999734.1|  katanin p80 WD40 repeat-containing subunit B1         213   1e-60   
gb|EFX76979.1|  hypothetical protein DAPPUDRAFT_213756                  214   2e-60   
ref|XP_009058482.1|  hypothetical protein LOTGIDRAFT_191659             209   1e-59   
ref|XP_001743328.1|  hypothetical protein                               208   1e-59   
ref|XP_007902854.1|  PREDICTED: katanin p80 WD40 repeat-containin...    208   2e-59   
gb|AAM92815.1|  putative microtubule-severing protein subunit           210   3e-59   
ref|XP_007902852.1|  PREDICTED: katanin p80 WD40 repeat-containin...    208   4e-59   
ref|XP_011139481.1|  PREDICTED: katanin p80 WD40 repeat-containin...    207   2e-58   
ref|XP_011139479.1|  PREDICTED: katanin p80 WD40 repeat-containin...    207   2e-58   
ref|XP_011139480.1|  PREDICTED: katanin p80 WD40 repeat-containin...    207   3e-58   
tpg|DAA50959.1|  TPA: hypothetical protein ZEAMMB73_722956              203   3e-58   
ref|XP_006392033.1|  hypothetical protein EUTSA_v10023689mg             194   3e-58   
ref|XP_004998772.1|  hypothetical protein PTSG_00223                    204   3e-58   
ref|XP_011330395.1|  PREDICTED: katanin p80 WD40 repeat-containin...    206   6e-58   
ref|XP_011251036.1|  PREDICTED: katanin p80 WD40 repeat-containin...    206   7e-58   
ref|XP_011330394.1|  PREDICTED: katanin p80 WD40 repeat-containin...    206   7e-58   
ref|XP_011251035.1|  PREDICTED: katanin p80 WD40 repeat-containin...    206   7e-58   
ref|XP_003691954.1|  PREDICTED: LOW QUALITY PROTEIN: katanin p80 ...    206   9e-58   
ref|XP_011068391.1|  PREDICTED: katanin p80 WD40 repeat-containin...    206   9e-58   
ref|XP_011068390.1|  PREDICTED: katanin p80 WD40 repeat-containin...    206   9e-58   
ref|XP_003699959.1|  PREDICTED: katanin p80 WD40-containing subun...    206   1e-57   
ref|XP_006614307.1|  PREDICTED: katanin p80 WD40 repeat-containin...    206   1e-57   
ref|XP_006566473.1|  PREDICTED: katanin p80 WD40 repeat-containin...    206   1e-57   
ref|XP_003399349.1|  PREDICTED: katanin p80 WD40-containing subun...    206   1e-57   
ref|XP_006614308.1|  PREDICTED: katanin p80 WD40 repeat-containin...    206   1e-57   
ref|XP_006007410.1|  PREDICTED: katanin p80 WD40 repeat-containin...    203   1e-57   
ref|XP_393828.2|  PREDICTED: katanin p80 WD40 repeat-containing s...    206   1e-57   
gb|EGW12724.1|  Katanin p80 WD40-containing subunit B1                  196   1e-57   
ref|XP_011418638.1|  PREDICTED: katanin p80 WD40 repeat-containin...    204   1e-57   
ref|XP_011418637.1|  PREDICTED: katanin p80 WD40 repeat-containin...    204   2e-57   
ref|XP_006750039.1|  PREDICTED: katanin p80 WD40 repeat-containin...    198   2e-57   
ref|XP_010864872.1|  PREDICTED: katanin p80 WD40 repeat-containin...    194   2e-57   
ref|XP_011418636.1|  PREDICTED: katanin p80 WD40 repeat-containin...    204   2e-57   
gb|EKC42151.1|  Katanin p80 WD40-containing subunit B1                  204   3e-57   
ref|XP_005787574.1|  hypothetical protein EMIHUDRAFT_71168              192   5e-57   
ref|XP_011172303.1|  PREDICTED: katanin p80 WD40 repeat-containin...    203   7e-57   
ref|XP_004744322.1|  PREDICTED: katanin p80 WD40 repeat-containin...    202   7e-57   
ref|XP_007902853.1|  PREDICTED: katanin p80 WD40 repeat-containin...    202   7e-57   
ref|XP_011172294.1|  PREDICTED: katanin p80 WD40 repeat-containin...    203   7e-57   
ref|XP_011172283.1|  PREDICTED: katanin p80 WD40 repeat-containin...    203   8e-57   
ref|XP_011172276.1|  PREDICTED: katanin p80 WD40 repeat-containin...    203   8e-57   
ref|XP_001508340.2|  PREDICTED: katanin p80 WD40 repeat-containin...    201   8e-57   
ref|XP_005255829.1|  PREDICTED: katanin p80 WD40 repeat-containin...    202   9e-57   
ref|XP_006721184.1|  PREDICTED: katanin p80 WD40 repeat-containin...    202   9e-57   
ref|XP_008975639.1|  PREDICTED: katanin p80 WD40 repeat-containin...    202   9e-57   
ref|XP_008975636.1|  PREDICTED: katanin p80 WD40 repeat-containin...    202   1e-56   
ref|XP_004880968.1|  PREDICTED: katanin p80 WD40 repeat-containin...    201   1e-56   
ref|XP_006531476.1|  PREDICTED: katanin p80 WD40 repeat-containin...    200   1e-56   
ref|XP_004744324.1|  PREDICTED: katanin p80 WD40 repeat-containin...    201   2e-56   
gb|ELK15427.1|  Katanin p80 WD40-containing subunit B1                  201   2e-56   
ref|XP_003427661.1|  PREDICTED: katanin p80 WD40 repeat-containin...    202   2e-56   
gb|EAW82950.1|  katanin p80 (WD repeat containing) subunit B 1, i...    199   2e-56   
ref|XP_010984021.1|  PREDICTED: katanin p80 WD40 repeat-containin...    200   2e-56   
ref|XP_004600698.1|  PREDICTED: katanin p80 WD40 repeat-containin...    200   3e-56   
gb|AAI61823.1|  Katnb1 protein                                          200   3e-56   
ref|XP_009249034.1|  PREDICTED: katanin p80 WD40 repeat-containin...    199   3e-56   
ref|XP_010965578.1|  PREDICTED: katanin p80 WD40 repeat-containin...    200   3e-56   
ref|XP_004468582.1|  PREDICTED: katanin p80 WD40 repeat-containin...    200   3e-56   
ref|XP_008573098.1|  PREDICTED: katanin p80 WD40 repeat-containin...    200   3e-56   
ref|XP_002711590.1|  PREDICTED: katanin p80 WD40 repeat-containin...    200   3e-56   
ref|XP_006148504.1|  PREDICTED: katanin p80 WD40 repeat-containin...    200   3e-56   
ref|XP_006179819.1|  PREDICTED: katanin p80 WD40 repeat-containin...    200   3e-56   
ref|XP_850865.1|  PREDICTED: katanin p80 WD40 repeat-containing s...    200   4e-56   
ref|XP_011219109.1|  PREDICTED: LOW QUALITY PROTEIN: katanin p80 ...    200   4e-56   
ref|XP_006721186.1|  PREDICTED: katanin p80 WD40 repeat-containin...    200   4e-56   
ref|XP_004431708.1|  PREDICTED: katanin p80 WD40 repeat-containin...    200   4e-56   
ref|XP_003998126.1|  PREDICTED: katanin p80 WD40 repeat-containin...    200   4e-56   
ref|XP_004626003.1|  PREDICTED: katanin p80 WD40 repeat-containin...    200   4e-56   
ref|XP_010363802.1|  PREDICTED: katanin p80 WD40 repeat-containin...    200   4e-56   
ref|XP_008975640.1|  PREDICTED: katanin p80 WD40 repeat-containin...    200   4e-56   
ref|XP_007107095.1|  PREDICTED: katanin p80 WD40 repeat-containin...    200   4e-56   
ref|XP_008770502.1|  PREDICTED: katanin p80 WD40 repeat-containin...    200   4e-56   
ref|XP_006179818.1|  PREDICTED: katanin p80 WD40 repeat-containin...    200   4e-56   
ref|XP_001376504.1|  PREDICTED: katanin p80 WD40 repeat-containin...    200   4e-56   
ref|XP_006214568.1|  PREDICTED: katanin p80 WD40 repeat-containin...    200   4e-56   
ref|XP_005592119.1|  PREDICTED: katanin p80 WD40 repeat-containin...    200   4e-56   
ref|XP_004057764.1|  PREDICTED: katanin p80 WD40-containing subun...    200   4e-56   
ref|XP_003917005.1|  PREDICTED: katanin p80 WD40 repeat-containin...    200   4e-56   
ref|XP_005078685.1|  PREDICTED: katanin p80 WD40 repeat-containin...    200   4e-56   
ref|XP_005345634.1|  PREDICTED: katanin p80 WD40 repeat-containin...    199   4e-56   
ref|XP_002807787.1|  PREDICTED: LOW QUALITY PROTEIN: katanin p80 ...    200   4e-56   
ref|XP_003472109.1|  PREDICTED: katanin p80 WD40 repeat-containin...    200   4e-56   
ref|XP_001149222.1|  PREDICTED: katanin p80 WD40 repeat-containin...    200   4e-56   
ref|NP_001019917.1|  katanin p80 WD40 repeat-containing subunit B1      200   4e-56   
ref|NP_083081.2|  katanin p80 WD40 repeat-containing subunit B1         200   4e-56   
ref|NP_005877.2|  katanin p80 WD40 repeat-containing subunit B1         200   4e-56   
ref|XP_010329657.1|  PREDICTED: katanin p80 WD40 repeat-containin...    199   4e-56   
ref|XP_003943544.1|  PREDICTED: katanin p80 WD40 repeat-containin...    200   4e-56   
ref|XP_005592117.1|  PREDICTED: katanin p80 WD40 repeat-containin...    200   4e-56   
ref|XP_006105253.1|  PREDICTED: katanin p80 WD40 repeat-containin...    200   4e-56   
ref|XP_007167589.1|  PREDICTED: katanin p80 WD40 repeat-containin...    200   4e-56   
ref|XP_005345633.1|  PREDICTED: katanin p80 WD40 repeat-containin...    200   4e-56   
ref|XP_006985304.1|  PREDICTED: katanin p80 WD40 repeat-containin...    200   4e-56   
ref|XP_004395834.1|  PREDICTED: katanin p80 WD40 repeat-containin...    200   4e-56   
ref|XP_006214567.1|  PREDICTED: katanin p80 WD40 repeat-containin...    200   4e-56   
ref|XP_005388463.1|  PREDICTED: katanin p80 WD40 repeat-containin...    199   4e-56   
ref|XP_003509848.1|  PREDICTED: katanin p80 WD40 repeat-containin...    199   4e-56   
gb|AAP36445.1|  Homo sapiens katanin p80 (WD40-containing) subuni...    199   4e-56   
dbj|BAB26884.1|  unnamed protein product                                199   4e-56   
ref|XP_007520156.1|  PREDICTED: katanin p80 WD40 repeat-containin...    199   5e-56   
ref|XP_005318289.1|  PREDICTED: katanin p80 WD40 repeat-containin...    199   5e-56   
ref|XP_008066208.1|  PREDICTED: katanin p80 WD40 repeat-containin...    199   5e-56   
ref|XP_005004731.1|  PREDICTED: katanin p80 WD40 repeat-containin...    199   5e-56   
dbj|BAC27487.1|  unnamed protein product                                199   5e-56   
ref|XP_004431707.1|  PREDICTED: katanin p80 WD40 repeat-containin...    199   5e-56   
ref|XP_011358394.1|  PREDICTED: katanin p80 WD40 repeat-containin...    199   5e-56   
ref|XP_004318225.1|  PREDICTED: katanin p80 WD40 repeat-containin...    199   5e-56   
ref|XP_006059098.1|  PREDICTED: katanin p80 WD40 repeat-containin...    199   5e-56   
ref|XP_004663567.1|  PREDICTED: katanin p80 WD40 repeat-containin...    199   5e-56   
ref|XP_003792629.1|  PREDICTED: katanin p80 WD40-containing subun...    199   5e-56   
ref|XP_004264981.1|  PREDICTED: katanin p80 WD40 repeat-containin...    199   5e-56   
ref|XP_003416329.1|  PREDICTED: katanin p80 WD40 repeat-containin...    199   5e-56   
ref|XP_005692087.1|  PREDICTED: katanin p80 WD40 repeat-containin...    199   5e-56   
ref|XP_004015078.1|  PREDICTED: katanin p80 WD40-containing subun...    199   5e-56   
ref|XP_005899954.1|  PREDICTED: katanin p80 WD40 repeat-containin...    199   5e-56   
ref|NP_001095379.1|  katanin p80 WD40 repeat-containing subunit B1      199   5e-56   
ref|XP_004690582.1|  PREDICTED: katanin p80 WD40 repeat-containin...    199   6e-56   
ref|XP_006908857.1|  PREDICTED: katanin p80 WD40 repeat-containin...    199   6e-56   
ref|XP_008150513.1|  PREDICTED: katanin p80 WD40 repeat-containin...    199   6e-56   
ref|XP_005873570.1|  PREDICTED: katanin p80 WD40 repeat-containin...    199   6e-56   
ref|XP_006752939.1|  PREDICTED: katanin p80 WD40 repeat-containin...    199   6e-56   
ref|XP_004371604.1|  PREDICTED: katanin p80 WD40 repeat-containin...    199   6e-56   
ref|XP_006752937.1|  PREDICTED: katanin p80 WD40 repeat-containin...    199   6e-56   
ref|XP_008833101.1|  PREDICTED: katanin p80 WD40 repeat-containin...    199   6e-56   
ref|XP_004704700.1|  PREDICTED: katanin p80 WD40 repeat-containin...    199   6e-56   
ref|XP_011310634.1|  PREDICTED: LOW QUALITY PROTEIN: katanin p80 ...    201   6e-56   
ref|XP_007945706.1|  PREDICTED: katanin p80 WD40 repeat-containin...    199   6e-56   
ref|XP_004264980.1|  PREDICTED: katanin p80 WD40 repeat-containin...    199   6e-56   
ref|XP_003263155.1|  PREDICTED: katanin p80 WD40 repeat-containin...    199   7e-56   
ref|XP_007991671.1|  PREDICTED: katanin p80 WD40 repeat-containin...    199   7e-56   
ref|XP_006863627.1|  PREDICTED: katanin p80 WD40 repeat-containin...    199   7e-56   
ref|XP_004318224.1|  PREDICTED: katanin p80 WD40 repeat-containin...    199   7e-56   
ref|XP_011358391.1|  PREDICTED: katanin p80 WD40 repeat-containin...    199   7e-56   
ref|XP_007991668.1|  PREDICTED: katanin p80 WD40 repeat-containin...    199   7e-56   
ref|XP_008833100.1|  PREDICTED: katanin p80 WD40 repeat-containin...    199   8e-56   
ref|XP_006878799.1|  PREDICTED: katanin p80 WD40 repeat-containin...    199   8e-56   
ref|XP_010860161.1|  PREDICTED: katanin p80 WD40 repeat-containin...    199   8e-56   
ref|XP_007468359.1|  PREDICTED: katanin p80 WD40 repeat-containin...    199   1e-55   
gb|KDR22601.1|  Katanin p80 WD40-containing subunit B1                  199   1e-55   
gb|EHH60426.1|  Katanin p80 WD40-containing subunit B1                  198   2e-55   
ref|XP_004583948.1|  PREDICTED: katanin p80 WD40 repeat-containin...    198   2e-55   
ref|XP_010615530.1|  PREDICTED: katanin p80 WD40 repeat-containin...    198   2e-55   
ref|XP_005092094.1|  PREDICTED: katanin p80 WD40 repeat-containin...    197   2e-55   
ref|XP_006271752.1|  PREDICTED: katanin p80 WD40 repeat-containin...    198   2e-55   
ref|XP_006020280.1|  PREDICTED: katanin p80 WD40 repeat-containin...    198   2e-55   
ref|XP_005092093.1|  PREDICTED: katanin p80 WD40 repeat-containin...    197   2e-55   
ref|XP_008922432.1|  PREDICTED: katanin p80 WD40 repeat-containin...    197   2e-55   
ref|XP_008922433.1|  PREDICTED: katanin p80 WD40 repeat-containin...    197   2e-55   
ref|XP_006105256.1|  PREDICTED: katanin p80 WD40 repeat-containin...    198   3e-55   
ref|XP_008922434.1|  PREDICTED: katanin p80 WD40 repeat-containin...    197   3e-55   
ref|XP_001494571.3|  PREDICTED: LOW QUALITY PROTEIN: katanin p80 ...    197   5e-55   
ref|XP_007436294.1|  PREDICTED: katanin p80 WD40 repeat-containin...    197   5e-55   
ref|XP_010716146.1|  PREDICTED: katanin p80 WD40 repeat-containin...    197   5e-55   
ref|NP_998874.1|  katanin p80 WD40 repeat-containing subunit B1         197   6e-55   
ref|XP_010716145.1|  PREDICTED: katanin p80 WD40 repeat-containin...    197   6e-55   
ref|XP_005052445.1|  PREDICTED: katanin p80 WD40 repeat-containin...    196   7e-55   
ref|XP_005052443.1|  PREDICTED: katanin p80 WD40 repeat-containin...    196   7e-55   
ref|XP_005052444.1|  PREDICTED: katanin p80 WD40 repeat-containin...    196   8e-55   
ref|XP_011501573.1|  PREDICTED: katanin p80 WD40 repeat-containin...    198   8e-55   
ref|XP_010215661.1|  PREDICTED: katanin p80 WD40 repeat-containin...    196   8e-55   
gb|AAH77273.1|  Unknown (protein for IMAGE:4031030)                     192   8e-55   
ref|XP_008636933.1|  PREDICTED: katanin p80 WD40 repeat-containin...    196   8e-55   
ref|XP_005528260.1|  PREDICTED: katanin p80 WD40 repeat-containin...    196   8e-55   
ref|XP_002197745.2|  PREDICTED: katanin p80 WD40 repeat-containin...    196   8e-55   
ref|XP_009088981.1|  PREDICTED: katanin p80 WD40 repeat-containin...    196   8e-55   
ref|XP_005528262.1|  PREDICTED: katanin p80 WD40 repeat-containin...    196   9e-55   
ref|XP_005528261.1|  PREDICTED: katanin p80 WD40 repeat-containin...    196   9e-55   
gb|AAC09328.1|  katanin p80 subunit                                     196   9e-55   
ref|XP_010215660.1|  PREDICTED: katanin p80 WD40 repeat-containin...    196   9e-55   
ref|XP_009664342.1|  PREDICTED: katanin p80 WD40 repeat-containin...    196   9e-55   
ref|XP_009088979.1|  PREDICTED: katanin p80 WD40 repeat-containin...    196   9e-55   
ref|XP_008636935.1|  PREDICTED: katanin p80 WD40 repeat-containin...    196   9e-55   
ref|XP_009088980.1|  PREDICTED: katanin p80 WD40 repeat-containin...    196   9e-55   
ref|XP_009664340.1|  PREDICTED: katanin p80 WD40 repeat-containin...    196   9e-55   
ref|XP_008636934.1|  PREDICTED: katanin p80 WD40 repeat-containin...    196   1e-54   
ref|XP_009586088.1|  PREDICTED: katanin p80 WD40 repeat-containin...    196   1e-54   
ref|XP_010581376.1|  PREDICTED: katanin p80 WD40 repeat-containin...    196   1e-54   
ref|XP_010581370.1|  PREDICTED: katanin p80 WD40 repeat-containin...    196   1e-54   
ref|XP_005981379.1|  PREDICTED: katanin p80 WD40 repeat-containin...    196   1e-54   
ref|XP_009586090.1|  PREDICTED: katanin p80 WD40 repeat-containin...    196   1e-54   
ref|XP_009586089.1|  PREDICTED: katanin p80 WD40 repeat-containin...    195   2e-54   
ref|NP_001080197.1|  katanin p80 (WD40-containing) subunit B 1          195   2e-54   
ref|XP_009468712.1|  PREDICTED: katanin p80 WD40 repeat-containin...    195   2e-54   
gb|EMT29620.1|  hypothetical protein F775_12395                         196   2e-54   
emb|CDQ55912.1|  unnamed protein product                                196   2e-54   
ref|XP_006676909.1|  hypothetical protein BATDEDRAFT_86622              196   2e-54   



>ref|XP_009778973.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 isoform 
X1 [Nicotiana sylvestris]
Length=1027

 Score =   315 bits (806),  Expect = 1e-96, Method: Composition-based stats.
 Identities = 142/158 (90%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKRGYKLQEFVAHSGNVNCLRFGKKT R FLTGGDD +VNLWSIGKPTST++LSGHTSP
Sbjct  1    MAKRGYKLQEFVAHSGNVNCLRFGKKTRRQFLTGGDDQTVNLWSIGKPTSTASLSGHTSP  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            VES+AFDSAE+LV AGSSSG+IKLWDLE+TKM+RTL+GHRSYCTA EFHPFGEFFASGSM
Sbjct  61   VESVAFDSAEVLVLAGSSSGVIKLWDLEETKMVRTLNGHRSYCTACEFHPFGEFFASGSM  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DTNLK+WDIRKKGCIHTYKGHTRGISTIRF+PDGRWVV
Sbjct  121  DTNLKLWDIRKKGCIHTYKGHTRGISTIRFSPDGRWVV  158


 Score = 79.7 bits (195),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 37/125 (30%), Positives = 60/125 (48%), Gaps = 0/125 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ LW I K     T  GHT  + +I F      V +G    ++K+WDL   
Sbjct  115  FASGSMDTNLKLWDIRKKGCIHTYKGHTRGISTIRFSPDGRWVVSGGFDNVVKVWDLTAG  174

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H  +  +++FHP     A+GS D  +  WD+     I + +    G+ ++ F
Sbjct  175  KLLHDFKSHEGHVRSIDFHPLEFLLATGSADRTVNFWDLETFELIGSTRREAAGVRSMTF  234

Query  647  TPDGR  661
             PDGR
Sbjct  235  HPDGR  239


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 32/120 (27%), Positives = 56/120 (47%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  ++ +RF     R  ++GG D+ V +W +           H   V SI F 
Sbjct  135  IHTYKGHTRGISTIRFSPDG-RWVVSGGFDNVVKVWDLTAGKLLHDFKSHEGHVRSIDFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +  WDLE  ++I +     +   ++ FHP G     G +D +LK++
Sbjct  194  PLEFLLATGSADRTVNFWDLETFELIGSTRREAAGVRSMTFHPDGRTLFCG-LDDSLKVY  252



>ref|XP_009593301.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
{ECO:0000255|HAMAP-Rule:MF_03022} isoform X1 [Nicotiana 
tomentosiformis]
Length=1027

 Score =   314 bits (804),  Expect = 2e-96, Method: Composition-based stats.
 Identities = 142/158 (90%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKRGYKLQEFVAHSGNVNCLRFGKKT R FLTGGDD +VNLWSIGKPTST++LSGHTSP
Sbjct  1    MAKRGYKLQEFVAHSGNVNCLRFGKKTRRQFLTGGDDQTVNLWSIGKPTSTASLSGHTSP  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            VES+AFDSAE+LV AGSSSG+IKLWDLE+TKM+RTL+GHRSYCTA EFHPFGEFFASGSM
Sbjct  61   VESVAFDSAEVLVLAGSSSGVIKLWDLEETKMVRTLNGHRSYCTACEFHPFGEFFASGSM  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DTNLK+WDIRKKGCIHTYKGHTRGISTIRF+PDGRWVV
Sbjct  121  DTNLKLWDIRKKGCIHTYKGHTRGISTIRFSPDGRWVV  158


 Score = 79.3 bits (194),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 37/125 (30%), Positives = 60/125 (48%), Gaps = 0/125 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ LW I K     T  GHT  + +I F      V +G    ++K+WDL   
Sbjct  115  FASGSMDTNLKLWDIRKKGCIHTYKGHTRGISTIRFSPDGRWVVSGGFDNVVKVWDLTAG  174

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H  +  +++FHP     A+GS D  +  WD+     I + +    G+ ++ F
Sbjct  175  KLLHDFKSHEGHVRSIDFHPLEFLLATGSADRTVNFWDLETFELIGSTRREAAGVRSMTF  234

Query  647  TPDGR  661
             PDGR
Sbjct  235  HPDGR  239


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 32/120 (27%), Positives = 56/120 (47%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  ++ +RF     R  ++GG D+ V +W +           H   V SI F 
Sbjct  135  IHTYKGHTRGISTIRFSPDG-RWVVSGGFDNVVKVWDLTAGKLLHDFKSHEGHVRSIDFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +  WDLE  ++I +     +   ++ FHP G     G +D +LK++
Sbjct  194  PLEFLLATGSADRTVNFWDLETFELIGSTRREAAGVRSMTFHPDGRTLFCG-LDDSLKVY  252



>ref|XP_006347178.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
[Solanum tuberosum]
Length=1113

 Score =   313 bits (802),  Expect = 1e-95, Method: Composition-based stats.
 Identities = 141/158 (89%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKRGYKLQEFVAHSGNVNCLRFGKKT R FLTGGDD +VNLWSIGKPTST++LSGHTSP
Sbjct  1    MAKRGYKLQEFVAHSGNVNCLRFGKKTRRQFLTGGDDQNVNLWSIGKPTSTASLSGHTSP  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            +ES+AFDSAE+LV AG+SSG+IKLWDLE+TKM+RTL+GHRSYCTA EFHPFGEFFASGSM
Sbjct  61   IESVAFDSAEVLVLAGASSGVIKLWDLEETKMVRTLTGHRSYCTACEFHPFGEFFASGSM  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DTNLKIWDIRKKGCIHTYKGHTRGISTIRF+PDGRWVV
Sbjct  121  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFSPDGRWVV  158


 Score = 79.0 bits (193),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 37/125 (30%), Positives = 61/125 (49%), Gaps = 0/125 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GHT  + +I F      V +G    ++K+WDL   
Sbjct  115  FASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFSPDGRWVVSGGFDNVVKVWDLTAG  174

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H  +  +++FHPF    A+GS D  +  WD+     I + +    G+ +I F
Sbjct  175  KLLHDFKFHEGHIRSIDFHPFEFLLATGSADRTVNFWDLETFELIGSTRREASGVRSITF  234

Query  647  TPDGR  661
             P+GR
Sbjct  235  HPEGR  239


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 33/127 (26%), Positives = 57/127 (45%), Gaps = 2/127 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  ++ +RF     R  ++GG D+ V +W +           H   + SI F 
Sbjct  135  IHTYKGHTRGISTIRFSPDG-RWVVSGGFDNVVKVWDLTAGKLLHDFKFHEGHIRSIDFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +  WDLE  ++I +     S   ++ FHP G     G +D +LK++
Sbjct  194  PFEFLLATGSADRTVNFWDLETFELIGSTRREASGVRSITFHPEGRTLFCG-LDDSLKVY  252

Query  578  DIRKKGC  598
                  C
Sbjct  253  SWEPVKC  259



>ref|XP_004232826.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Solanum lycopersicum]
Length=1029

 Score =   311 bits (796),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 140/158 (89%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MA RGYKLQEFVAHSGNVNCLRFGKKT R FLTGGDD +VNLWSIGKPTST++LSGHTSP
Sbjct  1    MANRGYKLQEFVAHSGNVNCLRFGKKTRRQFLTGGDDQNVNLWSIGKPTSTTSLSGHTSP  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            +ES+AFDSAE+LV AG+SSG+IKLWDLE+TKM+RTL+GHRSYCTA EFHPFGEFFASGSM
Sbjct  61   IESVAFDSAEVLVLAGASSGVIKLWDLEETKMVRTLTGHRSYCTACEFHPFGEFFASGSM  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DTNLKIWDIRKKGCIHTYKGHTRGISTIRF+PDGRWVV
Sbjct  121  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFSPDGRWVV  158


 Score = 71.6 bits (174),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 36/125 (29%), Positives = 60/125 (48%), Gaps = 0/125 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GHT  + +I F      V +G    ++K+WDL   
Sbjct  115  FASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFSPDGRWVVSGGFDNVVKVWDLTAG  174

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H  +  +++FHP     A+GS D  +  WD+     I + +    G+ +I F
Sbjct  175  KLLHDFKFHEGHIRSIDFHPLEFLLATGSADRTVNFWDLETFELIGSTRREAAGVRSITF  234

Query  647  TPDGR  661
             P+GR
Sbjct  235  HPEGR  239


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 32/124 (26%), Positives = 56/124 (45%), Gaps = 2/124 (2%)
 Frame = +2

Query  227  FVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAE  406
            +  H+  ++ +RF     R  ++GG D+ V +W +           H   + SI F   E
Sbjct  138  YKGHTRGISTIRFSPDG-RWVVSGGFDNVVKVWDLTAGKLLHDFKFHEGHIRSIDFHPLE  196

Query  407  ILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIR  586
             L+A GS+   +  WDLE  ++I +     +   ++ FHP G     G +D +LK++   
Sbjct  197  FLLATGSADRTVNFWDLETFELIGSTRREAAGVRSITFHPEGRTLFCG-LDDSLKVYSWE  255

Query  587  KKGC  598
               C
Sbjct  256  PVNC  259



>ref|XP_011096279.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
[Sesamum indicum]
Length=860

 Score =   307 bits (787),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 139/158 (88%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKRGYKLQEFVAH+GNVNCL FGKK CR+F+TGGDD  VNLWS+GKPTS  +L GHTSP
Sbjct  1    MAKRGYKLQEFVAHAGNVNCLSFGKKNCRVFITGGDDQKVNLWSVGKPTSLMSLCGHTSP  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            VES AFDSAE+LV AGSSSG IKLWDLE+TKM+RTLSGHRSYCTA+EFHPFGEFFASGSM
Sbjct  61   VESAAFDSAEVLVVAGSSSGAIKLWDLEETKMVRTLSGHRSYCTAVEFHPFGEFFASGSM  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV
Sbjct  121  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  158


 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 59/125 (47%), Gaps = 0/125 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GHT  + +I F      V +G    ++K+WDL   
Sbjct  115  FASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVVSGGFDNVVKVWDLTAG  174

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H  +  ++EFHP     A+G    NLK WD+     I + +    G+  I F
Sbjct  175  KLLHDFKFHEGHIRSIEFHPLEFLLATGXXXXNLKFWDLETFEMIGSARREATGVRAITF  234

Query  647  TPDGR  661
             PDGR
Sbjct  235  HPDGR  239


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 53/117 (45%), Gaps = 2/117 (2%)
 Frame = +2

Query  227  FVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAE  406
            +  H+  ++ +RF     R  ++GG D+ V +W +           H   + SI F   E
Sbjct  138  YKGHTRGISTIRFTPDG-RWVVSGGFDNVVKVWDLTAGKLLHDFKFHEGHIRSIEFHPLE  196

Query  407  ILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
             L+A G     +K WDLE  +MI +     +   A+ FHP G     G +D  LK++
Sbjct  197  FLLATGXXXXNLKFWDLETFEMIGSARREATGVRAITFHPDGRTLFCG-LDDTLKVY  252



>gb|EYU27954.1| hypothetical protein MIMGU_mgv1a001351mg [Erythranthe guttata]
Length=835

 Score =   302 bits (773),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 137/158 (87%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKRGYKLQEFVAH GNVNCL FGKK CR F+TGGDD  VNLWS+GKPT  ++L GHTSP
Sbjct  1    MAKRGYKLQEFVAHGGNVNCLSFGKKNCRSFITGGDDQKVNLWSVGKPTCLTSLCGHTSP  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            VES AFDSAE+LV AGSSSG IKLWDLE+TKM+RTL+GHRSYCTA+EFHPFGEFFASGSM
Sbjct  61   VESAAFDSAEVLVVAGSSSGAIKLWDLEETKMVRTLTGHRSYCTAVEFHPFGEFFASGSM  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV
Sbjct  121  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  158


 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 61/125 (49%), Gaps = 0/125 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GHT  + +I F      V +G    ++K+WDL   
Sbjct  115  FASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVVSGGFDNVVKVWDLTAG  174

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H  +  ++EFHP     A+GS D  +K WD+     I + +    G+ ++ F
Sbjct  175  KLLHDFKFHEGHVRSIEFHPLEFLLATGSADKTVKFWDLETFEMIGSARREATGVRSLAF  234

Query  647  TPDGR  661
             PDGR
Sbjct  235  HPDGR  239


 Score = 55.8 bits (133),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  ++ +RF     R  ++GG D+ V +W +           H   V SI F 
Sbjct  135  IHTYKGHTRGISTIRFTPDG-RWVVSGGFDNVVKVWDLTAGKLLHDFKFHEGHVRSIEFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  +MI +     +   +L FHP G     G +D +LK++
Sbjct  194  PLEFLLATGSADKTVKFWDLETFEMIGSARREATGVRSLAFHPDGRTLFCG-LDDSLKVY  252



>emb|CDO99605.1| unnamed protein product [Coffea canephora]
Length=807

 Score =   299 bits (766),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 137/158 (87%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKRGYKLQEFVAHSGNVNCLR GKK  R F+TGGDD  VNLWSIG P   S LSGH+SP
Sbjct  1    MAKRGYKLQEFVAHSGNVNCLRIGKKNFRQFITGGDDQVVNLWSIGNPAPLSCLSGHSSP  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            VES+AFDS+EILV AG+SSG+IKLWDLE+TKM+RTLSGHRSYCTA+EFHPFGEFFASGSM
Sbjct  61   VESVAFDSSEILVVAGASSGVIKLWDLEETKMVRTLSGHRSYCTAVEFHPFGEFFASGSM  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV
Sbjct  121  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  158


 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 62/125 (50%), Gaps = 0/125 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GHT  + +I F      V +G    ++K+WDL   
Sbjct  115  FASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVVSGGFDNVVKIWDLTAG  174

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H  +  +++FHP     A+GS D  +K WD+     I + +  T G+ +I F
Sbjct  175  KLLHDFKFHEGHIRSIDFHPLEFLLATGSADRTVKFWDLETFEMIGSARRETAGVRSITF  234

Query  647  TPDGR  661
             PDGR
Sbjct  235  HPDGR  239


 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/120 (28%), Positives = 56/120 (47%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  ++ +RF     R  ++GG D+ V +W +           H   + SI F 
Sbjct  135  IHTYKGHTRGISTIRFTPDG-RWVVSGGFDNVVKIWDLTAGKLLHDFKFHEGHIRSIDFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  +MI +     +   ++ FHP G     G  D +LK++
Sbjct  194  PLEFLLATGSADRTVKFWDLETFEMIGSARRETAGVRSITFHPDGRTLFCG-FDDSLKVY  252



>emb|CBI38493.3| unnamed protein product [Vitis vinifera]
Length=506

 Score =   289 bits (740),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 129/158 (82%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKRGYKLQEFVAH+ NVNCL  GKK CR+ ++GGDDH VNLW+IGKPTS  +L GHTSP
Sbjct  1    MAKRGYKLQEFVAHTTNVNCLNIGKKACRLLISGGDDHKVNLWAIGKPTSLMSLCGHTSP  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            VES+ FDSAE+LVAAG+S+G+IKLWDLE+ KM+RTL+GHRS CTA+EFHPFGEFFASGS+
Sbjct  61   VESVTFDSAEVLVAAGASTGVIKLWDLEEAKMVRTLTGHRSNCTAVEFHPFGEFFASGSL  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DTNLK+WDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV
Sbjct  121  DTNLKVWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  158


 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/148 (28%), Positives = 67/148 (45%), Gaps = 1/148 (1%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            ++    H  N   + F       F +G  D ++ +W I K     T  GHT  + +I F 
Sbjct  93   VRTLTGHRSNCTAVEF-HPFGEFFASGSLDTNLKVWDIRKKGCIHTYKGHTRGISTIRFT  151

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
                 V +G    ++K+WDL   K++     H  +  +++FHP     A+GS D  +K W
Sbjct  152  PDGRWVVSGGFDNVVKVWDLTAGKLLHDFKFHEGHIRSIDFHPLEFLLATGSADRTVKFW  211

Query  578  DIRKKGCIHTYKGHTRGISTIRFTPDGR  661
            D+     I + +    G+ +I F PDGR
Sbjct  212  DLETFELIGSARPEATGVRSITFHPDGR  239


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 44/165 (27%), Positives = 70/165 (42%), Gaps = 20/165 (12%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  ++ +RF     R  ++GG D+ V +W +           H   + SI F 
Sbjct  135  IHTYKGHTRGISTIRFTPDG-RWVVSGGFDNVVKVWDLTAGKLLHDFKFHEGHIRSIDFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKI-  574
              E L+A GS+   +K WDLE  ++I +     +   ++ FHP G     G +D +LK+ 
Sbjct  194  PLEFLLATGSADRTVKFWDLETFELIGSARPEATGVRSITFHPDGRTLFCG-LDDSLKVY  252

Query  575  --------------WDIRKKGCIHTYKGHTRGISTIRFTPDGRWV  667
                          W I    CIH  +G   G S  R +  G WV
Sbjct  253  SWEPVVCHDAVDMGWSILGDICIH--EGKLLGCSYYRNSV-GVWV  294



>ref|XP_010647331.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
[Vitis vinifera]
Length=806

 Score =   293 bits (750),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 129/158 (82%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKRGYKLQEFVAH+ NVNCL  GKK CR+ ++GGDDH VNLW+IGKPTS  +L GHTSP
Sbjct  1    MAKRGYKLQEFVAHTTNVNCLNIGKKACRLLISGGDDHKVNLWAIGKPTSLMSLCGHTSP  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            VES+ FDSAE+LVAAG+S+G+IKLWDLE+ KM+RTL+GHRS CTA+EFHPFGEFFASGS+
Sbjct  61   VESVTFDSAEVLVAAGASTGVIKLWDLEEAKMVRTLTGHRSNCTAVEFHPFGEFFASGSL  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DTNLK+WDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV
Sbjct  121  DTNLKVWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  158


 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 61/125 (49%), Gaps = 0/125 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GHT  + +I F      V +G    ++K+WDL   
Sbjct  115  FASGSLDTNLKVWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVVSGGFDNVVKVWDLTAG  174

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H  +  +++FHP     A+GS D  +K WD+     I + +    G+ +I F
Sbjct  175  KLLHDFKFHEGHIRSIDFHPLEFLLATGSADRTVKFWDLETFELIGSARPEATGVRSITF  234

Query  647  TPDGR  661
             PDGR
Sbjct  235  HPDGR  239


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 44/165 (27%), Positives = 70/165 (42%), Gaps = 20/165 (12%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  ++ +RF     R  ++GG D+ V +W +           H   + SI F 
Sbjct  135  IHTYKGHTRGISTIRFTPDG-RWVVSGGFDNVVKVWDLTAGKLLHDFKFHEGHIRSIDFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKI-  574
              E L+A GS+   +K WDLE  ++I +     +   ++ FHP G     G +D +LK+ 
Sbjct  194  PLEFLLATGSADRTVKFWDLETFELIGSARPEATGVRSITFHPDGRTLFCG-LDDSLKVY  252

Query  575  --------------WDIRKKGCIHTYKGHTRGISTIRFTPDGRWV  667
                          W I    CIH  +G   G S  R +  G WV
Sbjct  253  SWEPVVCHDAVDMGWSILGDICIH--EGKLLGCSYYRNSV-GVWV  294



>gb|KDP20912.1| hypothetical protein JCGZ_21383 [Jatropha curcas]
Length=941

 Score =   293 bits (750),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKRGYKLQEFVAHS NVNCL  GKK CR+F+TGGDD+ VNLW+IGKPTS  +L GHTSP
Sbjct  1    MAKRGYKLQEFVAHSTNVNCLSIGKKACRLFITGGDDNKVNLWTIGKPTSLMSLCGHTSP  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            VES+AFD+AE+LV AG+S+G+IKLWDLE+ KM+RTL+GHRS CTA+EFHPFGEFFASGS 
Sbjct  61   VESVAFDTAEVLVLAGASTGVIKLWDLEEAKMVRTLTGHRSNCTAVEFHPFGEFFASGST  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV
Sbjct  121  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  158


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 60/125 (48%), Gaps = 0/125 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GHT  + +I F      V +G    ++K+WDL   
Sbjct  115  FASGSTDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVVSGGFDNIVKVWDLTAG  174

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H  +  +L+FHP     A+GS D  +K WD+     I + +    G+  I F
Sbjct  175  KLLHDFKFHEGHIRSLDFHPLEFLLATGSADKTVKFWDLETFELIGSSRPEATGVRAITF  234

Query  647  TPDGR  661
             PDGR
Sbjct  235  HPDGR  239


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 32/120 (27%), Positives = 56/120 (47%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  ++ +RF     R  ++GG D+ V +W +           H   + S+ F 
Sbjct  135  IHTYKGHTRGISTIRFTPDG-RWVVSGGFDNIVKVWDLTAGKLLHDFKFHEGHIRSLDFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   A+ FHP G     G +D  LK++
Sbjct  194  PLEFLLATGSADKTVKFWDLETFELIGSSRPEATGVRAITFHPDGRTLFCG-LDDCLKVY  252



>ref|XP_008442143.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Cucumis melo]
Length=922

 Score =   293 bits (749),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKRGYKLQEF AHSGNVNCL  GKK CR+F+TGGDD+ VNLW+IGKP S  +L GHT+P
Sbjct  1    MAKRGYKLQEFAAHSGNVNCLSIGKKACRLFITGGDDYKVNLWAIGKPNSLMSLCGHTNP  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            VES+AFDSAE+LV AG+SSG IKLWDLE+ KM+RTLSGHRS CTA+EFHPFGEFFASGS 
Sbjct  61   VESVAFDSAEVLVLAGASSGAIKLWDLEEAKMVRTLSGHRSNCTAVEFHPFGEFFASGSR  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DTNLKIWDIRKKGCIHTYKGHT+GISTI+FTPDGRWVV
Sbjct  121  DTNLKIWDIRKKGCIHTYKGHTQGISTIKFTPDGRWVV  158


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 58/125 (46%), Gaps = 0/125 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GHT  + +I F      V +G     +K+WDL   
Sbjct  115  FASGSRDTNLKIWDIRKKGCIHTYKGHTQGISTIKFTPDGRWVVSGGFDSAVKVWDLTAG  174

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H     +++FHP     A+GS D  +K WD+     I + +    G+  I F
Sbjct  175  KLMHDFKFHEGPIRSIDFHPLEFLLATGSADKTVKFWDLETFELIGSTRPEAAGVRAITF  234

Query  647  TPDGR  661
             PDGR
Sbjct  235  HPDGR  239


 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 58/117 (50%), Gaps = 2/117 (2%)
 Frame = +2

Query  227  FVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAE  406
            +  H+  ++ ++F     R  ++GG D +V +W +           H  P+ SI F   E
Sbjct  138  YKGHTQGISTIKFTPDG-RWVVSGGFDSAVKVWDLTAGKLMHDFKFHEGPIRSIDFHPLE  196

Query  407  ILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
             L+A GS+   +K WDLE  ++I +     +   A+ FHP G    SG +D +LK++
Sbjct  197  FLLATGSADKTVKFWDLETFELIGSTRPEAAGVRAITFHPDGRTLFSG-LDESLKVY  252



>ref|XP_008442151.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X2 [Cucumis melo]
Length=920

 Score =   292 bits (748),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKRGYKLQEF AHSGNVNCL  GKK CR+F+TGGDD+ VNLW+IGKP S  +L GHT+P
Sbjct  1    MAKRGYKLQEFAAHSGNVNCLSIGKKACRLFITGGDDYKVNLWAIGKPNSLMSLCGHTNP  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            VES+AFDSAE+LV AG+SSG IKLWDLE+ KM+RTLSGHRS CTA+EFHPFGEFFASGS 
Sbjct  61   VESVAFDSAEVLVLAGASSGAIKLWDLEEAKMVRTLSGHRSNCTAVEFHPFGEFFASGSR  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DTNLKIWDIRKKGCIHTYKGHT+GISTI+FTPDGRWVV
Sbjct  121  DTNLKIWDIRKKGCIHTYKGHTQGISTIKFTPDGRWVV  158


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 58/125 (46%), Gaps = 0/125 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GHT  + +I F      V +G     +K+WDL   
Sbjct  115  FASGSRDTNLKIWDIRKKGCIHTYKGHTQGISTIKFTPDGRWVVSGGFDSAVKVWDLTAG  174

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H     +++FHP     A+GS D  +K WD+     I + +    G+  I F
Sbjct  175  KLMHDFKFHEGPIRSIDFHPLEFLLATGSADKTVKFWDLETFELIGSTRPEAAGVRAITF  234

Query  647  TPDGR  661
             PDGR
Sbjct  235  HPDGR  239


 Score = 58.9 bits (141),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 58/117 (50%), Gaps = 2/117 (2%)
 Frame = +2

Query  227  FVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAE  406
            +  H+  ++ ++F     R  ++GG D +V +W +           H  P+ SI F   E
Sbjct  138  YKGHTQGISTIKFTPDG-RWVVSGGFDSAVKVWDLTAGKLMHDFKFHEGPIRSIDFHPLE  196

Query  407  ILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
             L+A GS+   +K WDLE  ++I +     +   A+ FHP G    SG +D +LK++
Sbjct  197  FLLATGSADKTVKFWDLETFELIGSTRPEAAGVRAITFHPDGRTLFSG-LDESLKVY  252



>ref|XP_004146637.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
[Cucumis sativus]
Length=922

 Score =   292 bits (747),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKRGYKLQEF AHSGNVNCL  GKK CR+F+TGGDD+ VNLW+IGKP S  +L GHT+P
Sbjct  1    MAKRGYKLQEFAAHSGNVNCLSIGKKACRLFITGGDDYKVNLWAIGKPNSLMSLCGHTNP  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            VES+AFDSAE+LV AG+SSG IKLWDLE+ KM+RTLSGHRS CTA+EFHPFGEFFASGS 
Sbjct  61   VESVAFDSAEVLVLAGASSGAIKLWDLEEAKMVRTLSGHRSNCTAVEFHPFGEFFASGSR  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DTNLKIWDIRKKGCIHTYKGHT+GISTI+FTPDGRWVV
Sbjct  121  DTNLKIWDIRKKGCIHTYKGHTQGISTIKFTPDGRWVV  158


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 58/125 (46%), Gaps = 0/125 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GHT  + +I F      V +G     +K+WDL   
Sbjct  115  FASGSRDTNLKIWDIRKKGCIHTYKGHTQGISTIKFTPDGRWVVSGGFDSAVKVWDLTAG  174

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H     +++FHP     A+GS D  +K WD+     I + +    G+  I F
Sbjct  175  KLMHDFKFHEGPIRSIDFHPLEFLLATGSADKTVKFWDLETFELIGSTRPEAAGVRAITF  234

Query  647  TPDGR  661
             PDGR
Sbjct  235  HPDGR  239


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 59/120 (49%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  ++ ++F     R  ++GG D +V +W +           H  P+ SI F 
Sbjct  135  IHTYKGHTQGISTIKFTPDG-RWVVSGGFDSAVKVWDLTAGKLMHDFKFHEGPIRSIDFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   A+ FHP G    SG +D +LK++
Sbjct  194  PLEFLLATGSADKTVKFWDLETFELIGSTRPEAAGVRAITFHPDGRTLFSG-LDESLKVY  252



>gb|KGN64638.1| hypothetical protein Csa_1G072490 [Cucumis sativus]
Length=978

 Score =   293 bits (749),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKRGYKLQEF AHSGNVNCL  GKK CR+F+TGGDD+ VNLW+IGKP S  +L GHT+P
Sbjct  1    MAKRGYKLQEFAAHSGNVNCLSIGKKACRLFITGGDDYKVNLWAIGKPNSLMSLCGHTNP  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            VES+AFDSAE+LV AG+SSG IKLWDLE+ KM+RTLSGHRS CTA+EFHPFGEFFASGS 
Sbjct  61   VESVAFDSAEVLVLAGASSGAIKLWDLEEAKMVRTLSGHRSNCTAVEFHPFGEFFASGSR  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DTNLKIWDIRKKGCIHTYKGHT+GISTI+FTPDGRWVV
Sbjct  121  DTNLKIWDIRKKGCIHTYKGHTQGISTIKFTPDGRWVV  158


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 58/125 (46%), Gaps = 0/125 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GHT  + +I F      V +G     +K+WDL   
Sbjct  115  FASGSRDTNLKIWDIRKKGCIHTYKGHTQGISTIKFTPDGRWVVSGGFDSAVKVWDLTAG  174

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H     +++FHP     A+GS D  +K WD+     I + +    G+  I F
Sbjct  175  KLMHDFKFHEGPIRSIDFHPLEFLLATGSADKTVKFWDLETFELIGSTRPEAAGVRAITF  234

Query  647  TPDGR  661
             PDGR
Sbjct  235  HPDGR  239


 Score = 58.9 bits (141),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 58/117 (50%), Gaps = 2/117 (2%)
 Frame = +2

Query  227  FVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAE  406
            +  H+  ++ ++F     R  ++GG D +V +W +           H  P+ SI F   E
Sbjct  138  YKGHTQGISTIKFTPDG-RWVVSGGFDSAVKVWDLTAGKLMHDFKFHEGPIRSIDFHPLE  196

Query  407  ILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
             L+A GS+   +K WDLE  ++I +     +   A+ FHP G    SG +D +LK++
Sbjct  197  FLLATGSADKTVKFWDLETFELIGSTRPEAAGVRAITFHPDGRTLFSG-LDESLKVY  252



>gb|KJB69457.1| hypothetical protein B456_011G024400 [Gossypium raimondii]
Length=886

 Score =   291 bits (745),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKRGYKLQEFVAH+ NVNCL  GKKTCR+ +TGGDDH VN+W+IGKPTS  +L GHTSP
Sbjct  1    MAKRGYKLQEFVAHTTNVNCLSMGKKTCRLLITGGDDHKVNVWAIGKPTSLMSLCGHTSP  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            VES+AFDSAE+ V AGSS+G IKLWDLE+TKM+R L+GHRS CTALEFHPFGEFF SGSM
Sbjct  61   VESLAFDSAEVFVLAGSSTGGIKLWDLEETKMVRGLTGHRSNCTALEFHPFGEFFVSGSM  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DTNLK+WDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV
Sbjct  121  DTNLKVWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  158


 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 42/145 (29%), Positives = 64/145 (44%), Gaps = 1/145 (1%)
 Frame = +2

Query  227  FVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAE  406
               H  N   L F       F++G  D ++ +W I K     T  GHT  + +I F    
Sbjct  96   LTGHRSNCTALEF-HPFGEFFVSGSMDTNLKVWDIRKKGCIHTYKGHTRGISTIRFTPDG  154

Query  407  ILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIR  586
              V +G    ++K+WDL   K++     H  +   ++FHP     A+GS D  +K WD+ 
Sbjct  155  RWVVSGGFDNVVKIWDLTAGKLLNEFKFHEGHIRTIDFHPLEFLLATGSADRTVKFWDLE  214

Query  587  KKGCIHTYKGHTRGISTIRFTPDGR  661
                I + +    G  +I F PDGR
Sbjct  215  TFELIGSSRPEATGFHSIAFHPDGR  239



>gb|EPS68225.1| hypothetical protein M569_06544, partial [Genlisea aurea]
Length=758

 Score =   288 bits (738),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKRGYKLQEFVAHSGNVNCL FGKK+ R+F+TGGDD  VNLWS G+P+   +L GH+SP
Sbjct  1    MAKRGYKLQEFVAHSGNVNCLSFGKKSGRVFITGGDDQKVNLWSFGRPSPLMSLCGHSSP  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            VES +FDSAE LV AGSSSG IKLWDLE+TKM+RTL+GHRSYCTA+EFHPFGEFFASGSM
Sbjct  61   VESASFDSAEALVVAGSSSGAIKLWDLEETKMVRTLTGHRSYCTAVEFHPFGEFFASGSM  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DTNLKIWDIRKKGCIHT+KGHTRGISTIRFTPDGRWVV
Sbjct  121  DTNLKIWDIRKKGCIHTHKGHTRGISTIRFTPDGRWVV  158


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 58/125 (46%), Gaps = 0/125 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GHT  + +I F      V +G     +K+WDL   
Sbjct  115  FASGSMDTNLKIWDIRKKGCIHTHKGHTRGISTIRFTPDGRWVVSGGLDNAVKVWDLTAG  174

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H  +  ++EFHP     A+GS D  +K WD+     I +      G+  + F
Sbjct  175  KLLHDFKFHEGHVRSIEFHPLEFLLATGSADKTVKFWDLETFEMIGSTTREATGLRAMAF  234

Query  647  TPDGR  661
             PDGR
Sbjct  235  HPDGR  239


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/114 (31%), Positives = 57/114 (50%), Gaps = 2/114 (2%)
 Frame = +2

Query  236  HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILV  415
            H+  ++ +RF     R  ++GG D++V +W +           H   V SI F   E L+
Sbjct  141  HTRGISTIRFTPDG-RWVVSGGLDNAVKVWDLTAGKLLHDFKFHEGHVRSIEFHPLEFLL  199

Query  416  AAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
            A GS+   +K WDLE  +MI + +   +   A+ FHP G     G +D +LK++
Sbjct  200  ATGSADKTVKFWDLETFEMIGSTTREATGLRAMAFHPDGRTLFCG-LDDSLKVY  252



>ref|XP_007025739.1| Transducin/WD40 repeat-like superfamily protein isoform 7 [Theobroma 
cacao]
 gb|EOY28361.1| Transducin/WD40 repeat-like superfamily protein isoform 7 [Theobroma 
cacao]
Length=860

 Score =   290 bits (743),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKRGYKLQEFVAH+ NVNCL  GKKT R+ +TGGDDH VN+W+IGKPTS  +L GHTSP
Sbjct  1    MAKRGYKLQEFVAHTANVNCLSMGKKTRRLLITGGDDHKVNVWAIGKPTSLMSLCGHTSP  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            VES+AFDSAE+LV AG+S+G+IKLWDLE+TKM+R L+GHRS CTA+EFHPFGEFFASGSM
Sbjct  61   VESLAFDSAEVLVLAGASTGVIKLWDLEETKMVRGLTGHRSNCTAMEFHPFGEFFASGSM  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV
Sbjct  121  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  158


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/145 (29%), Positives = 65/145 (45%), Gaps = 1/145 (1%)
 Frame = +2

Query  227  FVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAE  406
               H  N   + F       F +G  D ++ +W I K     T  GHT  + +I F    
Sbjct  96   LTGHRSNCTAMEF-HPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDG  154

Query  407  ILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIR  586
              V +G    ++K+WDL   K++     H  +  ++EFHP     A+GS D  +K WD+ 
Sbjct  155  RWVVSGGFDNVVKVWDLTAGKLLHDFKFHEGHIHSIEFHPLEFLLATGSADRTVKFWDLE  214

Query  587  KKGCIHTYKGHTRGISTIRFTPDGR  661
                I + +    G+ +I F PDGR
Sbjct  215  TFELIGSSRPEATGVRSITFHPDGR  239


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/120 (27%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  ++ +RF     R  ++GG D+ V +W +           H   + SI F 
Sbjct  135  IHTYKGHTRGISTIRF-TPDGRWVVSGGFDNVVKVWDLTAGKLLHDFKFHEGHIHSIEFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   ++ FHP G     G +D +LK++
Sbjct  194  PLEFLLATGSADRTVKFWDLETFELIGSSRPEATGVRSITFHPDGRTLFCG-LDDDLKVY  252



>ref|XP_007148216.1| hypothetical protein PHAVU_006G189900g [Phaseolus vulgaris]
 gb|ESW20210.1| hypothetical protein PHAVU_006G189900g [Phaseolus vulgaris]
Length=828

 Score =   290 bits (741),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 129/158 (82%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKRGYKLQEFVAHS +VNCL  GKK CR+F+TGGDDH VNLW+IGKPTS  +LSGHTSP
Sbjct  1    MAKRGYKLQEFVAHSASVNCLNIGKKACRLFITGGDDHKVNLWTIGKPTSLMSLSGHTSP  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            VES+AFDSAE+LV  G+S+G+IKLWDLE+ KM+RT++GHRS CTA+EFHPFGEFFASGS 
Sbjct  61   VESVAFDSAEVLVLGGASTGVIKLWDLEEAKMVRTVAGHRSNCTAVEFHPFGEFFASGSS  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DTNLKIWDIRKKGCIHTYKGHT+GISTI+FTPDGRWVV
Sbjct  121  DTNLKIWDIRKKGCIHTYKGHTQGISTIKFTPDGRWVV  158


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 60/125 (48%), Gaps = 0/125 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GHT  + +I F      V +G    ++K+WDL   
Sbjct  115  FASGSSDTNLKIWDIRKKGCIHTYKGHTQGISTIKFTPDGRWVVSGGLDNVVKVWDLTAG  174

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H     +++FHP     A+GS D  +K WD+     I + +    G+ +I F
Sbjct  175  KLLHDFKFHEGPIRSIDFHPLEFLLATGSADRTVKFWDLETFELIGSARREASGVRSIAF  234

Query  647  TPDGR  661
             PDGR
Sbjct  235  HPDGR  239


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/120 (28%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  ++ ++F     R  ++GG D+ V +W +           H  P+ SI F 
Sbjct  135  IHTYKGHTQGISTIKFTPDG-RWVVSGGLDNVVKVWDLTAGKLLHDFKFHEGPIRSIDFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     S   ++ FHP G    +G  D  LK++
Sbjct  194  PLEFLLATGSADRTVKFWDLETFELIGSARREASGVRSIAFHPDGRTLFTGHED-GLKVY  252



>ref|XP_007025735.1| Katanin P80 subunit, putative isoform 3 [Theobroma cacao]
 gb|EOY28357.1| Katanin P80 subunit, putative isoform 3 [Theobroma cacao]
Length=927

 Score =   291 bits (746),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKRGYKLQEFVAH+ NVNCL  GKKT R+ +TGGDDH VN+W+IGKPTS  +L GHTSP
Sbjct  1    MAKRGYKLQEFVAHTANVNCLSMGKKTRRLLITGGDDHKVNVWAIGKPTSLMSLCGHTSP  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            VES+AFDSAE+LV AG+S+G+IKLWDLE+TKM+R L+GHRS CTA+EFHPFGEFFASGSM
Sbjct  61   VESLAFDSAEVLVLAGASTGVIKLWDLEETKMVRGLTGHRSNCTAMEFHPFGEFFASGSM  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV
Sbjct  121  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  158


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/145 (29%), Positives = 65/145 (45%), Gaps = 1/145 (1%)
 Frame = +2

Query  227  FVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAE  406
               H  N   + F       F +G  D ++ +W I K     T  GHT  + +I F    
Sbjct  96   LTGHRSNCTAMEF-HPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDG  154

Query  407  ILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIR  586
              V +G    ++K+WDL   K++     H  +  ++EFHP     A+GS D  +K WD+ 
Sbjct  155  RWVVSGGFDNVVKVWDLTAGKLLHDFKFHEGHIHSIEFHPLEFLLATGSADRTVKFWDLE  214

Query  587  KKGCIHTYKGHTRGISTIRFTPDGR  661
                I + +    G+ +I F PDGR
Sbjct  215  TFELIGSSRPEATGVRSITFHPDGR  239


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/120 (27%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  ++ +RF     R  ++GG D+ V +W +           H   + SI F 
Sbjct  135  IHTYKGHTRGISTIRF-TPDGRWVVSGGFDNVVKVWDLTAGKLLHDFKFHEGHIHSIEFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   ++ FHP G     G +D +LK++
Sbjct  194  PLEFLLATGSADRTVKFWDLETFELIGSSRPEATGVRSITFHPDGRTLFCG-LDDDLKVY  252



>ref|XP_007025737.1| Transducin/WD40 repeat-like superfamily protein isoform 5 [Theobroma 
cacao]
 gb|EOY28359.1| Transducin/WD40 repeat-like superfamily protein isoform 5 [Theobroma 
cacao]
Length=879

 Score =   290 bits (743),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKRGYKLQEFVAH+ NVNCL  GKKT R+ +TGGDDH VN+W+IGKPTS  +L GHTSP
Sbjct  1    MAKRGYKLQEFVAHTANVNCLSMGKKTRRLLITGGDDHKVNVWAIGKPTSLMSLCGHTSP  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            VES+AFDSAE+LV AG+S+G+IKLWDLE+TKM+R L+GHRS CTA+EFHPFGEFFASGSM
Sbjct  61   VESLAFDSAEVLVLAGASTGVIKLWDLEETKMVRGLTGHRSNCTAMEFHPFGEFFASGSM  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV
Sbjct  121  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  158


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/145 (29%), Positives = 65/145 (45%), Gaps = 1/145 (1%)
 Frame = +2

Query  227  FVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAE  406
               H  N   + F       F +G  D ++ +W I K     T  GHT  + +I F    
Sbjct  96   LTGHRSNCTAMEF-HPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDG  154

Query  407  ILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIR  586
              V +G    ++K+WDL   K++     H  +  ++EFHP     A+GS D  +K WD+ 
Sbjct  155  RWVVSGGFDNVVKVWDLTAGKLLHDFKFHEGHIHSIEFHPLEFLLATGSADRTVKFWDLE  214

Query  587  KKGCIHTYKGHTRGISTIRFTPDGR  661
                I + +    G+ +I F PDGR
Sbjct  215  TFELIGSSRPEATGVRSITFHPDGR  239


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/120 (27%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  ++ +RF     R  ++GG D+ V +W +           H   + SI F 
Sbjct  135  IHTYKGHTRGISTIRF-TPDGRWVVSGGFDNVVKVWDLTAGKLLHDFKFHEGHIHSIEFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   ++ FHP G     G +D +LK++
Sbjct  194  PLEFLLATGSADRTVKFWDLETFELIGSSRPEATGVRSITFHPDGRTLFCG-LDDDLKVY  252



>ref|XP_007025736.1| Transducin/WD40 repeat-like superfamily protein isoform 4 [Theobroma 
cacao]
 gb|EOY28358.1| Transducin/WD40 repeat-like superfamily protein isoform 4 [Theobroma 
cacao]
Length=963

 Score =   291 bits (746),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKRGYKLQEFVAH+ NVNCL  GKKT R+ +TGGDDH VN+W+IGKPTS  +L GHTSP
Sbjct  1    MAKRGYKLQEFVAHTANVNCLSMGKKTRRLLITGGDDHKVNVWAIGKPTSLMSLCGHTSP  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            VES+AFDSAE+LV AG+S+G+IKLWDLE+TKM+R L+GHRS CTA+EFHPFGEFFASGSM
Sbjct  61   VESLAFDSAEVLVLAGASTGVIKLWDLEETKMVRGLTGHRSNCTAMEFHPFGEFFASGSM  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV
Sbjct  121  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  158


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/145 (29%), Positives = 65/145 (45%), Gaps = 1/145 (1%)
 Frame = +2

Query  227  FVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAE  406
               H  N   + F       F +G  D ++ +W I K     T  GHT  + +I F    
Sbjct  96   LTGHRSNCTAMEF-HPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDG  154

Query  407  ILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIR  586
              V +G    ++K+WDL   K++     H  +  ++EFHP     A+GS D  +K WD+ 
Sbjct  155  RWVVSGGFDNVVKVWDLTAGKLLHDFKFHEGHIHSIEFHPLEFLLATGSADRTVKFWDLE  214

Query  587  KKGCIHTYKGHTRGISTIRFTPDGR  661
                I + +    G+ +I F PDGR
Sbjct  215  TFELIGSSRPEATGVRSITFHPDGR  239


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/120 (27%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  ++ +RF     R  ++GG D+ V +W +           H   + SI F 
Sbjct  135  IHTYKGHTRGISTIRF-TPDGRWVVSGGFDNVVKVWDLTAGKLLHDFKFHEGHIHSIEFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   ++ FHP G     G +D +LK++
Sbjct  194  PLEFLLATGSADRTVKFWDLETFELIGSSRPEATGVRSITFHPDGRTLFCG-LDDDLKVY  252



>ref|XP_007025734.1| Transducin/WD40 repeat-like superfamily protein isoform 2 [Theobroma 
cacao]
 gb|EOY28356.1| Transducin/WD40 repeat-like superfamily protein isoform 2 [Theobroma 
cacao]
Length=870

 Score =   290 bits (742),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKRGYKLQEFVAH+ NVNCL  GKKT R+ +TGGDDH VN+W+IGKPTS  +L GHTSP
Sbjct  1    MAKRGYKLQEFVAHTANVNCLSMGKKTRRLLITGGDDHKVNVWAIGKPTSLMSLCGHTSP  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            VES+AFDSAE+LV AG+S+G+IKLWDLE+TKM+R L+GHRS CTA+EFHPFGEFFASGSM
Sbjct  61   VESLAFDSAEVLVLAGASTGVIKLWDLEETKMVRGLTGHRSNCTAMEFHPFGEFFASGSM  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV
Sbjct  121  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  158


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/145 (29%), Positives = 65/145 (45%), Gaps = 1/145 (1%)
 Frame = +2

Query  227  FVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAE  406
               H  N   + F       F +G  D ++ +W I K     T  GHT  + +I F    
Sbjct  96   LTGHRSNCTAMEF-HPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDG  154

Query  407  ILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIR  586
              V +G    ++K+WDL   K++     H  +  ++EFHP     A+GS D  +K WD+ 
Sbjct  155  RWVVSGGFDNVVKVWDLTAGKLLHDFKFHEGHIHSIEFHPLEFLLATGSADRTVKFWDLE  214

Query  587  KKGCIHTYKGHTRGISTIRFTPDGR  661
                I + +    G+ +I F PDGR
Sbjct  215  TFELIGSSRPEATGVRSITFHPDGR  239


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/120 (27%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  ++ +RF     R  ++GG D+ V +W +           H   + SI F 
Sbjct  135  IHTYKGHTRGISTIRF-TPDGRWVVSGGFDNVVKVWDLTAGKLLHDFKFHEGHIHSIEFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   ++ FHP G     G +D +LK++
Sbjct  194  PLEFLLATGSADRTVKFWDLETFELIGSSRPEATGVRSITFHPDGRTLFCG-LDDDLKVY  252



>ref|XP_007025733.1| Katanin P80 subunit, putative isoform 1 [Theobroma cacao]
 gb|EOY28355.1| Katanin P80 subunit, putative isoform 1 [Theobroma cacao]
Length=966

 Score =   291 bits (746),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKRGYKLQEFVAH+ NVNCL  GKKT R+ +TGGDDH VN+W+IGKPTS  +L GHTSP
Sbjct  1    MAKRGYKLQEFVAHTANVNCLSMGKKTRRLLITGGDDHKVNVWAIGKPTSLMSLCGHTSP  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            VES+AFDSAE+LV AG+S+G+IKLWDLE+TKM+R L+GHRS CTA+EFHPFGEFFASGSM
Sbjct  61   VESLAFDSAEVLVLAGASTGVIKLWDLEETKMVRGLTGHRSNCTAMEFHPFGEFFASGSM  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV
Sbjct  121  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  158


 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 42/145 (29%), Positives = 65/145 (45%), Gaps = 1/145 (1%)
 Frame = +2

Query  227  FVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAE  406
               H  N   + F       F +G  D ++ +W I K     T  GHT  + +I F    
Sbjct  96   LTGHRSNCTAMEF-HPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDG  154

Query  407  ILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIR  586
              V +G    ++K+WDL   K++     H  +  ++EFHP     A+GS D  +K WD+ 
Sbjct  155  RWVVSGGFDNVVKVWDLTAGKLLHDFKFHEGHIHSIEFHPLEFLLATGSADRTVKFWDLE  214

Query  587  KKGCIHTYKGHTRGISTIRFTPDGR  661
                I + +    G+ +I F PDGR
Sbjct  215  TFELIGSSRPEATGVRSITFHPDGR  239


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/120 (27%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  ++ +RF     R  ++GG D+ V +W +           H   + SI F 
Sbjct  135  IHTYKGHTRGISTIRF-TPDGRWVVSGGFDNVVKVWDLTAGKLLHDFKFHEGHIHSIEFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   ++ FHP G     G +D +LK++
Sbjct  194  PLEFLLATGSADRTVKFWDLETFELIGSSRPEATGVRSITFHPDGRTLFCG-LDDDLKVY  252



>gb|KJB69456.1| hypothetical protein B456_011G024400 [Gossypium raimondii]
Length=987

 Score =   292 bits (747),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKRGYKLQEFVAH+ NVNCL  GKKTCR+ +TGGDDH VN+W+IGKPTS  +L GHTSP
Sbjct  1    MAKRGYKLQEFVAHTTNVNCLSMGKKTCRLLITGGDDHKVNVWAIGKPTSLMSLCGHTSP  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            VES+AFDSAE+ V AGSS+G IKLWDLE+TKM+R L+GHRS CTALEFHPFGEFF SGSM
Sbjct  61   VESLAFDSAEVFVLAGSSTGGIKLWDLEETKMVRGLTGHRSNCTALEFHPFGEFFVSGSM  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DTNLK+WDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV
Sbjct  121  DTNLKVWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  158


 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 42/145 (29%), Positives = 64/145 (44%), Gaps = 1/145 (1%)
 Frame = +2

Query  227  FVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAE  406
               H  N   L F       F++G  D ++ +W I K     T  GHT  + +I F    
Sbjct  96   LTGHRSNCTALEF-HPFGEFFVSGSMDTNLKVWDIRKKGCIHTYKGHTRGISTIRFTPDG  154

Query  407  ILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIR  586
              V +G    ++K+WDL   K++     H  +   ++FHP     A+GS D  +K WD+ 
Sbjct  155  RWVVSGGFDNVVKIWDLTAGKLLNEFKFHEGHIRTIDFHPLEFLLATGSADRTVKFWDLE  214

Query  587  KKGCIHTYKGHTRGISTIRFTPDGR  661
                I + +    G  +I F PDGR
Sbjct  215  TFELIGSSRPEATGFHSIAFHPDGR  239



>ref|XP_008224985.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X3 [Prunus mume]
Length=850

 Score =   289 bits (740),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKR YKLQEFVAHS N+NCL  GKK CR+F+TGGDDH VNLW+IGKPTS  +L+GHTSP
Sbjct  1    MAKRSYKLQEFVAHSDNINCLNIGKKACRLFVTGGDDHIVNLWTIGKPTSLMSLAGHTSP  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            VES+AF+SAE+LV AG+SSG+ K+WDLE+TKM+RTL+GHRS CTA+EFHPFGEFFASGS 
Sbjct  61   VESVAFNSAEVLVLAGASSGVTKIWDLEETKMVRTLTGHRSSCTAVEFHPFGEFFASGST  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DTNLKIWDIRKKGCIHTYKGHT+GISTI+FTPDGRWVV
Sbjct  121  DTNLKIWDIRKKGCIHTYKGHTQGISTIKFTPDGRWVV  158


 Score = 74.3 bits (181),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 59/125 (47%), Gaps = 0/125 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GHT  + +I F      V +G    ++K+WDL   
Sbjct  115  FASGSTDTNLKIWDIRKKGCIHTYKGHTQGISTIKFTPDGRWVVSGGFDNVVKVWDLTAG  174

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H  +  ++ FHP     A+GS D  +K WD+     I + +    G+  I F
Sbjct  175  KLLHDFKFHEGHIRSIGFHPLEFLLATGSADRTVKFWDLETFELIGSSRPEPTGVRAIAF  234

Query  647  TPDGR  661
             PDGR
Sbjct  235  HPDGR  239


 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/119 (28%), Positives = 57/119 (48%), Gaps = 2/119 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  ++ ++F     R  ++GG D+ V +W +           H   + SI F 
Sbjct  135  IHTYKGHTQGISTIKFTPDG-RWVVSGGFDNVVKVWDLTAGKLLHDFKFHEGHIRSIGFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKI  574
              E L+A GS+   +K WDLE  ++I +     +   A+ FHP G    SG +D +LK+
Sbjct  194  PLEFLLATGSADRTVKFWDLETFELIGSSRPEPTGVRAIAFHPDGRTLFSG-LDDSLKV  251



>ref|XP_008224983.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Prunus mume]
Length=852

 Score =   289 bits (740),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKR YKLQEFVAHS N+NCL  GKK CR+F+TGGDDH VNLW+IGKPTS  +L+GHTSP
Sbjct  1    MAKRSYKLQEFVAHSDNINCLNIGKKACRLFVTGGDDHIVNLWTIGKPTSLMSLAGHTSP  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            VES+AF+SAE+LV AG+SSG+ K+WDLE+TKM+RTL+GHRS CTA+EFHPFGEFFASGS 
Sbjct  61   VESVAFNSAEVLVLAGASSGVTKIWDLEETKMVRTLTGHRSSCTAVEFHPFGEFFASGST  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DTNLKIWDIRKKGCIHTYKGHT+GISTI+FTPDGRWVV
Sbjct  121  DTNLKIWDIRKKGCIHTYKGHTQGISTIKFTPDGRWVV  158


 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 59/125 (47%), Gaps = 0/125 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GHT  + +I F      V +G    ++K+WDL   
Sbjct  115  FASGSTDTNLKIWDIRKKGCIHTYKGHTQGISTIKFTPDGRWVVSGGFDNVVKVWDLTAG  174

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H  +  ++ FHP     A+GS D  +K WD+     I + +    G+  I F
Sbjct  175  KLLHDFKFHEGHIRSIGFHPLEFLLATGSADRTVKFWDLETFELIGSSRPEPTGVRAIAF  234

Query  647  TPDGR  661
             PDGR
Sbjct  235  HPDGR  239


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/119 (28%), Positives = 57/119 (48%), Gaps = 2/119 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  ++ ++F     R  ++GG D+ V +W +           H   + SI F 
Sbjct  135  IHTYKGHTQGISTIKFTPDG-RWVVSGGFDNVVKVWDLTAGKLLHDFKFHEGHIRSIGFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKI  574
              E L+A GS+   +K WDLE  ++I +     +   A+ FHP G    SG +D +LK+
Sbjct  194  PLEFLLATGSADRTVKFWDLETFELIGSSRPEPTGVRAIAFHPDGRTLFSG-LDDSLKV  251



>ref|XP_008224984.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X2 [Prunus mume]
Length=851

 Score =   289 bits (740),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKR YKLQEFVAHS N+NCL  GKK CR+F+TGGDDH VNLW+IGKPTS  +L+GHTSP
Sbjct  1    MAKRSYKLQEFVAHSDNINCLNIGKKACRLFVTGGDDHIVNLWTIGKPTSLMSLAGHTSP  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            VES+AF+SAE+LV AG+SSG+ K+WDLE+TKM+RTL+GHRS CTA+EFHPFGEFFASGS 
Sbjct  61   VESVAFNSAEVLVLAGASSGVTKIWDLEETKMVRTLTGHRSSCTAVEFHPFGEFFASGST  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DTNLKIWDIRKKGCIHTYKGHT+GISTI+FTPDGRWVV
Sbjct  121  DTNLKIWDIRKKGCIHTYKGHTQGISTIKFTPDGRWVV  158


 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 59/125 (47%), Gaps = 0/125 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GHT  + +I F      V +G    ++K+WDL   
Sbjct  115  FASGSTDTNLKIWDIRKKGCIHTYKGHTQGISTIKFTPDGRWVVSGGFDNVVKVWDLTAG  174

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H  +  ++ FHP     A+GS D  +K WD+     I + +    G+  I F
Sbjct  175  KLLHDFKFHEGHIRSIGFHPLEFLLATGSADRTVKFWDLETFELIGSSRPEPTGVRAIAF  234

Query  647  TPDGR  661
             PDGR
Sbjct  235  HPDGR  239


 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/119 (28%), Positives = 57/119 (48%), Gaps = 2/119 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  ++ ++F     R  ++GG D+ V +W +           H   + SI F 
Sbjct  135  IHTYKGHTQGISTIKFTPDG-RWVVSGGFDNVVKVWDLTAGKLLHDFKFHEGHIRSIGFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKI  574
              E L+A GS+   +K WDLE  ++I +     +   A+ FHP G    SG +D +LK+
Sbjct  194  PLEFLLATGSADRTVKFWDLETFELIGSSRPEPTGVRAIAFHPDGRTLFSG-LDDSLKV  251



>gb|AES63731.2| katanin p80 WD40 repeat subunit B1-like protein [Medicago truncatula]
Length=1111

 Score =   293 bits (749),  Expect = 4e-88, Method: Composition-based stats.
 Identities = 127/158 (80%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKRGYK+QEFVAHS NVNCL  GKK CR+F+TGGDDH VNLW+IGKPTS S+LSGHTSP
Sbjct  1    MAKRGYKIQEFVAHSSNVNCLNIGKKACRLFVTGGDDHKVNLWTIGKPTSLSSLSGHTSP  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            VES+ FDS E+LV AGS+SG+I+LWDLE++KM+RT++GHRS CT++EFHPFGEFFASGSM
Sbjct  61   VESVTFDSGEVLVLAGSTSGVIRLWDLEESKMVRTVAGHRSNCTSVEFHPFGEFFASGSM  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DTNLKIWD RKKGCIHTYKGH++GISTI+FTPDGRWVV
Sbjct  121  DTNLKIWDNRKKGCIHTYKGHSQGISTIKFTPDGRWVV  158


 Score = 78.2 bits (191),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 37/125 (30%), Positives = 62/125 (50%), Gaps = 0/125 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W   K     T  GH+  + +I F      V +G    ++K+WDL   
Sbjct  115  FASGSMDTNLKIWDNRKKGCIHTYKGHSQGISTIKFTPDGRWVVSGGFDNVVKVWDLTAG  174

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++   + H  + T+L+FHP     A+GS D  +K WD+     I + +    G+ ++ F
Sbjct  175  KLLHDFNFHDGHITSLDFHPLEFLLATGSADRTVKFWDLESFELIGSARREATGVRSMAF  234

Query  647  TPDGR  661
             PDGR
Sbjct  235  HPDGR  239


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 32/120 (27%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  HS  ++ ++F     R  ++GG D+ V +W +         + H   + S+ F 
Sbjct  135  IHTYKGHSQGISTIKFTPDG-RWVVSGGFDNVVKVWDLTAGKLLHDFNFHDGHITSLDFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   ++ FHP G    SG  D  LK++
Sbjct  194  PLEFLLATGSADRTVKFWDLESFELIGSARREATGVRSMAFHPDGRTLFSGHED-GLKVF  252



>gb|KEH36528.1| katanin p80 WD40 repeat subunit B1-like protein [Medicago truncatula]
Length=1030

 Score =   291 bits (746),  Expect = 4e-88, Method: Composition-based stats.
 Identities = 127/158 (80%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKRGYK+QEFVAHS NVNCL  GKK CR+F+TGGDDH VNLW+IGKPTS S+LSGHTSP
Sbjct  1    MAKRGYKIQEFVAHSSNVNCLNIGKKACRLFVTGGDDHKVNLWTIGKPTSLSSLSGHTSP  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            VES+ FDS E+LV AGS+SG+I+LWDLE++KM+RT++GHRS CT++EFHPFGEFFASGSM
Sbjct  61   VESVTFDSGEVLVLAGSTSGVIRLWDLEESKMVRTVAGHRSNCTSVEFHPFGEFFASGSM  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DTNLKIWD RKKGCIHTYKGH++GISTI+FTPDGRWVV
Sbjct  121  DTNLKIWDNRKKGCIHTYKGHSQGISTIKFTPDGRWVV  158


 Score = 78.2 bits (191),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 37/125 (30%), Positives = 62/125 (50%), Gaps = 0/125 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W   K     T  GH+  + +I F      V +G    ++K+WDL   
Sbjct  115  FASGSMDTNLKIWDNRKKGCIHTYKGHSQGISTIKFTPDGRWVVSGGFDNVVKVWDLTAG  174

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++   + H  + T+L+FHP     A+GS D  +K WD+     I + +    G+ ++ F
Sbjct  175  KLLHDFNFHDGHITSLDFHPLEFLLATGSADRTVKFWDLESFELIGSARREATGVRSMAF  234

Query  647  TPDGR  661
             PDGR
Sbjct  235  HPDGR  239


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 32/120 (27%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  HS  ++ ++F     R  ++GG D+ V +W +         + H   + S+ F 
Sbjct  135  IHTYKGHSQGISTIKFTPDG-RWVVSGGFDNVVKVWDLTAGKLLHDFNFHDGHITSLDFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   ++ FHP G    SG  D  LK++
Sbjct  194  PLEFLLATGSADRTVKFWDLESFELIGSARREATGVRSMAFHPDGRTLFSGHED-GLKVF  252



>ref|XP_007213652.1| hypothetical protein PRUPE_ppa001393mg [Prunus persica]
 gb|EMJ14851.1| hypothetical protein PRUPE_ppa001393mg [Prunus persica]
Length=839

 Score =   288 bits (736),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKR YKLQEFVAHS N+NCL  GKK CR+F+TGGDDH VNLW+IGKPTS  +L+ HTSP
Sbjct  1    MAKRAYKLQEFVAHSDNINCLNIGKKACRLFVTGGDDHIVNLWTIGKPTSLMSLASHTSP  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            VES+AF+SAE+LV AG+SSG+ K+WDLE+TKM+RTLSGHRS CTA+EFHPFGEFFASGS 
Sbjct  61   VESVAFNSAEVLVLAGASSGVTKIWDLEETKMVRTLSGHRSSCTAVEFHPFGEFFASGST  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DTNLKIWDIRKKGCIHTYKGHT+GISTI+FTPDGRWVV
Sbjct  121  DTNLKIWDIRKKGCIHTYKGHTQGISTIKFTPDGRWVV  158


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 60/125 (48%), Gaps = 0/125 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GHT  + +I F      V +G    ++K+WDL   
Sbjct  115  FASGSTDTNLKIWDIRKKGCIHTYKGHTQGISTIKFTPDGRWVVSGGFDNVVKVWDLTAG  174

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H  +  ++ FHP     A+GS D  +K WD+     I + +    G+ TI F
Sbjct  175  KLLHDFKFHEGHIRSIGFHPLEFLLATGSADRTVKFWDLETFELIGSTRPEPTGVRTIAF  234

Query  647  TPDGR  661
             PDGR
Sbjct  235  HPDGR  239


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/119 (27%), Positives = 56/119 (47%), Gaps = 2/119 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  ++ ++F     R  ++GG D+ V +W +           H   + SI F 
Sbjct  135  IHTYKGHTQGISTIKFTPDG-RWVVSGGFDNVVKVWDLTAGKLLHDFKFHEGHIRSIGFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKI  574
              E L+A GS+   +K WDLE  ++I +     +    + FHP G    SG +D +LK+
Sbjct  194  PLEFLLATGSADRTVKFWDLETFELIGSTRPEPTGVRTIAFHPDGRTLFSG-LDDSLKV  251



>gb|KHG08287.1| hypothetical protein F383_16149 [Gossypium arboreum]
Length=1005

 Score =   290 bits (742),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            M+KRGYKLQEFVAH+ +VNCL  GKKTCR+ +TGGDDH VN+W+IGKPTS  +L GHTSP
Sbjct  1    MSKRGYKLQEFVAHTTSVNCLSMGKKTCRLLITGGDDHKVNVWAIGKPTSLMSLCGHTSP  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            VES+AFDSAE+LV AGSS+G IKLWDLE+TKM+R L+GHRS CTALEFHPFGEFF SGSM
Sbjct  61   VESLAFDSAEVLVLAGSSTGGIKLWDLEETKMVRGLTGHRSNCTALEFHPFGEFFVSGSM  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DTNLK+WDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV
Sbjct  121  DTNLKVWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  158


 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 63/145 (43%), Gaps = 1/145 (1%)
 Frame = +2

Query  227  FVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAE  406
               H  N   L F       F++G  D ++ +W I K     T  GHT  + +I F    
Sbjct  96   LTGHRSNCTALEF-HPFGEFFVSGSMDTNLKVWDIRKKGCIHTYKGHTRGISTIRFTPDG  154

Query  407  ILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIR  586
              V +G    ++K+WDL   K++     H  +   ++FHP     A+GS D  +K WD+ 
Sbjct  155  RWVVSGGFDNVVKIWDLTAGKLLNEFKFHEGHIRTIDFHPLEFLLATGSADRTVKFWDLE  214

Query  587  KKGCIHTYKGHTRGISTIRFTPDGR  661
                I + +       +I F PDGR
Sbjct  215  TFELIGSSRPEATDFRSIAFHPDGR  239



>ref|XP_003545861.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Glycine max]
Length=825

 Score =   286 bits (732),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 126/158 (80%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKRGYK+QEFVAHS +VNCL  GKK CR+F+TGGDDH VNLW+IGKPT  ++LSGHTSP
Sbjct  1    MAKRGYKIQEFVAHSASVNCLNIGKKACRLFITGGDDHKVNLWTIGKPTFLTSLSGHTSP  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            VES+AFDS E+LV  G+S+G+IKLWDLE+ KM+RT++GHRS CTA+EFHPFGEFFASGSM
Sbjct  61   VESVAFDSGEVLVLGGASTGVIKLWDLEEAKMVRTVAGHRSNCTAVEFHPFGEFFASGSM  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DTNLKIWDIRKKGCIHTYKGH++GISTI+FTPDGRWVV
Sbjct  121  DTNLKIWDIRKKGCIHTYKGHSQGISTIKFTPDGRWVV  158


 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 61/127 (48%), Gaps = 0/127 (0%)
 Frame = +2

Query  281  RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLE  460
              F +G  D ++ +W I K     T  GH+  + +I F      V +G    ++K+WDL 
Sbjct  113  EFFASGSMDTNLKIWDIRKKGCIHTYKGHSQGISTIKFTPDGRWVVSGGFDNVVKVWDLT  172

Query  461  DTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTI  640
              K++     H  +  +++FHP     A+GS D  +K WD+     I + +    G+ +I
Sbjct  173  AGKLLHDFKFHEGHIRSIDFHPLEFLLATGSADRTVKFWDLETFELIGSARREATGVRSI  232

Query  641  RFTPDGR  661
             F PDGR
Sbjct  233  AFHPDGR  239


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/120 (27%), Positives = 56/120 (47%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  HS  ++ ++F     R  ++GG D+ V +W +           H   + SI F 
Sbjct  135  IHTYKGHSQGISTIKFTPDG-RWVVSGGFDNVVKVWDLTAGKLLHDFKFHEGHIRSIDFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   ++ FHP G    +G  D  LK++
Sbjct  194  PLEFLLATGSADRTVKFWDLETFELIGSARREATGVRSIAFHPDGRTLFTGHED-GLKVY  252



>ref|XP_011043252.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Populus euphratica]
Length=959

 Score =   288 bits (737),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKRGYKLQEFVAHS NVNCL  GKK CRMF+TGGDDH VNLW+IGKPTS  +L GHTSP
Sbjct  1    MAKRGYKLQEFVAHSTNVNCLSIGKKACRMFITGGDDHKVNLWAIGKPTSLMSLCGHTSP  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            VES+AFD++E+LV AG+S G IKLWDLE+ KM+RTL+GHRS CTA+EFHPFGEFFASGS 
Sbjct  61   VESVAFDTSEVLVLAGASMGAIKLWDLEEAKMVRTLTGHRSNCTAVEFHPFGEFFASGST  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            D N++IWDIRKKGCIHTYKGHT+GISTIRFTPDGRWVV
Sbjct  121  DMNMRIWDIRKKGCIHTYKGHTQGISTIRFTPDGRWVV  158


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 61/125 (49%), Gaps = 0/125 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GHT  + +I F      V +G    ++K+WDL   
Sbjct  115  FASGSTDMNMRIWDIRKKGCIHTYKGHTQGISTIRFTPDGRWVVSGGCDNVVKVWDLTAG  174

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H  +  +++FHP     A+GS D  +K WD+     I + +    G+ +I F
Sbjct  175  KLLHDFKFHEGHIRSIDFHPLEFLLATGSADRTVKFWDLETFELIGSARPEATGVRSITF  234

Query  647  TPDGR  661
             PDGR
Sbjct  235  HPDGR  239


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/120 (27%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  ++ +RF     R  ++GG D+ V +W +           H   + SI F 
Sbjct  135  IHTYKGHTQGISTIRFTPDG-RWVVSGGCDNVVKVWDLTAGKLLHDFKFHEGHIRSIDFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   ++ FHP G     G +D +LK++
Sbjct  194  PLEFLLATGSADRTVKFWDLETFELIGSARPEATGVRSITFHPDGRTLFCG-LDDSLKVY  252



>ref|XP_003543076.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
[Glycine max]
 gb|KHN08569.1| Katanin p80 WD40 repeat-containing subunit B1 like 1 [Glycine 
soja]
Length=824

 Score =   286 bits (731),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKRGYK+QEFVAHS +VNCL  GKK CR+F+TGGDDH VNLW+IGKPT  ++LSGHTSP
Sbjct  1    MAKRGYKIQEFVAHSASVNCLNIGKKACRLFITGGDDHKVNLWTIGKPTPITSLSGHTSP  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            VES+AFDS E+LV  G+S+G+IKLWDLE+ KM+RT++GHRS CTA+EFHPFGEFFASGSM
Sbjct  61   VESVAFDSGEVLVLGGASTGVIKLWDLEEAKMVRTVAGHRSNCTAVEFHPFGEFFASGSM  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DTNLKIWDIRKKGCIHTYKGH++GIS I+FTPDGRWVV
Sbjct  121  DTNLKIWDIRKKGCIHTYKGHSQGISIIKFTPDGRWVV  158


 Score = 74.3 bits (181),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 60/127 (47%), Gaps = 0/127 (0%)
 Frame = +2

Query  281  RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLE  460
              F +G  D ++ +W I K     T  GH+  +  I F      V +G    ++K+WDL 
Sbjct  113  EFFASGSMDTNLKIWDIRKKGCIHTYKGHSQGISIIKFTPDGRWVVSGGFDNVVKVWDLT  172

Query  461  DTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTI  640
              K++     H  +  +++FHP     A+GS D  +K WD+     I + +    G+ +I
Sbjct  173  AGKLLHDFKFHEGHIRSIDFHPLEFLLATGSADRTVKFWDLETFELIGSARPEATGVRSI  232

Query  641  RFTPDGR  661
             F PDGR
Sbjct  233  AFHPDGR  239


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/120 (27%), Positives = 56/120 (47%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  HS  ++ ++F     R  ++GG D+ V +W +           H   + SI F 
Sbjct  135  IHTYKGHSQGISIIKFTPDG-RWVVSGGFDNVVKVWDLTAGKLLHDFKFHEGHIRSIDFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   ++ FHP G    +G  D  LK++
Sbjct  194  PLEFLLATGSADRTVKFWDLETFELIGSARPEATGVRSIAFHPDGRALFTGHED-GLKVY  252



>gb|KJB68609.1| hypothetical protein B456_010G254700 [Gossypium raimondii]
Length=927

 Score =   287 bits (734),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 129/158 (82%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKRGYKLQEFVAH+ NVNCL  GKKT R+F+TGGDDH VN+WSIGKPTS  +L GHTSP
Sbjct  1    MAKRGYKLQEFVAHTANVNCLSMGKKTRRLFITGGDDHKVNVWSIGKPTSLMSLCGHTSP  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            VES+AFD AE+ V AG+S+G+IKLWDLE+TKM+R L+ HRS CTA+EFHPFGEFFASGSM
Sbjct  61   VESLAFDLAEVFVLAGASTGVIKLWDLEETKMVRGLTAHRSNCTAMEFHPFGEFFASGSM  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DTNLKIWDIRKKGCIHTYKGHTRGISTI+FTPDGRWVV
Sbjct  121  DTNLKIWDIRKKGCIHTYKGHTRGISTIQFTPDGRWVV  158


 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 66/145 (46%), Gaps = 1/145 (1%)
 Frame = +2

Query  227  FVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAE  406
              AH  N   + F       F +G  D ++ +W I K     T  GHT  + +I F    
Sbjct  96   LTAHRSNCTAMEF-HPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIQFTPDG  154

Query  407  ILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIR  586
              V +G    ++K+WDL   K++     H  +  +++FHP     A+GS D  +K WD+ 
Sbjct  155  RWVVSGGFDNVVKVWDLTAGKLLNEFKFHEGHIRSIDFHPLEFLLATGSADGTVKFWDLE  214

Query  587  KKGCIHTYKGHTRGISTIRFTPDGR  661
                I + +    G+ +I F PDG+
Sbjct  215  TFELIGSSRPEATGVCSITFHPDGK  239


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/120 (27%), Positives = 59/120 (49%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  ++ ++F     R  ++GG D+ V +W +      +    H   + SI F 
Sbjct  135  IHTYKGHTRGISTIQF-TPDGRWVVSGGFDNVVKVWDLTAGKLLNEFKFHEGHIRSIDFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+ G +K WDLE  ++I +     +   ++ FHP G+    G +D  LK++
Sbjct  194  PLEFLLATGSADGTVKFWDLETFELIGSSRPEATGVCSITFHPDGKTLFCG-LDDGLKVY  252



>gb|KJB68608.1| hypothetical protein B456_010G254700 [Gossypium raimondii]
Length=926

 Score =   286 bits (733),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 129/158 (82%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKRGYKLQEFVAH+ NVNCL  GKKT R+F+TGGDDH VN+WSIGKPTS  +L GHTSP
Sbjct  1    MAKRGYKLQEFVAHTANVNCLSMGKKTRRLFITGGDDHKVNVWSIGKPTSLMSLCGHTSP  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            VES+AFD AE+ V AG+S+G+IKLWDLE+TKM+R L+ HRS CTA+EFHPFGEFFASGSM
Sbjct  61   VESLAFDLAEVFVLAGASTGVIKLWDLEETKMVRGLTAHRSNCTAMEFHPFGEFFASGSM  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DTNLKIWDIRKKGCIHTYKGHTRGISTI+FTPDGRWVV
Sbjct  121  DTNLKIWDIRKKGCIHTYKGHTRGISTIQFTPDGRWVV  158


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 66/145 (46%), Gaps = 1/145 (1%)
 Frame = +2

Query  227  FVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAE  406
              AH  N   + F       F +G  D ++ +W I K     T  GHT  + +I F    
Sbjct  96   LTAHRSNCTAMEF-HPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIQFTPDG  154

Query  407  ILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIR  586
              V +G    ++K+WDL   K++     H  +  +++FHP     A+GS D  +K WD+ 
Sbjct  155  RWVVSGGFDNVVKVWDLTAGKLLNEFKFHEGHIRSIDFHPLEFLLATGSADGTVKFWDLE  214

Query  587  KKGCIHTYKGHTRGISTIRFTPDGR  661
                I + +    G+ +I F PDG+
Sbjct  215  TFELIGSSRPEATGVCSITFHPDGK  239


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/120 (27%), Positives = 59/120 (49%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  ++ ++F     R  ++GG D+ V +W +      +    H   + SI F 
Sbjct  135  IHTYKGHTRGISTIQF-TPDGRWVVSGGFDNVVKVWDLTAGKLLNEFKFHEGHIRSIDFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+ G +K WDLE  ++I +     +   ++ FHP G+    G +D  LK++
Sbjct  194  PLEFLLATGSADGTVKFWDLETFELIGSSRPEATGVCSITFHPDGKTLFCG-LDDGLKVY  252



>ref|XP_006377307.1| hypothetical protein POPTR_0011s04530g [Populus trichocarpa]
 gb|ERP55104.1| hypothetical protein POPTR_0011s04530g [Populus trichocarpa]
Length=990

 Score =   287 bits (735),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKRGYKLQEFVAHS NVNCL  GKK CRMF+TGGDDH VNLW+IGKPTS  +L GHTSP
Sbjct  1    MAKRGYKLQEFVAHSTNVNCLSIGKKACRMFITGGDDHKVNLWAIGKPTSLMSLCGHTSP  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            VES+AFD++E+LV AG+S G IKLWDLE+ KM+RTL+GHRS CTA+EFHPFGEFFASGS 
Sbjct  61   VESVAFDTSEVLVLAGASMGAIKLWDLEEAKMVRTLTGHRSNCTAVEFHPFGEFFASGST  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            D N++IWDIRKKGCIHTYKGHT+GISTIRF+PDGRWVV
Sbjct  121  DMNMRIWDIRKKGCIHTYKGHTQGISTIRFSPDGRWVV  158


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 61/125 (49%), Gaps = 0/125 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GHT  + +I F      V +G    ++K+WDL   
Sbjct  115  FASGSTDMNMRIWDIRKKGCIHTYKGHTQGISTIRFSPDGRWVVSGGCDNVVKVWDLTAG  174

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H  +  +++FHP     A+GS D  +K WD+     I + +    G+ +I F
Sbjct  175  KLLHDFKFHEGHIRSIDFHPLEFLLATGSADRTVKFWDLETFELIGSARPEATGVRSITF  234

Query  647  TPDGR  661
             PDGR
Sbjct  235  HPDGR  239


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/120 (27%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  ++ +RF     R  ++GG D+ V +W +           H   + SI F 
Sbjct  135  IHTYKGHTQGISTIRFSPDG-RWVVSGGCDNVVKVWDLTAGKLLHDFKFHEGHIRSIDFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   ++ FHP G     G +D +LK++
Sbjct  194  PLEFLLATGSADRTVKFWDLETFELIGSARPEATGVRSITFHPDGRTLFCG-LDDSLKVY  252



>gb|KHG05933.1| hypothetical protein F383_10434 [Gossypium arboreum]
Length=904

 Score =   286 bits (731),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 129/158 (82%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKRGYKLQEFVAH+ NVNCL  GKKT R+ +TGGDDH VN+WSIGKPTS  +L GHTSP
Sbjct  1    MAKRGYKLQEFVAHTANVNCLSMGKKTRRLLITGGDDHKVNVWSIGKPTSLMSLCGHTSP  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            VES+AFD AE+ V AG+S+G+IKLWDLE+TKM+R L+ HRS CTA+EFHPFGEFFASGSM
Sbjct  61   VESLAFDLAEVFVLAGASTGVIKLWDLEETKMVRGLTAHRSNCTAMEFHPFGEFFASGSM  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV
Sbjct  121  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  158


 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 66/145 (46%), Gaps = 1/145 (1%)
 Frame = +2

Query  227  FVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAE  406
              AH  N   + F       F +G  D ++ +W I K     T  GHT  + +I F    
Sbjct  96   LTAHRSNCTAMEF-HPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDG  154

Query  407  ILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIR  586
              V +G    ++K+WDL   K++     H  +  +++FHP     A+GS D  +K WD+ 
Sbjct  155  RWVVSGGFDNVVKVWDLTAGKLLNEFKFHEGHIRSIDFHPLEFLLATGSADGTVKFWDLE  214

Query  587  KKGCIHTYKGHTRGISTIRFTPDGR  661
                I + +    G+ +I F PDG+
Sbjct  215  TFELIGSSRPEATGVCSITFHPDGK  239


 Score = 55.8 bits (133),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 34/127 (27%), Positives = 60/127 (47%), Gaps = 2/127 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  ++ +RF     R  ++GG D+ V +W +      +    H   + SI F 
Sbjct  135  IHTYKGHTRGISTIRF-TPDGRWVVSGGFDNVVKVWDLTAGKLLNEFKFHEGHIRSIDFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+ G +K WDLE  ++I +     +   ++ FHP G+    G +D  LK++
Sbjct  194  PLEFLLATGSADGTVKFWDLETFELIGSSRPEATGVCSITFHPDGKTLFCG-LDDGLKVY  252

Query  578  DIRKKGC  598
                  C
Sbjct  253  SWEPVAC  259



>ref|XP_010109595.1| Katanin p80 WD40 repeat-containing subunit B1-1-like protein 
[Morus notabilis]
 gb|EXC56734.1| Katanin p80 WD40 repeat-containing subunit B1-1-like protein 
[Morus notabilis]
Length=170

 Score =   265 bits (676),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 139/158 (88%), Gaps = 7/158 (4%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKRGYKL++       VNCL  GKK CR+F+TGGDDH VN+W IGKPTS  +L GHTSP
Sbjct  1    MAKRGYKLRD-------VNCLNIGKKGCRLFVTGGDDHKVNVWEIGKPTSLKSLCGHTSP  53

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            VES+AFDSAE+LV AG+SSG+IK WDL++ KM+RTLSGHRS CTA+EFHPFGEFFASGSM
Sbjct  54   VESVAFDSAEVLVLAGASSGVIKQWDLQEAKMVRTLSGHRSNCTAVEFHPFGEFFASGSM  113

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DTNLKIWDIRKKGCIHTYKGHT+GISTI+FTPDGRWVV
Sbjct  114  DTNLKIWDIRKKGCIHTYKGHTQGISTIKFTPDGRWVV  151



>ref|XP_008371310.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Malus domestica]
Length=813

 Score =   282 bits (721),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKR YKLQEFVAHS ++NCL  GKK CR+F+TGGDDH VNLW+IGKPT+    +GHTSP
Sbjct  1    MAKRAYKLQEFVAHSDSINCLSIGKKACRLFVTGGDDHIVNLWAIGKPTALMRFAGHTSP  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            VES+AF+S E+LV AG+SSG+ K+WDLE+TKM+RTL+GHRS CTA+EFHPFGEFFASGSM
Sbjct  61   VESVAFNSGEVLVLAGASSGVTKIWDLEETKMVRTLTGHRSSCTAVEFHPFGEFFASGSM  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DTNLKIWDIRKKGCIHTYKGHT+GISTI+FTPDGRWVV
Sbjct  121  DTNLKIWDIRKKGCIHTYKGHTQGISTIKFTPDGRWVV  158


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 59/125 (47%), Gaps = 0/125 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GHT  + +I F      V +G     +K+WDL   
Sbjct  115  FASGSMDTNLKIWDIRKKGCIHTYKGHTQGISTIKFTPDGRWVVSGGFDNAVKIWDLTAG  174

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H  +  +L+FHP     A+GS D  +K WD+     I + +    G+  I F
Sbjct  175  KLLHDFKFHEGHIRSLDFHPLEFLLATGSTDRTVKFWDLETFELIGSSRPEPTGVRAIAF  234

Query  647  TPDGR  661
             PDGR
Sbjct  235  HPDGR  239


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/120 (27%), Positives = 59/120 (49%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  ++ ++F     R  ++GG D++V +W +           H   + S+ F 
Sbjct  135  IHTYKGHTQGISTIKFTPDG-RWVVSGGFDNAVKIWDLTAGKLLHDFKFHEGHIRSLDFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   A+ FHP G    SG +D +LK++
Sbjct  194  PLEFLLATGSTDRTVKFWDLETFELIGSSRPEPTGVRAIAFHPDGRTLFSG-LDDSLKVY  252



>ref|XP_006467861.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Citrus sinensis]
Length=1074

 Score =   285 bits (730),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 126/158 (80%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKRGYKLQEFVAHS NVNC+  GKK CR  +TGGDD  VNLW+IGKPT+  +L G +SP
Sbjct  1    MAKRGYKLQEFVAHSANVNCISIGKKACRFLITGGDDQKVNLWAIGKPTALMSLCGLSSP  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            V+S+AFDSAE+LV AG+SSG+IKLWDLE++KM+RTL+GH+S CTA+EFHPFGEFFASG M
Sbjct  61   VDSVAFDSAEVLVLAGASSGVIKLWDLEESKMVRTLTGHKSNCTAVEFHPFGEFFASGCM  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV
Sbjct  121  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  158


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/148 (28%), Positives = 66/148 (45%), Gaps = 1/148 (1%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            ++    H  N   + F       F +G  D ++ +W I K     T  GHT  + +I F 
Sbjct  93   VRTLTGHKSNCTAVEF-HPFGEFFASGCMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFT  151

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
                 V +G    ++K+WDL   K++     H  +  +++FHP     A+GS D  +K W
Sbjct  152  PDGRWVVSGGFDNVVKVWDLTAGKLLHDFKFHEGHIRSIDFHPLEFLLATGSADRTVKFW  211

Query  578  DIRKKGCIHTYKGHTRGISTIRFTPDGR  661
            D+     I + +    G+  I F PDGR
Sbjct  212  DLETFELIGSTRPEVTGVHAITFHPDGR  239


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  ++ +RF     R  ++GG D+ V +W +           H   + SI F 
Sbjct  135  IHTYKGHTRGISTIRFTPDG-RWVVSGGFDNVVKVWDLTAGKLLHDFKFHEGHIRSIDFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   A+ FHP G    SG  D NLK++
Sbjct  194  PLEFLLATGSADRTVKFWDLETFELIGSTRPEVTGVHAITFHPDGRTLFSG-FDDNLKVY  252



>ref|XP_010278330.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
[Nelumbo nucifera]
Length=786

 Score =   280 bits (717),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKRGYKLQEFVAH+ +VNCL  GKK+CR+ +TGG+DH VNLW+IGKP S  +LSGHTSP
Sbjct  1    MAKRGYKLQEFVAHASSVNCLSIGKKSCRLLVTGGEDHRVNLWAIGKPNSLLSLSGHTSP  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            VE +AFDSAE+LV AG+S+G IKLWDLE+ K++RTL+GHR  CTA+EFHPFGEFFASGS+
Sbjct  61   VECVAFDSAEVLVVAGASTGAIKLWDLEEAKIVRTLTGHRINCTAVEFHPFGEFFASGSL  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            D NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV
Sbjct  121  DANLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  158


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 60/125 (48%), Gaps = 0/125 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GHT  + +I F      V +G    ++K+WDL   
Sbjct  115  FASGSLDANLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVVSGGLDNVVKVWDLTAG  174

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++   + H    T ++FHP     A+GS D  +K WD+     I +      G+ ++ F
Sbjct  175  KLLHDFTFHEGRITCIDFHPLEFLLATGSADRTVKFWDLETFELIGSAGPEATGVRSMIF  234

Query  647  TPDGR  661
             PDGR
Sbjct  235  HPDGR  239



>ref|XP_006449267.1| hypothetical protein CICLE_v10014112mg [Citrus clementina]
 gb|ESR62507.1| hypothetical protein CICLE_v10014112mg [Citrus clementina]
Length=1058

 Score =   284 bits (727),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKRGYKLQEFVAHS NVNC+  GKK CR  +TGGDD  VNLW+IGKPT+  +L G +SP
Sbjct  1    MAKRGYKLQEFVAHSANVNCISIGKKACRFLITGGDDQKVNLWAIGKPTALMSLCGLSSP  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            V+S+AFDSAE+LV AG+S+G+IKLWDLE++KM+RTL+GH+S CTA+EFHPFGEFFASG M
Sbjct  61   VDSVAFDSAEVLVLAGASTGVIKLWDLEESKMVRTLTGHKSNCTAVEFHPFGEFFASGCM  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV
Sbjct  121  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  158


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/148 (28%), Positives = 66/148 (45%), Gaps = 1/148 (1%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            ++    H  N   + F       F +G  D ++ +W I K     T  GHT  + +I F 
Sbjct  93   VRTLTGHKSNCTAVEF-HPFGEFFASGCMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFT  151

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
                 V +G    ++K+WDL   K++     H  +  +++FHP     A+GS D  +K W
Sbjct  152  PDGRWVVSGGFDNVVKVWDLTAGKLLHDFKFHEGHIRSIDFHPLEFLLATGSADRTVKFW  211

Query  578  DIRKKGCIHTYKGHTRGISTIRFTPDGR  661
            D+     I + +    G+  I F PDGR
Sbjct  212  DLETFELIGSTRPEVTGVRAITFHPDGR  239


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  ++ +RF     R  ++GG D+ V +W +           H   + SI F 
Sbjct  135  IHTYKGHTRGISTIRFTPDG-RWVVSGGFDNVVKVWDLTAGKLLHDFKFHEGHIRSIDFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   A+ FHP G    SG  D N+K++
Sbjct  194  PLEFLLATGSADRTVKFWDLETFELIGSTRPEVTGVRAITFHPDGRTLFSG-FDDNMKVY  252



>ref|XP_010057471.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Eucalyptus grandis]
 gb|KCW74643.1| hypothetical protein EUGRSUZ_E03367 [Eucalyptus grandis]
Length=1017

 Score =   283 bits (724),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            M+KRGYKLQEFVAHS NVNCL  GKK CR+FLTGGDD  VNLW+IGKP S  +L GHT+ 
Sbjct  1    MSKRGYKLQEFVAHSSNVNCLSIGKKACRLFLTGGDDCKVNLWAIGKPNSLMSLCGHTNA  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            VES+AFDSAE+LV AG+SSG+IKLWD+E+ KM+R L+GHRS CTA+EFHPFGEFFASGS 
Sbjct  61   VESVAFDSAEVLVLAGASSGVIKLWDVEEAKMVRGLTGHRSNCTAMEFHPFGEFFASGST  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DTNLKIWDIRKKGCIHTYKGHTRGISTIRF+PDGRWVV
Sbjct  121  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFSPDGRWVV  158


 Score = 77.8 bits (190),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 66/145 (46%), Gaps = 1/145 (1%)
 Frame = +2

Query  227  FVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAE  406
               H  N   + F       F +G  D ++ +W I K     T  GHT  + +I F    
Sbjct  96   LTGHRSNCTAMEF-HPFGEFFASGSTDTNLKIWDIRKKGCIHTYKGHTRGISTIRFSPDG  154

Query  407  ILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIR  586
              V +G +  ++K+WDL   K++     H ++  +++FHP     A+GS D  +K WD+ 
Sbjct  155  RWVVSGGNDNVVKVWDLTAGKLLHDFKFHENHIRSMDFHPLEFLLATGSADRTVKFWDLE  214

Query  587  KKGCIHTYKGHTRGISTIRFTPDGR  661
                I + +    G+  I F PDGR
Sbjct  215  TFELIGSSRPEATGVRAIAFHPDGR  239


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/120 (26%), Positives = 59/120 (49%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  ++ +RF     R  ++GG+D+ V +W +           H + + S+ F 
Sbjct  135  IHTYKGHTRGISTIRFSPDG-RWVVSGGNDNVVKVWDLTAGKLLHDFKFHENHIRSMDFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   A+ FHP G     G ++ +LK++
Sbjct  194  PLEFLLATGSADRTVKFWDLETFELIGSSRPEATGVRAIAFHPDGRTLFCG-LEDSLKVY  252



>gb|KDO75817.1| hypothetical protein CISIN_1g001462mg [Citrus sinensis]
Length=1072

 Score =   283 bits (725),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 124/158 (78%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKRGYKLQEFVAHS NVNC+  GKK CR  +TGGDD  VNLW+IGKPT+  +L G +SP
Sbjct  1    MAKRGYKLQEFVAHSANVNCISIGKKACRFLITGGDDQKVNLWAIGKPTALMSLCGLSSP  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            V+S+AFDSAE+LV AG+S+G+IKLWDLE++KM+RTL+GH+S CTA+EFHPFGEFFASG M
Sbjct  61   VDSVAFDSAEVLVLAGASTGVIKLWDLEESKMVRTLTGHKSNCTAVEFHPFGEFFASGCM  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DTNLKIWDIRKKGCIHTYKGHTRGI+TIRFTPDGRWVV
Sbjct  121  DTNLKIWDIRKKGCIHTYKGHTRGINTIRFTPDGRWVV  158


 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/148 (28%), Positives = 66/148 (45%), Gaps = 1/148 (1%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            ++    H  N   + F       F +G  D ++ +W I K     T  GHT  + +I F 
Sbjct  93   VRTLTGHKSNCTAVEF-HPFGEFFASGCMDTNLKIWDIRKKGCIHTYKGHTRGINTIRFT  151

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
                 V +G    ++K+WDL   K++     H  +  +++FHP     A+GS D  +K W
Sbjct  152  PDGRWVVSGGFDNVVKVWDLTAGKLLHDFKFHEGHIRSIDFHPLEFLLATGSADRTVKFW  211

Query  578  DIRKKGCIHTYKGHTRGISTIRFTPDGR  661
            D+     I + +    G+  I F PDGR
Sbjct  212  DLETFELIGSTRPEVTGVHAITFHPDGR  239


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  +N +RF     R  ++GG D+ V +W +           H   + SI F 
Sbjct  135  IHTYKGHTRGINTIRFTPD-GRWVVSGGFDNVVKVWDLTAGKLLHDFKFHEGHIRSIDFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   A+ FHP G    SG  D NLK++
Sbjct  194  PLEFLLATGSADRTVKFWDLETFELIGSTRPEVTGVHAITFHPDGRTLFSG-FDDNLKVY  252



>gb|KDO75818.1| hypothetical protein CISIN_1g001462mg [Citrus sinensis]
Length=1074

 Score =   283 bits (725),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 124/158 (78%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKRGYKLQEFVAHS NVNC+  GKK CR  +TGGDD  VNLW+IGKPT+  +L G +SP
Sbjct  1    MAKRGYKLQEFVAHSANVNCISIGKKACRFLITGGDDQKVNLWAIGKPTALMSLCGLSSP  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            V+S+AFDSAE+LV AG+S+G+IKLWDLE++KM+RTL+GH+S CTA+EFHPFGEFFASG M
Sbjct  61   VDSVAFDSAEVLVLAGASTGVIKLWDLEESKMVRTLTGHKSNCTAVEFHPFGEFFASGCM  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DTNLKIWDIRKKGCIHTYKGHTRGI+TIRFTPDGRWVV
Sbjct  121  DTNLKIWDIRKKGCIHTYKGHTRGINTIRFTPDGRWVV  158


 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/148 (28%), Positives = 66/148 (45%), Gaps = 1/148 (1%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            ++    H  N   + F       F +G  D ++ +W I K     T  GHT  + +I F 
Sbjct  93   VRTLTGHKSNCTAVEF-HPFGEFFASGCMDTNLKIWDIRKKGCIHTYKGHTRGINTIRFT  151

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
                 V +G    ++K+WDL   K++     H  +  +++FHP     A+GS D  +K W
Sbjct  152  PDGRWVVSGGFDNVVKVWDLTAGKLLHDFKFHEGHIRSIDFHPLEFLLATGSADRTVKFW  211

Query  578  DIRKKGCIHTYKGHTRGISTIRFTPDGR  661
            D+     I + +    G+  I F PDGR
Sbjct  212  DLETFELIGSTRPEVTGVHAITFHPDGR  239


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  +N +RF     R  ++GG D+ V +W +           H   + SI F 
Sbjct  135  IHTYKGHTRGINTIRFTPD-GRWVVSGGFDNVVKVWDLTAGKLLHDFKFHEGHIRSIDFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   A+ FHP G    SG  D NLK++
Sbjct  194  PLEFLLATGSADRTVKFWDLETFELIGSTRPEVTGVHAITFHPDGRTLFSG-FDDNLKVY  252



>ref|XP_004293499.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Fragaria vesca subsp. vesca]
Length=803

 Score =   278 bits (712),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKR YKLQEFVAHS N+NCL  GKK CR+++TGGDDH VNLW+IGKPT+  +L+GHTSP
Sbjct  1    MAKRAYKLQEFVAHSDNINCLSIGKKACRLYVTGGDDHKVNLWTIGKPTALMSLTGHTSP  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            VES+AF+ AE+LV AG+S+G  K+WDLE+ KM+RTL+GHRS C+A+EFHPFGEFFASGS 
Sbjct  61   VESVAFNLAEVLVLAGASTGATKIWDLEEAKMVRTLTGHRSSCSAVEFHPFGEFFASGST  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DTNLKIWDIRKKGCIHTYKGHT+GISTI+FTPDGRWVV
Sbjct  121  DTNLKIWDIRKKGCIHTYKGHTQGISTIKFTPDGRWVV  158


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/127 (30%), Positives = 62/127 (49%), Gaps = 0/127 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GHT  + +I F      V +G    ++K+WDL   
Sbjct  115  FASGSTDTNLKIWDIRKKGCIHTYKGHTQGISTIKFTPDGRWVVSGGFDNVVKVWDLTAG  174

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H  +  +++FHP     A+GS D  +K WD+     I + +    G+ +I F
Sbjct  175  KLLHDFKFHEGHIRSIDFHPLEFLLATGSADRTVKFWDLETFELIGSTRPEPTGVRSIAF  234

Query  647  TPDGRWV  667
             PDGR +
Sbjct  235  HPDGRTI  241


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/120 (27%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  ++ ++F     R  ++GG D+ V +W +           H   + SI F 
Sbjct  135  IHTYKGHTQGISTIKFTPDG-RWVVSGGFDNVVKVWDLTAGKLLHDFKFHEGHIRSIDFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   ++ FHP G    SG +D  LK++
Sbjct  194  PLEFLLATGSADRTVKFWDLETFELIGSTRPEPTGVRSIAFHPDGRTIFSG-LDDRLKVY  252



>ref|XP_004158060.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
[Cucumis sativus]
Length=906

 Score =   280 bits (717),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/172 (75%), Positives = 144/172 (84%), Gaps = 14/172 (8%)
 Frame = +2

Query  197  MAKRGYKL--------------QEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIG  334
            MAKRGYKL              +EF AHSGNVNCL  GKK CR+F+TGGDD+ VNLW+IG
Sbjct  1    MAKRGYKLRILSNLIFLTYLKLEEFAAHSGNVNCLSIGKKACRLFITGGDDYKVNLWAIG  60

Query  335  KPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTAL  514
            KP S  +L GHT+PVES+AFDSAE+LV AG+SSG IKLWDLE+ KM+RTLSGHRS CTA+
Sbjct  61   KPNSLMSLCGHTNPVESVAFDSAEVLVLAGASSGAIKLWDLEEAKMVRTLSGHRSNCTAV  120

Query  515  EFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            EFHPFGEFFASGS DTNLKIWDIRKKGCIHTYKGHT+GISTI+FTPDGRWVV
Sbjct  121  EFHPFGEFFASGSRDTNLKIWDIRKKGCIHTYKGHTQGISTIKFTPDGRWVV  172


 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 58/125 (46%), Gaps = 0/125 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GHT  + +I F      V +G     +K+WDL   
Sbjct  129  FASGSRDTNLKIWDIRKKGCIHTYKGHTQGISTIKFTPDGRWVVSGGFDSAVKVWDLTAG  188

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H     +++FHP     A+GS D  +K WD+     I + +    G+  I F
Sbjct  189  KLMHDFKFHEGPIRSIDFHPLEFLLATGSADKTVKFWDLETFELIGSTRPEAAGVRAITF  248

Query  647  TPDGR  661
             PDGR
Sbjct  249  HPDGR  253


 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 59/120 (49%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  ++ ++F     R  ++GG D +V +W +           H  P+ SI F 
Sbjct  149  IHTYKGHTQGISTIKFTPDG-RWVVSGGFDSAVKVWDLTAGKLMHDFKFHEGPIRSIDFH  207

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   A+ FHP G    SG +D +LK++
Sbjct  208  PLEFLLATGSADKTVKFWDLETFELIGSTRPEAAGVRAITFHPDGRTLFSG-LDESLKVY  266



>ref|XP_010533875.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X2 [Tarenaya hassleriana]
Length=971

 Score =   281 bits (718),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKRGYKLQEF+AH  NVNCLR GKKT R+ +TGGDD +VNLW+IGKPTS  +L GHTSP
Sbjct  1    MAKRGYKLQEFLAHPANVNCLRIGKKTSRLLITGGDDCNVNLWAIGKPTSLMSLCGHTSP  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            V+S+AFDSAE LV AGSSSG+IKLWDLE+ K+++ L+GHRS C+A+EFHPFGEFFASGSM
Sbjct  61   VDSVAFDSAEALVLAGSSSGMIKLWDLEEAKIVQGLTGHRSNCSAVEFHPFGEFFASGSM  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            D+NLKIWDIRKKGCIHTYKGHTRGISTI+F+PDGRWVV
Sbjct  121  DSNLKIWDIRKKGCIHTYKGHTRGISTIKFSPDGRWVV  158


 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 41/148 (28%), Positives = 68/148 (46%), Gaps = 1/148 (1%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +Q    H  N + + F       F +G  D ++ +W I K     T  GHT  + +I F 
Sbjct  93   VQGLTGHRSNCSAVEF-HPFGEFFASGSMDSNLKIWDIRKKGCIHTYKGHTRGISTIKFS  151

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
                 V +G    ++K+WDL   K++     H  +  +++FHP     A+GS D  +K W
Sbjct  152  PDGRWVVSGGLDNVVKVWDLIAGKLLHDFKFHEGHIRSIDFHPLEFLLATGSADRTVKFW  211

Query  578  DIRKKGCIHTYKGHTRGISTIRFTPDGR  661
            D+     I + +    G+ +I F PDG+
Sbjct  212  DLETFELIGSSRPEATGVRSIAFHPDGQ  239


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 31/120 (26%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  ++ ++F     R  ++GG D+ V +W +           H   + SI F 
Sbjct  135  IHTYKGHTRGISTIKFSPD-GRWVVSGGLDNVVKVWDLIAGKLLHDFKFHEGHIRSIDFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   ++ FHP G+    G +D  LK++
Sbjct  194  PLEFLLATGSADRTVKFWDLETFELIGSSRPEATGVRSIAFHPDGQTLFCG-LDDGLKVY  252



>ref|XP_010533874.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Tarenaya hassleriana]
Length=972

 Score =   281 bits (718),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKRGYKLQEF+AH  NVNCLR GKKT R+ +TGGDD +VNLW+IGKPTS  +L GHTSP
Sbjct  1    MAKRGYKLQEFLAHPANVNCLRIGKKTSRLLITGGDDCNVNLWAIGKPTSLMSLCGHTSP  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            V+S+AFDSAE LV AGSSSG+IKLWDLE+ K+++ L+GHRS C+A+EFHPFGEFFASGSM
Sbjct  61   VDSVAFDSAEALVLAGSSSGMIKLWDLEEAKIVQGLTGHRSNCSAVEFHPFGEFFASGSM  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            D+NLKIWDIRKKGCIHTYKGHTRGISTI+F+PDGRWVV
Sbjct  121  DSNLKIWDIRKKGCIHTYKGHTRGISTIKFSPDGRWVV  158


 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 41/148 (28%), Positives = 68/148 (46%), Gaps = 1/148 (1%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +Q    H  N + + F       F +G  D ++ +W I K     T  GHT  + +I F 
Sbjct  93   VQGLTGHRSNCSAVEF-HPFGEFFASGSMDSNLKIWDIRKKGCIHTYKGHTRGISTIKFS  151

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
                 V +G    ++K+WDL   K++     H  +  +++FHP     A+GS D  +K W
Sbjct  152  PDGRWVVSGGLDNVVKVWDLIAGKLLHDFKFHEGHIRSIDFHPLEFLLATGSADRTVKFW  211

Query  578  DIRKKGCIHTYKGHTRGISTIRFTPDGR  661
            D+     I + +    G+ +I F PDG+
Sbjct  212  DLETFELIGSSRPEATGVRSIAFHPDGQ  239


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 31/120 (26%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  ++ ++F     R  ++GG D+ V +W +           H   + SI F 
Sbjct  135  IHTYKGHTRGISTIKFSPD-GRWVVSGGLDNVVKVWDLIAGKLLHDFKFHEGHIRSIDFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   ++ FHP G+    G +D  LK++
Sbjct  194  PLEFLLATGSADRTVKFWDLETFELIGSSRPEATGVRSIAFHPDGQTLFCG-LDDGLKVY  252



>ref|XP_010696578.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Beta vulgaris subsp. vulgaris]
Length=821

 Score =   278 bits (712),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKRGYKLQEFVAHS NVNCLR GKK CR+ LTGGDDH  NLW+IGKPTS  +L GHT+P
Sbjct  1    MAKRGYKLQEFVAHSANVNCLRIGKKACRLLLTGGDDHKANLWAIGKPTSLMSLCGHTTP  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            VES+AFDS E+LV  G+SSG +KLWDL++ KM+RTL+GHRS CT++EFHPFGEFFASGS 
Sbjct  61   VESLAFDSMEVLVLGGASSGTVKLWDLQEAKMVRTLTGHRSNCTSVEFHPFGEFFASGSA  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DT+LKIWDIRKKGCIHTYKGH  GI+TI+FTPDGRWVV
Sbjct  121  DTDLKIWDIRKKGCIHTYKGHNLGINTIKFTPDGRWVV  158


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/125 (30%), Positives = 57/125 (46%), Gaps = 0/125 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D  + +W I K     T  GH   + +I F      V +G    ++K+WDL   
Sbjct  115  FASGSADTDLKIWDIRKKGCIHTYKGHNLGINTIKFTPDGRWVVSGGFDNVVKVWDLTAG  174

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H     +L+FHP     A+GS D  +K WD+     I + +    G+  + F
Sbjct  175  KLLHDFKFHDGPIRSLDFHPLEFLLATGSADRTVKFWDLETFEMIGSTRAEAAGVRALTF  234

Query  647  TPDGR  661
             PDGR
Sbjct  235  HPDGR  239


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 56/120 (47%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  +N ++F     R  ++GG D+ V +W +           H  P+ S+ F 
Sbjct  135  IHTYKGHNLGINTIKFTPDG-RWVVSGGFDNVVKVWDLTAGKLLHDFKFHDGPIRSLDFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  +MI +     +   AL FHP G     G  D N K++
Sbjct  194  PLEFLLATGSADRTVKFWDLETFEMIGSTRAEAAGVRALTFHPDGRTLFCG-YDNNAKVY  252



>ref|XP_010696579.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X2 [Beta vulgaris subsp. vulgaris]
Length=820

 Score =   278 bits (712),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKRGYKLQEFVAHS NVNCLR GKK CR+ LTGGDDH  NLW+IGKPTS  +L GHT+P
Sbjct  1    MAKRGYKLQEFVAHSANVNCLRIGKKACRLLLTGGDDHKANLWAIGKPTSLMSLCGHTTP  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            VES+AFDS E+LV  G+SSG +KLWDL++ KM+RTL+GHRS CT++EFHPFGEFFASGS 
Sbjct  61   VESLAFDSMEVLVLGGASSGTVKLWDLQEAKMVRTLTGHRSNCTSVEFHPFGEFFASGSA  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DT+LKIWDIRKKGCIHTYKGH  GI+TI+FTPDGRWVV
Sbjct  121  DTDLKIWDIRKKGCIHTYKGHNLGINTIKFTPDGRWVV  158


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/125 (30%), Positives = 57/125 (46%), Gaps = 0/125 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D  + +W I K     T  GH   + +I F      V +G    ++K+WDL   
Sbjct  115  FASGSADTDLKIWDIRKKGCIHTYKGHNLGINTIKFTPDGRWVVSGGFDNVVKVWDLTAG  174

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H     +L+FHP     A+GS D  +K WD+     I + +    G+  + F
Sbjct  175  KLLHDFKFHDGPIRSLDFHPLEFLLATGSADRTVKFWDLETFEMIGSTRAEAAGVRALTF  234

Query  647  TPDGR  661
             PDGR
Sbjct  235  HPDGR  239


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 56/120 (47%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  +N ++F     R  ++GG D+ V +W +           H  P+ S+ F 
Sbjct  135  IHTYKGHNLGINTIKFTPDG-RWVVSGGFDNVVKVWDLTAGKLLHDFKFHDGPIRSLDFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  +MI +     +   AL FHP G     G  D N K++
Sbjct  194  PLEFLLATGSADRTVKFWDLETFEMIGSTRAEAAGVRALTFHPDGRTLFCG-YDNNAKVY  252



>ref|XP_010696580.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X3 [Beta vulgaris subsp. vulgaris]
Length=820

 Score =   278 bits (712),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKRGYKLQEFVAHS NVNCLR GKK CR+ LTGGDDH  NLW+IGKPTS  +L GHT+P
Sbjct  1    MAKRGYKLQEFVAHSANVNCLRIGKKACRLLLTGGDDHKANLWAIGKPTSLMSLCGHTTP  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            VES+AFDS E+LV  G+SSG +KLWDL++ KM+RTL+GHRS CT++EFHPFGEFFASGS 
Sbjct  61   VESLAFDSMEVLVLGGASSGTVKLWDLQEAKMVRTLTGHRSNCTSVEFHPFGEFFASGSA  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DT+LKIWDIRKKGCIHTYKGH  GI+TI+FTPDGRWVV
Sbjct  121  DTDLKIWDIRKKGCIHTYKGHNLGINTIKFTPDGRWVV  158


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/125 (30%), Positives = 57/125 (46%), Gaps = 0/125 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D  + +W I K     T  GH   + +I F      V +G    ++K+WDL   
Sbjct  115  FASGSADTDLKIWDIRKKGCIHTYKGHNLGINTIKFTPDGRWVVSGGFDNVVKVWDLTAG  174

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H     +L+FHP     A+GS D  +K WD+     I + +    G+  + F
Sbjct  175  KLLHDFKFHDGPIRSLDFHPLEFLLATGSADRTVKFWDLETFEMIGSTRAEAAGVRALTF  234

Query  647  TPDGR  661
             PDGR
Sbjct  235  HPDGR  239


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 56/120 (47%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  +N ++F     R  ++GG D+ V +W +           H  P+ S+ F 
Sbjct  135  IHTYKGHNLGINTIKFTPDG-RWVVSGGFDNVVKVWDLTAGKLLHDFKFHDGPIRSLDFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  +MI +     +   AL FHP G     G  D N K++
Sbjct  194  PLEFLLATGSADRTVKFWDLETFEMIGSTRAEAAGVRALTFHPDGRTLFCG-YDNNAKVY  252



>ref|XP_010533878.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X4 [Tarenaya hassleriana]
Length=969

 Score =   280 bits (717),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKRGYKLQEF+AH  NVNCLR GKKT R+ +TGGDD +VNLW+IGKPTS  +L GHTSP
Sbjct  1    MAKRGYKLQEFLAHPANVNCLRIGKKTSRLLITGGDDCNVNLWAIGKPTSLMSLCGHTSP  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            V+S+AFDSAE LV AGSSSG+IKLWDLE+ K+++ L+GHRS C+A+EFHPFGEFFASGSM
Sbjct  61   VDSVAFDSAEALVLAGSSSGMIKLWDLEEAKIVQGLTGHRSNCSAVEFHPFGEFFASGSM  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            D+NLKIWDIRKKGCIHTYKGHTRGISTI+F+PDGRWVV
Sbjct  121  DSNLKIWDIRKKGCIHTYKGHTRGISTIKFSPDGRWVV  158


 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 41/148 (28%), Positives = 68/148 (46%), Gaps = 1/148 (1%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +Q    H  N + + F       F +G  D ++ +W I K     T  GHT  + +I F 
Sbjct  93   VQGLTGHRSNCSAVEF-HPFGEFFASGSMDSNLKIWDIRKKGCIHTYKGHTRGISTIKFS  151

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
                 V +G    ++K+WDL   K++     H  +  +++FHP     A+GS D  +K W
Sbjct  152  PDGRWVVSGGLDNVVKVWDLIAGKLLHDFKFHEGHIRSIDFHPLEFLLATGSADRTVKFW  211

Query  578  DIRKKGCIHTYKGHTRGISTIRFTPDGR  661
            D+     I + +    G+ +I F PDG+
Sbjct  212  DLETFELIGSSRPEATGVRSIAFHPDGQ  239


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 31/120 (26%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  ++ ++F     R  ++GG D+ V +W +           H   + SI F 
Sbjct  135  IHTYKGHTRGISTIKFSPD-GRWVVSGGLDNVVKVWDLIAGKLLHDFKFHEGHIRSIDFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   ++ FHP G+    G +D  LK++
Sbjct  194  PLEFLLATGSADRTVKFWDLETFELIGSSRPEATGVRSIAFHPDGQTLFCG-LDDGLKVY  252



>ref|XP_010533877.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X3 [Tarenaya hassleriana]
Length=970

 Score =   280 bits (717),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKRGYKLQEF+AH  NVNCLR GKKT R+ +TGGDD +VNLW+IGKPTS  +L GHTSP
Sbjct  1    MAKRGYKLQEFLAHPANVNCLRIGKKTSRLLITGGDDCNVNLWAIGKPTSLMSLCGHTSP  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            V+S+AFDSAE LV AGSSSG+IKLWDLE+ K+++ L+GHRS C+A+EFHPFGEFFASGSM
Sbjct  61   VDSVAFDSAEALVLAGSSSGMIKLWDLEEAKIVQGLTGHRSNCSAVEFHPFGEFFASGSM  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            D+NLKIWDIRKKGCIHTYKGHTRGISTI+F+PDGRWVV
Sbjct  121  DSNLKIWDIRKKGCIHTYKGHTRGISTIKFSPDGRWVV  158


 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 41/148 (28%), Positives = 68/148 (46%), Gaps = 1/148 (1%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +Q    H  N + + F       F +G  D ++ +W I K     T  GHT  + +I F 
Sbjct  93   VQGLTGHRSNCSAVEF-HPFGEFFASGSMDSNLKIWDIRKKGCIHTYKGHTRGISTIKFS  151

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
                 V +G    ++K+WDL   K++     H  +  +++FHP     A+GS D  +K W
Sbjct  152  PDGRWVVSGGLDNVVKVWDLIAGKLLHDFKFHEGHIRSIDFHPLEFLLATGSADRTVKFW  211

Query  578  DIRKKGCIHTYKGHTRGISTIRFTPDGR  661
            D+     I + +    G+ +I F PDG+
Sbjct  212  DLETFELIGSSRPEATGVRSIAFHPDGQ  239


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 31/120 (26%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  ++ ++F     R  ++GG D+ V +W +           H   + SI F 
Sbjct  135  IHTYKGHTRGISTIKFSPD-GRWVVSGGLDNVVKVWDLIAGKLLHDFKFHEGHIRSIDFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   ++ FHP G+    G +D  LK++
Sbjct  194  PLEFLLATGSADRTVKFWDLETFELIGSSRPEATGVRSIAFHPDGQTLFCG-LDDGLKVY  252



>ref|XP_002521412.1| katanin P80 subunit, putative [Ricinus communis]
 gb|EEF40902.1| katanin P80 subunit, putative [Ricinus communis]
Length=936

 Score =   278 bits (712),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 127/169 (75%), Positives = 145/169 (86%), Gaps = 11/169 (7%)
 Frame = +2

Query  197  MAKRGYKL-----------QEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPT  343
            MAKRGYKL           +EFVAHS NVNCL  GKKTCRM++TGGDD+ VNLW+IGKPT
Sbjct  1    MAKRGYKLRILFSLTEMKLEEFVAHSSNVNCLNIGKKTCRMYITGGDDYKVNLWAIGKPT  60

Query  344  STSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFH  523
            S  +L GHTSPVES+AFD+AE+LV  G+S+G+IKLWDLE+ KM+RTL+GHRS CTA+EFH
Sbjct  61   SLMSLCGHTSPVESLAFDTAEVLVLGGASTGVIKLWDLEEAKMVRTLTGHRSNCTAIEFH  120

Query  524  PFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            PFGEFFASGS DTNLK+WDIRKKG +HTYKGHTRGISTIRFTPDGRWVV
Sbjct  121  PFGEFFASGSADTNLKLWDIRKKGTLHTYKGHTRGISTIRFTPDGRWVV  169


 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 43/148 (29%), Positives = 67/148 (45%), Gaps = 1/148 (1%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            ++    H  N   + F       F +G  D ++ LW I K  +  T  GHT  + +I F 
Sbjct  104  VRTLTGHRSNCTAIEF-HPFGEFFASGSADTNLKLWDIRKKGTLHTYKGHTRGISTIRFT  162

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
                 V +G    ++K+WDL   K++     H  +  +L+FHP     A+GS D  +K W
Sbjct  163  PDGRWVVSGGLDNVVKVWDLTAGKLLHDFKFHEGHIRSLDFHPLEFLLATGSADRTVKFW  222

Query  578  DIRKKGCIHTYKGHTRGISTIRFTPDGR  661
            D+     I + +    G+  I F PDGR
Sbjct  223  DLETFELIGSARPEATGVRAISFHPDGR  250


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/120 (28%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            L  +  H+  ++ +RF     R  ++GG D+ V +W +           H   + S+ F 
Sbjct  146  LHTYKGHTRGISTIRFTPDG-RWVVSGGLDNVVKVWDLTAGKLLHDFKFHEGHIRSLDFH  204

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   A+ FHP G     G +D +LK++
Sbjct  205  PLEFLLATGSADRTVKFWDLETFELIGSARPEATGVRAISFHPDGRTLFCG-LDDSLKVY  263



>ref|XP_003593480.1| Katanin p80 WD40-containing subunit B1 [Medicago truncatula]
Length=1131

 Score =   280 bits (715),  Expect = 2e-83, Method: Composition-based stats.
 Identities = 126/178 (71%), Positives = 147/178 (83%), Gaps = 20/178 (11%)
 Frame = +2

Query  197  MAKRGYKL--------------------QEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSV  316
            MAKRGYK+                    +EFVAHS NVNCL  GKK CR+F+TGGDDH V
Sbjct  1    MAKRGYKIRILFYFLINVLCLMKFQLTSEEFVAHSSNVNCLNIGKKACRLFVTGGDDHKV  60

Query  317  NLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHR  496
            NLW+IGKPTS S+LSGHTSPVES+ FDS E+LV AGS+SG+I+LWDLE++KM+RT++GHR
Sbjct  61   NLWTIGKPTSLSSLSGHTSPVESVTFDSGEVLVLAGSTSGVIRLWDLEESKMVRTVAGHR  120

Query  497  SYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            S CT++EFHPFGEFFASGSMDTNLKIWD RKKGCIHTYKGH++GISTI+FTPDGRWVV
Sbjct  121  SNCTSVEFHPFGEFFASGSMDTNLKIWDNRKKGCIHTYKGHSQGISTIKFTPDGRWVV  178


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 37/125 (30%), Positives = 62/125 (50%), Gaps = 0/125 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W   K     T  GH+  + +I F      V +G    ++K+WDL   
Sbjct  135  FASGSMDTNLKIWDNRKKGCIHTYKGHSQGISTIKFTPDGRWVVSGGFDNVVKVWDLTAG  194

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++   + H  + T+L+FHP     A+GS D  +K WD+     I + +    G+ ++ F
Sbjct  195  KLLHDFNFHDGHITSLDFHPLEFLLATGSADRTVKFWDLESFELIGSARREATGVRSMAF  254

Query  647  TPDGR  661
             PDGR
Sbjct  255  HPDGR  259


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 32/120 (27%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  HS  ++ ++F     R  ++GG D+ V +W +         + H   + S+ F 
Sbjct  155  IHTYKGHSQGISTIKFTPDG-RWVVSGGFDNVVKVWDLTAGKLLHDFNFHDGHITSLDFH  213

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   ++ FHP G    SG  D  LK++
Sbjct  214  PLEFLLATGSADRTVKFWDLESFELIGSARREATGVRSMAFHPDGRTLFSGHED-GLKVF  272



>gb|EYU24725.1| hypothetical protein MIMGU_mgv1a018894mg [Erythranthe guttata]
Length=184

 Score =   258 bits (659),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 112/156 (72%), Positives = 141/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS +VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +  +LSGH+S ++
Sbjct  6    KRAYKLQEFVAHSASVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHSSGID  65

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++FDS+E+LVAAG++SG IKLWDLE+ K++RTL+GHRS C +L+FHPFGEFFASGS+DT
Sbjct  66   SVSFDSSEVLVAAGAASGTIKLWDLEEAKILRTLTGHRSNCISLDFHPFGEFFASGSLDT  125

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NL IWDIR+KGCIHTYKGHTRG++TIRFTPDGRWVV
Sbjct  126  NLTIWDIRRKGCIHTYKGHTRGVNTIRFTPDGRWVV  161



>ref|XP_008350805.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
[Malus domestica]
 ref|XP_008350806.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
[Malus domestica]
Length=203

 Score =   257 bits (657),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS  VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +  +LSGHTS ++
Sbjct  4    KRAYKLQEFVAHSAAVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNALLSLSGHTSGID  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++FDS+E+LVAAG++SG IKLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DT
Sbjct  64   SVSFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIRKKGCIHTYKGHTRG++ IRFTPDGRWVV
Sbjct  124  NLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVV  159


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 38/90 (42%), Gaps = 0/90 (0%)
 Frame = +2

Query  281  RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLE  460
              F +G  D ++ +W I K     T  GHT  V +I F      V +      +KLWDL 
Sbjct  114  EFFASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSCGEDNTVKLWDLT  173

Query  461  DTKMIRTLSGHRSYCTALEFHPFGEFFASG  550
              KM+     H      ++FHP     A+G
Sbjct  174  AGKMLHDFKCHEGQVQCIDFHPHEFLLATG  203



>ref|XP_010473326.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X2 [Camelina sativa]
Length=1229

 Score =   278 bits (711),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKRGYKLQEF+AHS NVNCL  GKKT R+F+TGGDD+ VNLW+IGKPTS  +L GHTS 
Sbjct  1    MAKRGYKLQEFLAHSANVNCLSIGKKTSRLFITGGDDYKVNLWAIGKPTSLMSLCGHTSA  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            V+S+AFDSAE+LV AG+SSG+IKLWD+E+ KM+R  +GHRS C+A+EFHPFGEF ASGS 
Sbjct  61   VDSVAFDSAEVLVLAGASSGVIKLWDVEEAKMVRAFTGHRSNCSAVEFHPFGEFLASGSS  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            D NLKIWDIRKKGCI TYKGHTRGI+TIRFTPDGRWVV
Sbjct  121  DANLKIWDIRKKGCIQTYKGHTRGINTIRFTPDGRWVV  158


 Score = 78.2 bits (191),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 69/148 (47%), Gaps = 1/148 (1%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            ++ F  H  N + + F         +G  D ++ +W I K     T  GHT  + +I F 
Sbjct  93   VRAFTGHRSNCSAVEF-HPFGEFLASGSSDANLKIWDIRKKGCIQTYKGHTRGINTIRFT  151

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
                 V +G    ++K+WDL   K++     H    ++L+FHP     A+GS D  +K W
Sbjct  152  PDGRWVVSGGLDNVVKVWDLTAGKLLHEFKFHEGPISSLDFHPLEFLLATGSADRTVKFW  211

Query  578  DIRKKGCIHTYKGHTRGISTIRFTPDGR  661
            D+     I + +    G+ +I+F PDGR
Sbjct  212  DLETFELIGSTRPEATGVRSIKFHPDGR  239


 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 60/120 (50%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +Q +  H+  +N +RF     R  ++GG D+ V +W +           H  P+ S+ F 
Sbjct  135  IQTYKGHTRGINTIRFTPD-GRWVVSGGLDNVVKVWDLTAGKLLHEFKFHEGPISSLDFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   +++FHP G     G +D +LK++
Sbjct  194  PLEFLLATGSADRTVKFWDLETFELIGSTRPEATGVRSIKFHPDGRTLFCG-LDDSLKVY  252



>ref|XP_010473325.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Camelina sativa]
Length=1231

 Score =   278 bits (711),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKRGYKLQEF+AHS NVNCL  GKKT R+F+TGGDD+ VNLW+IGKPTS  +L GHTS 
Sbjct  1    MAKRGYKLQEFLAHSANVNCLSIGKKTSRLFITGGDDYKVNLWAIGKPTSLMSLCGHTSA  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            V+S+AFDSAE+LV AG+SSG+IKLWD+E+ KM+R  +GHRS C+A+EFHPFGEF ASGS 
Sbjct  61   VDSVAFDSAEVLVLAGASSGVIKLWDVEEAKMVRAFTGHRSNCSAVEFHPFGEFLASGSS  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            D NLKIWDIRKKGCI TYKGHTRGI+TIRFTPDGRWVV
Sbjct  121  DANLKIWDIRKKGCIQTYKGHTRGINTIRFTPDGRWVV  158


 Score = 78.2 bits (191),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 69/148 (47%), Gaps = 1/148 (1%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            ++ F  H  N + + F         +G  D ++ +W I K     T  GHT  + +I F 
Sbjct  93   VRAFTGHRSNCSAVEF-HPFGEFLASGSSDANLKIWDIRKKGCIQTYKGHTRGINTIRFT  151

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
                 V +G    ++K+WDL   K++     H    ++L+FHP     A+GS D  +K W
Sbjct  152  PDGRWVVSGGLDNVVKVWDLTAGKLLHEFKFHEGPISSLDFHPLEFLLATGSADRTVKFW  211

Query  578  DIRKKGCIHTYKGHTRGISTIRFTPDGR  661
            D+     I + +    G+ +I+F PDGR
Sbjct  212  DLETFELIGSTRPEATGVRSIKFHPDGR  239


 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 60/120 (50%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +Q +  H+  +N +RF     R  ++GG D+ V +W +           H  P+ S+ F 
Sbjct  135  IQTYKGHTRGINTIRFTPD-GRWVVSGGLDNVVKVWDLTAGKLLHEFKFHEGPISSLDFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   +++FHP G     G +D +LK++
Sbjct  194  PLEFLLATGSADRTVKFWDLETFELIGSTRPEATGVRSIKFHPDGRTLFCG-LDDSLKVY  252



>ref|XP_011087019.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
[Sesamum indicum]
Length=938

 Score =   276 bits (706),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 126/157 (80%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKR YKLQEFVAH+GNVNCL FG+K CR+F+TGGDD  VNLWSIGK  S  +LSGHTSP
Sbjct  1    MAKRRYKLQEFVAHAGNVNCLNFGRKNCRLFITGGDDRKVNLWSIGKAASVMSLSGHTSP  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            V S  FDSAE LV AGSSSG+IKLWD+ + K++RTL GHRSYCTA+EFHPFGEFF+SGSM
Sbjct  61   VVSAGFDSAEELVIAGSSSGVIKLWDMAERKIVRTLFGHRSYCTAVEFHPFGEFFSSGSM  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV  667
            DTNLKIWDIRKKGCIHTYKGHT GISTIRF+PDGRWV
Sbjct  121  DTNLKIWDIRKKGCIHTYKGHTGGISTIRFSPDGRWV  157


 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 63/127 (50%), Gaps = 0/127 (0%)
 Frame = +2

Query  281  RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLE  460
              F +G  D ++ +W I K     T  GHT  + +I F      VA+G    ++K+WDL 
Sbjct  113  EFFSSGSMDTNLKIWDIRKKGCIHTYKGHTGGISTIRFSPDGRWVASGGFDNVVKVWDLT  172

Query  461  DTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTI  640
              K++     H+ +   +EFHP     A+GS D  +K WD+ K   I + K    G+ ++
Sbjct  173  AGKLLHNFKLHKGHVCTIEFHPLEFLLATGSADHTVKFWDLEKFEMIGSAKREATGVRSM  232

Query  641  RFTPDGR  661
             F PDGR
Sbjct  233  TFHPDGR  239


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+G ++ +RF     R   +GG D+ V +W +           H   V +I F 
Sbjct  135  IHTYKGHTGGISTIRFSPDG-RWVASGGFDNVVKVWDLTAGKLLHNFKLHKGHVCTIEFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  +MI +     +   ++ FHP G     G +D +LK++
Sbjct  194  PLEFLLATGSADHTVKFWDLEKFEMIGSAKREATGVRSMTFHPDGRSLFCG-LDDSLKVY  252



>ref|XP_010418088.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Camelina sativa]
Length=1208

 Score =   278 bits (710),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKRGYKLQEF+AHS NVNCL  GKKT R+F+TGGDD+ VNLW+IGKPT+  +L GHTS 
Sbjct  1    MAKRGYKLQEFLAHSANVNCLSIGKKTSRLFITGGDDYKVNLWAIGKPTNLMSLCGHTSA  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            V+S+AFDSAE+LV AG+SSG+IKLWD+E+ KM+R  +GHRS C+A+EFHPFGEF ASGS 
Sbjct  61   VDSVAFDSAEVLVLAGASSGVIKLWDVEEAKMVRAFTGHRSNCSAVEFHPFGEFLASGST  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            D NLKIWDIRKKGCI TYKGHTRGI+TIRFTPDGRWVV
Sbjct  121  DANLKIWDIRKKGCIQTYKGHTRGINTIRFTPDGRWVV  158


 Score = 74.7 bits (182),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 68/148 (46%), Gaps = 1/148 (1%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            ++ F  H  N + + F         +G  D ++ +W I K     T  GHT  + +I F 
Sbjct  93   VRAFTGHRSNCSAVEF-HPFGEFLASGSTDANLKIWDIRKKGCIQTYKGHTRGINTIRFT  151

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
                 V +G    ++K+WDL   K +     H    ++L+FHP     A+GS D  +K W
Sbjct  152  PDGRWVVSGGLDNVVKVWDLTAGKPLHESKFHEGPISSLDFHPLEFLLATGSADRTVKFW  211

Query  578  DIRKKGCIHTYKGHTRGISTIRFTPDGR  661
            D+     I + +    G+ +I+F PDGR
Sbjct  212  DLETFELIGSTRPEATGVRSIKFHPDGR  239


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 64/122 (52%), Gaps = 6/122 (5%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSI--GKPTSTSTLSGHTSPVESIA  391
            +Q +  H+  +N +RF     R  ++GG D+ V +W +  GKP   S    H  P+ S+ 
Sbjct  135  IQTYKGHTRGINTIRFTPD-GRWVVSGGLDNVVKVWDLTAGKPLHESKF--HEGPISSLD  191

Query  392  FDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLK  571
            F   E L+A GS+   +K WDLE  ++I +     +   +++FHP G     G +D +LK
Sbjct  192  FHPLEFLLATGSADRTVKFWDLETFELIGSTRPEATGVRSIKFHPDGRTLFCG-LDDSLK  250

Query  572  IW  577
            ++
Sbjct  251  VY  252



>ref|XP_010430118.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
[Camelina sativa]
Length=1180

 Score =   277 bits (709),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKRGYKLQEF+AHS NVNCL  GKKT R+F+TGGDD+ VNLW+IGKPTS  +L GHTS 
Sbjct  1    MAKRGYKLQEFLAHSANVNCLSIGKKTSRLFITGGDDYKVNLWAIGKPTSLMSLCGHTSA  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            V+S+AFDSAE+LV AG+SSG+IKLWD+E+ KM+R  +GHRS C+A+EFHPFGEF ASGS 
Sbjct  61   VDSVAFDSAEVLVLAGASSGVIKLWDVEEAKMVRAFTGHRSNCSAVEFHPFGEFLASGSS  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            D NLKIWDIRKKGCI TYKGHTRGI+TIRFTPDGRWVV
Sbjct  121  DANLKIWDIRKKGCIQTYKGHTRGINTIRFTPDGRWVV  158


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 69/148 (47%), Gaps = 1/148 (1%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            ++ F  H  N + + F         +G  D ++ +W I K     T  GHT  + +I F 
Sbjct  93   VRAFTGHRSNCSAVEF-HPFGEFLASGSSDANLKIWDIRKKGCIQTYKGHTRGINTIRFT  151

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
                 V +G    ++K+WDL   K++     H    ++L+FHP     A+GS D  +K W
Sbjct  152  PDGRWVVSGGLDNVVKVWDLTAGKLLHEFKFHEGPISSLDFHPLEFLLATGSADRTVKFW  211

Query  578  DIRKKGCIHTYKGHTRGISTIRFTPDGR  661
            D+     I + +    G+ +I+F PDGR
Sbjct  212  DLETFELIGSTRPEATGVRSIKFHPDGR  239


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 60/120 (50%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +Q +  H+  +N +RF     R  ++GG D+ V +W +           H  P+ S+ F 
Sbjct  135  IQTYKGHTRGINTIRFTPD-GRWVVSGGLDNVVKVWDLTAGKLLHEFKFHEGPISSLDFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   +++FHP G     G +D +LK++
Sbjct  194  PLEFLLATGSADRTVKFWDLETFELIGSTRPEATGVRSIKFHPDGRTLFCG-LDDSLKVY  252



>ref|XP_010418089.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X2 [Camelina sativa]
Length=1206

 Score =   277 bits (709),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKRGYKLQEF+AHS NVNCL  GKKT R+F+TGGDD+ VNLW+IGKPT+  +L GHTS 
Sbjct  1    MAKRGYKLQEFLAHSANVNCLSIGKKTSRLFITGGDDYKVNLWAIGKPTNLMSLCGHTSA  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            V+S+AFDSAE+LV AG+SSG+IKLWD+E+ KM+R  +GHRS C+A+EFHPFGEF ASGS 
Sbjct  61   VDSVAFDSAEVLVLAGASSGVIKLWDVEEAKMVRAFTGHRSNCSAVEFHPFGEFLASGST  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            D NLKIWDIRKKGCI TYKGHTRGI+TIRFTPDGRWVV
Sbjct  121  DANLKIWDIRKKGCIQTYKGHTRGINTIRFTPDGRWVV  158


 Score = 74.7 bits (182),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 68/148 (46%), Gaps = 1/148 (1%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            ++ F  H  N + + F         +G  D ++ +W I K     T  GHT  + +I F 
Sbjct  93   VRAFTGHRSNCSAVEF-HPFGEFLASGSTDANLKIWDIRKKGCIQTYKGHTRGINTIRFT  151

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
                 V +G    ++K+WDL   K +     H    ++L+FHP     A+GS D  +K W
Sbjct  152  PDGRWVVSGGLDNVVKVWDLTAGKPLHESKFHEGPISSLDFHPLEFLLATGSADRTVKFW  211

Query  578  DIRKKGCIHTYKGHTRGISTIRFTPDGR  661
            D+     I + +    G+ +I+F PDGR
Sbjct  212  DLETFELIGSTRPEATGVRSIKFHPDGR  239


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 64/122 (52%), Gaps = 6/122 (5%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSI--GKPTSTSTLSGHTSPVESIA  391
            +Q +  H+  +N +RF     R  ++GG D+ V +W +  GKP   S    H  P+ S+ 
Sbjct  135  IQTYKGHTRGINTIRFTPD-GRWVVSGGLDNVVKVWDLTAGKPLHESKF--HEGPISSLD  191

Query  392  FDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLK  571
            F   E L+A GS+   +K WDLE  ++I +     +   +++FHP G     G +D +LK
Sbjct  192  FHPLEFLLATGSADRTVKFWDLETFELIGSTRPEATGVRSIKFHPDGRTLFCG-LDDSLK  250

Query  572  IW  577
            ++
Sbjct  251  VY  252



>ref|XP_006594334.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X2 [Glycine max]
Length=778

 Score =   273 bits (698),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAK GYKLQEF AHSGNVNCL+ G+K  R+F+TGGDDHSVNLW IGKPTS  +L GHTS 
Sbjct  1    MAKTGYKLQEFAAHSGNVNCLKLGRKANRLFITGGDDHSVNLWMIGKPTSLMSLCGHTSS  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            VES+ FDSAE+L+ +G+SSG+IKLWDLE+ KM+RTL+GHR  CTA+EFHPFGEFFASGS+
Sbjct  61   VESVTFDSAEVLILSGASSGVIKLWDLEEAKMVRTLTGHRLNCTAVEFHPFGEFFASGSL  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DTNL IWDIRKKGCI TYKGH++GISTI+F+PDGRWVV
Sbjct  121  DTNLNIWDIRKKGCIQTYKGHSQGISTIKFSPDGRWVV  158


 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 38/127 (30%), Positives = 62/127 (49%), Gaps = 0/127 (0%)
 Frame = +2

Query  281  RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLE  460
              F +G  D ++N+W I K     T  GH+  + +I F      V +G    ++K+WDL 
Sbjct  113  EFFASGSLDTNLNIWDIRKKGCIQTYKGHSQGISTIKFSPDGRWVVSGGFDNVVKVWDLT  172

Query  461  DTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTI  640
              K++     H  +  +L+FHP     A+GS D  +K WD+     I + +    G+ +I
Sbjct  173  GGKLLHDFKFHEGHIRSLDFHPLEFLMATGSADRTVKFWDLETFELIGSTRHEVSGVRSI  232

Query  641  RFTPDGR  661
             F PDG+
Sbjct  233  AFHPDGQ  239


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/120 (28%), Positives = 59/120 (49%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +Q +  HS  ++ ++F     R  ++GG D+ V +W +           H   + S+ F 
Sbjct  135  IQTYKGHSQGISTIKFSPDG-RWVVSGGFDNVVKVWDLTGGKLLHDFKFHEGHIRSLDFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     S   ++ FHP G+   +G  D+ LK++
Sbjct  194  PLEFLMATGSADRTVKFWDLETFELIGSTRHEVSGVRSIAFHPDGQILFAGFEDS-LKVY  252



>ref|NP_176316.4| protein DWD hypersensitive to ABA 3 [Arabidopsis thaliana]
 gb|AEE33803.1| transducin/WD-40 repeat-containing protein [Arabidopsis thaliana]
Length=1181

 Score =   277 bits (709),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKRGYKLQEF+AHS NVNCL  GKKT R+F+TGGDD+ VNLW+IGKPTS  +L GHTS 
Sbjct  1    MAKRGYKLQEFLAHSANVNCLSIGKKTSRLFITGGDDYKVNLWAIGKPTSLMSLCGHTSA  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            V+S+AFDSAE+LV AG+SSG+IKLWD+E+ KM+R  +GHRS C+A+EFHPFGEF ASGS 
Sbjct  61   VDSVAFDSAEVLVLAGASSGVIKLWDVEEAKMVRAFTGHRSNCSAVEFHPFGEFLASGSS  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            D NLKIWDIRKKGCI TYKGH+RGISTIRFTPDGRWVV
Sbjct  121  DANLKIWDIRKKGCIQTYKGHSRGISTIRFTPDGRWVV  158


 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/148 (28%), Positives = 68/148 (46%), Gaps = 1/148 (1%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            ++ F  H  N + + F         +G  D ++ +W I K     T  GH+  + +I F 
Sbjct  93   VRAFTGHRSNCSAVEF-HPFGEFLASGSSDANLKIWDIRKKGCIQTYKGHSRGISTIRFT  151

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
                 V +G    ++K+WDL   K++     H     +L+FHP     A+GS D  +K W
Sbjct  152  PDGRWVVSGGLDNVVKVWDLTAGKLLHEFKFHEGPIRSLDFHPLEFLLATGSADRTVKFW  211

Query  578  DIRKKGCIHTYKGHTRGISTIRFTPDGR  661
            D+     I + +    G+ +I+F PDGR
Sbjct  212  DLETFELIGSTRPEATGVRSIKFHPDGR  239


 Score = 58.9 bits (141),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 60/120 (50%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +Q +  HS  ++ +RF     R  ++GG D+ V +W +           H  P+ S+ F 
Sbjct  135  IQTYKGHSRGISTIRFTPD-GRWVVSGGLDNVVKVWDLTAGKLLHEFKFHEGPIRSLDFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   +++FHP G     G +D +LK++
Sbjct  194  PLEFLLATGSADRTVKFWDLETFELIGSTRPEATGVRSIKFHPDGRTLFCG-LDDSLKVY  252



>ref|NP_001185277.1| protein DWD hypersensitive to ABA 3 [Arabidopsis thaliana]
 gb|AEE33804.1| transducin/WD-40 repeat-containing protein [Arabidopsis thaliana]
Length=1179

 Score =   277 bits (708),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKRGYKLQEF+AHS NVNCL  GKKT R+F+TGGDD+ VNLW+IGKPTS  +L GHTS 
Sbjct  1    MAKRGYKLQEFLAHSANVNCLSIGKKTSRLFITGGDDYKVNLWAIGKPTSLMSLCGHTSA  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            V+S+AFDSAE+LV AG+SSG+IKLWD+E+ KM+R  +GHRS C+A+EFHPFGEF ASGS 
Sbjct  61   VDSVAFDSAEVLVLAGASSGVIKLWDVEEAKMVRAFTGHRSNCSAVEFHPFGEFLASGSS  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            D NLKIWDIRKKGCI TYKGH+RGISTIRFTPDGRWVV
Sbjct  121  DANLKIWDIRKKGCIQTYKGHSRGISTIRFTPDGRWVV  158


 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/148 (28%), Positives = 68/148 (46%), Gaps = 1/148 (1%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            ++ F  H  N + + F         +G  D ++ +W I K     T  GH+  + +I F 
Sbjct  93   VRAFTGHRSNCSAVEF-HPFGEFLASGSSDANLKIWDIRKKGCIQTYKGHSRGISTIRFT  151

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
                 V +G    ++K+WDL   K++     H     +L+FHP     A+GS D  +K W
Sbjct  152  PDGRWVVSGGLDNVVKVWDLTAGKLLHEFKFHEGPIRSLDFHPLEFLLATGSADRTVKFW  211

Query  578  DIRKKGCIHTYKGHTRGISTIRFTPDGR  661
            D+     I + +    G+ +I+F PDGR
Sbjct  212  DLETFELIGSTRPEATGVRSIKFHPDGR  239


 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 60/120 (50%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +Q +  HS  ++ +RF     R  ++GG D+ V +W +           H  P+ S+ F 
Sbjct  135  IQTYKGHSRGISTIRFTPD-GRWVVSGGLDNVVKVWDLTAGKLLHEFKFHEGPIRSLDFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   +++FHP G     G +D +LK++
Sbjct  194  PLEFLLATGSADRTVKFWDLETFELIGSTRPEATGVRSIKFHPDGRTLFCG-LDDSLKVY  252



>ref|XP_003541552.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Glycine max]
Length=814

 Score =   273 bits (698),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAK GYKLQEF AHSGNVNCL+ G+K  R+F+TGGDDHSVNLW IGKPTS  +L GHTS 
Sbjct  1    MAKTGYKLQEFAAHSGNVNCLKLGRKANRLFITGGDDHSVNLWMIGKPTSLMSLCGHTSS  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            VES+ FDSAE+L+ +G+SSG+IKLWDLE+ KM+RTL+GHR  CTA+EFHPFGEFFASGS+
Sbjct  61   VESVTFDSAEVLILSGASSGVIKLWDLEEAKMVRTLTGHRLNCTAVEFHPFGEFFASGSL  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DTNL IWDIRKKGCI TYKGH++GISTI+F+PDGRWVV
Sbjct  121  DTNLNIWDIRKKGCIQTYKGHSQGISTIKFSPDGRWVV  158


 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 38/127 (30%), Positives = 62/127 (49%), Gaps = 0/127 (0%)
 Frame = +2

Query  281  RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLE  460
              F +G  D ++N+W I K     T  GH+  + +I F      V +G    ++K+WDL 
Sbjct  113  EFFASGSLDTNLNIWDIRKKGCIQTYKGHSQGISTIKFSPDGRWVVSGGFDNVVKVWDLT  172

Query  461  DTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTI  640
              K++     H  +  +L+FHP     A+GS D  +K WD+     I + +    G+ +I
Sbjct  173  GGKLLHDFKFHEGHIRSLDFHPLEFLMATGSADRTVKFWDLETFELIGSTRHEVSGVRSI  232

Query  641  RFTPDGR  661
             F PDG+
Sbjct  233  AFHPDGQ  239


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/120 (28%), Positives = 59/120 (49%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +Q +  HS  ++ ++F     R  ++GG D+ V +W +           H   + S+ F 
Sbjct  135  IQTYKGHSQGISTIKFSPDG-RWVVSGGFDNVVKVWDLTGGKLLHDFKFHEGHIRSLDFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     S   ++ FHP G+   +G  D+ LK++
Sbjct  194  PLEFLMATGSADRTVKFWDLETFELIGSTRHEVSGVRSIAFHPDGQILFAGFEDS-LKVY  252



>ref|XP_010547289.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Tarenaya hassleriana]
Length=980

 Score =   275 bits (704),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKRGYKLQEF+AHS NVNCL  GKKT R+ +TGGDD +VNLW+IGKPTS  +L GHTSP
Sbjct  1    MAKRGYKLQEFLAHSANVNCLSIGKKTSRLLITGGDDCNVNLWAIGKPTSLMSLCGHTSP  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            V+S+ FD +E+ V AG+SSG+IKLW+LE+ KM+R L+GHRS C+A+EFHPFGEFFASGSM
Sbjct  61   VDSVDFDPSEVSVLAGASSGVIKLWNLEEAKMVRALTGHRSNCSAVEFHPFGEFFASGSM  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DTNL+IWDIRKKGCIHTYKGHTRGI+TI+FTPDGRWVV
Sbjct  121  DTNLRIWDIRKKGCIHTYKGHTRGINTIKFTPDGRWVV  158


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 68/148 (46%), Gaps = 1/148 (1%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            ++    H  N + + F       F +G  D ++ +W I K     T  GHT  + +I F 
Sbjct  93   VRALTGHRSNCSAVEF-HPFGEFFASGSMDTNLRIWDIRKKGCIHTYKGHTRGINTIKFT  151

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
                 V +G    ++K+WDL   K++     H  +  +L+FHP     A+GS D  +K W
Sbjct  152  PDGRWVVSGGLDNVVKVWDLTAGKLLHDFKFHEGHIRSLDFHPLEFLLATGSADRTVKFW  211

Query  578  DIRKKGCIHTYKGHTRGISTIRFTPDGR  661
            D+     I + +    G+ +I F PDGR
Sbjct  212  DLETFELIGSSRPEATGVRSIAFHPDGR  239


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 31/120 (26%), Positives = 56/120 (47%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  +N ++F     R  ++GG D+ V +W +           H   + S+ F 
Sbjct  135  IHTYKGHTRGINTIKF-TPDGRWVVSGGLDNVVKVWDLTAGKLLHDFKFHEGHIRSLDFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   ++ FHP G     G +D  LK++
Sbjct  194  PLEFLLATGSADRTVKFWDLETFELIGSSRPEATGVRSIAFHPDGRTLFCG-LDDGLKVY  252



>ref|XP_010547296.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X2 [Tarenaya hassleriana]
Length=979

 Score =   275 bits (704),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKRGYKLQEF+AHS NVNCL  GKKT R+ +TGGDD +VNLW+IGKPTS  +L GHTSP
Sbjct  1    MAKRGYKLQEFLAHSANVNCLSIGKKTSRLLITGGDDCNVNLWAIGKPTSLMSLCGHTSP  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            V+S+ FD +E+ V AG+SSG+IKLW+LE+ KM+R L+GHRS C+A+EFHPFGEFFASGSM
Sbjct  61   VDSVDFDPSEVSVLAGASSGVIKLWNLEEAKMVRALTGHRSNCSAVEFHPFGEFFASGSM  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DTNL+IWDIRKKGCIHTYKGHTRGI+TI+FTPDGRWVV
Sbjct  121  DTNLRIWDIRKKGCIHTYKGHTRGINTIKFTPDGRWVV  158


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 68/148 (46%), Gaps = 1/148 (1%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            ++    H  N + + F       F +G  D ++ +W I K     T  GHT  + +I F 
Sbjct  93   VRALTGHRSNCSAVEF-HPFGEFFASGSMDTNLRIWDIRKKGCIHTYKGHTRGINTIKFT  151

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
                 V +G    ++K+WDL   K++     H  +  +L+FHP     A+GS D  +K W
Sbjct  152  PDGRWVVSGGLDNVVKVWDLTAGKLLHDFKFHEGHIRSLDFHPLEFLLATGSADRTVKFW  211

Query  578  DIRKKGCIHTYKGHTRGISTIRFTPDGR  661
            D+     I + +    G+ +I F PDGR
Sbjct  212  DLETFELIGSSRPEATGVRSIAFHPDGR  239


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 31/120 (26%), Positives = 56/120 (47%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  +N ++F     R  ++GG D+ V +W +           H   + S+ F 
Sbjct  135  IHTYKGHTRGINTIKF-TPDGRWVVSGGLDNVVKVWDLTAGKLLHDFKFHEGHIRSLDFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   ++ FHP G     G +D  LK++
Sbjct  194  PLEFLLATGSADRTVKFWDLETFELIGSSRPEATGVRSIAFHPDGRTLFCG-LDDGLKVY  252



>ref|XP_010547304.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X3 [Tarenaya hassleriana]
Length=978

 Score =   275 bits (703),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKRGYKLQEF+AHS NVNCL  GKKT R+ +TGGDD +VNLW+IGKPTS  +L GHTSP
Sbjct  1    MAKRGYKLQEFLAHSANVNCLSIGKKTSRLLITGGDDCNVNLWAIGKPTSLMSLCGHTSP  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            V+S+ FD +E+ V AG+SSG+IKLW+LE+ KM+R L+GHRS C+A+EFHPFGEFFASGSM
Sbjct  61   VDSVDFDPSEVSVLAGASSGVIKLWNLEEAKMVRALTGHRSNCSAVEFHPFGEFFASGSM  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DTNL+IWDIRKKGCIHTYKGHTRGI+TI+FTPDGRWVV
Sbjct  121  DTNLRIWDIRKKGCIHTYKGHTRGINTIKFTPDGRWVV  158


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 68/148 (46%), Gaps = 1/148 (1%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            ++    H  N + + F       F +G  D ++ +W I K     T  GHT  + +I F 
Sbjct  93   VRALTGHRSNCSAVEF-HPFGEFFASGSMDTNLRIWDIRKKGCIHTYKGHTRGINTIKFT  151

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
                 V +G    ++K+WDL   K++     H  +  +L+FHP     A+GS D  +K W
Sbjct  152  PDGRWVVSGGLDNVVKVWDLTAGKLLHDFKFHEGHIRSLDFHPLEFLLATGSADRTVKFW  211

Query  578  DIRKKGCIHTYKGHTRGISTIRFTPDGR  661
            D+     I + +    G+ +I F PDGR
Sbjct  212  DLETFELIGSSRPEATGVRSIAFHPDGR  239


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 31/120 (26%), Positives = 56/120 (47%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  +N ++F     R  ++GG D+ V +W +           H   + S+ F 
Sbjct  135  IHTYKGHTRGINTIKF-TPDGRWVVSGGLDNVVKVWDLTAGKLLHDFKFHEGHIRSLDFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   ++ FHP G     G +D  LK++
Sbjct  194  PLEFLLATGSADRTVKFWDLETFELIGSSRPEATGVRSIAFHPDGRTLFCG-LDDGLKVY  252



>ref|XP_010547314.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X4 [Tarenaya hassleriana]
Length=977

 Score =   275 bits (703),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKRGYKLQEF+AHS NVNCL  GKKT R+ +TGGDD +VNLW+IGKPTS  +L GHTSP
Sbjct  1    MAKRGYKLQEFLAHSANVNCLSIGKKTSRLLITGGDDCNVNLWAIGKPTSLMSLCGHTSP  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            V+S+ FD +E+ V AG+SSG+IKLW+LE+ KM+R L+GHRS C+A+EFHPFGEFFASGSM
Sbjct  61   VDSVDFDPSEVSVLAGASSGVIKLWNLEEAKMVRALTGHRSNCSAVEFHPFGEFFASGSM  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DTNL+IWDIRKKGCIHTYKGHTRGI+TI+FTPDGRWVV
Sbjct  121  DTNLRIWDIRKKGCIHTYKGHTRGINTIKFTPDGRWVV  158


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 68/148 (46%), Gaps = 1/148 (1%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            ++    H  N + + F       F +G  D ++ +W I K     T  GHT  + +I F 
Sbjct  93   VRALTGHRSNCSAVEF-HPFGEFFASGSMDTNLRIWDIRKKGCIHTYKGHTRGINTIKFT  151

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
                 V +G    ++K+WDL   K++     H  +  +L+FHP     A+GS D  +K W
Sbjct  152  PDGRWVVSGGLDNVVKVWDLTAGKLLHDFKFHEGHIRSLDFHPLEFLLATGSADRTVKFW  211

Query  578  DIRKKGCIHTYKGHTRGISTIRFTPDGR  661
            D+     I + +    G+ +I F PDGR
Sbjct  212  DLETFELIGSSRPEATGVRSIAFHPDGR  239


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 31/120 (26%), Positives = 56/120 (47%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  +N ++F     R  ++GG D+ V +W +           H   + S+ F 
Sbjct  135  IHTYKGHTRGINTIKF-TPDGRWVVSGGLDNVVKVWDLTAGKLLHDFKFHEGHIRSLDFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   ++ FHP G     G +D  LK++
Sbjct  194  PLEFLLATGSADRTVKFWDLETFELIGSSRPEATGVRSIAFHPDGRTLFCG-LDDGLKVY  252



>ref|XP_007159273.1| hypothetical protein PHAVU_002G224100g [Phaseolus vulgaris]
 gb|ESW31267.1| hypothetical protein PHAVU_002G224100g [Phaseolus vulgaris]
Length=651

 Score =   269 bits (688),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAK GYKLQEFVAHSGNVNCL+ G+K  R+F+TGGDD++VNLW IGK TS  +L GHTS 
Sbjct  1    MAKTGYKLQEFVAHSGNVNCLKIGRKANRLFITGGDDYNVNLWMIGKATSLISLCGHTST  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            VES+ FDSAE+LV +G+SSG+IKLWDLE+ KM+RTL+GHRS CTA+EFHPFGEFFASGS+
Sbjct  61   VESVTFDSAEVLVLSGASSGVIKLWDLEEAKMLRTLTGHRSNCTAVEFHPFGEFFASGSL  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DTNL IWDIRKKGCIHTYK H++GISTI+F+PDGRWVV
Sbjct  121  DTNLNIWDIRKKGCIHTYKDHSQGISTIKFSPDGRWVV  158


 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 67/148 (45%), Gaps = 1/148 (1%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            L+    H  N   + F       F +G  D ++N+W I K     T   H+  + +I F 
Sbjct  93   LRTLTGHRSNCTAVEF-HPFGEFFASGSLDTNLNIWDIRKKGCIHTYKDHSQGISTIKFS  151

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
                 V +G    ++K+WDL   K++     H  +  +L+FHP     A+GS D  +K W
Sbjct  152  PDGRWVVSGGFDNVVKVWDLTGGKLLHDFKYHEGHIRSLDFHPLEFLLATGSADRTVKFW  211

Query  578  DIRKKGCIHTYKGHTRGISTIRFTPDGR  661
            D+     I + +    G+ +I F PDGR
Sbjct  212  DLETFELIGSSRHEVSGVRSITFHPDGR  239


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 56/114 (49%), Gaps = 2/114 (2%)
 Frame = +2

Query  236  HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILV  415
            HS  ++ ++F     R  ++GG D+ V +W +           H   + S+ F   E L+
Sbjct  141  HSQGISTIKFSPDG-RWVVSGGFDNVVKVWDLTGGKLLHDFKYHEGHIRSLDFHPLEFLL  199

Query  416  AAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
            A GS+   +K WDLE  ++I +     S   ++ FHP G    +G ++ +LK++
Sbjct  200  ATGSADRTVKFWDLETFELIGSSRHEVSGVRSITFHPDGRTLFAG-LEDSLKVY  252



>gb|KFK40725.1| hypothetical protein AALP_AA2G032800 [Arabis alpina]
Length=1232

 Score =   276 bits (705),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKRGYKLQEF+AHSGNVNCL  GKKT R+ +TGGDD+ VNLW+IGKPTS  +L GHTS 
Sbjct  1    MAKRGYKLQEFLAHSGNVNCLSIGKKTSRLLITGGDDYKVNLWAIGKPTSLMSLCGHTSA  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            V+S+AFDSAE+LV AG+SSG+IKLW+LE+ KM+R  +GHRS C+A+EFHPFGEF ASGS 
Sbjct  61   VDSVAFDSAEVLVLAGASSGVIKLWNLEEAKMVRGFTGHRSSCSAVEFHPFGEFLASGSS  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            D NLKIWD+RKKGCI TYKGHTRGISTI+FTPDGRWVV
Sbjct  121  DANLKIWDVRKKGCIQTYKGHTRGISTIKFTPDGRWVV  158


 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 60/125 (48%), Gaps = 0/125 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
              +G  D ++ +W + K     T  GHT  + +I F      V +G    ++K+WDL   
Sbjct  115  LASGSSDANLKIWDVRKKGCIQTYKGHTRGISTIKFTPDGRWVVSGGLDNVVKVWDLTAG  174

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K+I     H     +L+FHP     A+GS D  +K WD+     I + +    G+ +I+F
Sbjct  175  KLIHDFKFHEGPIRSLDFHPLEFLLATGSADRTVKFWDLETFELIGSTRPEATGVRSIKF  234

Query  647  TPDGR  661
             PDGR
Sbjct  235  HPDGR  239


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/120 (27%), Positives = 59/120 (49%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +Q +  H+  ++ ++F     R  ++GG D+ V +W +           H  P+ S+ F 
Sbjct  135  IQTYKGHTRGISTIKFTPD-GRWVVSGGLDNVVKVWDLTAGKLIHDFKFHEGPIRSLDFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   +++FHP G     G +D  LK++
Sbjct  194  PLEFLLATGSADRTVKFWDLETFELIGSTRPEATGVRSIKFHPDGRTLFCG-LDDCLKVY  252



>gb|KFK40724.1| hypothetical protein AALP_AA2G032800 [Arabis alpina]
Length=1230

 Score =   276 bits (705),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKRGYKLQEF+AHSGNVNCL  GKKT R+ +TGGDD+ VNLW+IGKPTS  +L GHTS 
Sbjct  1    MAKRGYKLQEFLAHSGNVNCLSIGKKTSRLLITGGDDYKVNLWAIGKPTSLMSLCGHTSA  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            V+S+AFDSAE+LV AG+SSG+IKLW+LE+ KM+R  +GHRS C+A+EFHPFGEF ASGS 
Sbjct  61   VDSVAFDSAEVLVLAGASSGVIKLWNLEEAKMVRGFTGHRSSCSAVEFHPFGEFLASGSS  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            D NLKIWD+RKKGCI TYKGHTRGISTI+FTPDGRWVV
Sbjct  121  DANLKIWDVRKKGCIQTYKGHTRGISTIKFTPDGRWVV  158


 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 60/125 (48%), Gaps = 0/125 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
              +G  D ++ +W + K     T  GHT  + +I F      V +G    ++K+WDL   
Sbjct  115  LASGSSDANLKIWDVRKKGCIQTYKGHTRGISTIKFTPDGRWVVSGGLDNVVKVWDLTAG  174

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K+I     H     +L+FHP     A+GS D  +K WD+     I + +    G+ +I+F
Sbjct  175  KLIHDFKFHEGPIRSLDFHPLEFLLATGSADRTVKFWDLETFELIGSTRPEATGVRSIKF  234

Query  647  TPDGR  661
             PDGR
Sbjct  235  HPDGR  239


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/120 (27%), Positives = 59/120 (49%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +Q +  H+  ++ ++F     R  ++GG D+ V +W +           H  P+ S+ F 
Sbjct  135  IQTYKGHTRGISTIKFTPD-GRWVVSGGLDNVVKVWDLTAGKLIHDFKFHEGPIRSLDFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   +++FHP G     G +D  LK++
Sbjct  194  PLEFLLATGSADRTVKFWDLETFELIGSTRPEATGVRSIKFHPDGRTLFCG-LDDCLKVY  252



>ref|XP_009378573.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Pyrus x bretschneideri]
Length=864

 Score =   273 bits (697),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKR YKLQEFVAHS ++NCL  GK+  R+F+TGGDDH VNLW+IGK T+    +GHTSP
Sbjct  1    MAKRAYKLQEFVAHSDSINCLSIGKRARRLFVTGGDDHIVNLWTIGKATALMRFAGHTSP  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            VES+AF+S E+LV AG+SSG+ K+WDLE+TKM+RTL+GHRS CTA+EFHPFGEFFASGSM
Sbjct  61   VESVAFNSGEVLVLAGASSGVTKIWDLEETKMVRTLTGHRSSCTAVEFHPFGEFFASGSM  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DTNLKIWDIRKKGCIHTYKGHT+GISTI+FTPDGRWVV
Sbjct  121  DTNLKIWDIRKKGCIHTYKGHTQGISTIKFTPDGRWVV  158


 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 59/125 (47%), Gaps = 0/125 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GHT  + +I F      V +G     +K+WDL   
Sbjct  115  FASGSMDTNLKIWDIRKKGCIHTYKGHTQGISTIKFTPDGRWVVSGGFDNAVKIWDLTAG  174

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H  +  +L+FHP     A+GS D  +K WD+     I + +    G+  I F
Sbjct  175  KLLHDFKFHEGHIRSLDFHPLEFLLATGSSDRTVKFWDLETFELIGSSRPEPTGVRAIAF  234

Query  647  TPDGR  661
             PDGR
Sbjct  235  HPDGR  239


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/120 (28%), Positives = 59/120 (49%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  ++ ++F     R  ++GG D++V +W +           H   + S+ F 
Sbjct  135  IHTYKGHTQGISTIKFTPDG-RWVVSGGFDNAVKIWDLTAGKLLHDFKFHEGHIRSLDFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GSS   +K WDLE  ++I +     +   A+ FHP G    SG +D +LK++
Sbjct  194  PLEFLLATGSSDRTVKFWDLETFELIGSSRPEPTGVRAIAFHPDGRTLFSG-LDDSLKVY  252



>ref|XP_009378641.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X2 [Pyrus x bretschneideri]
Length=859

 Score =   273 bits (697),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKR YKLQEFVAHS ++NCL  GK+  R+F+TGGDDH VNLW+IGK T+    +GHTSP
Sbjct  1    MAKRAYKLQEFVAHSDSINCLSIGKRARRLFVTGGDDHIVNLWTIGKATALMRFAGHTSP  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            VES+AF+S E+LV AG+SSG+ K+WDLE+TKM+RTL+GHRS CTA+EFHPFGEFFASGSM
Sbjct  61   VESVAFNSGEVLVLAGASSGVTKIWDLEETKMVRTLTGHRSSCTAVEFHPFGEFFASGSM  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DTNLKIWDIRKKGCIHTYKGHT+GISTI+FTPDGRWVV
Sbjct  121  DTNLKIWDIRKKGCIHTYKGHTQGISTIKFTPDGRWVV  158


 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 59/125 (47%), Gaps = 0/125 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GHT  + +I F      V +G     +K+WDL   
Sbjct  115  FASGSMDTNLKIWDIRKKGCIHTYKGHTQGISTIKFTPDGRWVVSGGFDNAVKIWDLTAG  174

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H  +  +L+FHP     A+GS D  +K WD+     I + +    G+  I F
Sbjct  175  KLLHDFKFHEGHIRSLDFHPLEFLLATGSSDRTVKFWDLETFELIGSSRPEPTGVRAIAF  234

Query  647  TPDGR  661
             PDGR
Sbjct  235  HPDGR  239


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/120 (28%), Positives = 59/120 (49%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  ++ ++F     R  ++GG D++V +W +           H   + S+ F 
Sbjct  135  IHTYKGHTQGISTIKFTPDG-RWVVSGGFDNAVKIWDLTAGKLLHDFKFHEGHIRSLDFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GSS   +K WDLE  ++I +     +   A+ FHP G    SG +D +LK++
Sbjct  194  PLEFLLATGSSDRTVKFWDLETFELIGSSRPEPTGVRAIAFHPDGRTLFSG-LDDSLKVY  252



>ref|XP_007159274.1| hypothetical protein PHAVU_002G224100g [Phaseolus vulgaris]
 gb|ESW31268.1| hypothetical protein PHAVU_002G224100g [Phaseolus vulgaris]
Length=714

 Score =   270 bits (689),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAK GYKLQEFVAHSGNVNCL+ G+K  R+F+TGGDD++VNLW IGK TS  +L GHTS 
Sbjct  1    MAKTGYKLQEFVAHSGNVNCLKIGRKANRLFITGGDDYNVNLWMIGKATSLISLCGHTST  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            VES+ FDSAE+LV +G+SSG+IKLWDLE+ KM+RTL+GHRS CTA+EFHPFGEFFASGS+
Sbjct  61   VESVTFDSAEVLVLSGASSGVIKLWDLEEAKMLRTLTGHRSNCTAVEFHPFGEFFASGSL  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DTNL IWDIRKKGCIHTYK H++GISTI+F+PDGRWVV
Sbjct  121  DTNLNIWDIRKKGCIHTYKDHSQGISTIKFSPDGRWVV  158


 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 67/148 (45%), Gaps = 1/148 (1%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            L+    H  N   + F       F +G  D ++N+W I K     T   H+  + +I F 
Sbjct  93   LRTLTGHRSNCTAVEF-HPFGEFFASGSLDTNLNIWDIRKKGCIHTYKDHSQGISTIKFS  151

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
                 V +G    ++K+WDL   K++     H  +  +L+FHP     A+GS D  +K W
Sbjct  152  PDGRWVVSGGFDNVVKVWDLTGGKLLHDFKYHEGHIRSLDFHPLEFLLATGSADRTVKFW  211

Query  578  DIRKKGCIHTYKGHTRGISTIRFTPDGR  661
            D+     I + +    G+ +I F PDGR
Sbjct  212  DLETFELIGSSRHEVSGVRSITFHPDGR  239


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 56/114 (49%), Gaps = 2/114 (2%)
 Frame = +2

Query  236  HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILV  415
            HS  ++ ++F     R  ++GG D+ V +W +           H   + S+ F   E L+
Sbjct  141  HSQGISTIKFSPDG-RWVVSGGFDNVVKVWDLTGGKLLHDFKYHEGHIRSLDFHPLEFLL  199

Query  416  AAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
            A GS+   +K WDLE  ++I +     S   ++ FHP G    +G ++ +LK++
Sbjct  200  ATGSADRTVKFWDLETFELIGSSRHEVSGVRSITFHPDGRTLFAG-LEDSLKVY  252



>gb|AAD49999.1|AC007259_12 Hypothetical protein [Arabidopsis thaliana]
Length=961

 Score =   273 bits (698),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 139/158 (88%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKRGYKLQEFVAHSGNVNCL  GKKT R+ LTGGDD+ VNLWSIGK TS  +L GHTSP
Sbjct  1    MAKRGYKLQEFVAHSGNVNCLSIGKKTSRLLLTGGDDYKVNLWSIGKTTSPMSLCGHTSP  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            V+S+AF+S E+LV AG+SSG+IKLWDLE++KM+R  +GHRS C+A+EFHPFGEF ASGS 
Sbjct  61   VDSVAFNSEEVLVLAGASSGVIKLWDLEESKMVRAFTGHRSNCSAVEFHPFGEFLASGSS  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DTNL++WD RKKGCI TYKGHTRGISTI F+PDGRWVV
Sbjct  121  DTNLRVWDTRKKGCIQTYKGHTRGISTIEFSPDGRWVV  158


 Score = 74.3 bits (181),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 41/148 (28%), Positives = 65/148 (44%), Gaps = 1/148 (1%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            ++ F  H  N + + F         +G  D ++ +W   K     T  GHT  + +I F 
Sbjct  93   VRAFTGHRSNCSAVEF-HPFGEFLASGSSDTNLRVWDTRKKGCIQTYKGHTRGISTIEFS  151

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
                 V +G    ++K+WDL   K++     H     +L+FHP     A+GS D  +K W
Sbjct  152  PDGRWVVSGGLDNVVKVWDLTAGKLLHEFKCHEGPIRSLDFHPLEFLLATGSADRTVKFW  211

Query  578  DIRKKGCIHTYKGHTRGISTIRFTPDGR  661
            D+     I T +    G+  I F PDG+
Sbjct  212  DLETFELIGTTRPEATGVRAIAFHPDGQ  239


 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 58/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +Q +  H+  ++ + F     R  ++GG D+ V +W +           H  P+ S+ F 
Sbjct  135  IQTYKGHTRGISTIEFSPD-GRWVVSGGLDNVVKVWDLTAGKLLHEFKCHEGPIRSLDFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I T     +   A+ FHP G+    G +D  LK++
Sbjct  194  PLEFLLATGSADRTVKFWDLETFELIGTTRPEATGVRAIAFHPDGQTLFCG-LDDGLKVY  252



>ref|XP_010905606.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X2 [Elaeis guineensis]
Length=816

 Score =   270 bits (691),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKRGYKLQEFVAH+ +VNCL  GKK+ R+F+TGGDD  VNLW+IGKPT   +L GHTS 
Sbjct  1    MAKRGYKLQEFVAHTSDVNCLNIGKKSSRVFVTGGDDRKVNLWAIGKPTPLLSLCGHTSA  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            VES+AFDSAE+LV AGSS+G IKLWDLE+ K++RTLSGHR  CT++EFHPFGEFFASGS 
Sbjct  61   VESVAFDSAEVLVLAGSSNGSIKLWDLEEAKIVRTLSGHRFNCTSVEFHPFGEFFASGSS  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DT+LKIWDIRKKGCIHTYKGHTRGI TI+FTPDGRWVV
Sbjct  121  DTDLKIWDIRKKGCIHTYKGHTRGIRTIKFTPDGRWVV  158


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 57/127 (45%), Gaps = 0/127 (0%)
 Frame = +2

Query  281  RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLE  460
              F +G  D  + +W I K     T  GHT  + +I F      V  G    ++K+WDL 
Sbjct  113  EFFASGSSDTDLKIWDIRKKGCIHTYKGHTRGIRTIKFTPDGRWVVTGGEDNVVKVWDLT  172

Query  461  DTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTI  640
              K++     H+     ++FHP     A+GS D  +K WD+     I +      G+ ++
Sbjct  173  AGKLLHDFKFHKGQIRCIDFHPHEFLLATGSADRTVKFWDLETFELIGSAGPEVTGVRSM  232

Query  641  RFTPDGR  661
             F PDGR
Sbjct  233  IFHPDGR  239


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/120 (26%), Positives = 55/120 (46%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  +  ++F     R  +TGG+D+ V +W +           H   +  I F 
Sbjct  135  IHTYKGHTRGIRTIKFTPDG-RWVVTGGEDNVVKVWDLTAGKLLHDFKFHKGQIRCIDFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   ++ FHP G     G +D  LK++
Sbjct  194  PHEFLLATGSADRTVKFWDLETFELIGSAGPEVTGVRSMIFHPDGRTLFCG-LDVTLKVF  252



>ref|NP_172582.2| WD40 domain-containing protein [Arabidopsis thaliana]
 gb|AEE28692.1| WD40 domain-containing protein [Arabidopsis thaliana]
Length=1021

 Score =   273 bits (697),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 139/158 (88%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKRGYKLQEFVAHSGNVNCL  GKKT R+ LTGGDD+ VNLWSIGK TS  +L GHTSP
Sbjct  1    MAKRGYKLQEFVAHSGNVNCLSIGKKTSRLLLTGGDDYKVNLWSIGKTTSPMSLCGHTSP  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            V+S+AF+S E+LV AG+SSG+IKLWDLE++KM+R  +GHRS C+A+EFHPFGEF ASGS 
Sbjct  61   VDSVAFNSEEVLVLAGASSGVIKLWDLEESKMVRAFTGHRSNCSAVEFHPFGEFLASGSS  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DTNL++WD RKKGCI TYKGHTRGISTI F+PDGRWVV
Sbjct  121  DTNLRVWDTRKKGCIQTYKGHTRGISTIEFSPDGRWVV  158


 Score = 74.3 bits (181),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 41/148 (28%), Positives = 65/148 (44%), Gaps = 1/148 (1%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            ++ F  H  N + + F         +G  D ++ +W   K     T  GHT  + +I F 
Sbjct  93   VRAFTGHRSNCSAVEF-HPFGEFLASGSSDTNLRVWDTRKKGCIQTYKGHTRGISTIEFS  151

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
                 V +G    ++K+WDL   K++     H     +L+FHP     A+GS D  +K W
Sbjct  152  PDGRWVVSGGLDNVVKVWDLTAGKLLHEFKCHEGPIRSLDFHPLEFLLATGSADRTVKFW  211

Query  578  DIRKKGCIHTYKGHTRGISTIRFTPDGR  661
            D+     I T +    G+  I F PDG+
Sbjct  212  DLETFELIGTTRPEATGVRAIAFHPDGQ  239


 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 58/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +Q +  H+  ++ + F     R  ++GG D+ V +W +           H  P+ S+ F 
Sbjct  135  IQTYKGHTRGISTIEFSPD-GRWVVSGGLDNVVKVWDLTAGKLLHEFKCHEGPIRSLDFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I T     +   A+ FHP G+    G +D  LK++
Sbjct  194  PLEFLLATGSADRTVKFWDLETFELIGTTRPEATGVRAIAFHPDGQTLFCG-LDDGLKVY  252



>ref|XP_010905607.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X3 [Elaeis guineensis]
Length=797

 Score =   270 bits (689),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKRGYKLQEFVAH+ +VNCL  GKK+ R+F+TGGDD  VNLW+IGKPT   +L GHTS 
Sbjct  1    MAKRGYKLQEFVAHTSDVNCLNIGKKSSRVFVTGGDDRKVNLWAIGKPTPLLSLCGHTSA  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            VES+AFDSAE+LV AGSS+G IKLWDLE+ K++RTLSGHR  CT++EFHPFGEFFASGS 
Sbjct  61   VESVAFDSAEVLVLAGSSNGSIKLWDLEEAKIVRTLSGHRFNCTSVEFHPFGEFFASGSS  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DT+LKIWDIRKKGCIHTYKGHTRGI TI+FTPDGRWVV
Sbjct  121  DTDLKIWDIRKKGCIHTYKGHTRGIRTIKFTPDGRWVV  158


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/125 (30%), Positives = 57/125 (46%), Gaps = 0/125 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D  + +W I K     T  GHT  + +I F      V  G    ++K+WDL   
Sbjct  115  FASGSSDTDLKIWDIRKKGCIHTYKGHTRGIRTIKFTPDGRWVVTGGEDNVVKVWDLTAG  174

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H+     ++FHP     A+GS D  +K WD+     I +      G+ ++ F
Sbjct  175  KLLHDFKFHKGQIRCIDFHPHEFLLATGSADRTVKFWDLETFELIGSAGPEVTGVRSMIF  234

Query  647  TPDGR  661
             PDGR
Sbjct  235  HPDGR  239


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/120 (26%), Positives = 55/120 (46%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  +  ++F     R  +TGG+D+ V +W +           H   +  I F 
Sbjct  135  IHTYKGHTRGIRTIKFTPDG-RWVVTGGEDNVVKVWDLTAGKLLHDFKFHKGQIRCIDFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   ++ FHP G     G +D  LK++
Sbjct  194  PHEFLLATGSADRTVKFWDLETFELIGSAGPEVTGVRSMIFHPDGRTLFCG-LDVTLKVF  252



>ref|XP_010905604.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Elaeis guineensis]
Length=839

 Score =   270 bits (690),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKRGYKLQEFVAH+ +VNCL  GKK+ R+F+TGGDD  VNLW+IGKPT   +L GHTS 
Sbjct  1    MAKRGYKLQEFVAHTSDVNCLNIGKKSSRVFVTGGDDRKVNLWAIGKPTPLLSLCGHTSA  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            VES+AFDSAE+LV AGSS+G IKLWDLE+ K++RTLSGHR  CT++EFHPFGEFFASGS 
Sbjct  61   VESVAFDSAEVLVLAGSSNGSIKLWDLEEAKIVRTLSGHRFNCTSVEFHPFGEFFASGSS  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DT+LKIWDIRKKGCIHTYKGHTRGI TI+FTPDGRWVV
Sbjct  121  DTDLKIWDIRKKGCIHTYKGHTRGIRTIKFTPDGRWVV  158


 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 37/125 (30%), Positives = 57/125 (46%), Gaps = 0/125 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D  + +W I K     T  GHT  + +I F      V  G    ++K+WDL   
Sbjct  115  FASGSSDTDLKIWDIRKKGCIHTYKGHTRGIRTIKFTPDGRWVVTGGEDNVVKVWDLTAG  174

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H+     ++FHP     A+GS D  +K WD+     I +      G+ ++ F
Sbjct  175  KLLHDFKFHKGQIRCIDFHPHEFLLATGSADRTVKFWDLETFELIGSAGPEVTGVRSMIF  234

Query  647  TPDGR  661
             PDGR
Sbjct  235  HPDGR  239


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 31/120 (26%), Positives = 55/120 (46%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  +  ++F     R  +TGG+D+ V +W +           H   +  I F 
Sbjct  135  IHTYKGHTRGIRTIKFTPDG-RWVVTGGEDNVVKVWDLTAGKLLHDFKFHKGQIRCIDFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   ++ FHP G     G +D  LK++
Sbjct  194  PHEFLLATGSADRTVKFWDLETFELIGSAGPEVTGVRSMIFHPDGRTLFCG-LDVTLKVF  252



>ref|XP_010240610.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X2 [Brachypodium distachyon]
Length=921

 Score =   271 bits (692),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 116/156 (74%), Positives = 139/156 (89%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS NVNCL+ G+KT R+ +TGG+DH VNLW+IGKP S S+L GHTS VE
Sbjct  6    KRAYKLQEFVAHSSNVNCLKIGRKTSRVLVTGGEDHKVNLWAIGKPNSISSLPGHTSAVE  65

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S+AFDS E+ VAAG++SG +KLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DT
Sbjct  66   SVAFDSTEVFVAAGAASGTVKLWDLEEAKIVRTLTGHRSNCMSVDFHPFGEFFASGSLDT  125

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIR+KGCIHTYKGHTRG++ IRFTPDGRWVV
Sbjct  126  NLKIWDIRRKGCIHTYKGHTRGVNAIRFTPDGRWVV  161


 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 60/128 (47%), Gaps = 0/128 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I +     T  GHT  V +I F      V +G    ++K+WDL   
Sbjct  118  FASGSLDTNLKIWDIRRKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDSVVKIWDLTAG  177

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      ++FHP     A+GS D  +K WD+     I +      G+ ++ F
Sbjct  178  KLLHEFKSHDGQIQCIDFHPHEFLLATGSADKTVKFWDLETFELIGSTGPEMTGVRSMTF  237

Query  647  TPDGRWVV  670
             PDGR ++
Sbjct  238  NPDGRSLL  245


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/120 (26%), Positives = 56/120 (47%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN +RF     R  ++GG+D  V +W +           H   ++ I F 
Sbjct  138  IHTYKGHTRGVNAIRFTPD-GRWVVSGGEDSVVKIWDLTAGKLLHEFKSHDGQIQCIDFH  196

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   ++ F+P G     G +  +LK++
Sbjct  197  PHEFLLATGSADKTVKFWDLETFELIGSTGPEMTGVRSMTFNPDGRSLLCG-LHESLKVF  255



>ref|XP_010240609.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Brachypodium distachyon]
Length=922

 Score =   271 bits (692),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 116/156 (74%), Positives = 139/156 (89%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS NVNCL+ G+KT R+ +TGG+DH VNLW+IGKP S S+L GHTS VE
Sbjct  6    KRAYKLQEFVAHSSNVNCLKIGRKTSRVLVTGGEDHKVNLWAIGKPNSISSLPGHTSAVE  65

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S+AFDS E+ VAAG++SG +KLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DT
Sbjct  66   SVAFDSTEVFVAAGAASGTVKLWDLEEAKIVRTLTGHRSNCMSVDFHPFGEFFASGSLDT  125

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIR+KGCIHTYKGHTRG++ IRFTPDGRWVV
Sbjct  126  NLKIWDIRRKGCIHTYKGHTRGVNAIRFTPDGRWVV  161


 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 60/128 (47%), Gaps = 0/128 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I +     T  GHT  V +I F      V +G    ++K+WDL   
Sbjct  118  FASGSLDTNLKIWDIRRKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDSVVKIWDLTAG  177

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      ++FHP     A+GS D  +K WD+     I +      G+ ++ F
Sbjct  178  KLLHEFKSHDGQIQCIDFHPHEFLLATGSADKTVKFWDLETFELIGSTGPEMTGVRSMTF  237

Query  647  TPDGRWVV  670
             PDGR ++
Sbjct  238  NPDGRSLL  245


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/120 (26%), Positives = 56/120 (47%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN +RF     R  ++GG+D  V +W +           H   ++ I F 
Sbjct  138  IHTYKGHTRGVNAIRFTPD-GRWVVSGGEDSVVKIWDLTAGKLLHEFKSHDGQIQCIDFH  196

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   ++ F+P G     G +  +LK++
Sbjct  197  PHEFLLATGSADKTVKFWDLETFELIGSTGPEMTGVRSMTFNPDGRSLLCG-LHESLKVF  255



>gb|KFK43409.1| hypothetical protein AALP_AA1G122100 [Arabis alpina]
Length=977

 Score =   271 bits (693),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 119/158 (75%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKRGYKLQEF+AHSGNVNCL  GKKT R+ LTGGDD+ VNLW+IGKPTS  +L GHTSP
Sbjct  1    MAKRGYKLQEFLAHSGNVNCLSIGKKTSRLLLTGGDDYKVNLWAIGKPTSLMSLCGHTSP  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            V+S+AF+S E+LV AG+SSG+IKLW+LE+ KM+R   GHRS C+A+EFHPFG++ ASGS 
Sbjct  61   VDSVAFNSTEVLVLAGASSGVIKLWNLEEAKMVRAFIGHRSNCSAVEFHPFGQYIASGSS  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DTNLKIWD+RKKGCI TYKGHTRGISTI+F+PDGRWVV
Sbjct  121  DTNLKIWDVRKKGCIQTYKGHTRGISTIKFSPDGRWVV  158


 Score = 77.4 bits (189),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 41/148 (28%), Positives = 67/148 (45%), Gaps = 1/148 (1%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            ++ F+ H  N + + F     +   +G  D ++ +W + K     T  GHT  + +I F 
Sbjct  93   VRAFIGHRSNCSAVEF-HPFGQYIASGSSDTNLKIWDVRKKGCIQTYKGHTRGISTIKFS  151

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
                 V  G    ++K+WDL   K++     H     +L+FHP     A+GS D  +K W
Sbjct  152  PDGRWVVCGGLDNVVKVWDLTAGKLLHEFKSHDGPIRSLDFHPLEFLLATGSADRTVKFW  211

Query  578  DIRKKGCIHTYKGHTRGISTIRFTPDGR  661
            D+     I + +    G+  I F PDGR
Sbjct  212  DLETFEMIGSTRPEATGVRAITFHPDGR  239


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +Q +  H+  ++ ++F     R  + GG D+ V +W +           H  P+ S+ F 
Sbjct  135  IQTYKGHTRGISTIKFSPD-GRWVVCGGLDNVVKVWDLTAGKLLHEFKSHDGPIRSLDFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  +MI +     +   A+ FHP G     G+ D  LK++
Sbjct  194  PLEFLLATGSADRTVKFWDLETFEMIGSTRPEATGVRAITFHPDGRTLFCGA-DDGLKVY  252



>ref|XP_006300659.1| hypothetical protein CARUB_v10019681mg [Capsella rubella]
 gb|EOA33557.1| hypothetical protein CARUB_v10019681mg [Capsella rubella]
Length=1184

 Score =   272 bits (696),  Expect = 7e-81, Method: Composition-based stats.
 Identities = 122/158 (77%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKRGYKLQEF+AHS NVNCL  GKKT R+F+TGGDD+ VNLW+IGKPTS  +L GHTS 
Sbjct  1    MAKRGYKLQEFLAHSANVNCLSIGKKTSRLFITGGDDYKVNLWAIGKPTSLMSLCGHTSA  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            V+S+AFDSAE+LV AG+SSG+IKLWD+E+ KM+R  +GHRS C+A+EFHPFGEF ASGS 
Sbjct  61   VDSVAFDSAEVLVLAGASSGVIKLWDVEEAKMVRAFTGHRSNCSAVEFHPFGEFLASGSS  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            D NLKIWDIRKKGCI TYKGHTRGI+TIRFTPDGRWVV
Sbjct  121  DANLKIWDIRKKGCIQTYKGHTRGINTIRFTPDGRWVV  158


 Score = 82.4 bits (202),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 42/148 (28%), Positives = 68/148 (46%), Gaps = 1/148 (1%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            ++ F  H  N + + F         +G  D ++ +W I K     T  GHT  + +I F 
Sbjct  93   VRAFTGHRSNCSAVEF-HPFGEFLASGSSDANLKIWDIRKKGCIQTYKGHTRGINTIRFT  151

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
                 V +G    ++K+WDL   K++     H     +L+FHP     A+GS D  +K W
Sbjct  152  PDGRWVVSGGLDNVVKVWDLTAGKLLHEFKLHEGAIRSLDFHPLEFLLATGSADRTVKFW  211

Query  578  DIRKKGCIHTYKGHTRGISTIRFTPDGR  661
            D+     I + +    G+ +I+F PDGR
Sbjct  212  DLETFELIGSTRPEATGVRSIKFHPDGR  239


 Score = 58.9 bits (141),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 33/120 (28%), Positives = 59/120 (49%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +Q +  H+  +N +RF     R  ++GG D+ V +W +           H   + S+ F 
Sbjct  135  IQTYKGHTRGINTIRFTPDG-RWVVSGGLDNVVKVWDLTAGKLLHEFKLHEGAIRSLDFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   +++FHP G     G +D +LK++
Sbjct  194  PLEFLLATGSADRTVKFWDLETFELIGSTRPEATGVRSIKFHPDGRTLFCG-LDDSLKVY  252



>emb|CDY03812.1| BnaC01g29290D [Brassica napus]
Length=1123

 Score =   272 bits (696),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 120/158 (76%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKRGYKLQEF+AHS NVNCL  GKKT R+ +TGGDD+ VNLW+IGKPTS  +L GHTS 
Sbjct  1    MAKRGYKLQEFLAHSANVNCLSIGKKTSRLLITGGDDYKVNLWAIGKPTSLMSLCGHTSA  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            V+S+AFDSAE+LV  G+SSGLIKLWDLE+ KM+R  +GHRS C+A+EFHPFGEF ASGS 
Sbjct  61   VDSLAFDSAEVLVLGGASSGLIKLWDLEEAKMVRAFTGHRSSCSAVEFHPFGEFLASGSN  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DTNLKIWDIRKKGCI TYKGHTR I+TI+F+PDGRWVV
Sbjct  121  DTNLKIWDIRKKGCIQTYKGHTRDINTIKFSPDGRWVV  158


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 67/148 (45%), Gaps = 1/148 (1%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            ++ F  H  + + + F         +G +D ++ +W I K     T  GHT  + +I F 
Sbjct  93   VRAFTGHRSSCSAVEF-HPFGEFLASGSNDTNLKIWDIRKKGCIQTYKGHTRDINTIKFS  151

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
                 V  G     +K+WDL   K+I     H     +L+FHP     A+GS D  +K W
Sbjct  152  PDGRWVVTGGLDNAVKVWDLTAGKLIHDFKFHEGSIRSLDFHPLEFLLATGSADRTVKFW  211

Query  578  DIRKKGCIHTYKGHTRGISTIRFTPDGR  661
            D+     I + +    G+ +I+F PDGR
Sbjct  212  DLETFELIGSTRPEDTGVRSIKFHPDGR  239


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/120 (28%), Positives = 60/120 (50%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +Q +  H+ ++N ++F     R  +TGG D++V +W +           H   + S+ F 
Sbjct  135  IQTYKGHTRDINTIKFSPD-GRWVVTGGLDNAVKVWDLTAGKLIHDFKFHEGSIRSLDFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   +++FHP G     G +D  LK++
Sbjct  194  PLEFLLATGSADRTVKFWDLETFELIGSTRPEDTGVRSIKFHPDGRTLFCG-LDDGLKVY  252



>emb|CAE05767.2| OSJNBa0064G10.18 [Oryza sativa Japonica Group]
Length=935

 Score =   271 bits (692),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 117/156 (75%), Positives = 138/156 (88%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS NVNCL+ G+KT R+ +TGGDDH VNLW+IGKP S  +LSGHTS VE
Sbjct  6    KRAYKLQEFVAHSSNVNCLKIGRKTSRVLVTGGDDHKVNLWAIGKPNSILSLSGHTSAVE  65

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S+ FDS E+ VAAG++SG IKLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DT
Sbjct  66   SVNFDSTEVFVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCMSVDFHPFGEFFASGSLDT  125

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIR+KGCIHTYKGHTRG++ IRFTPDGRWVV
Sbjct  126  NLKIWDIRRKGCIHTYKGHTRGVNAIRFTPDGRWVV  161


 Score = 74.7 bits (182),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 61/128 (48%), Gaps = 0/128 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I +     T  GHT  V +I F      V +G    ++KLWDL   
Sbjct  118  FASGSLDTNLKIWDIRRKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNVVKLWDLTAG  177

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      ++FHP     A+GS D  +K WD+     I +    T G+ ++ F
Sbjct  178  KLLHDFKCHEGQIQCIDFHPHEFLLATGSSDKTVKFWDLETFELIGSTGPETTGVRSMTF  237

Query  647  TPDGRWVV  670
             PDGR ++
Sbjct  238  NPDGRSLL  245


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/120 (28%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN +RF     R  ++GG+D+ V LW +           H   ++ I F 
Sbjct  138  IHTYKGHTRGVNAIRFTPD-GRWVVSGGEDNVVKLWDLTAGKLLHDFKCHEGQIQCIDFH  196

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GSS   +K WDLE  ++I +     +   ++ F+P G     G +  +LK++
Sbjct  197  PHEFLLATGSSDKTVKFWDLETFELIGSTGPETTGVRSMTFNPDGRSLLCG-LHESLKVF  255



>ref|XP_009104469.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X2 [Brassica rapa]
Length=1122

 Score =   272 bits (695),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 120/158 (76%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKRGYKLQEF+AHS NVNCL  GKKT R+ +TGGDD+ VNLW+IGKPTS  +L GHTS 
Sbjct  1    MAKRGYKLQEFLAHSANVNCLSIGKKTSRLLITGGDDYKVNLWAIGKPTSLMSLCGHTSA  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            V+S+AFDSAE+LV  G+SSGLIKLWDLE+ KM+R  +GHRS C+A+EFHPFGEF ASGS 
Sbjct  61   VDSLAFDSAEVLVLGGASSGLIKLWDLEEAKMVRAFTGHRSSCSAVEFHPFGEFLASGSN  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DTNLKIWDIRKKGCI TYKGHTR I+TI+F+PDGRWVV
Sbjct  121  DTNLKIWDIRKKGCIQTYKGHTRDINTIKFSPDGRWVV  158


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 67/148 (45%), Gaps = 1/148 (1%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            ++ F  H  + + + F         +G +D ++ +W I K     T  GHT  + +I F 
Sbjct  93   VRAFTGHRSSCSAVEF-HPFGEFLASGSNDTNLKIWDIRKKGCIQTYKGHTRDINTIKFS  151

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
                 V  G     +K+WDL   K+I     H     +L+FHP     A+GS D  +K W
Sbjct  152  PDGRWVVTGGLDNAVKVWDLTAGKLIHDFKFHEGSIRSLDFHPLEFLLATGSADRTVKFW  211

Query  578  DIRKKGCIHTYKGHTRGISTIRFTPDGR  661
            D+     I + +    G+ +I+F PDGR
Sbjct  212  DLETFELIGSTRPEDTGVRSIKFHPDGR  239


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/120 (28%), Positives = 60/120 (50%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +Q +  H+ ++N ++F     R  +TGG D++V +W +           H   + S+ F 
Sbjct  135  IQTYKGHTRDINTIKFSPD-GRWVVTGGLDNAVKVWDLTAGKLIHDFKFHEGSIRSLDFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   +++FHP G     G +D  LK++
Sbjct  194  PLEFLLATGSADRTVKFWDLETFELIGSTRPEDTGVRSIKFHPDGRTLFCG-LDDGLKVY  252



>gb|KFK43408.1| hypothetical protein AALP_AA1G122100 [Arabis alpina]
Length=1026

 Score =   271 bits (694),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 119/158 (75%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKRGYKLQEF+AHSGNVNCL  GKKT R+ LTGGDD+ VNLW+IGKPTS  +L GHTSP
Sbjct  1    MAKRGYKLQEFLAHSGNVNCLSIGKKTSRLLLTGGDDYKVNLWAIGKPTSLMSLCGHTSP  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            V+S+AF+S E+LV AG+SSG+IKLW+LE+ KM+R   GHRS C+A+EFHPFG++ ASGS 
Sbjct  61   VDSVAFNSTEVLVLAGASSGVIKLWNLEEAKMVRAFIGHRSNCSAVEFHPFGQYIASGSS  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DTNLKIWD+RKKGCI TYKGHTRGISTI+F+PDGRWVV
Sbjct  121  DTNLKIWDVRKKGCIQTYKGHTRGISTIKFSPDGRWVV  158


 Score = 77.4 bits (189),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 41/148 (28%), Positives = 67/148 (45%), Gaps = 1/148 (1%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            ++ F+ H  N + + F     +   +G  D ++ +W + K     T  GHT  + +I F 
Sbjct  93   VRAFIGHRSNCSAVEF-HPFGQYIASGSSDTNLKIWDVRKKGCIQTYKGHTRGISTIKFS  151

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
                 V  G    ++K+WDL   K++     H     +L+FHP     A+GS D  +K W
Sbjct  152  PDGRWVVCGGLDNVVKVWDLTAGKLLHEFKSHDGPIRSLDFHPLEFLLATGSADRTVKFW  211

Query  578  DIRKKGCIHTYKGHTRGISTIRFTPDGR  661
            D+     I + +    G+  I F PDGR
Sbjct  212  DLETFEMIGSTRPEATGVRAITFHPDGR  239


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +Q +  H+  ++ ++F     R  + GG D+ V +W +           H  P+ S+ F 
Sbjct  135  IQTYKGHTRGISTIKFSPD-GRWVVCGGLDNVVKVWDLTAGKLLHEFKSHDGPIRSLDFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  +MI +     +   A+ FHP G     G+ D  LK++
Sbjct  194  PLEFLLATGSADRTVKFWDLETFEMIGSTRPEATGVRAITFHPDGRTLFCGA-DDGLKVY  252



>ref|XP_009104461.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Brassica rapa]
Length=1124

 Score =   272 bits (695),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 120/158 (76%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKRGYKLQEF+AHS NVNCL  GKKT R+ +TGGDD+ VNLW+IGKPTS  +L GHTS 
Sbjct  1    MAKRGYKLQEFLAHSANVNCLSIGKKTSRLLITGGDDYKVNLWAIGKPTSLMSLCGHTSA  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            V+S+AFDSAE+LV  G+SSGLIKLWDLE+ KM+R  +GHRS C+A+EFHPFGEF ASGS 
Sbjct  61   VDSLAFDSAEVLVLGGASSGLIKLWDLEEAKMVRAFTGHRSSCSAVEFHPFGEFLASGSN  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DTNLKIWDIRKKGCI TYKGHTR I+TI+F+PDGRWVV
Sbjct  121  DTNLKIWDIRKKGCIQTYKGHTRDINTIKFSPDGRWVV  158


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 67/148 (45%), Gaps = 1/148 (1%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            ++ F  H  + + + F         +G +D ++ +W I K     T  GHT  + +I F 
Sbjct  93   VRAFTGHRSSCSAVEF-HPFGEFLASGSNDTNLKIWDIRKKGCIQTYKGHTRDINTIKFS  151

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
                 V  G     +K+WDL   K+I     H     +L+FHP     A+GS D  +K W
Sbjct  152  PDGRWVVTGGLDNAVKVWDLTAGKLIHDFKFHEGSIRSLDFHPLEFLLATGSADRTVKFW  211

Query  578  DIRKKGCIHTYKGHTRGISTIRFTPDGR  661
            D+     I + +    G+ +I+F PDGR
Sbjct  212  DLETFELIGSTRPEDTGVRSIKFHPDGR  239


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/120 (28%), Positives = 60/120 (50%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +Q +  H+ ++N ++F     R  +TGG D++V +W +           H   + S+ F 
Sbjct  135  IQTYKGHTRDINTIKFSPD-GRWVVTGGLDNAVKVWDLTAGKLIHDFKFHEGSIRSLDFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   +++FHP G     G +D  LK++
Sbjct  194  PLEFLLATGSADRTVKFWDLETFELIGSTRPEDTGVRSIKFHPDGRTLFCG-LDDGLKVY  252



>ref|XP_010274906.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
[Nelumbo nucifera]
Length=799

 Score =   268 bits (684),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 115/156 (74%), Positives = 141/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS NVNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +  +LSGHTS VE
Sbjct  4    KRAYKLQEFVAHSSNVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHTSAVE  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++FDS+E+LVAAG++SG IKLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DT
Sbjct  64   SVSFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIR+KGCIHTYKGHTRG++ IRFTPDGRWVV
Sbjct  124  NLKIWDIRRKGCIHTYKGHTRGVNAIRFTPDGRWVV  159


 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 59/125 (47%), Gaps = 0/125 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I +     T  GHT  V +I F      V +G    ++KLWDL   
Sbjct  116  FASGSLDTNLKIWDIRRKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNIVKLWDLTAG  175

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      ++FHP     A+GS D  +K WD+     I +    T G+ ++ F
Sbjct  176  KLLHDFKCHEGQIQCIDFHPHEFLLATGSADRTVKFWDLETFELIGSAGPETTGVRSMTF  235

Query  647  TPDGR  661
             PDGR
Sbjct  236  NPDGR  240


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 59/125 (47%), Gaps = 2/125 (2%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            +R   +  +  H+  VN +RF     R  ++GG+D+ V LW +           H   ++
Sbjct  131  RRKGCIHTYKGHTRGVNAIRFTPDG-RWVVSGGEDNIVKLWDLTAGKLLHDFKCHEGQIQ  189

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
             I F   E L+A GS+   +K WDLE  ++I +     +   ++ F+P G     G +  
Sbjct  190  CIDFHPHEFLLATGSADRTVKFWDLETFELIGSAGPETTGVRSMTFNPDGRTLLCG-LHE  248

Query  563  NLKIW  577
            +LK++
Sbjct  249  SLKVF  253



>emb|CDY52222.1| BnaA01g35940D [Brassica napus]
Length=1122

 Score =   270 bits (689),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 119/158 (75%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKRGYKLQEF+AHS NVNCL  GKKT R+ +TGGDD+ VNLW+IGKPTS  +L GHTS 
Sbjct  1    MAKRGYKLQEFLAHSANVNCLSIGKKTSRLLITGGDDYKVNLWAIGKPTSLMSLCGHTSA  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            V+S+AFDSAE+LV  G+SSGLIKLWDLE+ KM+R  +GHRS C+A+EFHPFGEF ASGS 
Sbjct  61   VDSLAFDSAEVLVLGGASSGLIKLWDLEEAKMVRAFTGHRSSCSAVEFHPFGEFLASGSN  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DT+LKIWDIRKKGCI TYKGHTR I+TI+F+PDGRWVV
Sbjct  121  DTSLKIWDIRKKGCIQTYKGHTRDINTIKFSPDGRWVV  158


 Score = 77.4 bits (189),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 43/148 (29%), Positives = 67/148 (45%), Gaps = 1/148 (1%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            ++ F  H  + + + F         +G +D S+ +W I K     T  GHT  + +I F 
Sbjct  93   VRAFTGHRSSCSAVEF-HPFGEFLASGSNDTSLKIWDIRKKGCIQTYKGHTRDINTIKFS  151

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
                 V  G     +K+WDL   K+I     H     +L+FHP     A+GS D  +K W
Sbjct  152  PDGRWVVTGGLDNAVKVWDLTAGKLIHDFKFHEGSIRSLDFHPLEFLLATGSADRTVKFW  211

Query  578  DIRKKGCIHTYKGHTRGISTIRFTPDGR  661
            D+     I + +    G+ +I+F PDGR
Sbjct  212  DLETFELIGSTRPEDTGVRSIKFHPDGR  239


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/120 (28%), Positives = 60/120 (50%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +Q +  H+ ++N ++F     R  +TGG D++V +W +           H   + S+ F 
Sbjct  135  IQTYKGHTRDINTIKFSPD-GRWVVTGGLDNAVKVWDLTAGKLIHDFKFHEGSIRSLDFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   +++FHP G     G +D  LK++
Sbjct  194  PLEFLLATGSADRTVKFWDLETFELIGSTRPEDTGVRSIKFHPDGRTLFCG-LDDGLKVY  252



>ref|XP_010935618.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X2 [Elaeis guineensis]
Length=684

 Score =   264 bits (674),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 141/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS NVNCL+ G++T R+ +TGG+DH VNLW+IGKP +  +LSGHTS +E
Sbjct  5    KRAYKLQEFVAHSSNVNCLKIGRRTSRVLVTGGEDHKVNLWAIGKPNAILSLSGHTSAIE  64

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++FDS+E+LVAAG++SG IKLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DT
Sbjct  65   SVSFDSSEVLVAAGAASGTIKLWDLEEAKVVRTLTGHRSNCISVDFHPFGEFFASGSLDT  124

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIR+KGCIHTYKGHTRG++ IRFTPDGRW+V
Sbjct  125  NLKIWDIRRKGCIHTYKGHTRGVNAIRFTPDGRWIV  160


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 61/130 (47%), Gaps = 0/130 (0%)
 Frame = +2

Query  281  RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLE  460
              F +G  D ++ +W I +     T  GHT  V +I F      + +G    ++KLWDL 
Sbjct  115  EFFASGSLDTNLKIWDIRRKGCIHTYKGHTRGVNAIRFTPDGRWIVSGGEDNIVKLWDLT  174

Query  461  DTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTI  640
              K++     H      ++FHP     A+GS D  +K WD+     I +    T G+ ++
Sbjct  175  AGKLLHDFKCHEGQIQCIDFHPHEFLLATGSADKTVKFWDLETFELIGSAGPETTGVRSM  234

Query  641  RFTPDGRWVV  670
             F PDGR ++
Sbjct  235  TFNPDGRTLL  244


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/120 (27%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN +RF     R  ++GG+D+ V LW +           H   ++ I F 
Sbjct  137  IHTYKGHTRGVNAIRF-TPDGRWIVSGGEDNIVKLWDLTAGKLLHDFKCHEGQIQCIDFH  195

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   ++ F+P G     G +  +LK++
Sbjct  196  PHEFLLATGSADKTVKFWDLETFELIGSAGPETTGVRSMTFNPDGRTLLCG-LHESLKVF  254



>ref|XP_011033110.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X2 [Populus euphratica]
Length=666

 Score =   263 bits (673),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 141/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS +VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +  +LSGHTS ++
Sbjct  4    KRAYKLQEFVAHSSSVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHTSGID  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++FDS+E+LVAAG++SG IKLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DT
Sbjct  64   SVSFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIRKKGCIHTYKGHTRG++ IRFTPDGRWVV
Sbjct  124  NLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVV  159


 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 59/128 (46%), Gaps = 0/128 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GHT  V +I F      V +G     +KLWDL   
Sbjct  116  FASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNTVKLWDLTAG  175

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      ++FHP     A+GS D  +K WD+     I +    T G+  + F
Sbjct  176  KLLHDFKYHEGQIQCIDFHPHEFLLATGSADRTVKFWDLETFELIGSAGTETTGVRCLTF  235

Query  647  TPDGRWVV  670
             PDGR ++
Sbjct  236  NPDGRTLL  243


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/120 (28%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN +RF     R  ++GG+D++V LW +           H   ++ I F 
Sbjct  136  IHTYKGHTRGVNAIRF-TPDGRWVVSGGEDNTVKLWDLTAGKLLHDFKYHEGQIQCIDFH  194

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +    L F+P G     G +  +LK++
Sbjct  195  PHEFLLATGSADRTVKFWDLETFELIGSAGTETTGVRCLTFNPDGRTLLCG-LHESLKVF  253



>ref|XP_002889852.1| hypothetical protein ARALYDRAFT_471250 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66111.1| hypothetical protein ARALYDRAFT_471250 [Arabidopsis lyrata subsp. 
lyrata]
Length=1024

 Score =   269 bits (687),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 137/158 (87%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKRGYKLQEFVAHSGNVNCL  GKKT R+ LTGGDD+ VNLWSIGK TS  +L GHTSP
Sbjct  1    MAKRGYKLQEFVAHSGNVNCLSIGKKTSRLLLTGGDDYKVNLWSIGKTTSLMSLCGHTSP  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            V+S+AF+S EILV  G+SSG+IKLWDLE+ KM+R  +GHRS C+A+EFHPFGEF ASGS 
Sbjct  61   VDSVAFNSGEILVLGGASSGVIKLWDLEEAKMVRAFTGHRSNCSAVEFHPFGEFLASGSS  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DTNL++WD RKKGCI TYKGHT GISTIRF+PDGRWVV
Sbjct  121  DTNLRVWDTRKKGCIQTYKGHTCGISTIRFSPDGRWVV  158


 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 40/148 (27%), Positives = 65/148 (44%), Gaps = 1/148 (1%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            ++ F  H  N + + F         +G  D ++ +W   K     T  GHT  + +I F 
Sbjct  93   VRAFTGHRSNCSAVEF-HPFGEFLASGSSDTNLRVWDTRKKGCIQTYKGHTCGISTIRFS  151

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
                 V +G    ++K+WDL   K++     H     +L+FHP     A+GS D  +K W
Sbjct  152  PDGRWVVSGGLDNVVKVWDLTAGKLLHEFKFHEGPIRSLDFHPLEFLLATGSADRTVKFW  211

Query  578  DIRKKGCIHTYKGHTRGISTIRFTPDGR  661
            D+     I + +    G+  I F PDG+
Sbjct  212  DLETFELIGSTRPEAAGVRAIAFHPDGQ  239


 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 59/120 (49%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +Q +  H+  ++ +RF     R  ++GG D+ V +W +           H  P+ S+ F 
Sbjct  135  IQTYKGHTCGISTIRFSPD-GRWVVSGGLDNVVKVWDLTAGKLLHEFKFHEGPIRSLDFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   A+ FHP G+    G +D  LK++
Sbjct  194  PLEFLLATGSADRTVKFWDLETFELIGSTRPEAAGVRAIAFHPDGQTLFCG-LDDGLKVY  252



>ref|XP_009392835.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X4 [Musa acuminata subsp. malaccensis]
Length=761

 Score =   265 bits (678),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 114/156 (73%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS NVNCL+ G++T R+ +TGG+DH VNLW+IGKP +  +LSGH S VE
Sbjct  5    KRAYKLQEFVAHSSNVNCLKIGRRTSRVLVTGGEDHKVNLWAIGKPNAILSLSGHISAVE  64

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++FDS+E+LVAAG++SG IKLWDLE+ K++RTL+GHRS C A++FHPFGEFFASGS+DT
Sbjct  65   SVSFDSSEVLVAAGAASGSIKLWDLEEAKIVRTLTGHRSNCIAVDFHPFGEFFASGSLDT  124

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIR+KGCIHTYKGHTRG++ I+FTPDGRWVV
Sbjct  125  NLKIWDIRRKGCIHTYKGHTRGVNAIKFTPDGRWVV  160


 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 59/125 (47%), Gaps = 0/125 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I +     T  GHT  V +I F      V +G    ++KLWDL   
Sbjct  117  FASGSLDTNLKIWDIRRKGCIHTYKGHTRGVNAIKFTPDGRWVVSGGEDNIVKLWDLTAG  176

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      ++FHP     A+GS D  +K WD+     I +    T G+ ++ F
Sbjct  177  KLLHDFKFHEGQIRCIDFHPHEFLLATGSADRTVKFWDLETFELIGSAGPETSGVRSMTF  236

Query  647  TPDGR  661
             PDGR
Sbjct  237  NPDGR  241


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/120 (27%), Positives = 56/120 (47%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN ++F     R  ++GG+D+ V LW +           H   +  I F 
Sbjct  137  IHTYKGHTRGVNAIKFTPDG-RWVVSGGEDNIVKLWDLTAGKLLHDFKFHEGQIRCIDFH  195

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     S   ++ F+P G     G +  +LK++
Sbjct  196  PHEFLLATGSADRTVKFWDLETFELIGSAGPETSGVRSMTFNPDGRTLLCG-LHESLKVF  254



>ref|XP_008668688.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
[Zea mays]
Length=920

 Score =   268 bits (684),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 116/156 (74%), Positives = 138/156 (88%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS NVNCL+ G+KT R+ +TGG+DH VNLW+IGKP S  +LSGHTS VE
Sbjct  6    KRAYKLQEFVAHSSNVNCLKIGRKTSRVLVTGGEDHKVNLWAIGKPNSILSLSGHTSAVE  65

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S+ FDS E+ VAAG++SG IKLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DT
Sbjct  66   SVGFDSTEVFVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCMSVDFHPFGEFFASGSLDT  125

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIR+K CIHTYKGHTRG++TIRFTPDGRWVV
Sbjct  126  NLKIWDIRRKNCIHTYKGHTRGVNTIRFTPDGRWVV  161


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 61/128 (48%), Gaps = 0/128 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I +     T  GHT  V +I F      V +G    ++KLWDL   
Sbjct  118  FASGSLDTNLKIWDIRRKNCIHTYKGHTRGVNTIRFTPDGRWVVSGGEDNIVKLWDLTAG  177

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      ++FHP     A+GS D  +K WD+     I +    T G+ ++ F
Sbjct  178  KLLHEFKCHEGQIQCIDFHPHEFLLATGSADKTVKFWDLETFELIGSTGPETTGVRSMTF  237

Query  647  TPDGRWVV  670
             PDGR ++
Sbjct  238  NPDGRSLL  245


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 59/125 (47%), Gaps = 2/125 (2%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            +R   +  +  H+  VN +RF     R  ++GG+D+ V LW +           H   ++
Sbjct  133  RRKNCIHTYKGHTRGVNTIRFTPDG-RWVVSGGEDNIVKLWDLTAGKLLHEFKCHEGQIQ  191

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
             I F   E L+A GS+   +K WDLE  ++I +     +   ++ F+P G     G +  
Sbjct  192  CIDFHPHEFLLATGSADKTVKFWDLETFELIGSTGPETTGVRSMTFNPDGRSLLCG-LHE  250

Query  563  NLKIW  577
            +LK++
Sbjct  251  SLKVF  255



>ref|XP_009418645.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
[Musa acuminata subsp. malaccensis]
Length=775

 Score =   265 bits (678),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 114/156 (73%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS NVNCL+ G+KT R+ +TGGDD+ VN+W+IGKP +  +LSGH S VE
Sbjct  5    KRAYKLQEFVAHSSNVNCLKIGRKTSRVLVTGGDDNKVNIWAIGKPNAIMSLSGHMSAVE  64

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++FDS+E+LVAAG++SG IKLWDLE+ K+IRTL+GHRS C A++FHPFGEFFASGS+DT
Sbjct  65   SVSFDSSEVLVAAGAASGSIKLWDLEEAKIIRTLTGHRSNCIAVDFHPFGEFFASGSLDT  124

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWD+R+KGCIHTYKGHTRG++ I+FTPDGRWVV
Sbjct  125  NLKIWDMRRKGCIHTYKGHTRGVNAIKFTPDGRWVV  160


 Score = 74.3 bits (181),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 59/125 (47%), Gaps = 0/125 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W + +     T  GHT  V +I F      V +G    ++KLWDL   
Sbjct  117  FASGSLDTNLKIWDMRRKGCIHTYKGHTRGVNAIKFTPDGRWVVSGGEDNIVKLWDLTAG  176

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      ++FHP     A+GS D  +K WD+     I +    T G+ ++ F
Sbjct  177  KLLHDFKLHEGQIQCIDFHPNEFLLATGSADRTVKFWDLETFELIGSAGPETSGVRSMTF  236

Query  647  TPDGR  661
             PDGR
Sbjct  237  NPDGR  241


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/127 (28%), Positives = 61/127 (48%), Gaps = 3/127 (2%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            M ++G  +  +  H+  VN ++F     R  ++GG+D+ V LW +           H   
Sbjct  131  MRRKGC-IHTYKGHTRGVNAIKFTPDG-RWVVSGGEDNIVKLWDLTAGKLLHDFKLHEGQ  188

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            ++ I F   E L+A GS+   +K WDLE  ++I +     S   ++ F+P G     G +
Sbjct  189  IQCIDFHPNEFLLATGSADRTVKFWDLETFELIGSAGPETSGVRSMTFNPDGRTLLCG-L  247

Query  557  DTNLKIW  577
              +LKI+
Sbjct  248  HESLKIF  254



>gb|AFW59905.1| hypothetical protein ZEAMMB73_759012 [Zea mays]
Length=700

 Score =   264 bits (674),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 114/156 (73%), Positives = 137/156 (88%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAH+ NVNCL+ G+KT R+ +TGG+DH VNLW+IGKP S  +LSGHTS VE
Sbjct  6    KRAYKLQEFVAHASNVNCLKIGRKTSRVLVTGGEDHKVNLWAIGKPNSILSLSGHTSAVE  65

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S+ FDS E+ VAAG++SG IKLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DT
Sbjct  66   SVGFDSTEVFVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCMSVDFHPFGEFFASGSLDT  125

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIR+K CIHTYKGHTRG++ IRFTPDGRWVV
Sbjct  126  NLKIWDIRRKNCIHTYKGHTRGVNAIRFTPDGRWVV  161


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 61/130 (47%), Gaps = 0/130 (0%)
 Frame = +2

Query  281  RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLE  460
              F +G  D ++ +W I +     T  GHT  V +I F      V +G    ++KLWDL 
Sbjct  116  EFFASGSLDTNLKIWDIRRKNCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNIVKLWDLT  175

Query  461  DTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTI  640
              K++     H      ++FHP     A+GS D  +K WD+     I +    T G+ ++
Sbjct  176  AGKLLHEFKCHEGQIQCIDFHPHEFLLATGSADKTVKFWDLETFELIGSTGPETTGVRSM  235

Query  641  RFTPDGRWVV  670
             F PDGR ++
Sbjct  236  TFNPDGRTLL  245


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 59/125 (47%), Gaps = 2/125 (2%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            +R   +  +  H+  VN +RF     R  ++GG+D+ V LW +           H   ++
Sbjct  133  RRKNCIHTYKGHTRGVNAIRF-TPDGRWVVSGGEDNIVKLWDLTAGKLLHEFKCHEGQIQ  191

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
             I F   E L+A GS+   +K WDLE  ++I +     +   ++ F+P G     G +  
Sbjct  192  CIDFHPHEFLLATGSADKTVKFWDLETFELIGSTGPETTGVRSMTFNPDGRTLLCG-LHE  250

Query  563  NLKIW  577
            +LK++
Sbjct  251  SLKVF  255



>ref|XP_010935617.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Elaeis guineensis]
Length=781

 Score =   265 bits (678),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 141/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS NVNCL+ G++T R+ +TGG+DH VNLW+IGKP +  +LSGHTS +E
Sbjct  5    KRAYKLQEFVAHSSNVNCLKIGRRTSRVLVTGGEDHKVNLWAIGKPNAILSLSGHTSAIE  64

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++FDS+E+LVAAG++SG IKLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DT
Sbjct  65   SVSFDSSEVLVAAGAASGTIKLWDLEEAKVVRTLTGHRSNCISVDFHPFGEFFASGSLDT  124

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIR+KGCIHTYKGHTRG++ IRFTPDGRW+V
Sbjct  125  NLKIWDIRRKGCIHTYKGHTRGVNAIRFTPDGRWIV  160


 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 61/130 (47%), Gaps = 0/130 (0%)
 Frame = +2

Query  281  RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLE  460
              F +G  D ++ +W I +     T  GHT  V +I F      + +G    ++KLWDL 
Sbjct  115  EFFASGSLDTNLKIWDIRRKGCIHTYKGHTRGVNAIRFTPDGRWIVSGGEDNIVKLWDLT  174

Query  461  DTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTI  640
              K++     H      ++FHP     A+GS D  +K WD+     I +    T G+ ++
Sbjct  175  AGKLLHDFKCHEGQIQCIDFHPHEFLLATGSADKTVKFWDLETFELIGSAGPETTGVRSM  234

Query  641  RFTPDGRWVV  670
             F PDGR ++
Sbjct  235  TFNPDGRTLL  244


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 32/120 (27%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN +RF     R  ++GG+D+ V LW +           H   ++ I F 
Sbjct  137  IHTYKGHTRGVNAIRF-TPDGRWIVSGGEDNIVKLWDLTAGKLLHDFKCHEGQIQCIDFH  195

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   ++ F+P G     G +  +LK++
Sbjct  196  PHEFLLATGSADKTVKFWDLETFELIGSAGPETTGVRSMTFNPDGRTLLCG-LHESLKVF  254



>gb|AAB71474.1| contains beta-transducin motif [Arabidopsis thaliana]
Length=1184

 Score =   269 bits (688),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 140/168 (83%), Gaps = 10/168 (6%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTST---------  349
            MAKRGYKLQEF+AHS NVNCL  GKKT R+F+TGGDD+ VNLW+IGKPTS          
Sbjct  1    MAKRGYKLQEFLAHSANVNCLSIGKKTSRLFITGGDDYKVNLWAIGKPTSLMKNDAIAFY  60

Query  350  -STLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHP  526
              +L GHTS V+S+AFDSAE+LV AG+SSG+IKLWD+E+ KM+R  +GHRS C+A+EFHP
Sbjct  61   WQSLCGHTSAVDSVAFDSAEVLVLAGASSGVIKLWDVEEAKMVRAFTGHRSNCSAVEFHP  120

Query  527  FGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            FGEF ASGS D NLKIWDIRKKGCI TYKGH+RGISTIRFTPDGRWVV
Sbjct  121  FGEFLASGSSDANLKIWDIRKKGCIQTYKGHSRGISTIRFTPDGRWVV  168


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/148 (28%), Positives = 68/148 (46%), Gaps = 1/148 (1%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            ++ F  H  N + + F         +G  D ++ +W I K     T  GH+  + +I F 
Sbjct  103  VRAFTGHRSNCSAVEF-HPFGEFLASGSSDANLKIWDIRKKGCIQTYKGHSRGISTIRFT  161

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
                 V +G    ++K+WDL   K++     H     +L+FHP     A+GS D  +K W
Sbjct  162  PDGRWVVSGGLDNVVKVWDLTAGKLLHEFKFHEGPIRSLDFHPLEFLLATGSADRTVKFW  221

Query  578  DIRKKGCIHTYKGHTRGISTIRFTPDGR  661
            D+     I + +    G+ +I+F PDGR
Sbjct  222  DLETFELIGSTRPEATGVRSIKFHPDGR  249


 Score = 59.3 bits (142),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 60/120 (50%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +Q +  HS  ++ +RF     R  ++GG D+ V +W +           H  P+ S+ F 
Sbjct  145  IQTYKGHSRGISTIRFTPD-GRWVVSGGLDNVVKVWDLTAGKLLHEFKFHEGPIRSLDFH  203

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   +++FHP G     G +D +LK++
Sbjct  204  PLEFLLATGSADRTVKFWDLETFELIGSTRPEATGVRSIKFHPDGRTLFCG-LDDSLKVY  262



>ref|XP_009351341.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog, 
partial [Pyrus x bretschneideri]
Length=561

 Score =   260 bits (665),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 112/156 (72%), Positives = 142/156 (91%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS +VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +  +LSGHTS ++
Sbjct  4    KRAYKLQEFVAHSSSVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHTSGID  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++FDS+E+LVAAG++SG +KLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DT
Sbjct  64   SVSFDSSEVLVAAGAASGTVKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIRKKGCIHTYKGH+RG++TIRFTPDGRWVV
Sbjct  124  NLKIWDIRKKGCIHTYKGHSRGVNTIRFTPDGRWVV  159


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/127 (30%), Positives = 56/127 (44%), Gaps = 0/127 (0%)
 Frame = +2

Query  281  RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLE  460
              F +G  D ++ +W I K     T  GH+  V +I F      V +G     +KLWDL 
Sbjct  114  EFFASGSLDTNLKIWDIRKKGCIHTYKGHSRGVNTIRFTPDGRWVVSGGEDNTVKLWDLT  173

Query  461  DTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTI  640
              K++     H      ++FHP     A+GS D  +K WD+     I +    T G+  +
Sbjct  174  AGKLLHDFKCHEGQIQCIDFHPHEFLLATGSADRTVKFWDLETFELIGSAGPETTGVRCL  233

Query  641  RFTPDGR  661
             F  DGR
Sbjct  234  TFNSDGR  240


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/127 (28%), Positives = 58/127 (46%), Gaps = 2/127 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  HS  VN +RF     R  ++GG+D++V LW +           H   ++ I F 
Sbjct  136  IHTYKGHSRGVNTIRFTPDG-RWVVSGGEDNTVKLWDLTAGKLLHDFKCHEGQIQCIDFH  194

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +    L F+  G     G +  +LK++
Sbjct  195  PHEFLLATGSADRTVKFWDLETFELIGSAGPETTGVRCLTFNSDGRTLLCG-LHESLKVF  253

Query  578  DIRKKGC  598
                 GC
Sbjct  254  SWEPIGC  260



>ref|XP_009392833.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=780

 Score =   265 bits (677),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 114/156 (73%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS NVNCL+ G++T R+ +TGG+DH VNLW+IGKP +  +LSGH S VE
Sbjct  5    KRAYKLQEFVAHSSNVNCLKIGRRTSRVLVTGGEDHKVNLWAIGKPNAILSLSGHISAVE  64

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++FDS+E+LVAAG++SG IKLWDLE+ K++RTL+GHRS C A++FHPFGEFFASGS+DT
Sbjct  65   SVSFDSSEVLVAAGAASGSIKLWDLEEAKIVRTLTGHRSNCIAVDFHPFGEFFASGSLDT  124

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIR+KGCIHTYKGHTRG++ I+FTPDGRWVV
Sbjct  125  NLKIWDIRRKGCIHTYKGHTRGVNAIKFTPDGRWVV  160


 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 61/128 (48%), Gaps = 0/128 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I +     T  GHT  V +I F      V +G    ++KLWDL   
Sbjct  117  FASGSLDTNLKIWDIRRKGCIHTYKGHTRGVNAIKFTPDGRWVVSGGEDNIVKLWDLTAG  176

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      ++FHP     A+GS D  +K WD+     I +    T G+ ++ F
Sbjct  177  KLLHDFKFHEGQIRCIDFHPHEFLLATGSADRTVKFWDLETFELIGSAGPETSGVRSMTF  236

Query  647  TPDGRWVV  670
             PDGR ++
Sbjct  237  NPDGRTLL  244


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/120 (27%), Positives = 56/120 (47%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN ++F     R  ++GG+D+ V LW +           H   +  I F 
Sbjct  137  IHTYKGHTRGVNAIKFTPDG-RWVVSGGEDNIVKLWDLTAGKLLHDFKFHEGQIRCIDFH  195

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     S   ++ F+P G     G +  +LK++
Sbjct  196  PHEFLLATGSADRTVKFWDLETFELIGSAGPETSGVRSMTFNPDGRTLLCG-LHESLKVF  254



>ref|XP_006306661.1| hypothetical protein CARUB_v10008176mg [Capsella rubella]
 gb|EOA39559.1| hypothetical protein CARUB_v10008176mg [Capsella rubella]
Length=1024

 Score =   268 bits (685),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 119/158 (75%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MA RGYKLQEFVAHSGNVNCL  GKKT R+ LTGGDD+ VNLWSIGK TS  +L GHTSP
Sbjct  1    MANRGYKLQEFVAHSGNVNCLSIGKKTSRLLLTGGDDYKVNLWSIGKTTSLMSLCGHTSP  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            V+S+AF+SAE+LV AG+SSGLIKLWDL++ KM+R  +GHRS C A+EFHPFG+F ASGS 
Sbjct  61   VDSLAFNSAEVLVLAGASSGLIKLWDLQEAKMVRAFTGHRSNCCAVEFHPFGDFLASGSS  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DTNL++WD RKKGCI TYKGHTRGI+TI+F+PDGRWVV
Sbjct  121  DTNLRVWDTRKKGCIQTYKGHTRGITTIKFSPDGRWVV  158


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/148 (27%), Positives = 64/148 (43%), Gaps = 1/148 (1%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            ++ F  H  N   + F         +G  D ++ +W   K     T  GHT  + +I F 
Sbjct  93   VRAFTGHRSNCCAVEF-HPFGDFLASGSSDTNLRVWDTRKKGCIQTYKGHTRGITTIKFS  151

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
                 V +G    ++K+WDL   K++     H     +L+FHP     A+GS D  +K W
Sbjct  152  PDGRWVVSGGLDNVVKVWDLTAGKLLHEFKFHEGPIRSLDFHPLEFLLATGSADGTVKFW  211

Query  578  DIRKKGCIHTYKGHTRGISTIRFTPDGR  661
            D+     I + +    G+  I F PDG+
Sbjct  212  DLETFELIGSTRPEATGVRAITFHPDGQ  239


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 59/120 (49%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +Q +  H+  +  ++F     R  ++GG D+ V +W +           H  P+ S+ F 
Sbjct  135  IQTYKGHTRGITTIKFSPDG-RWVVSGGLDNVVKVWDLTAGKLLHEFKFHEGPIRSLDFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+ G +K WDLE  ++I +     +   A+ FHP G+    G +D  LK++
Sbjct  194  PLEFLLATGSADGTVKFWDLETFELIGSTRPEATGVRAITFHPDGQTLFCG-LDDGLKVY  252



>gb|KHG16229.1| hypothetical protein F383_04189 [Gossypium arboreum]
Length=852

 Score =   266 bits (680),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 114/156 (73%), Positives = 142/156 (91%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS +VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +  +LSGHTS ++
Sbjct  4    KRAYKLQEFVAHSSSVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHTSGID  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++FDS+E+LVAAG++SG IKLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DT
Sbjct  64   SVSFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIRKKGCIHTYKGHTRG++TIRFTPDGRWVV
Sbjct  124  NLKIWDIRKKGCIHTYKGHTRGVNTIRFTPDGRWVV  159


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 60/128 (47%), Gaps = 0/128 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GHT  V +I F      V +G    ++K+WDL   
Sbjct  116  FASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNTIRFTPDGRWVVSGGEDNIVKVWDLTAG  175

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      L+FHP     A+GS D  +K WD+     I +    T G+  + F
Sbjct  176  KLLHDFKYHEGQIQCLDFHPHEFLLATGSADRTVKFWDLETFELIGSAGPETTGVRCLTF  235

Query  647  TPDGRWVV  670
             PDGR V+
Sbjct  236  NPDGRTVL  243



>gb|KDP33053.1| hypothetical protein JCGZ_13639 [Jatropha curcas]
Length=806

 Score =   265 bits (678),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 114/156 (73%), Positives = 141/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS +VNCL+ G+K+ R+ LTGG+DH VNLW+IGKP +  +LSGHTS ++
Sbjct  4    KRAYKLQEFVAHSSSVNCLKIGRKSSRVLLTGGEDHKVNLWAIGKPNAILSLSGHTSGID  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++FDS+E+LVAAG++SG IKLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DT
Sbjct  64   SVSFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIRKKGCIHTYKGHTRG++ IRFTPDGRWVV
Sbjct  124  NLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVV  159


 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 57/125 (46%), Gaps = 0/125 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GHT  V +I F      V +G     +KLWDL   
Sbjct  116  FASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNTVKLWDLTAG  175

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      ++FHP     A+GS D  +K WD+     I +    T G+  + F
Sbjct  176  KLLHDFKCHEGQVQCIDFHPHEFLLATGSADRTVKFWDLETFELIGSAGPETTGVRCLTF  235

Query  647  TPDGR  661
             PDGR
Sbjct  236  NPDGR  240


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN +RF     R  ++GG+D++V LW +           H   V+ I F 
Sbjct  136  IHTYKGHTRGVNAIRF-TPDGRWVVSGGEDNTVKLWDLTAGKLLHDFKCHEGQVQCIDFH  194

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +    L F+P G     G +  NLK++
Sbjct  195  PHEFLLATGSADRTVKFWDLETFELIGSAGPETTGVRCLTFNPDGRTLLCG-LHENLKVF  253



>gb|AFW59901.1| hypothetical protein ZEAMMB73_759012, partial [Zea mays]
Length=695

 Score =   263 bits (672),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 114/156 (73%), Positives = 137/156 (88%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAH+ NVNCL+ G+KT R+ +TGG+DH VNLW+IGKP S  +LSGHTS VE
Sbjct  6    KRAYKLQEFVAHASNVNCLKIGRKTSRVLVTGGEDHKVNLWAIGKPNSILSLSGHTSAVE  65

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S+ FDS E+ VAAG++SG IKLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DT
Sbjct  66   SVGFDSTEVFVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCMSVDFHPFGEFFASGSLDT  125

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIR+K CIHTYKGHTRG++ IRFTPDGRWVV
Sbjct  126  NLKIWDIRRKNCIHTYKGHTRGVNAIRFTPDGRWVV  161


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 61/130 (47%), Gaps = 0/130 (0%)
 Frame = +2

Query  281  RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLE  460
              F +G  D ++ +W I +     T  GHT  V +I F      V +G    ++KLWDL 
Sbjct  116  EFFASGSLDTNLKIWDIRRKNCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNIVKLWDLT  175

Query  461  DTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTI  640
              K++     H      ++FHP     A+GS D  +K WD+     I +    T G+ ++
Sbjct  176  AGKLLHEFKCHEGQIQCIDFHPHEFLLATGSADKTVKFWDLETFELIGSTGPETTGVRSM  235

Query  641  RFTPDGRWVV  670
             F PDGR ++
Sbjct  236  TFNPDGRTLL  245


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 59/125 (47%), Gaps = 2/125 (2%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            +R   +  +  H+  VN +RF     R  ++GG+D+ V LW +           H   ++
Sbjct  133  RRKNCIHTYKGHTRGVNAIRFTPDG-RWVVSGGEDNIVKLWDLTAGKLLHEFKCHEGQIQ  191

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
             I F   E L+A GS+   +K WDLE  ++I +     +   ++ F+P G     G +  
Sbjct  192  CIDFHPHEFLLATGSADKTVKFWDLETFELIGSTGPETTGVRSMTFNPDGRTLLCG-LHE  250

Query  563  NLKIW  577
            +LK++
Sbjct  251  SLKVF  255



>ref|XP_008800146.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
[Phoenix dactylifera]
Length=839

 Score =   265 bits (678),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 139/158 (88%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKRGYKLQEF+AH+ +V CL  GKK+ R+F+TGG+D  VNLW+IGKPT   +L GHTS 
Sbjct  1    MAKRGYKLQEFIAHTSDVKCLNIGKKSSRVFVTGGEDRKVNLWAIGKPTPLLSLCGHTSA  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            VES+AFDSAE+LV AGSSSG IKLWDLE+ K++RTLSGHR  CT++EFHPFGEFFASGS 
Sbjct  61   VESVAFDSAEVLVLAGSSSGTIKLWDLEEAKIVRTLSGHRFNCTSVEFHPFGEFFASGSS  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DT+LKIWDIRKKGCIHTYKGHTRGI TI+FTPDGRWVV
Sbjct  121  DTDLKIWDIRKKGCIHTYKGHTRGIRTIKFTPDGRWVV  158


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/127 (30%), Positives = 57/127 (45%), Gaps = 0/127 (0%)
 Frame = +2

Query  281  RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLE  460
              F +G  D  + +W I K     T  GHT  + +I F      V  G    ++KLWDL 
Sbjct  113  EFFASGSSDTDLKIWDIRKKGCIHTYKGHTRGIRTIKFTPDGRWVVTGGEDNVVKLWDLT  172

Query  461  DTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTI  640
              K++     H+     ++FHP     A+GS D  +K WD+     I +      G+ ++
Sbjct  173  AGKLLHDFKFHKGQIRCIDFHPHEFLLATGSADRTVKFWDLETFELIGSAGPEVTGVRSM  232

Query  641  RFTPDGR  661
             F PDGR
Sbjct  233  IFHPDGR  239


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/120 (27%), Positives = 55/120 (46%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  +  ++F     R  +TGG+D+ V LW +           H   +  I F 
Sbjct  135  IHTYKGHTRGIRTIKFTPDG-RWVVTGGEDNVVKLWDLTAGKLLHDFKFHKGQIRCIDFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   ++ FHP G     G +D  LK++
Sbjct  194  PHEFLLATGSADRTVKFWDLETFELIGSAGPEVTGVRSMIFHPDGRTLFCG-LDVTLKVF  252



>ref|XP_006653028.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
[Oryza brachyantha]
Length=937

 Score =   266 bits (681),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 115/156 (74%), Positives = 137/156 (88%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS NVNCL+ G+KT R+ +TGG+DH VNLW+IGKP S  +LSGHTS VE
Sbjct  6    KRAYKLQEFVAHSSNVNCLKIGRKTSRVLVTGGEDHKVNLWAIGKPNSILSLSGHTSAVE  65

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S+ FDS E+ VA G++SG IKLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DT
Sbjct  66   SVNFDSTEVFVAGGAASGTIKLWDLEEAKIVRTLTGHRSNCMSVDFHPFGEFFASGSLDT  125

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIR+KGCIHTYKGHTRG++ IRFTPDGRWVV
Sbjct  126  NLKIWDIRRKGCIHTYKGHTRGVNAIRFTPDGRWVV  161


 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 61/128 (48%), Gaps = 0/128 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I +     T  GHT  V +I F      V +G    ++KLWDL   
Sbjct  118  FASGSLDTNLKIWDIRRKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNVVKLWDLTAG  177

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      ++FHP     A+GS D  +K WD+     I +    T G+ ++ F
Sbjct  178  KLLHDFKCHEGQIQCIDFHPHEFLLATGSADKTVKFWDLETFELIGSTGPETTGVRSMTF  237

Query  647  TPDGRWVV  670
             PDGR ++
Sbjct  238  NPDGRSLL  245


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/120 (27%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN +RF     R  ++GG+D+ V LW +           H   ++ I F 
Sbjct  138  IHTYKGHTRGVNAIRF-TPDGRWVVSGGEDNVVKLWDLTAGKLLHDFKCHEGQIQCIDFH  196

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   ++ F+P G     G +  +LK++
Sbjct  197  PHEFLLATGSADKTVKFWDLETFELIGSTGPETTGVRSMTFNPDGRSLLCG-LHESLKVF  255



>ref|XP_008802561.1| PREDICTED: LOW QUALITY PROTEIN: katanin p80 WD40 repeat-containing 
subunit B1 homolog [Phoenix dactylifera]
Length=781

 Score =   264 bits (675),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 112/156 (72%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS NVNCL+ G++T R+ +TGG+DH VN+W+IGKP +   LSGHTS +E
Sbjct  5    KRAYKLQEFVAHSSNVNCLKIGRRTSRVLVTGGEDHKVNIWAIGKPNAILNLSGHTSAIE  64

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++FDS+E+LVAAG++SG IKLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DT
Sbjct  65   SVSFDSSEVLVAAGAASGTIKLWDLEEAKVVRTLTGHRSNCISVDFHPFGEFFASGSLDT  124

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIR+KGCIHTYKGHTRG++ IRFTPDGRW+V
Sbjct  125  NLKIWDIRRKGCIHTYKGHTRGVNAIRFTPDGRWIV  160


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 61/130 (47%), Gaps = 0/130 (0%)
 Frame = +2

Query  281  RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLE  460
              F +G  D ++ +W I +     T  GHT  V +I F      + +G    ++KLWDL 
Sbjct  115  EFFASGSLDTNLKIWDIRRKGCIHTYKGHTRGVNAIRFTPDGRWIVSGGEDNIVKLWDLT  174

Query  461  DTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTI  640
              K++     H      ++FHP     A+GS D  +K WD+     I +    T G+ ++
Sbjct  175  AGKLLHDFKCHEGQIQCIDFHPHEFLLATGSADKTVKFWDLETFELIGSAGPETTGVRSM  234

Query  641  RFTPDGRWVV  670
             F PDGR ++
Sbjct  235  TFNPDGRTLL  244


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 32/120 (27%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN +RF     R  ++GG+D+ V LW +           H   ++ I F 
Sbjct  137  IHTYKGHTRGVNAIRF-TPDGRWIVSGGEDNIVKLWDLTAGKLLHDFKCHEGQIQCIDFH  195

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   ++ F+P G     G +  +LK++
Sbjct  196  PHEFLLATGSADKTVKFWDLETFELIGSAGPETTGVRSMTFNPDGRTLLCG-LHESLKVF  254



>gb|AFW59902.1| hypothetical protein ZEAMMB73_759012 [Zea mays]
 gb|AFW59903.1| hypothetical protein ZEAMMB73_759012 [Zea mays]
Length=808

 Score =   265 bits (676),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 114/156 (73%), Positives = 137/156 (88%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAH+ NVNCL+ G+KT R+ +TGG+DH VNLW+IGKP S  +LSGHTS VE
Sbjct  6    KRAYKLQEFVAHASNVNCLKIGRKTSRVLVTGGEDHKVNLWAIGKPNSILSLSGHTSAVE  65

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S+ FDS E+ VAAG++SG IKLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DT
Sbjct  66   SVGFDSTEVFVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCMSVDFHPFGEFFASGSLDT  125

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIR+K CIHTYKGHTRG++ IRFTPDGRWVV
Sbjct  126  NLKIWDIRRKNCIHTYKGHTRGVNAIRFTPDGRWVV  161


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 61/128 (48%), Gaps = 0/128 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I +     T  GHT  V +I F      V +G    ++KLWDL   
Sbjct  118  FASGSLDTNLKIWDIRRKNCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNIVKLWDLTAG  177

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      ++FHP     A+GS D  +K WD+     I +    T G+ ++ F
Sbjct  178  KLLHEFKCHEGQIQCIDFHPHEFLLATGSADKTVKFWDLETFELIGSTGPETTGVRSMTF  237

Query  647  TPDGRWVV  670
             PDGR ++
Sbjct  238  NPDGRTLL  245


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 59/125 (47%), Gaps = 2/125 (2%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            +R   +  +  H+  VN +RF     R  ++GG+D+ V LW +           H   ++
Sbjct  133  RRKNCIHTYKGHTRGVNAIRF-TPDGRWVVSGGEDNIVKLWDLTAGKLLHEFKCHEGQIQ  191

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
             I F   E L+A GS+   +K WDLE  ++I +     +   ++ F+P G     G +  
Sbjct  192  CIDFHPHEFLLATGSADKTVKFWDLETFELIGSTGPETTGVRSMTFNPDGRTLLCG-LHE  250

Query  563  NLKIW  577
            +LK++
Sbjct  251  SLKVF  255



>ref|XP_009351775.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X3 [Pyrus x bretschneideri]
Length=728

 Score =   263 bits (672),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS  VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +  +LSGHTS ++
Sbjct  4    KRAYKLQEFVAHSAAVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNALLSLSGHTSGID  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++FDS+E+LVAAG++SG IKLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DT
Sbjct  64   SVSFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIRKKGCIHTYKGHTRG++ IRFTPDGRWVV
Sbjct  124  NLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVV  159


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/130 (31%), Positives = 61/130 (47%), Gaps = 0/130 (0%)
 Frame = +2

Query  281  RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLE  460
              F +G  D ++ +W I K     T  GHT  V +I F      V +G     +KLWDL 
Sbjct  114  EFFASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNTVKLWDLT  173

Query  461  DTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTI  640
              K++     H      ++FHP     A+GS D  +K WD+     I +    T G+ ++
Sbjct  174  AGKLLHDFKCHEGQVQCIDFHPHEFLLATGSADRTVKFWDLETFELIGSAGPETTGVRSL  233

Query  641  RFTPDGRWVV  670
             F+PDGR ++
Sbjct  234  TFSPDGRALL  243


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN +RF     R  ++GG+D++V LW +           H   V+ I F 
Sbjct  136  IHTYKGHTRGVNAIRF-TPDGRWVVSGGEDNTVKLWDLTAGKLLHDFKCHEGQVQCIDFH  194

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   +L F P G     G +  +LK++
Sbjct  195  PHEFLLATGSADRTVKFWDLETFELIGSAGPETTGVRSLTFSPDGRALLCG-LHESLKVF  253



>ref|XP_006468674.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X3 [Citrus sinensis]
Length=811

 Score =   264 bits (675),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS  VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +  +LSGHTS ++
Sbjct  4    KRAYKLQEFVAHSSTVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHTSGID  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++FDS+E+LVAAG++SG IKLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DT
Sbjct  64   SVSFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIRKKGCIHTYKGHTRG++ IRFTPDGRWVV
Sbjct  124  NLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVV  159


 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 57/125 (46%), Gaps = 0/125 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GHT  V +I F      V +G     +KLWDL   
Sbjct  116  FASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNTVKLWDLTAG  175

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      ++FHP     A+GS D  +K WD+     I +    T G+  + F
Sbjct  176  KLLHDFKCHEGQIQCIDFHPHEFLLATGSADRTVKFWDLETFELIGSAGPETSGVRCLTF  235

Query  647  TPDGR  661
             PDGR
Sbjct  236  NPDGR  240


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN +RF     R  ++GG+D++V LW +           H   ++ I F 
Sbjct  136  IHTYKGHTRGVNAIRFTPDG-RWVVSGGEDNTVKLWDLTAGKLLHDFKCHEGQIQCIDFH  194

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     S    L F+P G     G +  +LK++
Sbjct  195  PHEFLLATGSADRTVKFWDLETFELIGSAGPETSGVRCLTFNPDGRTLLCG-LHESLKVF  253



>gb|KDO77056.1| hypothetical protein CISIN_1g003448mg [Citrus sinensis]
Length=811

 Score =   264 bits (675),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS  VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +  +LSGHTS ++
Sbjct  4    KRAYKLQEFVAHSSTVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHTSGID  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++FDS+E+LVAAG++SG IKLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DT
Sbjct  64   SVSFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIRKKGCIHTYKGHTRG++ IRFTPDGRWVV
Sbjct  124  NLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVV  159


 Score = 74.7 bits (182),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 57/125 (46%), Gaps = 0/125 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GHT  V +I F      V +G     +KLWDL   
Sbjct  116  FASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNTVKLWDLTAG  175

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      ++FHP     A+GS D  +K WD+     I +    T G+  + F
Sbjct  176  KLLHDFKCHEGQIQCIDFHPHEFLLATGSADRTVKFWDLETFELIGSAGPETSGVRCLTF  235

Query  647  TPDGR  661
             PDGR
Sbjct  236  NPDGR  240


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN +RF     R  ++GG+D++V LW +           H   ++ I F 
Sbjct  136  IHTYKGHTRGVNAIRFTPDG-RWVVSGGEDNTVKLWDLTAGKLLHDFKCHEGQIQCIDFH  194

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     S    L F+P G     G +  +LK++
Sbjct  195  PHEFLLATGSADRTVKFWDLETFELIGSAGPETSGVRCLTFNPDGRTLLCG-LHESLKVF  253



>ref|XP_010940397.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X2 [Elaeis guineensis]
Length=650

 Score =   261 bits (667),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 114/156 (73%), Positives = 138/156 (88%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS NVNCL+ G++T R+ +TGG+DH VNLWSIGKP +  +LSGHTS VE
Sbjct  5    KRAYKLQEFVAHSSNVNCLKIGRRTSRVLVTGGEDHKVNLWSIGKPNAILSLSGHTSAVE  64

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++FDS+E+LVAAG++SG IKLWDLE+ K++RTL+GHRS C +++FHPFGEF ASGS DT
Sbjct  65   SVSFDSSEVLVAAGAASGTIKLWDLEEAKVVRTLTGHRSNCVSVDFHPFGEFLASGSSDT  124

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIR+K CIHTYKGHTRG++ IRFTPDGRWVV
Sbjct  125  NLKIWDIRRKSCIHTYKGHTRGVNAIRFTPDGRWVV  160


 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 40/138 (29%), Positives = 63/138 (46%), Gaps = 1/138 (1%)
 Frame = +2

Query  251  NCLRFGKKTCRMFL-TGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGS  427
            NC+         FL +G  D ++ +W I + +   T  GHT  V +I F      V +G 
Sbjct  104  NCVSVDFHPFGEFLASGSSDTNLKIWDIRRKSCIHTYKGHTRGVNAIRFTPDGRWVVSGG  163

Query  428  SSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHT  607
               ++KLWDL   K++     H      ++FHP     A+GS D  +K WD+     + +
Sbjct  164  EDNVVKLWDLTAGKLLHDFKCHEGQIQCIDFHPHEFLLATGSADRTVKFWDLETFELVGS  223

Query  608  YKGHTRGISTIRFTPDGR  661
                  G+ ++ F PDGR
Sbjct  224  AGPEATGVRSMTFNPDGR  241


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 59/125 (47%), Gaps = 2/125 (2%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            +R   +  +  H+  VN +RF     R  ++GG+D+ V LW +           H   ++
Sbjct  132  RRKSCIHTYKGHTRGVNAIRFTPDG-RWVVSGGEDNVVKLWDLTAGKLLHDFKCHEGQIQ  190

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
             I F   E L+A GS+   +K WDLE  +++ +     +   ++ F+P G     G  +T
Sbjct  191  CIDFHPHEFLLATGSADRTVKFWDLETFELVGSAGPEATGVRSMTFNPDGRNLLCGLHET  250

Query  563  NLKIW  577
             LK++
Sbjct  251  -LKVF  254



>ref|XP_002311885.1| hypothetical protein POPTR_0008s00290g [Populus trichocarpa]
 gb|EEE89252.1| hypothetical protein POPTR_0008s00290g [Populus trichocarpa]
Length=802

 Score =   264 bits (675),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 114/156 (73%), Positives = 141/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS +VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +  +LSGHTS ++
Sbjct  4    KRAYKLQEFVAHSSSVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHTSGID  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++FDS+E+LVAAG++SG IKLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DT
Sbjct  64   SVSFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIRKKGCIHTYKGHTRG+S IRFTPDGRWVV
Sbjct  124  NLKIWDIRKKGCIHTYKGHTRGVSAIRFTPDGRWVV  159


 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 59/128 (46%), Gaps = 0/128 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GHT  V +I F      V +G     +KLWDL   
Sbjct  116  FASGSLDTNLKIWDIRKKGCIHTYKGHTRGVSAIRFTPDGRWVVSGGEDNTVKLWDLTAG  175

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      ++FHP     A+GS D  +K WD+     I +    T G+  + F
Sbjct  176  KLLHDFKYHEGQIQCIDFHPHEFLLATGSADRTVKFWDLETFELIGSAGTETTGVRCLTF  235

Query  647  TPDGRWVV  670
             PDGR ++
Sbjct  236  NPDGRTLL  243


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/120 (27%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  V+ +RF     R  ++GG+D++V LW +           H   ++ I F 
Sbjct  136  IHTYKGHTRGVSAIRFTPDG-RWVVSGGEDNTVKLWDLTAGKLLHDFKYHEGQIQCIDFH  194

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +    L F+P G     G +  +LK++
Sbjct  195  PHEFLLATGSADRTVKFWDLETFELIGSAGTETTGVRCLTFNPDGRTLLCG-LHESLKVF  253



>gb|KDO77057.1| hypothetical protein CISIN_1g003448mg [Citrus sinensis]
Length=818

 Score =   264 bits (675),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS  VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +  +LSGHTS ++
Sbjct  4    KRAYKLQEFVAHSSTVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHTSGID  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++FDS+E+LVAAG++SG IKLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DT
Sbjct  64   SVSFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIRKKGCIHTYKGHTRG++ IRFTPDGRWVV
Sbjct  124  NLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVV  159


 Score = 74.7 bits (182),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 57/125 (46%), Gaps = 0/125 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GHT  V +I F      V +G     +KLWDL   
Sbjct  116  FASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNTVKLWDLTAG  175

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      ++FHP     A+GS D  +K WD+     I +    T G+  + F
Sbjct  176  KLLHDFKCHEGQIQCIDFHPHEFLLATGSADRTVKFWDLETFELIGSAGPETSGVRCLTF  235

Query  647  TPDGR  661
             PDGR
Sbjct  236  NPDGR  240


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN +RF     R  ++GG+D++V LW +           H   ++ I F 
Sbjct  136  IHTYKGHTRGVNAIRFTPDG-RWVVSGGEDNTVKLWDLTAGKLLHDFKCHEGQIQCIDFH  194

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     S    L F+P G     G +  +LK++
Sbjct  195  PHEFLLATGSADRTVKFWDLETFELIGSAGPETSGVRCLTFNPDGRTLLCG-LHESLKVF  253



>ref|XP_006468673.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X2 [Citrus sinensis]
Length=818

 Score =   264 bits (675),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS  VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +  +LSGHTS ++
Sbjct  4    KRAYKLQEFVAHSSTVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHTSGID  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++FDS+E+LVAAG++SG IKLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DT
Sbjct  64   SVSFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIRKKGCIHTYKGHTRG++ IRFTPDGRWVV
Sbjct  124  NLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVV  159


 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 57/125 (46%), Gaps = 0/125 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GHT  V +I F      V +G     +KLWDL   
Sbjct  116  FASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNTVKLWDLTAG  175

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      ++FHP     A+GS D  +K WD+     I +    T G+  + F
Sbjct  176  KLLHDFKCHEGQIQCIDFHPHEFLLATGSADRTVKFWDLETFELIGSAGPETSGVRCLTF  235

Query  647  TPDGR  661
             PDGR
Sbjct  236  NPDGR  240


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN +RF     R  ++GG+D++V LW +           H   ++ I F 
Sbjct  136  IHTYKGHTRGVNAIRFTPDG-RWVVSGGEDNTVKLWDLTAGKLLHDFKCHEGQIQCIDFH  194

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     S    L F+P G     G +  +LK++
Sbjct  195  PHEFLLATGSADRTVKFWDLETFELIGSAGPETSGVRCLTFNPDGRTLLCG-LHESLKVF  253



>ref|XP_006468672.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Citrus sinensis]
Length=819

 Score =   264 bits (675),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS  VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +  +LSGHTS ++
Sbjct  4    KRAYKLQEFVAHSSTVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHTSGID  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++FDS+E+LVAAG++SG IKLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DT
Sbjct  64   SVSFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIRKKGCIHTYKGHTRG++ IRFTPDGRWVV
Sbjct  124  NLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVV  159


 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 57/125 (46%), Gaps = 0/125 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GHT  V +I F      V +G     +KLWDL   
Sbjct  116  FASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNTVKLWDLTAG  175

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      ++FHP     A+GS D  +K WD+     I +    T G+  + F
Sbjct  176  KLLHDFKCHEGQIQCIDFHPHEFLLATGSADRTVKFWDLETFELIGSAGPETSGVRCLTF  235

Query  647  TPDGR  661
             PDGR
Sbjct  236  NPDGR  240


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN +RF     R  ++GG+D++V LW +           H   ++ I F 
Sbjct  136  IHTYKGHTRGVNAIRFTPDG-RWVVSGGEDNTVKLWDLTAGKLLHDFKCHEGQIQCIDFH  194

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     S    L F+P G     G +  +LK++
Sbjct  195  PHEFLLATGSADRTVKFWDLETFELIGSAGPETSGVRCLTFNPDGRTLLCG-LHESLKVF  253



>gb|KDO77058.1| hypothetical protein CISIN_1g003448mg [Citrus sinensis]
 gb|KDO77059.1| hypothetical protein CISIN_1g003448mg [Citrus sinensis]
Length=819

 Score =   264 bits (675),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS  VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +  +LSGHTS ++
Sbjct  4    KRAYKLQEFVAHSSTVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHTSGID  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++FDS+E+LVAAG++SG IKLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DT
Sbjct  64   SVSFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIRKKGCIHTYKGHTRG++ IRFTPDGRWVV
Sbjct  124  NLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVV  159


 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 57/125 (46%), Gaps = 0/125 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GHT  V +I F      V +G     +KLWDL   
Sbjct  116  FASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNTVKLWDLTAG  175

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      ++FHP     A+GS D  +K WD+     I +    T G+  + F
Sbjct  176  KLLHDFKCHEGQIQCIDFHPHEFLLATGSADRTVKFWDLETFELIGSAGPETSGVRCLTF  235

Query  647  TPDGR  661
             PDGR
Sbjct  236  NPDGR  240


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN +RF     R  ++GG+D++V LW +           H   ++ I F 
Sbjct  136  IHTYKGHTRGVNAIRFTPDG-RWVVSGGEDNTVKLWDLTAGKLLHDFKCHEGQIQCIDFH  194

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     S    L F+P G     G +  +LK++
Sbjct  195  PHEFLLATGSADRTVKFWDLETFELIGSAGPETSGVRCLTFNPDGRTLLCG-LHESLKVF  253



>ref|XP_006448506.1| hypothetical protein CICLE_v10014294mg [Citrus clementina]
 gb|ESR61746.1| hypothetical protein CICLE_v10014294mg [Citrus clementina]
Length=818

 Score =   264 bits (675),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS  VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +  +LSGHTS ++
Sbjct  4    KRAYKLQEFVAHSSTVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHTSGID  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++FDS+E+LVAAG++SG IKLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DT
Sbjct  64   SVSFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIRKKGCIHTYKGHTRG++ IRFTPDGRWVV
Sbjct  124  NLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVV  159


 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 57/125 (46%), Gaps = 0/125 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GHT  V +I F      V +G     +KLWDL   
Sbjct  116  FASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNTVKLWDLTAG  175

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      ++FHP     A+GS D  +K WD+     I +    T G+  + F
Sbjct  176  KLLHDFKCHEGQIQCIDFHPHEFLLATGSADRTVKFWDLETFELIGSAGPETSGVRCLTF  235

Query  647  TPDGR  661
             PDGR
Sbjct  236  NPDGR  240


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN +RF     R  ++GG+D++V LW +           H   ++ I F 
Sbjct  136  IHTYKGHTRGVNAIRFTPDG-RWVVSGGEDNTVKLWDLTAGKLLHDFKCHEGQIQCIDFH  194

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     S    L F+P G     G +  +LK++
Sbjct  195  PHEFLLATGSADRTVKFWDLETFELIGSAGPETSGVRCLTFNPDGRTLLCG-LHESLKVF  253



>ref|XP_011033108.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Populus euphratica]
 ref|XP_011033109.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Populus euphratica]
Length=806

 Score =   264 bits (674),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 141/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS +VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +  +LSGHTS ++
Sbjct  4    KRAYKLQEFVAHSSSVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHTSGID  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++FDS+E+LVAAG++SG IKLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DT
Sbjct  64   SVSFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIRKKGCIHTYKGHTRG++ IRFTPDGRWVV
Sbjct  124  NLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVV  159


 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 59/128 (46%), Gaps = 0/128 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GHT  V +I F      V +G     +KLWDL   
Sbjct  116  FASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNTVKLWDLTAG  175

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      ++FHP     A+GS D  +K WD+     I +    T G+  + F
Sbjct  176  KLLHDFKYHEGQIQCIDFHPHEFLLATGSADRTVKFWDLETFELIGSAGTETTGVRCLTF  235

Query  647  TPDGRWVV  670
             PDGR ++
Sbjct  236  NPDGRTLL  243


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/120 (28%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN +RF     R  ++GG+D++V LW +           H   ++ I F 
Sbjct  136  IHTYKGHTRGVNAIRFTPDG-RWVVSGGEDNTVKLWDLTAGKLLHDFKYHEGQIQCIDFH  194

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +    L F+P G     G +  +LK++
Sbjct  195  PHEFLLATGSADRTVKFWDLETFELIGSAGTETTGVRCLTFNPDGRTLLCG-LHESLKVF  253



>ref|XP_011463422.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X4 [Fragaria vesca subsp. vesca]
Length=796

 Score =   263 bits (673),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAH+  VNCL+ G+KT R+ +TGG+DH VNLW+IGKP +  +LSGHTS ++
Sbjct  4    KRAYKLQEFVAHTSAVNCLKIGRKTSRVLVTGGEDHKVNLWAIGKPNALLSLSGHTSGID  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++FDS+E+LVAAG++SG IKLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DT
Sbjct  64   SVSFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIRKKGCIHTYKGHTRG++ IRFTPDGRWVV
Sbjct  124  NLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVV  159


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 61/128 (48%), Gaps = 0/128 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GHT  V +I F      V +G     +KLWDL   
Sbjct  116  FASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNTVKLWDLTAG  175

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      ++FHP     A+GS D  +K WD+     I +    T G+ ++ F
Sbjct  176  KLLHDFKCHEGQIQCIDFHPHEFLLATGSADRTVKFWDLETFELIGSAGPETTGVRSLTF  235

Query  647  TPDGRWVV  670
            +PDGR ++
Sbjct  236  SPDGRALL  243


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/120 (28%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN +RF     R  ++GG+D++V LW +           H   ++ I F 
Sbjct  136  IHTYKGHTRGVNAIRFTPDG-RWVVSGGEDNTVKLWDLTAGKLLHDFKCHEGQIQCIDFH  194

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   +L F P G     G +  +LK++
Sbjct  195  PHEFLLATGSADRTVKFWDLETFELIGSAGPETTGVRSLTFSPDGRALLCG-LHESLKVF  253



>ref|XP_011463423.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X5 [Fragaria vesca subsp. vesca]
Length=795

 Score =   263 bits (673),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAH+  VNCL+ G+KT R+ +TGG+DH VNLW+IGKP +  +LSGHTS ++
Sbjct  4    KRAYKLQEFVAHTSAVNCLKIGRKTSRVLVTGGEDHKVNLWAIGKPNALLSLSGHTSGID  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++FDS+E+LVAAG++SG IKLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DT
Sbjct  64   SVSFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIRKKGCIHTYKGHTRG++ IRFTPDGRWVV
Sbjct  124  NLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVV  159


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 61/128 (48%), Gaps = 0/128 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GHT  V +I F      V +G     +KLWDL   
Sbjct  116  FASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNTVKLWDLTAG  175

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      ++FHP     A+GS D  +K WD+     I +    T G+ ++ F
Sbjct  176  KLLHDFKCHEGQIQCIDFHPHEFLLATGSADRTVKFWDLETFELIGSAGPETTGVRSLTF  235

Query  647  TPDGRWVV  670
            +PDGR ++
Sbjct  236  SPDGRALL  243


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/120 (28%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN +RF     R  ++GG+D++V LW +           H   ++ I F 
Sbjct  136  IHTYKGHTRGVNAIRFTPDG-RWVVSGGEDNTVKLWDLTAGKLLHDFKCHEGQIQCIDFH  194

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   +L F P G     G +  +LK++
Sbjct  195  PHEFLLATGSADRTVKFWDLETFELIGSAGPETTGVRSLTFSPDGRALLCG-LHESLKVF  253



>gb|KJB34818.1| hypothetical protein B456_006G086000 [Gossypium raimondii]
 gb|KJB34819.1| hypothetical protein B456_006G086000 [Gossypium raimondii]
Length=781

 Score =   263 bits (672),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 117/158 (74%), Positives = 137/158 (87%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKRGYKLQE VAH+ NVNCL  GKKTC++ +TGGDDH V +W+IGK TS  +L GH+SP
Sbjct  1    MAKRGYKLQEIVAHTANVNCLSIGKKTCKLLITGGDDHKVYVWAIGKTTSLMSLCGHSSP  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            VES+ FDS E+ V AG+S+G IKLWDLE+TKM+R  +GHRS CTA++FHPFGEFFASGSM
Sbjct  61   VESLVFDSEEVSVLAGASTGAIKLWDLEETKMVRGFTGHRSNCTAMDFHPFGEFFASGSM  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            D +LKIWDIRKKGCIHTYK HTRGIS+IRF+PDGRWVV
Sbjct  121  DRSLKIWDIRKKGCIHTYKSHTRGISSIRFSPDGRWVV  158


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/145 (29%), Positives = 64/145 (44%), Gaps = 1/145 (1%)
 Frame = +2

Query  227  FVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAE  406
            F  H  N   + F       F +G  D S+ +W I K     T   HT  + SI F    
Sbjct  96   FTGHRSNCTAMDF-HPFGEFFASGSMDRSLKIWDIRKKGCIHTYKSHTRGISSIRFSPDG  154

Query  407  ILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIR  586
              V +G    ++K+WDL   K++     H  +  ++ FHP     A+GS D  +K WD+ 
Sbjct  155  RWVVSGGFDNVVKVWDLTAGKLLNEFKFHEGHIRSINFHPLEFLLATGSADRTVKFWDLE  214

Query  587  KKGCIHTYKGHTRGISTIRFTPDGR  661
                I + K   +G  ++ F PDG+
Sbjct  215  TFELIGSSKPEAKGARSVTFHPDGK  239


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/120 (27%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  + +H+  ++ +RF     R  ++GG D+ V +W +      +    H   + SI F 
Sbjct  135  IHTYKSHTRGISSIRFSPDG-RWVVSGGFDNVVKVWDLTAGKLLNEFKFHEGHIRSINFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +         ++ FHP G+    GS D   K++
Sbjct  194  PLEFLLATGSADRTVKFWDLETFELIGSSKPEAKGARSVTFHPDGKTLFCGS-DDGFKVY  252



>gb|KJB34817.1| hypothetical protein B456_006G086000 [Gossypium raimondii]
Length=780

 Score =   263 bits (672),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 117/158 (74%), Positives = 137/158 (87%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKRGYKLQE VAH+ NVNCL  GKKTC++ +TGGDDH V +W+IGK TS  +L GH+SP
Sbjct  1    MAKRGYKLQEIVAHTANVNCLSIGKKTCKLLITGGDDHKVYVWAIGKTTSLMSLCGHSSP  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            VES+ FDS E+ V AG+S+G IKLWDLE+TKM+R  +GHRS CTA++FHPFGEFFASGSM
Sbjct  61   VESLVFDSEEVSVLAGASTGAIKLWDLEETKMVRGFTGHRSNCTAMDFHPFGEFFASGSM  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            D +LKIWDIRKKGCIHTYK HTRGIS+IRF+PDGRWVV
Sbjct  121  DRSLKIWDIRKKGCIHTYKSHTRGISSIRFSPDGRWVV  158


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/145 (29%), Positives = 64/145 (44%), Gaps = 1/145 (1%)
 Frame = +2

Query  227  FVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAE  406
            F  H  N   + F       F +G  D S+ +W I K     T   HT  + SI F    
Sbjct  96   FTGHRSNCTAMDF-HPFGEFFASGSMDRSLKIWDIRKKGCIHTYKSHTRGISSIRFSPDG  154

Query  407  ILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIR  586
              V +G    ++K+WDL   K++     H  +  ++ FHP     A+GS D  +K WD+ 
Sbjct  155  RWVVSGGFDNVVKVWDLTAGKLLNEFKFHEGHIRSINFHPLEFLLATGSADRTVKFWDLE  214

Query  587  KKGCIHTYKGHTRGISTIRFTPDGR  661
                I + K   +G  ++ F PDG+
Sbjct  215  TFELIGSSKPEAKGARSVTFHPDGK  239


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/120 (27%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  + +H+  ++ +RF     R  ++GG D+ V +W +      +    H   + SI F 
Sbjct  135  IHTYKSHTRGISSIRFSPDG-RWVVSGGFDNVVKVWDLTAGKLLNEFKFHEGHIRSINFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +         ++ FHP G+    GS D   K++
Sbjct  194  PLEFLLATGSADRTVKFWDLETFELIGSSKPEAKGARSVTFHPDGKTLFCGS-DDGFKVY  252



>ref|XP_009622381.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
{ECO:0000255|HAMAP-Rule:MF_03022}-like isoform X3 [Nicotiana 
tomentosiformis]
Length=805

 Score =   263 bits (673),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 114/156 (73%), Positives = 142/156 (91%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS +VNCL+ G+K+ R+ +TGG+DH VNLWSIGKP +  +LSGH+S ++
Sbjct  12   KRAYKLQEFVAHSLSVNCLKIGRKSSRVLVTGGEDHKVNLWSIGKPDAVLSLSGHSSGID  71

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++FDS+E+LVAAG++SG IKLWDLE+ K++RTL+GHRS C +L+FHPFGEFFASGS+DT
Sbjct  72   SVSFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISLDFHPFGEFFASGSLDT  131

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIR+KGCIHTYKGHTRG++TIRFTPDGRWVV
Sbjct  132  NLKIWDIRRKGCIHTYKGHTRGVNTIRFTPDGRWVV  167


 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/125 (30%), Positives = 57/125 (46%), Gaps = 0/125 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I +     T  GHT  V +I F      V +G     +K+WDL   
Sbjct  124  FASGSLDTNLKIWDIRRKGCIHTYKGHTRGVNTIRFTPDGRWVVSGGEDSTVKIWDLTAG  183

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H     +++FHP     A+GS D  +K WD+     I +    T G+  + F
Sbjct  184  KLLHDFKCHEGQIRSIDFHPHEFLLATGSADKTVKFWDLETFELIGSAGPETTGVRCMAF  243

Query  647  TPDGR  661
              DGR
Sbjct  244  NTDGR  248


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/120 (27%), Positives = 55/120 (46%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN +RF     R  ++GG+D +V +W +           H   + SI F 
Sbjct  144  IHTYKGHTRGVNTIRFTPDG-RWVVSGGEDSTVKIWDLTAGKLLHDFKCHEGQIRSIDFH  202

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +    + F+  G     G +  NLK++
Sbjct  203  PHEFLLATGSADKTVKFWDLETFELIGSAGPETTGVRCMAFNTDGRTLLCG-LHENLKVF  261



>ref|XP_009351774.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X2 [Pyrus x bretschneideri]
Length=802

 Score =   263 bits (673),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS  VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +  +LSGHTS ++
Sbjct  4    KRAYKLQEFVAHSAAVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNALLSLSGHTSGID  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++FDS+E+LVAAG++SG IKLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DT
Sbjct  64   SVSFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIRKKGCIHTYKGHTRG++ IRFTPDGRWVV
Sbjct  124  NLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVV  159


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/130 (31%), Positives = 61/130 (47%), Gaps = 0/130 (0%)
 Frame = +2

Query  281  RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLE  460
              F +G  D ++ +W I K     T  GHT  V +I F      V +G     +KLWDL 
Sbjct  114  EFFASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNTVKLWDLT  173

Query  461  DTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTI  640
              K++     H      ++FHP     A+GS D  +K WD+     I +    T G+ ++
Sbjct  174  AGKLLHDFKCHEGQVQCIDFHPHEFLLATGSADRTVKFWDLETFELIGSAGPETTGVRSL  233

Query  641  RFTPDGRWVV  670
             F+PDGR ++
Sbjct  234  TFSPDGRALL  243


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN +RF     R  ++GG+D++V LW +           H   V+ I F 
Sbjct  136  IHTYKGHTRGVNAIRFTPDG-RWVVSGGEDNTVKLWDLTAGKLLHDFKCHEGQVQCIDFH  194

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   +L F P G     G +  +LK++
Sbjct  195  PHEFLLATGSADRTVKFWDLETFELIGSAGPETTGVRSLTFSPDGRALLCG-LHESLKVF  253



>ref|XP_009622380.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
{ECO:0000255|HAMAP-Rule:MF_03022}-like isoform X2 [Nicotiana 
tomentosiformis]
Length=817

 Score =   263 bits (673),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 114/156 (73%), Positives = 142/156 (91%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS +VNCL+ G+K+ R+ +TGG+DH VNLWSIGKP +  +LSGH+S ++
Sbjct  12   KRAYKLQEFVAHSLSVNCLKIGRKSSRVLVTGGEDHKVNLWSIGKPDAVLSLSGHSSGID  71

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++FDS+E+LVAAG++SG IKLWDLE+ K++RTL+GHRS C +L+FHPFGEFFASGS+DT
Sbjct  72   SVSFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISLDFHPFGEFFASGSLDT  131

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIR+KGCIHTYKGHTRG++TIRFTPDGRWVV
Sbjct  132  NLKIWDIRRKGCIHTYKGHTRGVNTIRFTPDGRWVV  167


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/125 (30%), Positives = 57/125 (46%), Gaps = 0/125 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I +     T  GHT  V +I F      V +G     +K+WDL   
Sbjct  124  FASGSLDTNLKIWDIRRKGCIHTYKGHTRGVNTIRFTPDGRWVVSGGEDSTVKIWDLTAG  183

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H     +++FHP     A+GS D  +K WD+     I +    T G+  + F
Sbjct  184  KLLHDFKCHEGQIRSIDFHPHEFLLATGSADKTVKFWDLETFELIGSAGPETTGVRCMAF  243

Query  647  TPDGR  661
              DGR
Sbjct  244  NTDGR  248


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/120 (27%), Positives = 55/120 (46%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN +RF     R  ++GG+D +V +W +           H   + SI F 
Sbjct  144  IHTYKGHTRGVNTIRFTPDG-RWVVSGGEDSTVKIWDLTAGKLLHDFKCHEGQIRSIDFH  202

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +    + F+  G     G +  NLK++
Sbjct  203  PHEFLLATGSADKTVKFWDLETFELIGSAGPETTGVRCMAFNTDGRTLLCG-LHENLKVF  261



>ref|XP_009622378.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
{ECO:0000255|HAMAP-Rule:MF_03022}-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009622379.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
{ECO:0000255|HAMAP-Rule:MF_03022}-like isoform X1 [Nicotiana 
tomentosiformis]
Length=818

 Score =   263 bits (673),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 114/156 (73%), Positives = 142/156 (91%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS +VNCL+ G+K+ R+ +TGG+DH VNLWSIGKP +  +LSGH+S ++
Sbjct  12   KRAYKLQEFVAHSLSVNCLKIGRKSSRVLVTGGEDHKVNLWSIGKPDAVLSLSGHSSGID  71

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++FDS+E+LVAAG++SG IKLWDLE+ K++RTL+GHRS C +L+FHPFGEFFASGS+DT
Sbjct  72   SVSFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISLDFHPFGEFFASGSLDT  131

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIR+KGCIHTYKGHTRG++TIRFTPDGRWVV
Sbjct  132  NLKIWDIRRKGCIHTYKGHTRGVNTIRFTPDGRWVV  167


 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/125 (30%), Positives = 57/125 (46%), Gaps = 0/125 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I +     T  GHT  V +I F      V +G     +K+WDL   
Sbjct  124  FASGSLDTNLKIWDIRRKGCIHTYKGHTRGVNTIRFTPDGRWVVSGGEDSTVKIWDLTAG  183

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H     +++FHP     A+GS D  +K WD+     I +    T G+  + F
Sbjct  184  KLLHDFKCHEGQIRSIDFHPHEFLLATGSADKTVKFWDLETFELIGSAGPETTGVRCMAF  243

Query  647  TPDGR  661
              DGR
Sbjct  244  NTDGR  248


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/120 (27%), Positives = 55/120 (46%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN +RF     R  ++GG+D +V +W +           H   + SI F 
Sbjct  144  IHTYKGHTRGVNTIRFTPDG-RWVVSGGEDSTVKIWDLTAGKLLHDFKCHEGQIRSIDFH  202

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +    + F+  G     G +  NLK++
Sbjct  203  PHEFLLATGSADKTVKFWDLETFELIGSAGPETTGVRCMAFNTDGRTLLCG-LHENLKVF  261



>ref|XP_008663730.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
[Zea mays]
 gb|AFW59904.1| hypothetical protein ZEAMMB73_759012 [Zea mays]
Length=910

 Score =   265 bits (677),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 114/156 (73%), Positives = 137/156 (88%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAH+ NVNCL+ G+KT R+ +TGG+DH VNLW+IGKP S  +LSGHTS VE
Sbjct  6    KRAYKLQEFVAHASNVNCLKIGRKTSRVLVTGGEDHKVNLWAIGKPNSILSLSGHTSAVE  65

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S+ FDS E+ VAAG++SG IKLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DT
Sbjct  66   SVGFDSTEVFVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCMSVDFHPFGEFFASGSLDT  125

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIR+K CIHTYKGHTRG++ IRFTPDGRWVV
Sbjct  126  NLKIWDIRRKNCIHTYKGHTRGVNAIRFTPDGRWVV  161


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 61/128 (48%), Gaps = 0/128 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I +     T  GHT  V +I F      V +G    ++KLWDL   
Sbjct  118  FASGSLDTNLKIWDIRRKNCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNIVKLWDLTAG  177

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      ++FHP     A+GS D  +K WD+     I +    T G+ ++ F
Sbjct  178  KLLHEFKCHEGQIQCIDFHPHEFLLATGSADKTVKFWDLETFELIGSTGPETTGVRSMTF  237

Query  647  TPDGRWVV  670
             PDGR ++
Sbjct  238  NPDGRTLL  245


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 59/125 (47%), Gaps = 2/125 (2%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            +R   +  +  H+  VN +RF     R  ++GG+D+ V LW +           H   ++
Sbjct  133  RRKNCIHTYKGHTRGVNAIRFTPDG-RWVVSGGEDNIVKLWDLTAGKLLHEFKCHEGQIQ  191

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
             I F   E L+A GS+   +K WDLE  ++I +     +   ++ F+P G     G +  
Sbjct  192  CIDFHPHEFLLATGSADKTVKFWDLETFELIGSTGPETTGVRSMTFNPDGRTLLCG-LHE  250

Query  563  NLKIW  577
            +LK++
Sbjct  251  SLKVF  255



>ref|XP_009351770.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Pyrus x bretschneideri]
 ref|XP_009351771.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Pyrus x bretschneideri]
 ref|XP_009351772.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Pyrus x bretschneideri]
 ref|XP_009351773.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Pyrus x bretschneideri]
Length=803

 Score =   263 bits (673),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS  VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +  +LSGHTS ++
Sbjct  4    KRAYKLQEFVAHSAAVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNALLSLSGHTSGID  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++FDS+E+LVAAG++SG IKLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DT
Sbjct  64   SVSFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIRKKGCIHTYKGHTRG++ IRFTPDGRWVV
Sbjct  124  NLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVV  159


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/130 (31%), Positives = 61/130 (47%), Gaps = 0/130 (0%)
 Frame = +2

Query  281  RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLE  460
              F +G  D ++ +W I K     T  GHT  V +I F      V +G     +KLWDL 
Sbjct  114  EFFASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNTVKLWDLT  173

Query  461  DTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTI  640
              K++     H      ++FHP     A+GS D  +K WD+     I +    T G+ ++
Sbjct  174  AGKLLHDFKCHEGQVQCIDFHPHEFLLATGSADRTVKFWDLETFELIGSAGPETTGVRSL  233

Query  641  RFTPDGRWVV  670
             F+PDGR ++
Sbjct  234  TFSPDGRALL  243


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN +RF     R  ++GG+D++V LW +           H   V+ I F 
Sbjct  136  IHTYKGHTRGVNAIRFTPDG-RWVVSGGEDNTVKLWDLTAGKLLHDFKCHEGQVQCIDFH  194

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   +L F P G     G +  +LK++
Sbjct  195  PHEFLLATGSADRTVKFWDLETFELIGSAGPETTGVRSLTFSPDGRALLCG-LHESLKVF  253



>ref|XP_006603797.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
[Glycine max]
Length=759

 Score =   262 bits (670),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 112/156 (72%), Positives = 141/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAH+  VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +  +LSGH+S ++
Sbjct  4    KRAYKLQEFVAHASTVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHSSGID  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++FDS+E+LVAAG++SG IKLWDLE+ K++RTL+GHRS CT+++FHPFGEFFASGS+DT
Sbjct  64   SVSFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCTSVDFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIRKKGCIHTYKGHTRG++ IRFTPDGRWVV
Sbjct  124  NLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVV  159


 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 61/128 (48%), Gaps = 0/128 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GHT  V +I F      V +G     +KLWDL   
Sbjct  116  FASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNTVKLWDLTAG  175

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      ++FHP     A+GS D  +K WD+     I +    T G+ ++ F
Sbjct  176  KLLHDFKCHEGQIQCIDFHPNEFLLATGSADRTVKFWDLETFELIGSAGPETTGVRSLTF  235

Query  647  TPDGRWVV  670
            +PDGR ++
Sbjct  236  SPDGRTLL  243


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/120 (28%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN +RF     R  ++GG+D++V LW +           H   ++ I F 
Sbjct  136  IHTYKGHTRGVNAIRFTPDG-RWVVSGGEDNTVKLWDLTAGKLLHDFKCHEGQIQCIDFH  194

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   +L F P G     G +  +LK++
Sbjct  195  PNEFLLATGSADRTVKFWDLETFELIGSAGPETTGVRSLTFSPDGRTLLCG-LHESLKVF  253



>ref|XP_008340406.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Malus domestica]
 ref|XP_008340407.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Malus domestica]
 ref|XP_008340408.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Malus domestica]
Length=803

 Score =   263 bits (672),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS  VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +  +LSGHTS ++
Sbjct  4    KRAYKLQEFVAHSAAVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNALLSLSGHTSGID  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++FDS+E+LVAAG++SG IKLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DT
Sbjct  64   SVSFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIRKKGCIHTYKGHTRG++ IRFTPDGRWVV
Sbjct  124  NLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVV  159


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/130 (31%), Positives = 61/130 (47%), Gaps = 0/130 (0%)
 Frame = +2

Query  281  RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLE  460
              F +G  D ++ +W I K     T  GHT  V +I F      V +G     +KLWDL 
Sbjct  114  EFFASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNTVKLWDLT  173

Query  461  DTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTI  640
              K++     H      ++FHP     A+GS D  +K WD+     I +    T G+ ++
Sbjct  174  AGKLLHDFKCHEGQVQCIDFHPHEFLLATGSADRTVKFWDLETFELIGSAGPETTGVRSL  233

Query  641  RFTPDGRWVV  670
             F+PDGR ++
Sbjct  234  TFSPDGRALL  243


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN +RF     R  ++GG+D++V LW +           H   V+ I F 
Sbjct  136  IHTYKGHTRGVNAIRFTPDG-RWVVSGGEDNTVKLWDLTAGKLLHDFKCHEGQVQCIDFH  194

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   +L F P G     G +  +LK++
Sbjct  195  PHEFLLATGSADRTVKFWDLETFELIGSAGPETTGVRSLTFSPDGRALLCG-LHESLKVF  253



>ref|XP_007221941.1| hypothetical protein PRUPE_ppa001553mg [Prunus persica]
 gb|EMJ23140.1| hypothetical protein PRUPE_ppa001553mg [Prunus persica]
Length=803

 Score =   263 bits (672),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS  VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +  +LSGHTS ++
Sbjct  4    KRAYKLQEFVAHSSTVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHTSGID  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++FDS+E+LVAAG++SG IKLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DT
Sbjct  64   SVSFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIRKKGCIHTYKGHTRG++ IRFTPDGRWVV
Sbjct  124  NLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVV  159


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 61/128 (48%), Gaps = 0/128 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GHT  V +I F      V +G     +KLWDL   
Sbjct  116  FASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNTVKLWDLTAG  175

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      ++FHP     A+GS D  +K WD+     I +    T G+ ++ F
Sbjct  176  KLLHDFKCHEGQIQCIDFHPHEFLLATGSADRTVKFWDLETFELIGSSGPETTGVRSLTF  235

Query  647  TPDGRWVV  670
            +PDGR ++
Sbjct  236  SPDGRALL  243


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/120 (28%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN +RF     R  ++GG+D++V LW +           H   ++ I F 
Sbjct  136  IHTYKGHTRGVNAIRFTPDG-RWVVSGGEDNTVKLWDLTAGKLLHDFKCHEGQIQCIDFH  194

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   +L F P G     G +  +LK++
Sbjct  195  PHEFLLATGSADRTVKFWDLETFELIGSSGPETTGVRSLTFSPDGRALLCG-LHESLKVF  253



>ref|XP_008340409.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X2 [Malus domestica]
Length=802

 Score =   263 bits (672),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS  VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +  +LSGHTS ++
Sbjct  4    KRAYKLQEFVAHSAAVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNALLSLSGHTSGID  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++FDS+E+LVAAG++SG IKLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DT
Sbjct  64   SVSFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIRKKGCIHTYKGHTRG++ IRFTPDGRWVV
Sbjct  124  NLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVV  159


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/130 (31%), Positives = 61/130 (47%), Gaps = 0/130 (0%)
 Frame = +2

Query  281  RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLE  460
              F +G  D ++ +W I K     T  GHT  V +I F      V +G     +KLWDL 
Sbjct  114  EFFASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNTVKLWDLT  173

Query  461  DTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTI  640
              K++     H      ++FHP     A+GS D  +K WD+     I +    T G+ ++
Sbjct  174  AGKLLHDFKCHEGQVQCIDFHPHEFLLATGSADRTVKFWDLETFELIGSAGPETTGVRSL  233

Query  641  RFTPDGRWVV  670
             F+PDGR ++
Sbjct  234  TFSPDGRALL  243


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN +RF     R  ++GG+D++V LW +           H   V+ I F 
Sbjct  136  IHTYKGHTRGVNAIRFTPDG-RWVVSGGEDNTVKLWDLTAGKLLHDFKCHEGQVQCIDFH  194

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   +L F P G     G +  +LK++
Sbjct  195  PHEFLLATGSADRTVKFWDLETFELIGSAGPETTGVRSLTFSPDGRALLCG-LHESLKVF  253



>ref|XP_007150863.1| hypothetical protein PHAVU_004G000600g [Phaseolus vulgaris]
 ref|XP_007150864.1| hypothetical protein PHAVU_004G000600g [Phaseolus vulgaris]
 gb|ESW22857.1| hypothetical protein PHAVU_004G000600g [Phaseolus vulgaris]
 gb|ESW22858.1| hypothetical protein PHAVU_004G000600g [Phaseolus vulgaris]
Length=759

 Score =   262 bits (670),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 112/156 (72%), Positives = 142/156 (91%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAH+ +VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +  +LSGH+S ++
Sbjct  4    KRAYKLQEFVAHASSVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHSSGID  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++FDS+E+LVAAG++SG IKLWDLE+ K++RTL+GHRS CT+++FHPFGEFFASGS+DT
Sbjct  64   SVSFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCTSVDFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIRKKGCIHTYKGHTRG++ IRFTPDGRWVV
Sbjct  124  NLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVV  159


 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 61/128 (48%), Gaps = 0/128 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GHT  V +I F      V +G     +KLWDL   
Sbjct  116  FASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNTVKLWDLTAG  175

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      ++FHP     A+GS D  +K WD+     I +    T G+ ++ F
Sbjct  176  KLLHDFKCHEGQIQCIDFHPNEFLLATGSADRTVKFWDLETFELIGSAGPETSGVRSLTF  235

Query  647  TPDGRWVV  670
            +PDGR ++
Sbjct  236  SPDGRTLL  243


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN +RF     R  ++GG+D++V LW +           H   ++ I F 
Sbjct  136  IHTYKGHTRGVNAIRFTPDG-RWVVSGGEDNTVKLWDLTAGKLLHDFKCHEGQIQCIDFH  194

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     S   +L F P G     G +  +LK++
Sbjct  195  PNEFLLATGSADRTVKFWDLETFELIGSAGPETSGVRSLTFSPDGRTLLCG-LHESLKVF  253



>ref|XP_010476017.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Camelina sativa]
Length=1008

 Score =   266 bits (679),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 116/158 (73%), Positives = 137/158 (87%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MA RGY LQEFVAHSGNVNCL  GKK+ R+ LTGGDD+ VNLWSIGK TS  +L GHTSP
Sbjct  1    MANRGYNLQEFVAHSGNVNCLSIGKKSSRLLLTGGDDYKVNLWSIGKTTSLMSLCGHTSP  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            V+S+AF+S E+LV AG+SSG+IKLWDL++ KM+R  +GHR+ C+A+EFHPFGEF ASGS 
Sbjct  61   VDSVAFNSKEVLVLAGASSGVIKLWDLQEAKMVRAFTGHRANCSAVEFHPFGEFLASGSS  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DTNL++WD RKKGCI TYKGHTRGISTI+F+PDGRWVV
Sbjct  121  DTNLRVWDTRKKGCIQTYKGHTRGISTIKFSPDGRWVV  158


 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/148 (27%), Positives = 65/148 (44%), Gaps = 1/148 (1%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            ++ F  H  N + + F         +G  D ++ +W   K     T  GHT  + +I F 
Sbjct  93   VRAFTGHRANCSAVEF-HPFGEFLASGSSDTNLRVWDTRKKGCIQTYKGHTRGISTIKFS  151

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
                 V +G    ++K+WDL   K++     H     +L+FHP     A+GS D  +K W
Sbjct  152  PDGRWVVSGGLDNVVKVWDLTAGKLLHEFKFHEGPIRSLDFHPLEFLLATGSADRTVKFW  211

Query  578  DIRKKGCIHTYKGHTRGISTIRFTPDGR  661
            D+     I + +    G+  I F PDG+
Sbjct  212  DLETFELIGSTRPEATGVRAITFHPDGQ  239


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/120 (28%), Positives = 59/120 (49%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +Q +  H+  ++ ++F     R  ++GG D+ V +W +           H  P+ S+ F 
Sbjct  135  IQTYKGHTRGISTIKFSPD-GRWVVSGGLDNVVKVWDLTAGKLLHEFKFHEGPIRSLDFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   A+ FHP G+    G +D  LK++
Sbjct  194  PLEFLLATGSADRTVKFWDLETFELIGSTRPEATGVRAITFHPDGQTLFCG-LDDGLKVY  252



>ref|XP_010476018.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X2 [Camelina sativa]
Length=1006

 Score =   265 bits (678),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 116/158 (73%), Positives = 137/158 (87%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MA RGY LQEFVAHSGNVNCL  GKK+ R+ LTGGDD+ VNLWSIGK TS  +L GHTSP
Sbjct  1    MANRGYNLQEFVAHSGNVNCLSIGKKSSRLLLTGGDDYKVNLWSIGKTTSLMSLCGHTSP  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            V+S+AF+S E+LV AG+SSG+IKLWDL++ KM+R  +GHR+ C+A+EFHPFGEF ASGS 
Sbjct  61   VDSVAFNSKEVLVLAGASSGVIKLWDLQEAKMVRAFTGHRANCSAVEFHPFGEFLASGSS  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DTNL++WD RKKGCI TYKGHTRGISTI+F+PDGRWVV
Sbjct  121  DTNLRVWDTRKKGCIQTYKGHTRGISTIKFSPDGRWVV  158


 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/148 (27%), Positives = 65/148 (44%), Gaps = 1/148 (1%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            ++ F  H  N + + F         +G  D ++ +W   K     T  GHT  + +I F 
Sbjct  93   VRAFTGHRANCSAVEF-HPFGEFLASGSSDTNLRVWDTRKKGCIQTYKGHTRGISTIKFS  151

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
                 V +G    ++K+WDL   K++     H     +L+FHP     A+GS D  +K W
Sbjct  152  PDGRWVVSGGLDNVVKVWDLTAGKLLHEFKFHEGPIRSLDFHPLEFLLATGSADRTVKFW  211

Query  578  DIRKKGCIHTYKGHTRGISTIRFTPDGR  661
            D+     I + +    G+  I F PDG+
Sbjct  212  DLETFELIGSTRPEATGVRAITFHPDGQ  239


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/120 (28%), Positives = 59/120 (49%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +Q +  H+  ++ ++F     R  ++GG D+ V +W +           H  P+ S+ F 
Sbjct  135  IQTYKGHTRGISTIKFSPD-GRWVVSGGLDNVVKVWDLTAGKLLHEFKFHEGPIRSLDFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   A+ FHP G+    G +D  LK++
Sbjct  194  PLEFLLATGSADRTVKFWDLETFELIGSTRPEATGVRAITFHPDGQTLFCG-LDDGLKVY  252



>ref|XP_010319353.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X2 [Solanum lycopersicum]
Length=809

 Score =   263 bits (672),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 114/156 (73%), Positives = 142/156 (91%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS +VNCL+ G+K+ R+ +TGG+DH VNLWSIGKP +  +LSGH+S ++
Sbjct  5    KRAYKLQEFVAHSLSVNCLKIGRKSSRVLVTGGEDHKVNLWSIGKPDAILSLSGHSSGID  64

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++FDS+E+LVAAG++SG IKLWDLE+ K++RTL+GHRS C +L+FHPFGEFFASGS+DT
Sbjct  65   SVSFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISLDFHPFGEFFASGSLDT  124

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIR+KGCIHTYKGHTRG++TIRFTPDGRWVV
Sbjct  125  NLKIWDIRRKGCIHTYKGHTRGVNTIRFTPDGRWVV  160


 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 37/125 (30%), Positives = 57/125 (46%), Gaps = 0/125 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I +     T  GHT  V +I F      V +G     +K+WDL   
Sbjct  117  FASGSLDTNLKIWDIRRKGCIHTYKGHTRGVNTIRFTPDGRWVVSGGEDRSVKIWDLTAG  176

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      ++FHP     A+GS D  +K WD+     I +    T G+ ++ F
Sbjct  177  KLLHDFKCHEGKIQCIDFHPHEFLLATGSADKTVKFWDLESFELIGSAGPETTGVRSMAF  236

Query  647  TPDGR  661
              DGR
Sbjct  237  NTDGR  241


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/120 (27%), Positives = 56/120 (47%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN +RF     R  ++GG+D SV +W +           H   ++ I F 
Sbjct  137  IHTYKGHTRGVNTIRFTPDG-RWVVSGGEDRSVKIWDLTAGKLLHDFKCHEGKIQCIDFH  195

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   ++ F+  G     G +  NLK++
Sbjct  196  PHEFLLATGSADKTVKFWDLESFELIGSAGPETTGVRSMAFNTDGRTLLCG-LHENLKVF  254



>ref|XP_008221115.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X2 [Prunus mume]
Length=802

 Score =   263 bits (671),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS  VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +  +LSGHTS ++
Sbjct  4    KRAYKLQEFVAHSSAVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHTSGID  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++FDS+E+LVAAG++SG IKLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DT
Sbjct  64   SVSFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIRKKGCIHTYKGHTRG++ IRFTPDGRWVV
Sbjct  124  NLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVV  159


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 61/128 (48%), Gaps = 0/128 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GHT  V +I F      V +G     +KLWDL   
Sbjct  116  FASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNTVKLWDLTAG  175

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      ++FHP     A+GS D  +K WD+     I +    T G+ ++ F
Sbjct  176  KLLHDFKCHEGQIQCIDFHPHEFLLATGSADRTVKFWDLETFELIGSSGPETTGVRSLTF  235

Query  647  TPDGRWVV  670
            +PDGR ++
Sbjct  236  SPDGRALL  243


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/120 (28%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN +RF     R  ++GG+D++V LW +           H   ++ I F 
Sbjct  136  IHTYKGHTRGVNAIRFTPDG-RWVVSGGEDNTVKLWDLTAGKLLHDFKCHEGQIQCIDFH  194

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   +L F P G     G +  +LK++
Sbjct  195  PHEFLLATGSADRTVKFWDLETFELIGSSGPETTGVRSLTFSPDGRALLCG-LHESLKVF  253



>ref|XP_004236878.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Solanum lycopersicum]
Length=810

 Score =   263 bits (672),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 114/156 (73%), Positives = 142/156 (91%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS +VNCL+ G+K+ R+ +TGG+DH VNLWSIGKP +  +LSGH+S ++
Sbjct  5    KRAYKLQEFVAHSLSVNCLKIGRKSSRVLVTGGEDHKVNLWSIGKPDAILSLSGHSSGID  64

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++FDS+E+LVAAG++SG IKLWDLE+ K++RTL+GHRS C +L+FHPFGEFFASGS+DT
Sbjct  65   SVSFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISLDFHPFGEFFASGSLDT  124

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIR+KGCIHTYKGHTRG++TIRFTPDGRWVV
Sbjct  125  NLKIWDIRRKGCIHTYKGHTRGVNTIRFTPDGRWVV  160


 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 37/125 (30%), Positives = 57/125 (46%), Gaps = 0/125 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I +     T  GHT  V +I F      V +G     +K+WDL   
Sbjct  117  FASGSLDTNLKIWDIRRKGCIHTYKGHTRGVNTIRFTPDGRWVVSGGEDRSVKIWDLTAG  176

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      ++FHP     A+GS D  +K WD+     I +    T G+ ++ F
Sbjct  177  KLLHDFKCHEGKIQCIDFHPHEFLLATGSADKTVKFWDLESFELIGSAGPETTGVRSMAF  236

Query  647  TPDGR  661
              DGR
Sbjct  237  NTDGR  241


 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 32/120 (27%), Positives = 56/120 (47%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN +RF     R  ++GG+D SV +W +           H   ++ I F 
Sbjct  137  IHTYKGHTRGVNTIRFTPDG-RWVVSGGEDRSVKIWDLTAGKLLHDFKCHEGKIQCIDFH  195

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   ++ F+  G     G +  NLK++
Sbjct  196  PHEFLLATGSADKTVKFWDLESFELIGSAGPETTGVRSMAFNTDGRTLLCG-LHENLKVF  254



>ref|XP_008221114.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Prunus mume]
Length=803

 Score =   263 bits (671),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS  VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +  +LSGHTS ++
Sbjct  4    KRAYKLQEFVAHSSAVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHTSGID  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++FDS+E+LVAAG++SG IKLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DT
Sbjct  64   SVSFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIRKKGCIHTYKGHTRG++ IRFTPDGRWVV
Sbjct  124  NLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVV  159


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 61/128 (48%), Gaps = 0/128 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GHT  V +I F      V +G     +KLWDL   
Sbjct  116  FASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNTVKLWDLTAG  175

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      ++FHP     A+GS D  +K WD+     I +    T G+ ++ F
Sbjct  176  KLLHDFKCHEGQIQCIDFHPHEFLLATGSADRTVKFWDLETFELIGSSGPETTGVRSLTF  235

Query  647  TPDGRWVV  670
            +PDGR ++
Sbjct  236  SPDGRALL  243


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/120 (28%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN +RF     R  ++GG+D++V LW +           H   ++ I F 
Sbjct  136  IHTYKGHTRGVNAIRFTPDG-RWVVSGGEDNTVKLWDLTAGKLLHDFKCHEGQIQCIDFH  194

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   +L F P G     G +  +LK++
Sbjct  195  PHEFLLATGSADRTVKFWDLETFELIGSSGPETTGVRSLTFSPDGRALLCG-LHESLKVF  253



>ref|XP_011070501.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
[Sesamum indicum]
Length=791

 Score =   263 bits (671),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 141/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS +VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +  +LSGH+S ++
Sbjct  6    KRAYKLQEFVAHSLSVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHSSGID  65

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++FDS+E+LVAAG++SG IKLWDLE+ K+IRTL+GHRS C +L+FHPFGEFFASGS+DT
Sbjct  66   SVSFDSSEVLVAAGAASGTIKLWDLEEAKIIRTLTGHRSNCISLDFHPFGEFFASGSLDT  125

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIR+KGCIHTYKGHTRG++ IRFTPDGRWVV
Sbjct  126  NLKIWDIRRKGCIHTYKGHTRGVNAIRFTPDGRWVV  161


 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 38/128 (30%), Positives = 59/128 (46%), Gaps = 0/128 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I +     T  GHT  V +I F      V +G     +KLWDL   
Sbjct  118  FASGSLDTNLKIWDIRRKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNTVKLWDLTAG  177

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      ++FHP     A+GS D  +K WD+     I +    + G+  + F
Sbjct  178  KLLHDFKCHEGQIQCIDFHPHEFLLATGSADRTVKFWDLETFELIGSTGPESTGVRCMTF  237

Query  647  TPDGRWVV  670
             PDGR ++
Sbjct  238  NPDGRTLL  245


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/120 (28%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN +RF     R  ++GG+D++V LW +           H   ++ I F 
Sbjct  138  IHTYKGHTRGVNAIRFTPDG-RWVVSGGEDNTVKLWDLTAGKLLHDFKCHEGQIQCIDFH  196

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +    + F+P G     G +  NLK++
Sbjct  197  PHEFLLATGSADRTVKFWDLETFELIGSTGPESTGVRCMTFNPDGRTLLCG-LHENLKVF  255



>ref|XP_002316424.2| hypothetical protein POPTR_0010s26190g [Populus trichocarpa]
 gb|EEF02595.2| hypothetical protein POPTR_0010s26190g [Populus trichocarpa]
Length=728

 Score =   261 bits (667),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 112/156 (72%), Positives = 141/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS +VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +  +LSGHTS ++
Sbjct  4    KRAYKLQEFVAHSSSVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHTSGID  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++FDS+E+LVAAG++SG +KLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DT
Sbjct  64   SVSFDSSEVLVAAGAASGTVKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIRKKGCIHTYKGHTRG++ IRFTPDGRWVV
Sbjct  124  NLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVV  159


 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 56/125 (45%), Gaps = 0/125 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GHT  V +I F      V +G     +KLWDL   
Sbjct  116  FASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNTVKLWDLTAG  175

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      ++FHP     A+GS D  +K WD+     I +    T G+  + F
Sbjct  176  KLLHDFKCHEGQIQCIDFHPHEFLLATGSADRTVKFWDLETFELIGSAGPETTGVRCLTF  235

Query  647  TPDGR  661
              DGR
Sbjct  236  NSDGR  240


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 34/127 (27%), Positives = 58/127 (46%), Gaps = 2/127 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN +RF     R  ++GG+D++V LW +           H   ++ I F 
Sbjct  136  IHTYKGHTRGVNAIRFTPDG-RWVVSGGEDNTVKLWDLTAGKLLHDFKCHEGQIQCIDFH  194

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +    L F+  G     G +  +LK++
Sbjct  195  PHEFLLATGSADRTVKFWDLETFELIGSAGPETTGVRCLTFNSDGRTLLCG-LHESLKVF  253

Query  578  DIRKKGC  598
                 GC
Sbjct  254  SWEPIGC  260



>gb|KHG00735.1| hypothetical protein F383_07474 [Gossypium arboreum]
Length=846

 Score =   263 bits (673),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS +VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +  +LSGHTS ++
Sbjct  4    KRAYKLQEFVAHSSSVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHTSGID  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S+ FDS+E+LVAAG++SG IKLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DT
Sbjct  64   SVTFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIRKKGCIHTYKGHTRG++ IRFTPDGRWVV
Sbjct  124  NLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVV  159


 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 60/128 (47%), Gaps = 0/128 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GHT  V +I F      V +G    ++K+WDL   
Sbjct  116  FASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNIVKVWDLTAG  175

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      L+FHP     A+GS D  +K WD+     I +    T G+  + F
Sbjct  176  KLLHQFKDHEGQIQCLDFHPHEFLLATGSADRTVKFWDLETFELIGSAGPETAGVRCLTF  235

Query  647  TPDGRWVV  670
             PDGR V+
Sbjct  236  NPDGRTVL  243


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/120 (27%), Positives = 56/120 (47%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN +RF     R  ++GG+D+ V +W +           H   ++ + F 
Sbjct  136  IHTYKGHTRGVNAIRFTPDG-RWVVSGGEDNIVKVWDLTAGKLLHQFKDHEGQIQCLDFH  194

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +    L F+P G     G +  NLK++
Sbjct  195  PHEFLLATGSADRTVKFWDLETFELIGSAGPETAGVRCLTFNPDGRTVLCG-LHENLKVF  253



>gb|KJB12376.1| hypothetical protein B456_002G014900 [Gossypium raimondii]
Length=816

 Score =   263 bits (671),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 139/156 (89%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS +VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +   LSGHTS ++
Sbjct  4    KRAYKLQEFVAHSSSVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILNLSGHTSGID  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S+ FDS+E+LVAAG++SG IKLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DT
Sbjct  64   SVTFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIRKKGCIHTYKGHTRG++ IRFTPDGRWVV
Sbjct  124  NLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVV  159


 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 60/128 (47%), Gaps = 0/128 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GHT  V +I F      V +G    ++K+WDL   
Sbjct  116  FASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNIVKVWDLTAG  175

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      L+FHP     A+GS D  +K WD+     I +    T G+  + F
Sbjct  176  KLLHQFKDHEGQIQCLDFHPHEFLLATGSADRTVKFWDLETFELIGSAGPETAGVRCLTF  235

Query  647  TPDGRWVV  670
             PDGR V+
Sbjct  236  NPDGRTVL  243


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 55/117 (47%), Gaps = 2/117 (2%)
 Frame = +2

Query  227  FVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAE  406
            +  H+  VN +RF     R  ++GG+D+ V +W +           H   ++ + F   E
Sbjct  139  YKGHTRGVNAIRFTPDG-RWVVSGGEDNIVKVWDLTAGKLLHQFKDHEGQIQCLDFHPHE  197

Query  407  ILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
             L+A GS+   +K WDLE  ++I +     +    L F+P G     G +  NLK++
Sbjct  198  FLLATGSADRTVKFWDLETFELIGSAGPETAGVRCLTFNPDGRTVLCG-LHENLKVF  253



>gb|KJB12377.1| hypothetical protein B456_002G014900 [Gossypium raimondii]
Length=815

 Score =   263 bits (671),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 139/156 (89%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS +VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +   LSGHTS ++
Sbjct  4    KRAYKLQEFVAHSSSVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILNLSGHTSGID  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S+ FDS+E+LVAAG++SG IKLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DT
Sbjct  64   SVTFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIRKKGCIHTYKGHTRG++ IRFTPDGRWVV
Sbjct  124  NLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVV  159


 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 60/128 (47%), Gaps = 0/128 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GHT  V +I F      V +G    ++K+WDL   
Sbjct  116  FASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNIVKVWDLTAG  175

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      L+FHP     A+GS D  +K WD+     I +    T G+  + F
Sbjct  176  KLLHQFKDHEGQIQCLDFHPHEFLLATGSADRTVKFWDLETFELIGSAGPETAGVRCLTF  235

Query  647  TPDGRWVV  670
             PDGR V+
Sbjct  236  NPDGRTVL  243


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/120 (27%), Positives = 56/120 (47%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN +RF     R  ++GG+D+ V +W +           H   ++ + F 
Sbjct  136  IHTYKGHTRGVNAIRFTPDG-RWVVSGGEDNIVKVWDLTAGKLLHQFKDHEGQIQCLDFH  194

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +    L F+P G     G +  NLK++
Sbjct  195  PHEFLLATGSADRTVKFWDLETFELIGSAGPETAGVRCLTFNPDGRTVLCG-LHENLKVF  253



>ref|XP_006360856.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
[Solanum tuberosum]
Length=811

 Score =   263 bits (671),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 114/156 (73%), Positives = 141/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS +VNCL+ G+K+ R+ +TGG+DH VNLWSIGKP +  +LSGH+S ++
Sbjct  5    KRAYKLQEFVAHSLSVNCLKIGRKSSRVLVTGGEDHKVNLWSIGKPDAILSLSGHSSGID  64

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++FDS E+LVAAG++SG IKLWDLE+ K++RTL+GHRS C +L+FHPFGEFFASGS+DT
Sbjct  65   SVSFDSLEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISLDFHPFGEFFASGSLDT  124

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIR+KGCIHTYKGHTRG++TIRFTPDGRWVV
Sbjct  125  NLKIWDIRRKGCIHTYKGHTRGVNTIRFTPDGRWVV  160


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/125 (30%), Positives = 57/125 (46%), Gaps = 0/125 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I +     T  GHT  V +I F      V +G     +K+WDL   
Sbjct  117  FASGSLDTNLKIWDIRRKGCIHTYKGHTRGVNTIRFTPDGRWVVSGGEDSSVKIWDLTAG  176

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      ++FHP     A+GS D  +K WD+     I +    T G+ ++ F
Sbjct  177  KLLHDFKCHEGKIQCIDFHPHEFLLATGSADKTVKFWDLESFELIGSAGPETTGVRSMAF  236

Query  647  TPDGR  661
              DGR
Sbjct  237  NTDGR  241


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/120 (27%), Positives = 56/120 (47%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN +RF     R  ++GG+D SV +W +           H   ++ I F 
Sbjct  137  IHTYKGHTRGVNTIRFTPDG-RWVVSGGEDSSVKIWDLTAGKLLHDFKCHEGKIQCIDFH  195

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   ++ F+  G     G +  NLK++
Sbjct  196  PHEFLLATGSADKTVKFWDLESFELIGSAGPETTGVRSMAFNTDGRTLLCG-LHENLKVF  254



>ref|XP_010458498.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Camelina sativa]
Length=1009

 Score =   265 bits (677),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/158 (73%), Positives = 136/158 (86%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MA RGY LQEFVAHSGNVNCL  GKKT R+ LTGGDD+ VNLWSIGK TS  +L GHTSP
Sbjct  1    MANRGYNLQEFVAHSGNVNCLSIGKKTSRLLLTGGDDYKVNLWSIGKTTSLMSLCGHTSP  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            V+S+AF+S E+LV  G+SSG+IKLWDL++ KM+R  +GHRS C+A+EFHPFGEF ASGS 
Sbjct  61   VDSVAFNSEEVLVLGGASSGVIKLWDLQEAKMVRAFTGHRSNCSAVEFHPFGEFLASGSR  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DTNL++WD RKKGCI TYKGHTRGI+TI+F+PDGRWVV
Sbjct  121  DTNLRVWDTRKKGCIQTYKGHTRGITTIKFSPDGRWVV  158


 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 64/148 (43%), Gaps = 1/148 (1%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            ++ F  H  N + + F         +G  D ++ +W   K     T  GHT  + +I F 
Sbjct  93   VRAFTGHRSNCSAVEF-HPFGEFLASGSRDTNLRVWDTRKKGCIQTYKGHTRGITTIKFS  151

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
                 V +G    ++K+WDL   K++     H     +L+FHP     A+GS D  +K W
Sbjct  152  PDGRWVVSGGLDNVVKVWDLTAGKLLHEFKFHEGPIRSLDFHPLEFLLATGSADRTVKFW  211

Query  578  DIRKKGCIHTYKGHTRGISTIRFTPDGR  661
            D+     I + +     +  I F PDG+
Sbjct  212  DLETFELIGSTRPEATEVRAITFHPDGQ  239


 Score = 58.9 bits (141),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 33/120 (28%), Positives = 58/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +Q +  H+  +  ++F     R  ++GG D+ V +W +           H  P+ S+ F 
Sbjct  135  IQTYKGHTRGITTIKFSPD-GRWVVSGGLDNVVKVWDLTAGKLLHEFKFHEGPIRSLDFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   A+ FHP G+    G +D  LK++
Sbjct  194  PLEFLLATGSADRTVKFWDLETFELIGSTRPEATEVRAITFHPDGQTLFCG-LDDGLKVY  252



>gb|KJB12372.1| hypothetical protein B456_002G014900 [Gossypium raimondii]
Length=847

 Score =   263 bits (672),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 139/156 (89%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS +VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +   LSGHTS ++
Sbjct  4    KRAYKLQEFVAHSSSVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILNLSGHTSGID  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S+ FDS+E+LVAAG++SG IKLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DT
Sbjct  64   SVTFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIRKKGCIHTYKGHTRG++ IRFTPDGRWVV
Sbjct  124  NLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVV  159


 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 60/128 (47%), Gaps = 0/128 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GHT  V +I F      V +G    ++K+WDL   
Sbjct  116  FASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNIVKVWDLTAG  175

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      L+FHP     A+GS D  +K WD+     I +    T G+  + F
Sbjct  176  KLLHQFKDHEGQIQCLDFHPHEFLLATGSADRTVKFWDLETFELIGSAGPETAGVRCLTF  235

Query  647  TPDGRWVV  670
             PDGR V+
Sbjct  236  NPDGRTVL  243


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/120 (27%), Positives = 56/120 (47%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN +RF     R  ++GG+D+ V +W +           H   ++ + F 
Sbjct  136  IHTYKGHTRGVNAIRFTPDG-RWVVSGGEDNIVKVWDLTAGKLLHQFKDHEGQIQCLDFH  194

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +    L F+P G     G +  NLK++
Sbjct  195  PHEFLLATGSADRTVKFWDLETFELIGSAGPETAGVRCLTFNPDGRTVLCG-LHENLKVF  253



>gb|KJB12373.1| hypothetical protein B456_002G014900 [Gossypium raimondii]
Length=849

 Score =   263 bits (672),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 139/156 (89%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS +VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +   LSGHTS ++
Sbjct  4    KRAYKLQEFVAHSSSVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILNLSGHTSGID  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S+ FDS+E+LVAAG++SG IKLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DT
Sbjct  64   SVTFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIRKKGCIHTYKGHTRG++ IRFTPDGRWVV
Sbjct  124  NLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVV  159


 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 60/128 (47%), Gaps = 0/128 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GHT  V +I F      V +G    ++K+WDL   
Sbjct  116  FASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNIVKVWDLTAG  175

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      L+FHP     A+GS D  +K WD+     I +    T G+  + F
Sbjct  176  KLLHQFKDHEGQIQCLDFHPHEFLLATGSADRTVKFWDLETFELIGSAGPETAGVRCLTF  235

Query  647  TPDGRWVV  670
             PDGR V+
Sbjct  236  NPDGRTVL  243


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/120 (27%), Positives = 56/120 (47%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN +RF     R  ++GG+D+ V +W +           H   ++ + F 
Sbjct  136  IHTYKGHTRGVNAIRFTPDG-RWVVSGGEDNIVKVWDLTAGKLLHQFKDHEGQIQCLDFH  194

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +    L F+P G     G +  NLK++
Sbjct  195  PHEFLLATGSADRTVKFWDLETFELIGSAGPETAGVRCLTFNPDGRTVLCG-LHENLKVF  253



>ref|XP_010458499.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X2 [Camelina sativa]
Length=1007

 Score =   265 bits (677),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/158 (73%), Positives = 136/158 (86%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MA RGY LQEFVAHSGNVNCL  GKKT R+ LTGGDD+ VNLWSIGK TS  +L GHTSP
Sbjct  1    MANRGYNLQEFVAHSGNVNCLSIGKKTSRLLLTGGDDYKVNLWSIGKTTSLMSLCGHTSP  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            V+S+AF+S E+LV  G+SSG+IKLWDL++ KM+R  +GHRS C+A+EFHPFGEF ASGS 
Sbjct  61   VDSVAFNSEEVLVLGGASSGVIKLWDLQEAKMVRAFTGHRSNCSAVEFHPFGEFLASGSR  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DTNL++WD RKKGCI TYKGHTRGI+TI+F+PDGRWVV
Sbjct  121  DTNLRVWDTRKKGCIQTYKGHTRGITTIKFSPDGRWVV  158


 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 64/148 (43%), Gaps = 1/148 (1%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            ++ F  H  N + + F         +G  D ++ +W   K     T  GHT  + +I F 
Sbjct  93   VRAFTGHRSNCSAVEF-HPFGEFLASGSRDTNLRVWDTRKKGCIQTYKGHTRGITTIKFS  151

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
                 V +G    ++K+WDL   K++     H     +L+FHP     A+GS D  +K W
Sbjct  152  PDGRWVVSGGLDNVVKVWDLTAGKLLHEFKFHEGPIRSLDFHPLEFLLATGSADRTVKFW  211

Query  578  DIRKKGCIHTYKGHTRGISTIRFTPDGR  661
            D+     I + +     +  I F PDG+
Sbjct  212  DLETFELIGSTRPEATEVRAITFHPDGQ  239


 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 33/120 (28%), Positives = 58/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +Q +  H+  +  ++F     R  ++GG D+ V +W +           H  P+ S+ F 
Sbjct  135  IQTYKGHTRGITTIKFSPD-GRWVVSGGLDNVVKVWDLTAGKLLHEFKFHEGPIRSLDFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   A+ FHP G+    G +D  LK++
Sbjct  194  PLEFLLATGSADRTVKFWDLETFELIGSTRPEATEVRAITFHPDGQTLFCG-LDDGLKVY  252



>gb|KJB12375.1| hypothetical protein B456_002G014900 [Gossypium raimondii]
Length=848

 Score =   263 bits (672),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 139/156 (89%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS +VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +   LSGHTS ++
Sbjct  4    KRAYKLQEFVAHSSSVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILNLSGHTSGID  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S+ FDS+E+LVAAG++SG IKLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DT
Sbjct  64   SVTFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIRKKGCIHTYKGHTRG++ IRFTPDGRWVV
Sbjct  124  NLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVV  159


 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 60/128 (47%), Gaps = 0/128 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GHT  V +I F      V +G    ++K+WDL   
Sbjct  116  FASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNIVKVWDLTAG  175

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      L+FHP     A+GS D  +K WD+     I +    T G+  + F
Sbjct  176  KLLHQFKDHEGQIQCLDFHPHEFLLATGSADRTVKFWDLETFELIGSAGPETAGVRCLTF  235

Query  647  TPDGRWVV  670
             PDGR V+
Sbjct  236  NPDGRTVL  243


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/120 (27%), Positives = 56/120 (47%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN +RF     R  ++GG+D+ V +W +           H   ++ + F 
Sbjct  136  IHTYKGHTRGVNAIRFTPDG-RWVVSGGEDNIVKVWDLTAGKLLHQFKDHEGQIQCLDFH  194

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +    L F+P G     G +  NLK++
Sbjct  195  PHEFLLATGSADRTVKFWDLETFELIGSAGPETAGVRCLTFNPDGRTVLCG-LHENLKVF  253



>gb|KJB12374.1| hypothetical protein B456_002G014900 [Gossypium raimondii]
Length=853

 Score =   263 bits (672),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 139/156 (89%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS +VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +   LSGHTS ++
Sbjct  4    KRAYKLQEFVAHSSSVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILNLSGHTSGID  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S+ FDS+E+LVAAG++SG IKLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DT
Sbjct  64   SVTFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIRKKGCIHTYKGHTRG++ IRFTPDGRWVV
Sbjct  124  NLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVV  159


 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 60/128 (47%), Gaps = 0/128 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GHT  V +I F      V +G    ++K+WDL   
Sbjct  116  FASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNIVKVWDLTAG  175

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      L+FHP     A+GS D  +K WD+     I +    T G+  + F
Sbjct  176  KLLHQFKDHEGQIQCLDFHPHEFLLATGSADRTVKFWDLETFELIGSAGPETAGVRCLTF  235

Query  647  TPDGRWVV  670
             PDGR V+
Sbjct  236  NPDGRTVL  243


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/120 (27%), Positives = 56/120 (47%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN +RF     R  ++GG+D+ V +W +           H   ++ + F 
Sbjct  136  IHTYKGHTRGVNAIRFTPDG-RWVVSGGEDNIVKVWDLTAGKLLHQFKDHEGQIQCLDFH  194

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +    L F+P G     G +  NLK++
Sbjct  195  PHEFLLATGSADRTVKFWDLETFELIGSAGPETAGVRCLTFNPDGRTVLCG-LHENLKVF  253



>ref|XP_010655954.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Vitis vinifera]
 ref|XP_010655955.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Vitis vinifera]
 ref|XP_010655956.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Vitis vinifera]
 ref|XP_010655957.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Vitis vinifera]
Length=797

 Score =   262 bits (670),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 141/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS +VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +  +LSGHTS ++
Sbjct  4    KRAYKLQEFVAHSSSVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHTSGID  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++FDS+E+LVAAG++SG IKLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DT
Sbjct  64   SVSFDSSELLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIRKKGCIHTYKGHTRG++ IRFTPDGRWVV
Sbjct  124  NLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVV  159


 Score = 74.7 bits (182),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 59/128 (46%), Gaps = 0/128 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GHT  V +I F      V +G     +KLWDL   
Sbjct  116  FASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNTVKLWDLTAG  175

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      ++FHP     A+GS D  +K WD+     I +    T G+  + F
Sbjct  176  KLLHDFKSHEGQLQCIDFHPHEFLLATGSADRTVKFWDLETFELIGSAGPETAGVRCMTF  235

Query  647  TPDGRWVV  670
             PDG+ ++
Sbjct  236  NPDGKTLL  243


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/120 (27%), Positives = 58/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN +RF     R  ++GG+D++V LW +           H   ++ I F 
Sbjct  136  IHTYKGHTRGVNAIRFTPDG-RWVVSGGEDNTVKLWDLTAGKLLHDFKSHEGQLQCIDFH  194

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +    + F+P G+    G +  +LK++
Sbjct  195  PHEFLLATGSADRTVKFWDLETFELIGSAGPETAGVRCMTFNPDGKTLLCG-LHESLKVF  253



>gb|KEH24722.1| katanin p80 WD40 repeat subunit B1-like protein [Medicago truncatula]
Length=760

 Score =   261 bits (668),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 112/156 (72%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAH+  VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +  +LSGH+S ++
Sbjct  4    KRAYKLQEFVAHASAVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHSSGID  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S+ FDS+E+LVAAG++SG IKLWDLE+ K++RTL+GHRS CT+++FHPFGEFFASGS+DT
Sbjct  64   SVNFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCTSVDFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIRKKGCIHTYKGHTRG++ IRFTPDGRWVV
Sbjct  124  NLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVV  159


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 61/128 (48%), Gaps = 0/128 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GHT  V +I F      V +G     +KLWDL   
Sbjct  116  FASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNTVKLWDLTAG  175

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      ++FHP     A+GS D  +K WD+     I +    T G+ ++ F
Sbjct  176  KLLHDFKSHEGQIQCIDFHPSEFLLATGSADRTVKFWDLETFELIGSAGPETTGVRSLTF  235

Query  647  TPDGRWVV  670
            +PDGR ++
Sbjct  236  SPDGRTLL  243


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/120 (28%), Positives = 58/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN +RF     R  ++GG+D++V LW +           H   ++ I F 
Sbjct  136  IHTYKGHTRGVNAIRF-TPDGRWVVSGGEDNTVKLWDLTAGKLLHDFKSHEGQIQCIDFH  194

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
             +E L+A GS+   +K WDLE  ++I +     +   +L F P G     G +  +LK++
Sbjct  195  PSEFLLATGSADRTVKFWDLETFELIGSAGPETTGVRSLTFSPDGRTLLCG-LHESLKVF  253



>ref|XP_010655958.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X2 [Vitis vinifera]
 ref|XP_010655959.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X2 [Vitis vinifera]
Length=796

 Score =   262 bits (670),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 141/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS +VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +  +LSGHTS ++
Sbjct  4    KRAYKLQEFVAHSSSVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHTSGID  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++FDS+E+LVAAG++SG IKLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DT
Sbjct  64   SVSFDSSELLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIRKKGCIHTYKGHTRG++ IRFTPDGRWVV
Sbjct  124  NLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVV  159


 Score = 74.7 bits (182),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 59/128 (46%), Gaps = 0/128 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GHT  V +I F      V +G     +KLWDL   
Sbjct  116  FASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNTVKLWDLTAG  175

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      ++FHP     A+GS D  +K WD+     I +    T G+  + F
Sbjct  176  KLLHDFKSHEGQLQCIDFHPHEFLLATGSADRTVKFWDLETFELIGSAGPETAGVRCMTF  235

Query  647  TPDGRWVV  670
             PDG+ ++
Sbjct  236  NPDGKTLL  243


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/120 (27%), Positives = 58/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN +RF     R  ++GG+D++V LW +           H   ++ I F 
Sbjct  136  IHTYKGHTRGVNAIRFTPDG-RWVVSGGEDNTVKLWDLTAGKLLHDFKSHEGQLQCIDFH  194

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +    + F+P G+    G +  +LK++
Sbjct  195  PHEFLLATGSADRTVKFWDLETFELIGSAGPETAGVRCMTFNPDGKTLLCG-LHESLKVF  253



>ref|XP_010940396.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Elaeis guineensis]
Length=784

 Score =   262 bits (669),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 114/156 (73%), Positives = 138/156 (88%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS NVNCL+ G++T R+ +TGG+DH VNLWSIGKP +  +LSGHTS VE
Sbjct  5    KRAYKLQEFVAHSSNVNCLKIGRRTSRVLVTGGEDHKVNLWSIGKPNAILSLSGHTSAVE  64

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++FDS+E+LVAAG++SG IKLWDLE+ K++RTL+GHRS C +++FHPFGEF ASGS DT
Sbjct  65   SVSFDSSEVLVAAGAASGTIKLWDLEEAKVVRTLTGHRSNCVSVDFHPFGEFLASGSSDT  124

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIR+K CIHTYKGHTRG++ IRFTPDGRWVV
Sbjct  125  NLKIWDIRRKSCIHTYKGHTRGVNAIRFTPDGRWVV  160


 Score = 74.3 bits (181),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 40/138 (29%), Positives = 63/138 (46%), Gaps = 1/138 (1%)
 Frame = +2

Query  251  NCLRFGKKTCRMFL-TGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGS  427
            NC+         FL +G  D ++ +W I + +   T  GHT  V +I F      V +G 
Sbjct  104  NCVSVDFHPFGEFLASGSSDTNLKIWDIRRKSCIHTYKGHTRGVNAIRFTPDGRWVVSGG  163

Query  428  SSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHT  607
               ++KLWDL   K++     H      ++FHP     A+GS D  +K WD+     + +
Sbjct  164  EDNVVKLWDLTAGKLLHDFKCHEGQIQCIDFHPHEFLLATGSADRTVKFWDLETFELVGS  223

Query  608  YKGHTRGISTIRFTPDGR  661
                  G+ ++ F PDGR
Sbjct  224  AGPEATGVRSMTFNPDGR  241


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 59/125 (47%), Gaps = 2/125 (2%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            +R   +  +  H+  VN +RF     R  ++GG+D+ V LW +           H   ++
Sbjct  132  RRKSCIHTYKGHTRGVNAIRFTPDG-RWVVSGGEDNVVKLWDLTAGKLLHDFKCHEGQIQ  190

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
             I F   E L+A GS+   +K WDLE  +++ +     +   ++ F+P G     G  +T
Sbjct  191  CIDFHPHEFLLATGSADRTVKFWDLETFELVGSAGPEATGVRSMTFNPDGRNLLCGLHET  250

Query  563  NLKIW  577
             LK++
Sbjct  251  -LKVF  254



>ref|XP_009790405.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X2 [Nicotiana sylvestris]
Length=656

 Score =   259 bits (662),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 111/156 (71%), Positives = 141/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS +VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +  +LSGH+S ++
Sbjct  5    KRAYKLQEFVAHSLSVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHSSGID  64

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++FDS+E+LVAAG++SG IKLWDLE+ K++RTL+GHRS C +L+FHPFGEFFASGS+DT
Sbjct  65   SVSFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISLDFHPFGEFFASGSLDT  124

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIR+KGCIHTYKGH+RG++ IRFTPDGRWVV
Sbjct  125  NLKIWDIRRKGCIHTYKGHSRGVNAIRFTPDGRWVV  160


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/128 (30%), Positives = 59/128 (46%), Gaps = 0/128 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I +     T  GH+  V +I F      V +G     +KLWDL   
Sbjct  117  FASGSLDTNLKIWDIRRKGCIHTYKGHSRGVNAIRFTPDGRWVVSGGEDNTVKLWDLTAG  176

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      ++FHP     A+GS D  +K WD+     I +    T G+  + F
Sbjct  177  KLLHDFKCHEGQIQCIDFHPHEFLLATGSADRTVKFWDLETFELIGSAGPETSGVRCMTF  236

Query  647  TPDGRWVV  670
             PDGR ++
Sbjct  237  NPDGRTLL  244


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/119 (29%), Positives = 56/119 (47%), Gaps = 2/119 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  HS  VN +RF     R  ++GG+D++V LW +           H   ++ I F 
Sbjct  137  IHTYKGHSRGVNAIRFTPDG-RWVVSGGEDNTVKLWDLTAGKLLHDFKCHEGQIQCIDFH  195

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKI  574
              E L+A GS+   +K WDLE  ++I +     S    + F+P G     G +  +LK+
Sbjct  196  PHEFLLATGSADRTVKFWDLETFELIGSAGPETSGVRCMTFNPDGRTLLCG-LHESLKV  253



>ref|XP_004231535.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
[Solanum lycopersicum]
Length=798

 Score =   262 bits (669),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 112/156 (72%), Positives = 141/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS +VNCL+ G+K+ R+ LTGG+DH VNLW+IGKP +  +LSGH+S ++
Sbjct  5    KRAYKLQEFVAHSLSVNCLKIGRKSSRVLLTGGEDHKVNLWAIGKPNAILSLSGHSSGID  64

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++FDS+E+LVAAG++SG IKLWDLE+ K++RTL+GHRS C +L+FHPFGEFFASGS+DT
Sbjct  65   SVSFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISLDFHPFGEFFASGSLDT  124

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIR+KGCIHTYKGH+RG++ IRFTPDGRWVV
Sbjct  125  NLKIWDIRRKGCIHTYKGHSRGVNAIRFTPDGRWVV  160


 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 57/125 (46%), Gaps = 0/125 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I +     T  GH+  V +I F      V +G     +KLWDL   
Sbjct  117  FASGSLDTNLKIWDIRRKGCIHTYKGHSRGVNAIRFTPDGRWVVSGGEDNTVKLWDLTAG  176

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      ++FHP     A+GS D  +K WD+     I +    T G+  + F
Sbjct  177  KLLHDFKCHEGQIQCIDFHPHEFLLATGSADRTVKFWDLETFELIGSSGPETSGVRCMTF  236

Query  647  TPDGR  661
             PDGR
Sbjct  237  NPDGR  241


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/119 (29%), Positives = 56/119 (47%), Gaps = 2/119 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  HS  VN +RF     R  ++GG+D++V LW +           H   ++ I F 
Sbjct  137  IHTYKGHSRGVNAIRFTPDG-RWVVSGGEDNTVKLWDLTAGKLLHDFKCHEGQIQCIDFH  195

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKI  574
              E L+A GS+   +K WDLE  ++I +     S    + F+P G     G +  +LK+
Sbjct  196  PHEFLLATGSADRTVKFWDLETFELIGSSGPETSGVRCMTFNPDGRTLLCG-LHESLKV  253



>ref|XP_010067050.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X2 [Eucalyptus grandis]
Length=786

 Score =   262 bits (669),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 111/156 (71%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS  VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +  +LSGH+S ++
Sbjct  4    KRAYKLQEFVAHSAAVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAIQSLSGHSSGID  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++FDS+E+LVAAG++SG IK+WDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DT
Sbjct  64   SVSFDSSEVLVAAGAASGSIKIWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIRKKGCIHTYKGHTRG++ IRFTPDGRWVV
Sbjct  124  NLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVV  159


 Score = 74.7 bits (182),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 57/125 (46%), Gaps = 0/125 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GHT  V +I F      V +G     +KLWDL   
Sbjct  116  FASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNTVKLWDLTAG  175

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      ++FHP     A+GS D  +K WD+     I +    + G+  + F
Sbjct  176  KLLHDFKSHEGQVQCIDFHPHEFLLATGSADRTVKFWDLETFELIGSSGPESTGVRCLTF  235

Query  647  TPDGR  661
             PDGR
Sbjct  236  NPDGR  240


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 56/119 (47%), Gaps = 2/119 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN +RF     R  ++GG+D++V LW +           H   V+ I F 
Sbjct  136  IHTYKGHTRGVNAIRF-TPDGRWVVSGGEDNTVKLWDLTAGKLLHDFKSHEGQVQCIDFH  194

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKI  574
              E L+A GS+   +K WDLE  ++I +     +    L F+P G     G +  NLK+
Sbjct  195  PHEFLLATGSADRTVKFWDLETFELIGSSGPESTGVRCLTFNPDGRTLLCG-LHENLKV  252



>ref|XP_010067049.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Eucalyptus grandis]
 gb|KCW65113.1| hypothetical protein EUGRSUZ_G02621 [Eucalyptus grandis]
Length=787

 Score =   262 bits (669),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 111/156 (71%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS  VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +  +LSGH+S ++
Sbjct  4    KRAYKLQEFVAHSAAVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAIQSLSGHSSGID  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++FDS+E+LVAAG++SG IK+WDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DT
Sbjct  64   SVSFDSSEVLVAAGAASGSIKIWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIRKKGCIHTYKGHTRG++ IRFTPDGRWVV
Sbjct  124  NLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVV  159


 Score = 74.7 bits (182),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 57/125 (46%), Gaps = 0/125 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GHT  V +I F      V +G     +KLWDL   
Sbjct  116  FASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNTVKLWDLTAG  175

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      ++FHP     A+GS D  +K WD+     I +    + G+  + F
Sbjct  176  KLLHDFKSHEGQVQCIDFHPHEFLLATGSADRTVKFWDLETFELIGSSGPESTGVRCLTF  235

Query  647  TPDGR  661
             PDGR
Sbjct  236  NPDGR  240


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 56/119 (47%), Gaps = 2/119 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN +RF     R  ++GG+D++V LW +           H   V+ I F 
Sbjct  136  IHTYKGHTRGVNAIRF-TPDGRWVVSGGEDNTVKLWDLTAGKLLHDFKSHEGQVQCIDFH  194

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKI  574
              E L+A GS+   +K WDLE  ++I +     +    L F+P G     G +  NLK+
Sbjct  195  PHEFLLATGSADRTVKFWDLETFELIGSSGPESTGVRCLTFNPDGRTLLCG-LHENLKV  252



>ref|XP_006361541.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
[Solanum tuberosum]
Length=798

 Score =   262 bits (669),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 112/156 (72%), Positives = 141/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS +VNCL+ G+K+ R+ LTGG+DH VNLW+IGKP +  +LSGH+S ++
Sbjct  5    KRAYKLQEFVAHSLSVNCLKIGRKSSRVLLTGGEDHKVNLWAIGKPNAILSLSGHSSGID  64

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++FDS+E+LVAAG++SG IKLWDLE+ K++RTL+GHRS C +L+FHPFGEFFASGS+DT
Sbjct  65   SVSFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISLDFHPFGEFFASGSLDT  124

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIR+KGCIHTYKGH+RG++ IRFTPDGRWVV
Sbjct  125  NLKIWDIRRKGCIHTYKGHSRGVNAIRFTPDGRWVV  160


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 57/125 (46%), Gaps = 0/125 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I +     T  GH+  V +I F      V +G     +KLWDL   
Sbjct  117  FASGSLDTNLKIWDIRRKGCIHTYKGHSRGVNAIRFTPDGRWVVSGGEDNTVKLWDLTAG  176

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      ++FHP     A+GS D  +K WD+     I +    T G+  + F
Sbjct  177  KLLHDFKCHEGQIQCIDFHPHEFLLATGSADRTVKFWDLETFELIGSSGPETSGVRCMTF  236

Query  647  TPDGR  661
             PDGR
Sbjct  237  NPDGR  241


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/119 (29%), Positives = 56/119 (47%), Gaps = 2/119 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  HS  VN +RF     R  ++GG+D++V LW +           H   ++ I F 
Sbjct  137  IHTYKGHSRGVNAIRFTPDG-RWVVSGGEDNTVKLWDLTAGKLLHDFKCHEGQIQCIDFH  195

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKI  574
              E L+A GS+   +K WDLE  ++I +     S    + F+P G     G +  +LK+
Sbjct  196  PHEFLLATGSADRTVKFWDLETFELIGSSGPETSGVRCMTFNPDGRTLLCG-LHESLKV  253



>ref|XP_006392030.1| hypothetical protein EUTSA_v10023227mg [Eutrema salsugineum]
 gb|ESQ29316.1| hypothetical protein EUTSA_v10023227mg [Eutrema salsugineum]
Length=1127

 Score =   265 bits (677),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 121/176 (69%), Positives = 139/176 (79%), Gaps = 18/176 (10%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTS----------  346
            MAKRGYKLQEF+AHS NVNCL  GKKT R+ +TGGDD+ VNLW+IGKPTS          
Sbjct  1    MAKRGYKLQEFLAHSANVNCLSIGKKTLRLLITGGDDYKVNLWAIGKPTSLMVCFTFSLL  60

Query  347  --------TSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSY  502
                      +L GHTS V+S+AFDSAE+LV  G+SSG+IKLWDLE+ KM+R  +GHRS 
Sbjct  61   SKFFLLVEQKSLCGHTSAVDSVAFDSAEVLVLGGASSGVIKLWDLEEAKMVRAFTGHRSN  120

Query  503  CTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            C+A+EFHPFGEF ASGS DTNLKIWDIRKKGCI TYKGHTRGI+TI+FTPDGRWVV
Sbjct  121  CSAVEFHPFGEFLASGSSDTNLKIWDIRKKGCIQTYKGHTRGINTIKFTPDGRWVV  176


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/120 (28%), Positives = 56/120 (47%), Gaps = 16/120 (13%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +Q +  H+  +N ++F     R  +TGG D+ V                H  P+ S+ F 
Sbjct  153  IQTYKGHTRGINTIKFTPD-GRWVVTGGLDNVVKF--------------HEGPIRSLDFH  197

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   +++FHP G     G +D  LK++
Sbjct  198  PLEFLLATGSADRTVKFWDLETFELIGSTRPEATGVRSMKFHPDGRTLFCG-LDDGLKVY  256



>ref|XP_008776609.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X2 [Phoenix dactylifera]
Length=726

 Score =   260 bits (665),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = +2

Query  200  AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV  379
            AKR YKLQEF AH+ NVNCL+ G+KT R+  TGG+DH VNLW++GKP +  +LSGHTS V
Sbjct  3    AKRAYKLQEFAAHASNVNCLKIGRKTSRVLFTGGEDHKVNLWALGKPNAILSLSGHTSAV  62

Query  380  ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD  559
            ES++FDS+E+L+AAG++SG IKLWDLE+  ++RTL+GHRS C +++FHPFGEF ASGS+D
Sbjct  63   ESVSFDSSEVLLAAGAASGTIKLWDLEEANVVRTLTGHRSNCISVDFHPFGEFIASGSLD  122

Query  560  TNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            TNLKIWDIR+KGCIHTYKGHTRG+++IRFTPDGRWVV
Sbjct  123  TNLKIWDIRRKGCIHTYKGHTRGVNSIRFTPDGRWVV  159


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/138 (30%), Positives = 61/138 (44%), Gaps = 1/138 (1%)
 Frame = +2

Query  251  NCLRFGKKTCRMFLTGGD-DHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGS  427
            NC+         F+  G  D ++ +W I +     T  GHT  V SI F      V +G 
Sbjct  103  NCISVDFHPFGEFIASGSLDTNLKIWDIRRKGCIHTYKGHTRGVNSIRFTPDGRWVVSGG  162

Query  428  SSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHT  607
               ++KLWDL   K++     H      ++FHP     A+GS D  +K WD+     I +
Sbjct  163  EDNIVKLWDLTAGKLLHDFKCHEGQIQCIDFHPHEFLLATGSADKTVKFWDLETFEMIGS  222

Query  608  YKGHTRGISTIRFTPDGR  661
                T  + ++ F PDGR
Sbjct  223  SGPETSSVHSMTFNPDGR  240


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 58/124 (47%), Gaps = 2/124 (2%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            +R   +  +  H+  VN +RF     R  ++GG+D+ V LW +           H   ++
Sbjct  131  RRKGCIHTYKGHTRGVNSIRFTPDG-RWVVSGGEDNIVKLWDLTAGKLLHDFKCHEGQIQ  189

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
             I F   E L+A GS+   +K WDLE  +MI +     S   ++ F+P G     G +  
Sbjct  190  CIDFHPHEFLLATGSADKTVKFWDLETFEMIGSSGPETSSVHSMTFNPDGRTLCCG-LHE  248

Query  563  NLKI  574
            +LK+
Sbjct  249  SLKV  252



>ref|XP_004489186.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X2 [Cicer arietinum]
Length=746

 Score =   260 bits (665),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 112/156 (72%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAH+  VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +  +LSGH+S ++
Sbjct  4    KRAYKLQEFVAHASAVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHSSGID  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S+ FDS+E+LVAAG++SG IKLWDLE+ K++RTL+GHRS CT+++FHPFGEFFASGS+DT
Sbjct  64   SVNFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCTSVDFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIRKKGCIHTYKGHTRG++ IRFTPDGRWVV
Sbjct  124  NLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVV  159


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 61/128 (48%), Gaps = 0/128 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GHT  V +I F      V +G     +KLWDL   
Sbjct  116  FASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNTVKLWDLTAG  175

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      ++FHP     A+GS D  +K WD+     I +    T G+ ++ F
Sbjct  176  KLLHDFKCHEGQIQCIDFHPSEFLLATGSADRTVKFWDLETFELIGSTGPETTGVRSLTF  235

Query  647  TPDGRWVV  670
            +PDGR ++
Sbjct  236  SPDGRTLL  243


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/120 (28%), Positives = 58/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN +RF     R  ++GG+D++V LW +           H   ++ I F 
Sbjct  136  IHTYKGHTRGVNAIRFTPDG-RWVVSGGEDNTVKLWDLTAGKLLHDFKCHEGQIQCIDFH  194

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
             +E L+A GS+   +K WDLE  ++I +     +   +L F P G     G +  +LK++
Sbjct  195  PSEFLLATGSADRTVKFWDLETFELIGSTGPETTGVRSLTFSPDGRTLLCG-LHESLKVF  253



>ref|XP_011046586.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X3 [Populus euphratica]
Length=748

 Score =   260 bits (665),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 111/156 (71%), Positives = 141/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS +VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +  +LSGHTS ++
Sbjct  4    KRAYKLQEFVAHSSSVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHTSGID  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++FDS+E+LVAAG++SG +KLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DT
Sbjct  64   SVSFDSSEVLVAAGAASGTVKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIRKKGCIHTYKGH+RG++ IRFTPDGRWVV
Sbjct  124  NLKIWDIRKKGCIHTYKGHSRGVNAIRFTPDGRWVV  159


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 56/125 (45%), Gaps = 0/125 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GH+  V +I F      V +G     +KLWDL   
Sbjct  116  FASGSLDTNLKIWDIRKKGCIHTYKGHSRGVNAIRFTPDGRWVVSGGEDNTVKLWDLTAG  175

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      ++FHP     A+GS D  +K WD+     I +    T G+  + F
Sbjct  176  KLLHDFKCHEGQIQCIDFHPHEFLLATGSADRTVKFWDLETFELIGSAGPETTGVRCLTF  235

Query  647  TPDGR  661
              DGR
Sbjct  236  NSDGR  240


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/127 (28%), Positives = 58/127 (46%), Gaps = 2/127 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  HS  VN +RF     R  ++GG+D++V LW +           H   ++ I F 
Sbjct  136  IHTYKGHSRGVNAIRFTPDG-RWVVSGGEDNTVKLWDLTAGKLLHDFKCHEGQIQCIDFH  194

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +    L F+  G     G +  +LK++
Sbjct  195  PHEFLLATGSADRTVKFWDLETFELIGSAGPETTGVRCLTFNSDGRTLLCG-LHESLKVF  253

Query  578  DIRKKGC  598
                 GC
Sbjct  254  SWEPIGC  260



>ref|XP_004489185.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Cicer arietinum]
Length=747

 Score =   260 bits (665),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 112/156 (72%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAH+  VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +  +LSGH+S ++
Sbjct  4    KRAYKLQEFVAHASAVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHSSGID  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S+ FDS+E+LVAAG++SG IKLWDLE+ K++RTL+GHRS CT+++FHPFGEFFASGS+DT
Sbjct  64   SVNFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCTSVDFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIRKKGCIHTYKGHTRG++ IRFTPDGRWVV
Sbjct  124  NLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVV  159


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 61/128 (48%), Gaps = 0/128 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GHT  V +I F      V +G     +KLWDL   
Sbjct  116  FASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNTVKLWDLTAG  175

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      ++FHP     A+GS D  +K WD+     I +    T G+ ++ F
Sbjct  176  KLLHDFKCHEGQIQCIDFHPSEFLLATGSADRTVKFWDLETFELIGSTGPETTGVRSLTF  235

Query  647  TPDGRWVV  670
            +PDGR ++
Sbjct  236  SPDGRTLL  243


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/120 (28%), Positives = 58/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN +RF     R  ++GG+D++V LW +           H   ++ I F 
Sbjct  136  IHTYKGHTRGVNAIRFTPDG-RWVVSGGEDNTVKLWDLTAGKLLHDFKCHEGQIQCIDFH  194

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
             +E L+A GS+   +K WDLE  ++I +     +   +L F P G     G +  +LK++
Sbjct  195  PSEFLLATGSADRTVKFWDLETFELIGSTGPETTGVRSLTFSPDGRTLLCG-LHESLKVF  253



>ref|XP_011013727.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Populus euphratica]
 ref|XP_011013728.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Populus euphratica]
Length=753

 Score =   260 bits (665),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 111/156 (71%), Positives = 141/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS +VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +  +LSGHTS ++
Sbjct  4    KRAYKLQEFVAHSSSVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHTSGID  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++FDS+E+LVAAG++SG +KLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DT
Sbjct  64   SVSFDSSEVLVAAGAASGTVKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIRKKGCIHTYKGH+RG++ IRFTPDGRWVV
Sbjct  124  NLKIWDIRKKGCIHTYKGHSRGVNAIRFTPDGRWVV  159


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 56/125 (45%), Gaps = 0/125 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GH+  V +I F      V +G     +KLWDL   
Sbjct  116  FASGSLDTNLKIWDIRKKGCIHTYKGHSRGVNAIRFTPDGRWVVSGGEDNTVKLWDLTAG  175

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      ++FHP     A+GS D  +K WD+     I +    T G+  + F
Sbjct  176  KLLHDFKCHEGQIQCIDFHPHEFLLATGSADRTVKFWDLETFELIGSAGPETTGVRCLTF  235

Query  647  TPDGR  661
              DGR
Sbjct  236  NSDGR  240


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/127 (28%), Positives = 58/127 (46%), Gaps = 2/127 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  HS  VN +RF     R  ++GG+D++V LW +           H   ++ I F 
Sbjct  136  IHTYKGHSRGVNAIRFTPDG-RWVVSGGEDNTVKLWDLTAGKLLHDFKCHEGQIQCIDFH  194

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +    L F+  G     G +  +LK++
Sbjct  195  PHEFLLATGSADRTVKFWDLETFELIGSAGPETTGVRCLTFNSDGRTLLCG-LHESLKVF  253

Query  578  DIRKKGC  598
                 GC
Sbjct  254  SWEPIGC  260



>ref|XP_011046585.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X2 [Populus euphratica]
Length=751

 Score =   260 bits (665),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 111/156 (71%), Positives = 141/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS +VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +  +LSGHTS ++
Sbjct  4    KRAYKLQEFVAHSSSVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHTSGID  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++FDS+E+LVAAG++SG +KLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DT
Sbjct  64   SVSFDSSEVLVAAGAASGTVKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIRKKGCIHTYKGH+RG++ IRFTPDGRWVV
Sbjct  124  NLKIWDIRKKGCIHTYKGHSRGVNAIRFTPDGRWVV  159


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 56/125 (45%), Gaps = 0/125 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GH+  V +I F      V +G     +KLWDL   
Sbjct  116  FASGSLDTNLKIWDIRKKGCIHTYKGHSRGVNAIRFTPDGRWVVSGGEDNTVKLWDLTAG  175

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      ++FHP     A+GS D  +K WD+     I +    T G+  + F
Sbjct  176  KLLHDFKCHEGQIQCIDFHPHEFLLATGSADRTVKFWDLETFELIGSAGPETTGVRCLTF  235

Query  647  TPDGR  661
              DGR
Sbjct  236  NSDGR  240


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/127 (28%), Positives = 58/127 (46%), Gaps = 2/127 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  HS  VN +RF     R  ++GG+D++V LW +           H   ++ I F 
Sbjct  136  IHTYKGHSRGVNAIRFTPDG-RWVVSGGEDNTVKLWDLTAGKLLHDFKCHEGQIQCIDFH  194

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +    L F+  G     G +  +LK++
Sbjct  195  PHEFLLATGSADRTVKFWDLETFELIGSAGPETTGVRCLTFNSDGRTLLCG-LHESLKVF  253

Query  578  DIRKKGC  598
                 GC
Sbjct  254  SWEPIGC  260



>ref|XP_011046583.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Populus euphratica]
 ref|XP_011046584.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Populus euphratica]
Length=753

 Score =   260 bits (665),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 111/156 (71%), Positives = 141/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS +VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +  +LSGHTS ++
Sbjct  4    KRAYKLQEFVAHSSSVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHTSGID  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++FDS+E+LVAAG++SG +KLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DT
Sbjct  64   SVSFDSSEVLVAAGAASGTVKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIRKKGCIHTYKGH+RG++ IRFTPDGRWVV
Sbjct  124  NLKIWDIRKKGCIHTYKGHSRGVNAIRFTPDGRWVV  159


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 56/125 (45%), Gaps = 0/125 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GH+  V +I F      V +G     +KLWDL   
Sbjct  116  FASGSLDTNLKIWDIRKKGCIHTYKGHSRGVNAIRFTPDGRWVVSGGEDNTVKLWDLTAG  175

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      ++FHP     A+GS D  +K WD+     I +    T G+  + F
Sbjct  176  KLLHDFKCHEGQIQCIDFHPHEFLLATGSADRTVKFWDLETFELIGSAGPETTGVRCLTF  235

Query  647  TPDGR  661
              DGR
Sbjct  236  NSDGR  240


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/127 (28%), Positives = 58/127 (46%), Gaps = 2/127 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  HS  VN +RF     R  ++GG+D++V LW +           H   ++ I F 
Sbjct  136  IHTYKGHSRGVNAIRFTPDG-RWVVSGGEDNTVKLWDLTAGKLLHDFKCHEGQIQCIDFH  194

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +    L F+  G     G +  +LK++
Sbjct  195  PHEFLLATGSADRTVKFWDLETFELIGSAGPETTGVRCLTFNSDGRTLLCG-LHESLKVF  253

Query  578  DIRKKGC  598
                 GC
Sbjct  254  SWEPIGC  260



>ref|XP_011013729.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X2 [Populus euphratica]
Length=751

 Score =   260 bits (665),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 111/156 (71%), Positives = 141/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS +VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +  +LSGHTS ++
Sbjct  4    KRAYKLQEFVAHSSSVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHTSGID  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++FDS+E+LVAAG++SG +KLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DT
Sbjct  64   SVSFDSSEVLVAAGAASGTVKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIRKKGCIHTYKGH+RG++ IRFTPDGRWVV
Sbjct  124  NLKIWDIRKKGCIHTYKGHSRGVNAIRFTPDGRWVV  159


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/127 (30%), Positives = 56/127 (44%), Gaps = 0/127 (0%)
 Frame = +2

Query  281  RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLE  460
              F +G  D ++ +W I K     T  GH+  V +I F      V +G     +KLWDL 
Sbjct  114  EFFASGSLDTNLKIWDIRKKGCIHTYKGHSRGVNAIRFTPDGRWVVSGGEDNTVKLWDLT  173

Query  461  DTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTI  640
              K++     H      ++FHP     A+GS D  +K WD+     I +    T G+  +
Sbjct  174  AGKLLHDFKCHEGQIQCIDFHPHEFLLATGSADRTVKFWDLETFELIGSAGPETTGVRCL  233

Query  641  RFTPDGR  661
             F  DGR
Sbjct  234  TFNSDGR  240


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/127 (28%), Positives = 58/127 (46%), Gaps = 2/127 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  HS  VN +RF     R  ++GG+D++V LW +           H   ++ I F 
Sbjct  136  IHTYKGHSRGVNAIRFTPDG-RWVVSGGEDNTVKLWDLTAGKLLHDFKCHEGQIQCIDFH  194

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +    L F+  G     G +  +LK++
Sbjct  195  PHEFLLATGSADRTVKFWDLETFELIGSAGPETTGVRCLTFNSDGRTLLCG-LHESLKVF  253

Query  578  DIRKKGC  598
                 GC
Sbjct  254  SWEPIGC  260



>ref|XP_011013730.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X3 [Populus euphratica]
Length=748

 Score =   260 bits (664),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 111/156 (71%), Positives = 141/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS +VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +  +LSGHTS ++
Sbjct  4    KRAYKLQEFVAHSSSVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHTSGID  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++FDS+E+LVAAG++SG +KLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DT
Sbjct  64   SVSFDSSEVLVAAGAASGTVKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIRKKGCIHTYKGH+RG++ IRFTPDGRWVV
Sbjct  124  NLKIWDIRKKGCIHTYKGHSRGVNAIRFTPDGRWVV  159


 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 56/125 (45%), Gaps = 0/125 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GH+  V +I F      V +G     +KLWDL   
Sbjct  116  FASGSLDTNLKIWDIRKKGCIHTYKGHSRGVNAIRFTPDGRWVVSGGEDNTVKLWDLTAG  175

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      ++FHP     A+GS D  +K WD+     I +    T G+  + F
Sbjct  176  KLLHDFKCHEGQIQCIDFHPHEFLLATGSADRTVKFWDLETFELIGSAGPETTGVRCLTF  235

Query  647  TPDGR  661
              DGR
Sbjct  236  NSDGR  240


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/127 (28%), Positives = 58/127 (46%), Gaps = 2/127 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  HS  VN +RF     R  ++GG+D++V LW +           H   ++ I F 
Sbjct  136  IHTYKGHSRGVNAIRFTPDG-RWVVSGGEDNTVKLWDLTAGKLLHDFKCHEGQIQCIDFH  194

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +    L F+  G     G +  +LK++
Sbjct  195  PHEFLLATGSADRTVKFWDLETFELIGSAGPETTGVRCLTFNSDGRTLLCG-LHESLKVF  253

Query  578  DIRKKGC  598
                 GC
Sbjct  254  SWEPIGC  260



>ref|XP_003525689.2| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
[Glycine max]
Length=759

 Score =   260 bits (665),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 111/156 (71%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAH+  VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +  +LSGH+S ++
Sbjct  4    KRAYKLQEFVAHASTVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHSSGID  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++FDS+E+LVAAG++SG IKLWDLE+ K++RTL+ HRS CT+++FHPFGEFFASGS+DT
Sbjct  64   SVSFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTSHRSNCTSVDFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIRKKGCIHTYKGHTRG++ IRFTPDGRWVV
Sbjct  124  NLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVV  159


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 61/128 (48%), Gaps = 0/128 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GHT  V +I F      V +G     +KLWDL   
Sbjct  116  FASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNTVKLWDLTAG  175

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      ++FHP     A+GS D  +K WD+     I +    T G+ ++ F
Sbjct  176  KLLHDFKCHEGQVQCIDFHPNEFLLATGSADRTVKFWDLETFELIGSAGPETTGVRSLTF  235

Query  647  TPDGRWVV  670
            +PDGR ++
Sbjct  236  SPDGRTLL  243


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN +RF     R  ++GG+D++V LW +           H   V+ I F 
Sbjct  136  IHTYKGHTRGVNAIRFTPDG-RWVVSGGEDNTVKLWDLTAGKLLHDFKCHEGQVQCIDFH  194

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   +L F P G     G +  +LK++
Sbjct  195  PNEFLLATGSADRTVKFWDLETFELIGSAGPETTGVRSLTFSPDGRTLLCG-LHESLKVF  253



>gb|KJB47120.1| hypothetical protein B456_008G011900 [Gossypium raimondii]
Length=829

 Score =   261 bits (667),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 111/156 (71%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS +VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +  +LSGHTS ++
Sbjct  4    KRAYKLQEFVAHSSSVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHTSGID  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++FDS+E+LVAAG++SG IKLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DT
Sbjct  64   SVSFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLK+WDIRKKGCIHTYKGH RG++ IRFTPDGRWVV
Sbjct  124  NLKVWDIRKKGCIHTYKGHNRGVNAIRFTPDGRWVV  159


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 60/128 (47%), Gaps = 0/128 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GH   V +I F      V +G    ++K+WDL   
Sbjct  116  FASGSLDTNLKVWDIRKKGCIHTYKGHNRGVNAIRFTPDGRWVVSGGEDNIVKVWDLTAG  175

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H     +L+FHP     A+GS D  +K WD+     I +    T G+  + F
Sbjct  176  KLLHDFKSHEGQIQSLDFHPNEFLLATGSADRTVKFWDLETFELIGSTGPETTGVRCLTF  235

Query  647  TPDGRWVV  670
             PDGR V+
Sbjct  236  NPDGRTVL  243


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 32/120 (27%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN +RF     R  ++GG+D+ V +W +           H   ++S+ F 
Sbjct  136  IHTYKGHNRGVNAIRFTPDG-RWVVSGGEDNIVKVWDLTAGKLLHDFKSHEGQIQSLDFH  194

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +    L F+P G     G +  +LK++
Sbjct  195  PNEFLLATGSADRTVKFWDLETFELIGSTGPETTGVRCLTFNPDGRTVLCG-LHESLKVF  253



>gb|KJB47122.1| hypothetical protein B456_008G011900 [Gossypium raimondii]
Length=828

 Score =   261 bits (667),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 111/156 (71%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS +VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +  +LSGHTS ++
Sbjct  4    KRAYKLQEFVAHSSSVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHTSGID  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++FDS+E+LVAAG++SG IKLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DT
Sbjct  64   SVSFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLK+WDIRKKGCIHTYKGH RG++ IRFTPDGRWVV
Sbjct  124  NLKVWDIRKKGCIHTYKGHNRGVNAIRFTPDGRWVV  159


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 60/128 (47%), Gaps = 0/128 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GH   V +I F      V +G    ++K+WDL   
Sbjct  116  FASGSLDTNLKVWDIRKKGCIHTYKGHNRGVNAIRFTPDGRWVVSGGEDNIVKVWDLTAG  175

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H     +L+FHP     A+GS D  +K WD+     I +    T G+  + F
Sbjct  176  KLLHDFKSHEGQIQSLDFHPNEFLLATGSADRTVKFWDLETFELIGSTGPETTGVRCLTF  235

Query  647  TPDGRWVV  670
             PDGR V+
Sbjct  236  NPDGRTVL  243


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 32/120 (27%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN +RF     R  ++GG+D+ V +W +           H   ++S+ F 
Sbjct  136  IHTYKGHNRGVNAIRFTPDG-RWVVSGGEDNIVKVWDLTAGKLLHDFKSHEGQIQSLDFH  194

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +    L F+P G     G +  +LK++
Sbjct  195  PNEFLLATGSADRTVKFWDLETFELIGSTGPETTGVRCLTFNPDGRTVLCG-LHESLKVF  253



>gb|KJB47118.1| hypothetical protein B456_008G011900 [Gossypium raimondii]
Length=809

 Score =   261 bits (666),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 111/156 (71%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS +VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +  +LSGHTS ++
Sbjct  4    KRAYKLQEFVAHSSSVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHTSGID  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++FDS+E+LVAAG++SG IKLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DT
Sbjct  64   SVSFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLK+WDIRKKGCIHTYKGH RG++ IRFTPDGRWVV
Sbjct  124  NLKVWDIRKKGCIHTYKGHNRGVNAIRFTPDGRWVV  159


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 60/128 (47%), Gaps = 0/128 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GH   V +I F      V +G    ++K+WDL   
Sbjct  116  FASGSLDTNLKVWDIRKKGCIHTYKGHNRGVNAIRFTPDGRWVVSGGEDNIVKVWDLTAG  175

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H     +L+FHP     A+GS D  +K WD+     I +    T G+  + F
Sbjct  176  KLLHDFKSHEGQIQSLDFHPNEFLLATGSADRTVKFWDLETFELIGSTGPETTGVRCLTF  235

Query  647  TPDGRWVV  670
             PDGR V+
Sbjct  236  NPDGRTVL  243


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 32/120 (27%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN +RF     R  ++GG+D+ V +W +           H   ++S+ F 
Sbjct  136  IHTYKGHNRGVNAIRFTPDG-RWVVSGGEDNIVKVWDLTAGKLLHDFKSHEGQIQSLDFH  194

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +    L F+P G     G +  +LK++
Sbjct  195  PNEFLLATGSADRTVKFWDLETFELIGSTGPETTGVRCLTFNPDGRTVLCG-LHESLKVF  253



>gb|KJB47123.1| hypothetical protein B456_008G011900 [Gossypium raimondii]
Length=810

 Score =   261 bits (666),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 111/156 (71%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS +VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +  +LSGHTS ++
Sbjct  4    KRAYKLQEFVAHSSSVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHTSGID  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++FDS+E+LVAAG++SG IKLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DT
Sbjct  64   SVSFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLK+WDIRKKGCIHTYKGH RG++ IRFTPDGRWVV
Sbjct  124  NLKVWDIRKKGCIHTYKGHNRGVNAIRFTPDGRWVV  159


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 60/128 (47%), Gaps = 0/128 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GH   V +I F      V +G    ++K+WDL   
Sbjct  116  FASGSLDTNLKVWDIRKKGCIHTYKGHNRGVNAIRFTPDGRWVVSGGEDNIVKVWDLTAG  175

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H     +L+FHP     A+GS D  +K WD+     I +    T G+  + F
Sbjct  176  KLLHDFKSHEGQIQSLDFHPNEFLLATGSADRTVKFWDLETFELIGSTGPETTGVRCLTF  235

Query  647  TPDGRWVV  670
             PDGR V+
Sbjct  236  NPDGRTVL  243


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 32/120 (27%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN +RF     R  ++GG+D+ V +W +           H   ++S+ F 
Sbjct  136  IHTYKGHNRGVNAIRFTPDG-RWVVSGGEDNIVKVWDLTAGKLLHDFKSHEGQIQSLDFH  194

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +    L F+P G     G +  +LK++
Sbjct  195  PNEFLLATGSADRTVKFWDLETFELIGSTGPETTGVRCLTFNPDGRTVLCG-LHESLKVF  253



>ref|XP_008776508.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Phoenix dactylifera]
Length=846

 Score =   261 bits (667),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = +2

Query  200  AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV  379
            AKR YKLQEF AH+ NVNCL+ G+KT R+  TGG+DH VNLW++GKP +  +LSGHTS V
Sbjct  3    AKRAYKLQEFAAHASNVNCLKIGRKTSRVLFTGGEDHKVNLWALGKPNAILSLSGHTSAV  62

Query  380  ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD  559
            ES++FDS+E+L+AAG++SG IKLWDLE+  ++RTL+GHRS C +++FHPFGEF ASGS+D
Sbjct  63   ESVSFDSSEVLLAAGAASGTIKLWDLEEANVVRTLTGHRSNCISVDFHPFGEFIASGSLD  122

Query  560  TNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            TNLKIWDIR+KGCIHTYKGHTRG+++IRFTPDGRWVV
Sbjct  123  TNLKIWDIRRKGCIHTYKGHTRGVNSIRFTPDGRWVV  159


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/138 (30%), Positives = 61/138 (44%), Gaps = 1/138 (1%)
 Frame = +2

Query  251  NCLRFGKKTCRMFLTGGD-DHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGS  427
            NC+         F+  G  D ++ +W I +     T  GHT  V SI F      V +G 
Sbjct  103  NCISVDFHPFGEFIASGSLDTNLKIWDIRRKGCIHTYKGHTRGVNSIRFTPDGRWVVSGG  162

Query  428  SSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHT  607
               ++KLWDL   K++     H      ++FHP     A+GS D  +K WD+     I +
Sbjct  163  EDNIVKLWDLTAGKLLHDFKCHEGQIQCIDFHPHEFLLATGSADKTVKFWDLETFEMIGS  222

Query  608  YKGHTRGISTIRFTPDGR  661
                T  + ++ F PDGR
Sbjct  223  SGPETSSVHSMTFNPDGR  240


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/119 (29%), Positives = 56/119 (47%), Gaps = 2/119 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN +RF     R  ++GG+D+ V LW +           H   ++ I F 
Sbjct  136  IHTYKGHTRGVNSIRFTPDG-RWVVSGGEDNIVKLWDLTAGKLLHDFKCHEGQIQCIDFH  194

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKI  574
              E L+A GS+   +K WDLE  +MI +     S   ++ F+P G     G +  +LK+
Sbjct  195  PHEFLLATGSADKTVKFWDLETFEMIGSSGPETSSVHSMTFNPDGRTLCCG-LHESLKV  252



>ref|XP_009395414.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
[Musa acuminata subsp. malaccensis]
Length=778

 Score =   259 bits (663),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 111/156 (71%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS +VNCL+ G+KT R+ +TGG+D+ VN+W+IGKP +  +LSGH S VE
Sbjct  5    KRAYKLQEFVAHSSSVNCLKIGRKTSRVLVTGGEDNKVNIWAIGKPNAILSLSGHMSAVE  64

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++FDS+EILVAAG++SG +KLWDLE+ K++RTL+GHRS C A++FHPFGEFFASGS+DT
Sbjct  65   SVSFDSSEILVAAGAASGSVKLWDLEEAKIVRTLTGHRSNCIAVDFHPFGEFFASGSLDT  124

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIR+KGCIHTYKGH+RG++ I+FTPDGRWVV
Sbjct  125  NLKIWDIRRKGCIHTYKGHSRGVNAIKFTPDGRWVV  160


 Score = 74.3 bits (181),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 59/125 (47%), Gaps = 0/125 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I +     T  GH+  V +I F      V +G     +KLWDL   
Sbjct  117  FASGSLDTNLKIWDIRRKGCIHTYKGHSRGVNAIKFTPDGRWVVSGGEDNTVKLWDLTAG  176

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      ++FHP     A+GS D  +K+WD+     I +    T G+ ++ F
Sbjct  177  KLLHDFKFHEGQIQCIDFHPHEFLLATGSADRTVKLWDLETFELIGSAGPETSGVRSMTF  236

Query  647  TPDGR  661
             PDGR
Sbjct  237  NPDGR  241


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/119 (29%), Positives = 58/119 (49%), Gaps = 2/119 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  HS  VN ++F     R  ++GG+D++V LW +           H   ++ I F 
Sbjct  137  IHTYKGHSRGVNAIKF-TPDGRWVVSGGEDNTVKLWDLTAGKLLHDFKFHEGQIQCIDFH  195

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKI  574
              E L+A GS+   +KLWDLE  ++I +     S   ++ F+P G     G +  +LK+
Sbjct  196  PHEFLLATGSADRTVKLWDLETFELIGSAGPETSGVRSMTFNPDGRTLLCG-LHESLKV  253



>gb|KJB47121.1| hypothetical protein B456_008G011900 [Gossypium raimondii]
Length=856

 Score =   261 bits (666),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 111/156 (71%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS +VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +  +LSGHTS ++
Sbjct  4    KRAYKLQEFVAHSSSVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHTSGID  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++FDS+E+LVAAG++SG IKLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DT
Sbjct  64   SVSFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLK+WDIRKKGCIHTYKGH RG++ IRFTPDGRWVV
Sbjct  124  NLKVWDIRKKGCIHTYKGHNRGVNAIRFTPDGRWVV  159


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 60/128 (47%), Gaps = 0/128 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GH   V +I F      V +G    ++K+WDL   
Sbjct  116  FASGSLDTNLKVWDIRKKGCIHTYKGHNRGVNAIRFTPDGRWVVSGGEDNIVKVWDLTAG  175

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H     +L+FHP     A+GS D  +K WD+     I +    T G+  + F
Sbjct  176  KLLHDFKSHEGQIQSLDFHPNEFLLATGSADRTVKFWDLETFELIGSTGPETTGVRCLTF  235

Query  647  TPDGRWVV  670
             PDGR V+
Sbjct  236  NPDGRTVL  243


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 32/120 (27%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN +RF     R  ++GG+D+ V +W +           H   ++S+ F 
Sbjct  136  IHTYKGHNRGVNAIRFTPDG-RWVVSGGEDNIVKVWDLTAGKLLHDFKSHEGQIQSLDFH  194

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +    L F+P G     G +  +LK++
Sbjct  195  PNEFLLATGSADRTVKFWDLETFELIGSTGPETTGVRCLTFNPDGRTVLCG-LHESLKVF  253



>ref|XP_009597532.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
{ECO:0000255|HAMAP-Rule:MF_03022}-like [Nicotiana tomentosiformis]
Length=798

 Score =   260 bits (664),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 111/156 (71%), Positives = 141/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS +VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +  +LSGH+S ++
Sbjct  5    KRAYKLQEFVAHSLSVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHSSGID  64

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++FDS+E+LVAAG++SG IKLWDLE+ K++RTL+GHRS C +L+FHPFGEFFASGS+DT
Sbjct  65   SVSFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISLDFHPFGEFFASGSLDT  124

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIR+KGCIHTYKGH+RG++ IRFTPDGRWVV
Sbjct  125  NLKIWDIRRKGCIHTYKGHSRGVNAIRFTPDGRWVV  160


 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 57/125 (46%), Gaps = 0/125 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I +     T  GH+  V +I F      V +G     +KLWDL   
Sbjct  117  FASGSLDTNLKIWDIRRKGCIHTYKGHSRGVNAIRFTPDGRWVVSGGEDNTVKLWDLTAG  176

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      ++FHP     A+GS D  +K WD+     I +    T G+  + F
Sbjct  177  KLLHDFKCHEGQIQCIDFHPHEFLLATGSADRTVKFWDLETFELIGSAGPETSGVRCMTF  236

Query  647  TPDGR  661
             PDGR
Sbjct  237  NPDGR  241


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 58/124 (47%), Gaps = 2/124 (2%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            +R   +  +  HS  VN +RF     R  ++GG+D++V LW +           H   ++
Sbjct  132  RRKGCIHTYKGHSRGVNAIRFTPDG-RWVVSGGEDNTVKLWDLTAGKLLHDFKCHEGQIQ  190

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
             I F   E L+A GS+   +K WDLE  ++I +     S    + F+P G     G +  
Sbjct  191  CIDFHPHEFLLATGSADRTVKFWDLETFELIGSAGPETSGVRCMTFNPDGRTLLCG-LHE  249

Query  563  NLKI  574
            +LK+
Sbjct  250  SLKV  253



>gb|KJB47119.1| hypothetical protein B456_008G011900 [Gossypium raimondii]
Length=855

 Score =   261 bits (666),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 111/156 (71%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS +VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +  +LSGHTS ++
Sbjct  4    KRAYKLQEFVAHSSSVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHTSGID  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++FDS+E+LVAAG++SG IKLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DT
Sbjct  64   SVSFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLK+WDIRKKGCIHTYKGH RG++ IRFTPDGRWVV
Sbjct  124  NLKVWDIRKKGCIHTYKGHNRGVNAIRFTPDGRWVV  159


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 60/128 (47%), Gaps = 0/128 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GH   V +I F      V +G    ++K+WDL   
Sbjct  116  FASGSLDTNLKVWDIRKKGCIHTYKGHNRGVNAIRFTPDGRWVVSGGEDNIVKVWDLTAG  175

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H     +L+FHP     A+GS D  +K WD+     I +    T G+  + F
Sbjct  176  KLLHDFKSHEGQIQSLDFHPNEFLLATGSADRTVKFWDLETFELIGSTGPETTGVRCLTF  235

Query  647  TPDGRWVV  670
             PDGR V+
Sbjct  236  NPDGRTVL  243


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 32/120 (27%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN +RF     R  ++GG+D+ V +W +           H   ++S+ F 
Sbjct  136  IHTYKGHNRGVNAIRFTPDG-RWVVSGGEDNIVKVWDLTAGKLLHDFKSHEGQIQSLDFH  194

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +    L F+P G     G +  +LK++
Sbjct  195  PNEFLLATGSADRTVKFWDLETFELIGSTGPETTGVRCLTFNPDGRTVLCG-LHESLKVF  253



>ref|XP_009790404.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Nicotiana sylvestris]
Length=797

 Score =   260 bits (664),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 111/156 (71%), Positives = 141/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS +VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +  +LSGH+S ++
Sbjct  5    KRAYKLQEFVAHSLSVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHSSGID  64

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++FDS+E+LVAAG++SG IKLWDLE+ K++RTL+GHRS C +L+FHPFGEFFASGS+DT
Sbjct  65   SVSFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISLDFHPFGEFFASGSLDT  124

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIR+KGCIHTYKGH+RG++ IRFTPDGRWVV
Sbjct  125  NLKIWDIRRKGCIHTYKGHSRGVNAIRFTPDGRWVV  160


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 57/125 (46%), Gaps = 0/125 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I +     T  GH+  V +I F      V +G     +KLWDL   
Sbjct  117  FASGSLDTNLKIWDIRRKGCIHTYKGHSRGVNAIRFTPDGRWVVSGGEDNTVKLWDLTAG  176

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      ++FHP     A+GS D  +K WD+     I +    T G+  + F
Sbjct  177  KLLHDFKCHEGQIQCIDFHPHEFLLATGSADRTVKFWDLETFELIGSAGPETSGVRCMTF  236

Query  647  TPDGR  661
             PDGR
Sbjct  237  NPDGR  241


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/119 (29%), Positives = 56/119 (47%), Gaps = 2/119 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  HS  VN +RF     R  ++GG+D++V LW +           H   ++ I F 
Sbjct  137  IHTYKGHSRGVNAIRFTPDG-RWVVSGGEDNTVKLWDLTAGKLLHDFKCHEGQIQCIDFH  195

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKI  574
              E L+A GS+   +K WDLE  ++I +     S    + F+P G     G +  +LK+
Sbjct  196  PHEFLLATGSADRTVKFWDLETFELIGSAGPETSGVRCMTFNPDGRTLLCG-LHESLKV  253



>gb|KHG19796.1| hypothetical protein F383_00950 [Gossypium arboreum]
Length=856

 Score =   260 bits (665),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 111/156 (71%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS +VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +  +LSGHTS ++
Sbjct  4    KRAYKLQEFVAHSSSVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHTSGID  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++FDS+E+LVAAG++SG IKLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DT
Sbjct  64   SVSFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLK+WDIRKKGCIHTYKGH RG++ IRFTPDGRWVV
Sbjct  124  NLKVWDIRKKGCIHTYKGHNRGVNAIRFTPDGRWVV  159


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 59/128 (46%), Gaps = 0/128 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GH   V +I F      V +G    ++K+WDL   
Sbjct  116  FASGSLDTNLKVWDIRKKGCIHTYKGHNRGVNAIRFTPDGRWVVSGGEDNIVKVWDLTAG  175

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      L+FHP     A+GS D  +K WD+     I +    T G+  + F
Sbjct  176  KLLHDFKSHEGQIQGLDFHPNEFLLATGSADRTVKFWDLETFELIGSTGPETTGVRCLTF  235

Query  647  TPDGRWVV  670
             PDGR V+
Sbjct  236  NPDGRTVL  243


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/120 (26%), Positives = 56/120 (47%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN +RF     R  ++GG+D+ V +W +           H   ++ + F 
Sbjct  136  IHTYKGHNRGVNAIRFTPDG-RWVVSGGEDNIVKVWDLTAGKLLHDFKSHEGQIQGLDFH  194

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +    L F+P G     G +  +LK++
Sbjct  195  PNEFLLATGSADRTVKFWDLETFELIGSTGPETTGVRCLTFNPDGRTVLCG-LHESLKVF  253



>ref|XP_010688601.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X2 [Beta vulgaris subsp. vulgaris]
Length=797

 Score =   259 bits (663),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 110/156 (71%), Positives = 139/156 (89%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAH+  VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +  +LSGH+S ++
Sbjct  4    KRAYKLQEFVAHTSTVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHSSGID  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S+ FDS+E+LVAAG++SG IKLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DT
Sbjct  64   SVGFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIR+KGCIHTYKGHTRG++ IRFTPDGRWVV
Sbjct  124  NLKIWDIRRKGCIHTYKGHTRGVNAIRFTPDGRWVV  159


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 59/128 (46%), Gaps = 0/128 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I +     T  GHT  V +I F      V +G     +KLWDL   
Sbjct  116  FASGSLDTNLKIWDIRRKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNTVKLWDLTAG  175

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      ++FHP     A+GS D  +K WD+     I +    T G+  I F
Sbjct  176  KLMHDFKSHEGQIQCIDFHPHEFLLATGSSDKTVKFWDLETFELIGSAGPETSGVRCIAF  235

Query  647  TPDGRWVV  670
             PDGR ++
Sbjct  236  NPDGRTLL  243


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 59/125 (47%), Gaps = 2/125 (2%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            +R   +  +  H+  VN +RF     R  ++GG+D++V LW +           H   ++
Sbjct  131  RRKGCIHTYKGHTRGVNAIRFTPDG-RWVVSGGEDNTVKLWDLTAGKLMHDFKSHEGQIQ  189

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
             I F   E L+A GSS   +K WDLE  ++I +     S    + F+P G     G +  
Sbjct  190  CIDFHPHEFLLATGSSDKTVKFWDLETFELIGSAGPETSGVRCIAFNPDGRTLLCG-LHE  248

Query  563  NLKIW  577
            +LK++
Sbjct  249  SLKVF  253



>ref|XP_010688600.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Beta vulgaris subsp. vulgaris]
Length=798

 Score =   259 bits (663),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 110/156 (71%), Positives = 139/156 (89%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAH+  VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +  +LSGH+S ++
Sbjct  4    KRAYKLQEFVAHTSTVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHSSGID  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S+ FDS+E+LVAAG++SG IKLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DT
Sbjct  64   SVGFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIR+KGCIHTYKGHTRG++ IRFTPDGRWVV
Sbjct  124  NLKIWDIRRKGCIHTYKGHTRGVNAIRFTPDGRWVV  159


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 59/128 (46%), Gaps = 0/128 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I +     T  GHT  V +I F      V +G     +KLWDL   
Sbjct  116  FASGSLDTNLKIWDIRRKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNTVKLWDLTAG  175

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      ++FHP     A+GS D  +K WD+     I +    T G+  I F
Sbjct  176  KLMHDFKSHEGQIQCIDFHPHEFLLATGSSDKTVKFWDLETFELIGSAGPETSGVRCIAF  235

Query  647  TPDGRWVV  670
             PDGR ++
Sbjct  236  NPDGRTLL  243


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 59/125 (47%), Gaps = 2/125 (2%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            +R   +  +  H+  VN +RF     R  ++GG+D++V LW +           H   ++
Sbjct  131  RRKGCIHTYKGHTRGVNAIRFTPDG-RWVVSGGEDNTVKLWDLTAGKLMHDFKSHEGQIQ  189

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
             I F   E L+A GSS   +K WDLE  ++I +     S    + F+P G     G +  
Sbjct  190  CIDFHPHEFLLATGSSDKTVKFWDLETFELIGSAGPETSGVRCIAFNPDGRTLLCG-LHE  248

Query  563  NLKIW  577
            +LK++
Sbjct  249  SLKVF  253



>ref|XP_008778233.1| PREDICTED: LOW QUALITY PROTEIN: katanin p80 WD40 repeat-containing 
subunit B1 homolog [Phoenix dactylifera]
Length=817

 Score =   259 bits (663),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 111/156 (71%), Positives = 138/156 (88%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS NVNCL+ G++T R+ +TGG+DH VNLW+IGKP +  +L+GHTS VE
Sbjct  5    KRAYKLQEFVAHSSNVNCLKIGRRTSRVLVTGGEDHKVNLWAIGKPNAILSLAGHTSAVE  64

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S+ FDS+E+LVAAG+++G IKLWDLE+ K++RTL+GHRS C +++FHPFGEF ASGS+DT
Sbjct  65   SVCFDSSEVLVAAGATNGTIKLWDLEEAKVVRTLTGHRSNCVSVDFHPFGEFLASGSLDT  124

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIR+K CIHTYKGHTRG++ IRFTPDGRWVV
Sbjct  125  NLKIWDIRRKSCIHTYKGHTRGVNAIRFTPDGRWVV  160


 Score = 74.3 bits (181),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 64/141 (45%), Gaps = 1/141 (1%)
 Frame = +2

Query  251  NCLRFGKKTCRMFLTGGD-DHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGS  427
            NC+         FL  G  D ++ +W I + +   T  GHT  V +I F      V +G 
Sbjct  104  NCVSVDFHPFGEFLASGSLDTNLKIWDIRRKSCIHTYKGHTRGVNAIRFTPDGRWVVSGG  163

Query  428  SSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHT  607
               ++KLWDL   K++     H      ++FHP     A+GS D  +K WD+     + +
Sbjct  164  EDNIVKLWDLTAGKLLHDFKCHEGQIQCIDFHPHEFLLATGSADRTVKFWDLETFELVGS  223

Query  608  YKGHTRGISTIRFTPDGRWVV  670
                  G+ ++ F PDGR ++
Sbjct  224  VGPEITGVRSMTFNPDGRTLL  244


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/124 (27%), Positives = 59/124 (48%), Gaps = 2/124 (2%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            +R   +  +  H+  VN +RF     R  ++GG+D+ V LW +           H   ++
Sbjct  132  RRKSCIHTYKGHTRGVNAIRF-TPDGRWVVSGGEDNIVKLWDLTAGKLLHDFKCHEGQIQ  190

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
             I F   E L+A GS+   +K WDLE  +++ ++    +   ++ F+P G     G  +T
Sbjct  191  CIDFHPHEFLLATGSADRTVKFWDLETFELVGSVGPEITGVRSMTFNPDGRTLLCGLHET  250

Query  563  NLKI  574
             LK+
Sbjct  251  -LKV  253



>gb|KHN46320.1| Katanin p80 WD40 repeat-containing subunit B1 like 1 [Glycine 
soja]
Length=834

 Score =   259 bits (663),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 120/178 (67%), Positives = 141/178 (79%), Gaps = 20/178 (11%)
 Frame = +2

Query  197  MAKRGYKL--------------------QEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSV  316
            MAK GYKL                    +EF AHSGNVNCL+ G+K  R+F+TGGDDHSV
Sbjct  1    MAKTGYKLRILFYIYKFCASENAFCCNVEEFAAHSGNVNCLKLGRKANRLFITGGDDHSV  60

Query  317  NLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHR  496
            NLW IGKPTS  +L GHTS VES+ FDSAE+L+ +G+SSG+IKLWDLE+ KM+RTL+GHR
Sbjct  61   NLWMIGKPTSLMSLCGHTSSVESVTFDSAEVLILSGASSGVIKLWDLEEAKMVRTLTGHR  120

Query  497  SYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
              CTA+EFHPFGEFFASGS+DTNL IWDIRKKGCI TYKGH++GISTI+F+PDGRWVV
Sbjct  121  LNCTAVEFHPFGEFFASGSLDTNLNIWDIRKKGCIQTYKGHSQGISTIKFSPDGRWVV  178


 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 38/127 (30%), Positives = 62/127 (49%), Gaps = 0/127 (0%)
 Frame = +2

Query  281  RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLE  460
              F +G  D ++N+W I K     T  GH+  + +I F      V +G    ++K+WDL 
Sbjct  133  EFFASGSLDTNLNIWDIRKKGCIQTYKGHSQGISTIKFSPDGRWVVSGGFDNVVKVWDLT  192

Query  461  DTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTI  640
              K++     H  +  +L+FHP     A+GS D  +K WD+     I + +    G+ +I
Sbjct  193  GGKLLHDFKFHEGHIRSLDFHPLEFLMATGSADRTVKFWDLETFELIGSTRHEVSGVRSI  252

Query  641  RFTPDGR  661
             F PDG+
Sbjct  253  AFHPDGQ  259


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/120 (27%), Positives = 60/120 (50%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +Q +  HS  ++ ++F     R  ++GG D+ V +W +           H   + S+ F 
Sbjct  155  IQTYKGHSQGISTIKFSPDG-RWVVSGGFDNVVKVWDLTGGKLLHDFKFHEGHIRSLDFH  213

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     S   ++ FHP G+   +G ++ +LK++
Sbjct  214  PLEFLMATGSADRTVKFWDLETFELIGSTRHEVSGVRSIAFHPDGQILFAG-LEDSLKVY  272



>emb|CBI35338.3| unnamed protein product [Vitis vinifera]
Length=989

 Score =   261 bits (668),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 141/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS +VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +  +LSGHTS ++
Sbjct  4    KRAYKLQEFVAHSSSVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHTSGID  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++FDS+E+LVAAG++SG IKLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DT
Sbjct  64   SVSFDSSELLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIRKKGCIHTYKGHTRG++ IRFTPDGRWVV
Sbjct  124  NLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVV  159


 Score = 74.7 bits (182),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 59/130 (45%), Gaps = 0/130 (0%)
 Frame = +2

Query  281  RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLE  460
              F +G  D ++ +W I K     T  GHT  V +I F      V +G     +KLWDL 
Sbjct  114  EFFASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNTVKLWDLT  173

Query  461  DTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTI  640
              K++     H      ++FHP     A+GS D  +K WD+     I +    T G+  +
Sbjct  174  AGKLLHDFKSHEGQLQCIDFHPHEFLLATGSADRTVKFWDLETFELIGSAGPETAGVRCM  233

Query  641  RFTPDGRWVV  670
             F PDG+ ++
Sbjct  234  TFNPDGKTLL  243


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/120 (27%), Positives = 58/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN +RF     R  ++GG+D++V LW +           H   ++ I F 
Sbjct  136  IHTYKGHTRGVNAIRFTPDG-RWVVSGGEDNTVKLWDLTAGKLLHDFKSHEGQLQCIDFH  194

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +    + F+P G+    G +  +LK++
Sbjct  195  PHEFLLATGSADRTVKFWDLETFELIGSAGPETAGVRCMTFNPDGKTLLCG-LHESLKVF  253



>ref|XP_007043149.1| Transducin/WD40 repeat-like superfamily protein [Theobroma cacao]
 gb|EOX98980.1| Transducin/WD40 repeat-like superfamily protein [Theobroma cacao]
Length=1199

 Score =   262 bits (670),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 141/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS +VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +  +LSGHTS ++
Sbjct  4    KRAYKLQEFVAHSSSVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHTSGID  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++FDS+E+LVAAG++SG IKLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DT
Sbjct  64   SVSFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIRKKGCIHTYKGHTRG++ IRFTPDGRWVV
Sbjct  124  NLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVV  159


 Score = 77.8 bits (190),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 41/130 (32%), Positives = 60/130 (46%), Gaps = 0/130 (0%)
 Frame = +2

Query  281  RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLE  460
              F +G  D ++ +W I K     T  GHT  V +I F      V +G    ++K+WDL 
Sbjct  114  EFFASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNIVKVWDLT  173

Query  461  DTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTI  640
              K++     H      L+FHP     A+GS D  +K WD+     I +    T G+  +
Sbjct  174  AGKLLHDFKYHEGQIQCLDFHPHEFLLATGSADRTVKFWDLETFELIGSAGPETTGVRCL  233

Query  641  RFTPDGRWVV  670
             F PDGR V+
Sbjct  234  TFNPDGRTVL  243


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 31/120 (26%), Positives = 56/120 (47%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN +RF     R  ++GG+D+ V +W +           H   ++ + F 
Sbjct  136  IHTYKGHTRGVNAIRFTPDG-RWVVSGGEDNIVKVWDLTAGKLLHDFKYHEGQIQCLDFH  194

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +    L F+P G     G +  +LK++
Sbjct  195  PHEFLLATGSADRTVKFWDLETFELIGSAGPETTGVRCLTFNPDGRTVLCG-LHESLKVF  253



>ref|XP_001768341.1| predicted protein [Physcomitrella patens]
 gb|EDQ66955.1| predicted protein, partial [Physcomitrella patens]
Length=322

 Score =   246 bits (629),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 137/153 (90%), Gaps = 0/153 (0%)
 Frame = +2

Query  212  YKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIA  391
            Y  +EFVAHS NVNCL+ GKK+ R+ +TGG+DH VN+W+IGKP +  +L+GHTS VES+A
Sbjct  1    YPSEEFVAHSSNVNCLKIGKKSSRVLVTGGEDHKVNMWAIGKPNAILSLAGHTSAVESVA  60

Query  392  FDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLK  571
            FD++E++V AG++SG IKLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DTNLK
Sbjct  61   FDASEVVVVAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDTNLK  120

Query  572  IWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            IWDIR+KGCIHTYKGHTRGI++I+F+PDGRWVV
Sbjct  121  IWDIRRKGCIHTYKGHTRGINSIKFSPDGRWVV  153


 Score = 73.2 bits (178),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 60/130 (46%), Gaps = 0/130 (0%)
 Frame = +2

Query  281  RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLE  460
              F +G  D ++ +W I +     T  GHT  + SI F      V +G    ++KLWDL 
Sbjct  108  EFFASGSLDTNLKIWDIRRKGCIHTYKGHTRGINSIKFSPDGRWVVSGGEDNVVKLWDLT  167

Query  461  DTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTI  640
              K++     H      L+FHP     A+GS D  +K +D+     I +    + G+  +
Sbjct  168  AGKLMHDFKYHEGQVQCLDFHPHEFLLATGSADRTVKFFDLETFELIGSAGPDSAGVRAM  227

Query  641  RFTPDGRWVV  670
             F PDGR V+
Sbjct  228  VFNPDGRTVL  237



>ref|XP_010933310.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X4 [Elaeis guineensis]
Length=774

 Score =   258 bits (659),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 110/156 (71%), Positives = 137/156 (88%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAH  NVNCL+ G+KT R+ +TGG+DH VNLW+IGKP +  +LSGHTS VE
Sbjct  5    KRSYKLQEFVAHDSNVNCLKIGRKTSRVLVTGGEDHKVNLWAIGKPNTILSLSGHTSAVE  64

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++ DS+E+L+AAG++SG IKLWDL + K++RTL+GHRS C +++FHPFGEF ASGS DT
Sbjct  65   SVSLDSSEVLLAAGAASGTIKLWDLGEAKVVRTLTGHRSNCISIDFHPFGEFIASGSSDT  124

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIR+KGCIHTYKGHTRG+++IRFTPDGRW+V
Sbjct  125  NLKIWDIRRKGCIHTYKGHTRGVNSIRFTPDGRWLV  160


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/97 (31%), Positives = 46/97 (47%), Gaps = 0/97 (0%)
 Frame = +2

Query  293  TGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKM  472
            +G  D ++ +W I +     T  GHT  V SI F      + +G    ++KLWDL   K+
Sbjct  119  SGSSDTNLKIWDIRRKGCIHTYKGHTRGVNSIRFTPDGRWLVSGGEDNIVKLWDLTAGKL  178

Query  473  IRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDI  583
            +     H      ++FHP     A+GS D  +K WD+
Sbjct  179  LHDFKCHEGQIQCIDFHPHEFLLATGSADKTVKFWDL  215



>emb|CDP16884.1| unnamed protein product [Coffea canephora]
Length=888

 Score =   260 bits (664),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 112/156 (72%), Positives = 141/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS +VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +  +LSGH+S ++
Sbjct  5    KRAYKLQEFVAHSQSVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAVLSLSGHSSGID  64

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++FDS+E+LVAAG++SG IKLWDLE+ K++RTL+GHRS C +L+FHPFGEFFASGS+DT
Sbjct  65   SVSFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISLDFHPFGEFFASGSLDT  124

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIR+KGCIHTYKGHTRG++ IRFTPDGRWVV
Sbjct  125  NLKIWDIRRKGCIHTYKGHTRGVNAIRFTPDGRWVV  160


 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 57/125 (46%), Gaps = 0/125 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I +     T  GHT  V +I F      V +G     +KLWDL   
Sbjct  117  FASGSLDTNLKIWDIRRKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNTVKLWDLTAG  176

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      ++FHP     A+GS D  +K WD+     I +    T G+  + F
Sbjct  177  KLLHDFKCHDGQIQCIDFHPHEFLLATGSADKTVKFWDLETFELIGSSGPETTGVRCMTF  236

Query  647  TPDGR  661
             PDG+
Sbjct  237  NPDGK  241


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 60/125 (48%), Gaps = 2/125 (2%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            +R   +  +  H+  VN +RF     R  ++GG+D++V LW +           H   ++
Sbjct  132  RRKGCIHTYKGHTRGVNAIRFTPDG-RWVVSGGEDNTVKLWDLTAGKLLHDFKCHDGQIQ  190

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
             I F   E L+A GS+   +K WDLE  ++I +     +    + F+P G+    G +  
Sbjct  191  CIDFHPHEFLLATGSADKTVKFWDLETFELIGSSGPETTGVRCMTFNPDGKTLLCG-LHE  249

Query  563  NLKIW  577
            +LK++
Sbjct  250  SLKVY  254



>ref|XP_010933311.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X5 [Elaeis guineensis]
Length=622

 Score =   255 bits (651),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 110/156 (71%), Positives = 137/156 (88%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAH  NVNCL+ G+KT R+ +TGG+DH VNLW+IGKP +  +LSGHTS VE
Sbjct  5    KRSYKLQEFVAHDSNVNCLKIGRKTSRVLVTGGEDHKVNLWAIGKPNTILSLSGHTSAVE  64

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++ DS+E+L+AAG++SG IKLWDL + K++RTL+GHRS C +++FHPFGEF ASGS DT
Sbjct  65   SVSLDSSEVLLAAGAASGTIKLWDLGEAKVVRTLTGHRSNCISIDFHPFGEFIASGSSDT  124

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIR+KGCIHTYKGHTRG+++IRFTPDGRW+V
Sbjct  125  NLKIWDIRRKGCIHTYKGHTRGVNSIRFTPDGRWLV  160


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 57/123 (46%), Gaps = 0/123 (0%)
 Frame = +2

Query  293  TGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKM  472
            +G  D ++ +W I +     T  GHT  V SI F      + +G    ++KLWDL   K+
Sbjct  119  SGSSDTNLKIWDIRRKGCIHTYKGHTRGVNSIRFTPDGRWLVSGGEDNIVKLWDLTAGKL  178

Query  473  IRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTP  652
            +     H      ++FHP     A+GS D  +K WD+     I +    T  + ++ F P
Sbjct  179  LHDFKCHEGQIQCIDFHPHEFLLATGSADKTVKFWDLETFEMIGSSVPETSSVHSMTFNP  238

Query  653  DGR  661
            DGR
Sbjct  239  DGR  241


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/119 (29%), Positives = 56/119 (47%), Gaps = 2/119 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN +RF     R  ++GG+D+ V LW +           H   ++ I F 
Sbjct  137  IHTYKGHTRGVNSIRFTPDG-RWLVSGGEDNIVKLWDLTAGKLLHDFKCHEGQIQCIDFH  195

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKI  574
              E L+A GS+   +K WDLE  +MI +     S   ++ F+P G     G +  +LK+
Sbjct  196  PHEFLLATGSADKTVKFWDLETFEMIGSSVPETSSVHSMTFNPDGRTLFCG-LHESLKV  253



>ref|XP_010492441.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X5 [Camelina sativa]
Length=991

 Score =   261 bits (666),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 135/158 (85%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MA RGY LQEFVAHSGNVNCL  GKKT R+ LTGGDD+ VNLWSIGK TS  +L GHTS 
Sbjct  1    MANRGYNLQEFVAHSGNVNCLSIGKKTSRLLLTGGDDYKVNLWSIGKTTSLMSLCGHTSA  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            V+S+AF+S E+LV AG+SSG+IKLWDL++ KM+R  +GHR+ C+A+EFHPFGEF ASGS 
Sbjct  61   VDSVAFNSKEVLVLAGASSGVIKLWDLQEAKMVRAFTGHRANCSAVEFHPFGEFLASGSS  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DTNL++WD RKKGCI TYKGH RGI+TI+F+PDGRWVV
Sbjct  121  DTNLRVWDTRKKGCIQTYKGHNRGITTIKFSPDGRWVV  158


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 64/148 (43%), Gaps = 1/148 (1%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            ++ F  H  N + + F         +G  D ++ +W   K     T  GH   + +I F 
Sbjct  93   VRAFTGHRANCSAVEF-HPFGEFLASGSSDTNLRVWDTRKKGCIQTYKGHNRGITTIKFS  151

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
                 V +G    ++K+WDL   K++     H     +L+FHP     A+GS D  +K W
Sbjct  152  PDGRWVVSGGLDNVVKVWDLTAGKLLHEFKFHEGPICSLDFHPLEFLLATGSADRTVKFW  211

Query  578  DIRKKGCIHTYKGHTRGISTIRFTPDGR  661
            D+     I + +    G+  I F PDG+
Sbjct  212  DLETFELIGSTRPEATGVRAITFHPDGQ  239


 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 33/120 (28%), Positives = 58/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +Q +  H+  +  ++F     R  ++GG D+ V +W +           H  P+ S+ F 
Sbjct  135  IQTYKGHNRGITTIKFSPD-GRWVVSGGLDNVVKVWDLTAGKLLHEFKFHEGPICSLDFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   A+ FHP G+    G +D  LK++
Sbjct  194  PLEFLLATGSADRTVKFWDLETFELIGSTRPEATGVRAITFHPDGQTLFCG-LDDALKVY  252



>ref|XP_010492410.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Camelina sativa]
Length=1019

 Score =   261 bits (666),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 135/158 (85%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MA RGY LQEFVAHSGNVNCL  GKKT R+ LTGGDD+ VNLWSIGK TS  +L GHTS 
Sbjct  1    MANRGYNLQEFVAHSGNVNCLSIGKKTSRLLLTGGDDYKVNLWSIGKTTSLMSLCGHTSA  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            V+S+AF+S E+LV AG+SSG+IKLWDL++ KM+R  +GHR+ C+A+EFHPFGEF ASGS 
Sbjct  61   VDSVAFNSKEVLVLAGASSGVIKLWDLQEAKMVRAFTGHRANCSAVEFHPFGEFLASGSS  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DTNL++WD RKKGCI TYKGH RGI+TI+F+PDGRWVV
Sbjct  121  DTNLRVWDTRKKGCIQTYKGHNRGITTIKFSPDGRWVV  158


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 64/148 (43%), Gaps = 1/148 (1%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            ++ F  H  N + + F         +G  D ++ +W   K     T  GH   + +I F 
Sbjct  93   VRAFTGHRANCSAVEF-HPFGEFLASGSSDTNLRVWDTRKKGCIQTYKGHNRGITTIKFS  151

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
                 V +G    ++K+WDL   K++     H     +L+FHP     A+GS D  +K W
Sbjct  152  PDGRWVVSGGLDNVVKVWDLTAGKLLHEFKFHEGPICSLDFHPLEFLLATGSADRTVKFW  211

Query  578  DIRKKGCIHTYKGHTRGISTIRFTPDGR  661
            D+     I + +    G+  I F PDG+
Sbjct  212  DLETFELIGSTRPEATGVRAITFHPDGQ  239


 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 33/120 (28%), Positives = 58/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +Q +  H+  +  ++F     R  ++GG D+ V +W +           H  P+ S+ F 
Sbjct  135  IQTYKGHNRGITTIKFSPD-GRWVVSGGLDNVVKVWDLTAGKLLHEFKFHEGPICSLDFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   A+ FHP G+    G +D  LK++
Sbjct  194  PLEFLLATGSADRTVKFWDLETFELIGSTRPEATGVRAITFHPDGQTLFCG-LDDALKVY  252



>ref|XP_010492426.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X3 [Camelina sativa]
Length=1014

 Score =   260 bits (665),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 135/158 (85%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MA RGY LQEFVAHSGNVNCL  GKKT R+ LTGGDD+ VNLWSIGK TS  +L GHTS 
Sbjct  1    MANRGYNLQEFVAHSGNVNCLSIGKKTSRLLLTGGDDYKVNLWSIGKTTSLMSLCGHTSA  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            V+S+AF+S E+LV AG+SSG+IKLWDL++ KM+R  +GHR+ C+A+EFHPFGEF ASGS 
Sbjct  61   VDSVAFNSKEVLVLAGASSGVIKLWDLQEAKMVRAFTGHRANCSAVEFHPFGEFLASGSS  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DTNL++WD RKKGCI TYKGH RGI+TI+F+PDGRWVV
Sbjct  121  DTNLRVWDTRKKGCIQTYKGHNRGITTIKFSPDGRWVV  158


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 64/148 (43%), Gaps = 1/148 (1%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            ++ F  H  N + + F         +G  D ++ +W   K     T  GH   + +I F 
Sbjct  93   VRAFTGHRANCSAVEF-HPFGEFLASGSSDTNLRVWDTRKKGCIQTYKGHNRGITTIKFS  151

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
                 V +G    ++K+WDL   K++     H     +L+FHP     A+GS D  +K W
Sbjct  152  PDGRWVVSGGLDNVVKVWDLTAGKLLHEFKFHEGPICSLDFHPLEFLLATGSADRTVKFW  211

Query  578  DIRKKGCIHTYKGHTRGISTIRFTPDGR  661
            D+     I + +    G+  I F PDG+
Sbjct  212  DLETFELIGSTRPEATGVRAITFHPDGQ  239


 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 33/120 (28%), Positives = 58/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +Q +  H+  +  ++F     R  ++GG D+ V +W +           H  P+ S+ F 
Sbjct  135  IQTYKGHNRGITTIKFSPD-GRWVVSGGLDNVVKVWDLTAGKLLHEFKFHEGPICSLDFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   A+ FHP G+    G +D  LK++
Sbjct  194  PLEFLLATGSADRTVKFWDLETFELIGSTRPEATGVRAITFHPDGQTLFCG-LDDALKVY  252



>ref|XP_010492433.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X4 [Camelina sativa]
Length=1011

 Score =   260 bits (665),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 135/158 (85%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MA RGY LQEFVAHSGNVNCL  GKKT R+ LTGGDD+ VNLWSIGK TS  +L GHTS 
Sbjct  1    MANRGYNLQEFVAHSGNVNCLSIGKKTSRLLLTGGDDYKVNLWSIGKTTSLMSLCGHTSA  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            V+S+AF+S E+LV AG+SSG+IKLWDL++ KM+R  +GHR+ C+A+EFHPFGEF ASGS 
Sbjct  61   VDSVAFNSKEVLVLAGASSGVIKLWDLQEAKMVRAFTGHRANCSAVEFHPFGEFLASGSS  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DTNL++WD RKKGCI TYKGH RGI+TI+F+PDGRWVV
Sbjct  121  DTNLRVWDTRKKGCIQTYKGHNRGITTIKFSPDGRWVV  158


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 64/148 (43%), Gaps = 1/148 (1%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            ++ F  H  N + + F         +G  D ++ +W   K     T  GH   + +I F 
Sbjct  93   VRAFTGHRANCSAVEF-HPFGEFLASGSSDTNLRVWDTRKKGCIQTYKGHNRGITTIKFS  151

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
                 V +G    ++K+WDL   K++     H     +L+FHP     A+GS D  +K W
Sbjct  152  PDGRWVVSGGLDNVVKVWDLTAGKLLHEFKFHEGPICSLDFHPLEFLLATGSADRTVKFW  211

Query  578  DIRKKGCIHTYKGHTRGISTIRFTPDGR  661
            D+     I + +    G+  I F PDG+
Sbjct  212  DLETFELIGSTRPEATGVRAITFHPDGQ  239


 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 33/120 (28%), Positives = 58/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +Q +  H+  +  ++F     R  ++GG D+ V +W +           H  P+ S+ F 
Sbjct  135  IQTYKGHNRGITTIKFSPD-GRWVVSGGLDNVVKVWDLTAGKLLHEFKFHEGPICSLDFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   A+ FHP G+    G +D  LK++
Sbjct  194  PLEFLLATGSADRTVKFWDLETFELIGSTRPEATGVRAITFHPDGQTLFCG-LDDALKVY  252



>ref|XP_009392423.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X3 [Musa acuminata subsp. malaccensis]
Length=711

 Score =   256 bits (655),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 114/156 (73%), Positives = 135/156 (87%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
             RGYKLQEFVAH+ +VNC+  GKK+ R+F+TGG+D  VNLW+IGKPT   +LSGH   VE
Sbjct  4    NRGYKLQEFVAHASDVNCVAIGKKSSRVFVTGGEDRKVNLWAIGKPTPLLSLSGHMGSVE  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S+AFDSAE+LV  GSS+G+IKLWDLE+ K++RTL+GHRS CT++EFHPFGEFFASGS+DT
Sbjct  64   SVAFDSAEVLVLGGSSTGIIKLWDLEEAKIVRTLTGHRSNCTSVEFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            +LKIWDIRKKGCIHTYKGH  GI  IRFTPDGRWVV
Sbjct  124  DLKIWDIRKKGCIHTYKGHAGGIQKIRFTPDGRWVV  159


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 56/127 (44%), Gaps = 0/127 (0%)
 Frame = +2

Query  281  RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLE  460
              F +G  D  + +W I K     T  GH   ++ I F      V  G +  ++KLWDL 
Sbjct  114  EFFASGSLDTDLKIWDIRKKGCIHTYKGHAGGIQKIRFTPDGRWVVTGGADNMVKLWDLT  173

Query  461  DTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTI  640
              K++     H      ++FHP     A+GS D  +K WD+     I +      G+ ++
Sbjct  174  AGKLLHDFKFHNGQIRCIDFHPHEFLLATGSADRTVKFWDLETFELIGSVGPEATGVCSM  233

Query  641  RFTPDGR  661
             F PDG+
Sbjct  234  IFHPDGK  240


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/120 (28%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+G +  +RF     R  +TGG D+ V LW +           H   +  I F 
Sbjct  136  IHTYKGHAGGIQKIRFTPDG-RWVVTGGADNMVKLWDLTAGKLLHDFKFHNGQIRCIDFH  194

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I ++    +   ++ FHP G+    G ++  LK++
Sbjct  195  PHEFLLATGSADRTVKFWDLETFELIGSVGPEATGVCSMIFHPDGKTLFCG-LEATLKVF  253



>gb|EEC78255.1| hypothetical protein OsI_17928 [Oryza sativa Indica Group]
Length=950

 Score =   260 bits (664),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 116/168 (69%), Positives = 138/168 (82%), Gaps = 12/168 (7%)
 Frame = +2

Query  203  KRGYKL------------QEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTS  346
            KR YKL            +EFVAHS NVNCL+ G+KT R+ +TGGDDH VNLW+IGKP S
Sbjct  6    KRAYKLRILANSFPVFLTKEFVAHSSNVNCLKIGRKTSRVLVTGGDDHKVNLWAIGKPNS  65

Query  347  TSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHP  526
              +LSGHTS VES+ FDS E+ VAAG++SG IKLWDLE+ K++RTL+GHRS C +++FHP
Sbjct  66   ILSLSGHTSAVESVNFDSTEVFVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCMSVDFHP  125

Query  527  FGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            FGEFFASGS+DTNLKIWDIR+KGCIHTYKGHTRG++ IRFTPDGRWVV
Sbjct  126  FGEFFASGSLDTNLKIWDIRRKGCIHTYKGHTRGVNAIRFTPDGRWVV  173


 Score = 74.7 bits (182),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 61/128 (48%), Gaps = 0/128 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I +     T  GHT  V +I F      V +G    ++KLWDL   
Sbjct  130  FASGSLDTNLKIWDIRRKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNVVKLWDLTAG  189

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      ++FHP     A+GS D  +K WD+     I +    T G+ ++ F
Sbjct  190  KLLHDFKCHEGQIQCIDFHPHEFLLATGSSDKTVKFWDLETFELIGSTGPETTGVRSMTF  249

Query  647  TPDGRWVV  670
             PDGR ++
Sbjct  250  NPDGRSLL  257


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/120 (28%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN +RF     R  ++GG+D+ V LW +           H   ++ I F 
Sbjct  150  IHTYKGHTRGVNAIRFTPD-GRWVVSGGEDNVVKLWDLTAGKLLHDFKCHEGQIQCIDFH  208

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GSS   +K WDLE  ++I +     +   ++ F+P G     G +  +LK++
Sbjct  209  PHEFLLATGSSDKTVKFWDLETFELIGSTGPETTGVRSMTFNPDGRSLLCG-LHESLKVF  267



>ref|XP_010492418.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X2 [Camelina sativa]
Length=1017

 Score =   260 bits (665),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 135/158 (85%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MA RGY LQEFVAHSGNVNCL  GKKT R+ LTGGDD+ VNLWSIGK TS  +L GHTS 
Sbjct  1    MANRGYNLQEFVAHSGNVNCLSIGKKTSRLLLTGGDDYKVNLWSIGKTTSLMSLCGHTSA  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            V+S+AF+S E+LV AG+SSG+IKLWDL++ KM+R  +GHR+ C+A+EFHPFGEF ASGS 
Sbjct  61   VDSVAFNSKEVLVLAGASSGVIKLWDLQEAKMVRAFTGHRANCSAVEFHPFGEFLASGSS  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DTNL++WD RKKGCI TYKGH RGI+TI+F+PDGRWVV
Sbjct  121  DTNLRVWDTRKKGCIQTYKGHNRGITTIKFSPDGRWVV  158


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 64/148 (43%), Gaps = 1/148 (1%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            ++ F  H  N + + F         +G  D ++ +W   K     T  GH   + +I F 
Sbjct  93   VRAFTGHRANCSAVEF-HPFGEFLASGSSDTNLRVWDTRKKGCIQTYKGHNRGITTIKFS  151

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
                 V +G    ++K+WDL   K++     H     +L+FHP     A+GS D  +K W
Sbjct  152  PDGRWVVSGGLDNVVKVWDLTAGKLLHEFKFHEGPICSLDFHPLEFLLATGSADRTVKFW  211

Query  578  DIRKKGCIHTYKGHTRGISTIRFTPDGR  661
            D+     I + +    G+  I F PDG+
Sbjct  212  DLETFELIGSTRPEATGVRAITFHPDGQ  239


 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 33/120 (28%), Positives = 58/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +Q +  H+  +  ++F     R  ++GG D+ V +W +           H  P+ S+ F 
Sbjct  135  IQTYKGHNRGITTIKFSPD-GRWVVSGGLDNVVKVWDLTAGKLLHEFKFHEGPICSLDFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   A+ FHP G+    G +D  LK++
Sbjct  194  PLEFLLATGSADRTVKFWDLETFELIGSTRPEATGVRAITFHPDGQTLFCG-LDDALKVY  252



>gb|EEE61907.1| hypothetical protein OsJ_16629 [Oryza sativa Japonica Group]
Length=944

 Score =   260 bits (664),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 116/168 (69%), Positives = 138/168 (82%), Gaps = 12/168 (7%)
 Frame = +2

Query  203  KRGYKL------------QEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTS  346
            KR YKL            +EFVAHS NVNCL+ G+KT R+ +TGGDDH VNLW+IGKP S
Sbjct  6    KRAYKLRILANSFPVFLTKEFVAHSSNVNCLKIGRKTSRVLVTGGDDHKVNLWAIGKPNS  65

Query  347  TSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHP  526
              +LSGHTS VES+ FDS E+ VAAG++SG IKLWDLE+ K++RTL+GHRS C +++FHP
Sbjct  66   ILSLSGHTSAVESVNFDSTEVFVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCMSVDFHP  125

Query  527  FGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            FGEFFASGS+DTNLKIWDIR+KGCIHTYKGHTRG++ IRFTPDGRWVV
Sbjct  126  FGEFFASGSLDTNLKIWDIRRKGCIHTYKGHTRGVNAIRFTPDGRWVV  173


 Score = 74.7 bits (182),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 61/128 (48%), Gaps = 0/128 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I +     T  GHT  V +I F      V +G    ++KLWDL   
Sbjct  130  FASGSLDTNLKIWDIRRKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNVVKLWDLTAG  189

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      ++FHP     A+GS D  +K WD+     I +    T G+ ++ F
Sbjct  190  KLLHDFKCHEGQIQCIDFHPHEFLLATGSSDKTVKFWDLETFELIGSTGPETTGVRSMTF  249

Query  647  TPDGRWVV  670
             PDGR ++
Sbjct  250  NPDGRSLL  257


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/120 (28%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN +RF     R  ++GG+D+ V LW +           H   ++ I F 
Sbjct  150  IHTYKGHTRGVNAIRFTPD-GRWVVSGGEDNVVKLWDLTAGKLLHDFKCHEGQIQCIDFH  208

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GSS   +K WDLE  ++I +     +   ++ F+P G     G +  +LK++
Sbjct  209  PHEFLLATGSSDKTVKFWDLETFELIGSTGPETTGVRSMTFNPDGRSLLCG-LHESLKVF  267



>ref|XP_010492450.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X6 [Camelina sativa]
Length=1009

 Score =   260 bits (665),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 135/158 (85%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MA RGY LQEFVAHSGNVNCL  GKKT R+ LTGGDD+ VNLWSIGK TS  +L GHTS 
Sbjct  1    MANRGYNLQEFVAHSGNVNCLSIGKKTSRLLLTGGDDYKVNLWSIGKTTSLMSLCGHTSA  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            V+S+AF+S E+LV AG+SSG+IKLWDL++ KM+R  +GHR+ C+A+EFHPFGEF ASGS 
Sbjct  61   VDSVAFNSKEVLVLAGASSGVIKLWDLQEAKMVRAFTGHRANCSAVEFHPFGEFLASGSS  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            DTNL++WD RKKGCI TYKGH RGI+TI+F+PDGRWVV
Sbjct  121  DTNLRVWDTRKKGCIQTYKGHNRGITTIKFSPDGRWVV  158


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 64/148 (43%), Gaps = 1/148 (1%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            ++ F  H  N + + F         +G  D ++ +W   K     T  GH   + +I F 
Sbjct  93   VRAFTGHRANCSAVEF-HPFGEFLASGSSDTNLRVWDTRKKGCIQTYKGHNRGITTIKFS  151

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
                 V +G    ++K+WDL   K++     H     +L+FHP     A+GS D  +K W
Sbjct  152  PDGRWVVSGGLDNVVKVWDLTAGKLLHEFKFHEGPICSLDFHPLEFLLATGSADRTVKFW  211

Query  578  DIRKKGCIHTYKGHTRGISTIRFTPDGR  661
            D+     I + +    G+  I F PDG+
Sbjct  212  DLETFELIGSTRPEATGVRAITFHPDGQ  239


 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 33/120 (28%), Positives = 58/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +Q +  H+  +  ++F     R  ++GG D+ V +W +           H  P+ S+ F 
Sbjct  135  IQTYKGHNRGITTIKFSPD-GRWVVSGGLDNVVKVWDLTAGKLLHEFKFHEGPICSLDFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   A+ FHP G+    G +D  LK++
Sbjct  194  PLEFLLATGSADRTVKFWDLETFELIGSTRPEATGVRAITFHPDGQTLFCG-LDDALKVY  252



>ref|XP_009392834.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X3 [Musa acuminata subsp. malaccensis]
Length=770

 Score =   257 bits (657),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 140/165 (85%), Gaps = 9/165 (5%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS NVNCL+ G++T R+ +TGG+DH VNLW+IGKP +  +LSGH S VE
Sbjct  5    KRAYKLQEFVAHSSNVNCLKIGRRTSRVLVTGGEDHKVNLWAIGKPNAILSLSGHISAVE  64

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKM---------IRTLSGHRSYCTALEFHPFGE  535
            S++FDS+E+LVAAG++SG IKLWDLE+ K+         +RTL+GHRS C A++FHPFGE
Sbjct  65   SVSFDSSEVLVAAGAASGSIKLWDLEEAKIGSLFLLCAVVRTLTGHRSNCIAVDFHPFGE  124

Query  536  FFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            FFASGS+DTNLKIWDIR+KGCIHTYKGHTRG++ I+FTPDGRWVV
Sbjct  125  FFASGSLDTNLKIWDIRRKGCIHTYKGHTRGVNAIKFTPDGRWVV  169


 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 59/125 (47%), Gaps = 0/125 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I +     T  GHT  V +I F      V +G    ++KLWDL   
Sbjct  126  FASGSLDTNLKIWDIRRKGCIHTYKGHTRGVNAIKFTPDGRWVVSGGEDNIVKLWDLTAG  185

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      ++FHP     A+GS D  +K WD+     I +    T G+ ++ F
Sbjct  186  KLLHDFKFHEGQIRCIDFHPHEFLLATGSADRTVKFWDLETFELIGSAGPETSGVRSMTF  245

Query  647  TPDGR  661
             PDGR
Sbjct  246  NPDGR  250


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/120 (27%), Positives = 56/120 (47%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN ++F     R  ++GG+D+ V LW +           H   +  I F 
Sbjct  146  IHTYKGHTRGVNAIKFTPDG-RWVVSGGEDNIVKLWDLTAGKLLHDFKFHEGQIRCIDFH  204

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     S   ++ F+P G     G +  +LK++
Sbjct  205  PHEFLLATGSADRTVKFWDLETFELIGSAGPETSGVRSMTFNPDGRTLLCG-LHESLKVF  263



>ref|XP_002972963.1| hypothetical protein SELMODRAFT_98102, partial [Selaginella moellendorffii]
 gb|EFJ26184.1| hypothetical protein SELMODRAFT_98102, partial [Selaginella moellendorffii]
Length=348

 Score =   246 bits (629),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 107/156 (69%), Positives = 136/156 (87%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS  VNCL+ G+KT R+ +TGGDDH VN+W+IGKP +  +L+GH+SPVE
Sbjct  3    KRAYKLQEFVAHSSQVNCLKIGRKTSRVLVTGGDDHKVNMWAIGKPNAILSLAGHSSPVE  62

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S+ FD+AE  V AG++SG IKLWDLE+ K++RTL+GHRS CTA++FHPFGEFFASGS+D+
Sbjct  63   SVTFDAAESHVVAGAASGAIKLWDLEEAKIVRTLTGHRSNCTAVDFHPFGEFFASGSLDS  122

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIR+KGCIHTY+GH  G++ ++F+PDGRWVV
Sbjct  123  NLKIWDIRRKGCIHTYRGHCCGVNCLKFSPDGRWVV  158


 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 55/127 (43%), Gaps = 0/127 (0%)
 Frame = +2

Query  281  RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLE  460
              F +G  D ++ +W I +     T  GH   V  + F      V +G     +KLWDL 
Sbjct  113  EFFASGSLDSNLKIWDIRRKGCIHTYRGHCCGVNCLKFSPDGRWVVSGGEDKTVKLWDLT  172

Query  461  DTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTI  640
              K+I     H     +L+FHP     A+GS D   K +D+     + +      G+  +
Sbjct  173  AGKLIHDFKYHDDQILSLDFHPHEFLLATGSDDKTAKFYDLETFELVGSSGPEDSGVRPM  232

Query  641  RFTPDGR  661
             FTPDGR
Sbjct  233  IFTPDGR  239



>ref|XP_004147132.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
[Cucumis sativus]
 ref|XP_004169348.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
[Cucumis sativus]
Length=795

 Score =   258 bits (658),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 111/156 (71%), Positives = 139/156 (89%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS  VNCL+ G+K+ R+ +TGG+D  VNLW+IGKP +  +L+GHTS ++
Sbjct  4    KRAYKLQEFVAHSSAVNCLKIGRKSSRVLVTGGEDFKVNLWAIGKPNAILSLTGHTSGID  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++FDS+E+LVAAG++SG IKLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DT
Sbjct  64   SVSFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIRKKGCIHTYKGHTRG++ IRFTPDGRWVV
Sbjct  124  NLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVV  159


 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 59/128 (46%), Gaps = 0/128 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GHT  V +I F      V +G     +KLWDL   
Sbjct  116  FASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNTVKLWDLTAG  175

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      ++FHP     A+GS D  +K WD+     I +    T G+  + F
Sbjct  176  KLLHDFKCHEGQVQCIDFHPHEFLLATGSADKTVKFWDLETFELIGSAGPETSGVRCLTF  235

Query  647  TPDGRWVV  670
             PDGR ++
Sbjct  236  NPDGRTLL  243


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN +RF     R  ++GG+D++V LW +           H   V+ I F 
Sbjct  136  IHTYKGHTRGVNAIRFTPDG-RWVVSGGEDNTVKLWDLTAGKLLHDFKCHEGQVQCIDFH  194

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     S    L F+P G     G +  +LK++
Sbjct  195  PHEFLLATGSADKTVKFWDLETFELIGSAGPETSGVRCLTFNPDGRTLLCG-LHESLKVF  253



>gb|KGN51580.1| hypothetical protein Csa_5G580650 [Cucumis sativus]
Length=844

 Score =   258 bits (660),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 111/156 (71%), Positives = 139/156 (89%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS  VNCL+ G+K+ R+ +TGG+D  VNLW+IGKP +  +L+GHTS ++
Sbjct  4    KRAYKLQEFVAHSSAVNCLKIGRKSSRVLVTGGEDFKVNLWAIGKPNAILSLTGHTSGID  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++FDS+E+LVAAG++SG IKLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DT
Sbjct  64   SVSFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIRKKGCIHTYKGHTRG++ IRFTPDGRWVV
Sbjct  124  NLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVV  159


 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 59/128 (46%), Gaps = 0/128 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GHT  V +I F      V +G     +KLWDL   
Sbjct  116  FASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNTVKLWDLTAG  175

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      ++FHP     A+GS D  +K WD+     I +    T G+  + F
Sbjct  176  KLLHDFKCHEGQVQCIDFHPHEFLLATGSADKTVKFWDLETFELIGSAGPETSGVRCLTF  235

Query  647  TPDGRWVV  670
             PDGR ++
Sbjct  236  NPDGRTLL  243


 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN +RF     R  ++GG+D++V LW +           H   V+ I F 
Sbjct  136  IHTYKGHTRGVNAIRFTPDG-RWVVSGGEDNTVKLWDLTAGKLLHDFKCHEGQVQCIDFH  194

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     S    L F+P G     G +  +LK++
Sbjct  195  PHEFLLATGSADKTVKFWDLETFELIGSAGPETSGVRCLTFNPDGRTLLCG-LHESLKVF  253



>ref|XP_009392832.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=789

 Score =   257 bits (657),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 140/165 (85%), Gaps = 9/165 (5%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS NVNCL+ G++T R+ +TGG+DH VNLW+IGKP +  +LSGH S VE
Sbjct  5    KRAYKLQEFVAHSSNVNCLKIGRRTSRVLVTGGEDHKVNLWAIGKPNAILSLSGHISAVE  64

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKM---------IRTLSGHRSYCTALEFHPFGE  535
            S++FDS+E+LVAAG++SG IKLWDLE+ K+         +RTL+GHRS C A++FHPFGE
Sbjct  65   SVSFDSSEVLVAAGAASGSIKLWDLEEAKIGSLFLLCAVVRTLTGHRSNCIAVDFHPFGE  124

Query  536  FFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            FFASGS+DTNLKIWDIR+KGCIHTYKGHTRG++ I+FTPDGRWVV
Sbjct  125  FFASGSLDTNLKIWDIRRKGCIHTYKGHTRGVNAIKFTPDGRWVV  169


 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 61/128 (48%), Gaps = 0/128 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I +     T  GHT  V +I F      V +G    ++KLWDL   
Sbjct  126  FASGSLDTNLKIWDIRRKGCIHTYKGHTRGVNAIKFTPDGRWVVSGGEDNIVKLWDLTAG  185

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      ++FHP     A+GS D  +K WD+     I +    T G+ ++ F
Sbjct  186  KLLHDFKFHEGQIRCIDFHPHEFLLATGSADRTVKFWDLETFELIGSAGPETSGVRSMTF  245

Query  647  TPDGRWVV  670
             PDGR ++
Sbjct  246  NPDGRTLL  253


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/120 (27%), Positives = 56/120 (47%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN ++F     R  ++GG+D+ V LW +           H   +  I F 
Sbjct  146  IHTYKGHTRGVNAIKFTPDG-RWVVSGGEDNIVKLWDLTAGKLLHDFKFHEGQIRCIDFH  204

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     S   ++ F+P G     G +  +LK++
Sbjct  205  PHEFLLATGSADRTVKFWDLETFELIGSAGPETSGVRSMTFNPDGRTLLCG-LHESLKVF  263



>ref|XP_004960069.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
[Setaria italica]
Length=931

 Score =   259 bits (661),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 115/166 (69%), Positives = 137/166 (83%), Gaps = 10/166 (6%)
 Frame = +2

Query  203  KRGYKL----------QEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTS  352
            KR YKL          QEFVAHS NVNCL+ G+KT R+ +TGG+DH VNLW+IGKP S  
Sbjct  6    KRAYKLRILVNLSLLFQEFVAHSSNVNCLKIGRKTSRVLVTGGEDHKVNLWAIGKPNSIL  65

Query  353  TLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFG  532
            +LSGHTS VES+ FDS E+ VAAG++SG IKLWDLE+ K++RTL+GHRS C +++FHPFG
Sbjct  66   SLSGHTSAVESVGFDSTEVFVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCMSVDFHPFG  125

Query  533  EFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            EFFASGS+DTNLKIWDIR+K CIHTYKGHTRG++ IRFTPDGRWVV
Sbjct  126  EFFASGSLDTNLKIWDIRRKNCIHTYKGHTRGVNAIRFTPDGRWVV  171


 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 60/128 (47%), Gaps = 0/128 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I +     T  GHT  V +I F      V +G     +KLWDL   
Sbjct  128  FASGSLDTNLKIWDIRRKNCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNTVKLWDLTAG  187

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      ++FHP     A+GS D  +K WD+     I +    T G+ ++ F
Sbjct  188  KLLHEFKCHEGQIQCIDFHPHEFLLATGSADKTVKFWDLETFELIGSTGPETTGVRSMTF  247

Query  647  TPDGRWVV  670
             PDGR ++
Sbjct  248  NPDGRSLL  255


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 60/125 (48%), Gaps = 2/125 (2%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            +R   +  +  H+  VN +RF     R  ++GG+D++V LW +           H   ++
Sbjct  143  RRKNCIHTYKGHTRGVNAIRFTPDG-RWVVSGGEDNTVKLWDLTAGKLLHEFKCHEGQIQ  201

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
             I F   E L+A GS+   +K WDLE  ++I +     +   ++ F+P G     G +  
Sbjct  202  CIDFHPHEFLLATGSADKTVKFWDLETFELIGSTGPETTGVRSMTFNPDGRSLLCG-LHE  260

Query  563  NLKIW  577
            +LK++
Sbjct  261  SLKVF  265



>ref|XP_008445915.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X2 [Cucumis melo]
Length=844

 Score =   258 bits (658),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 111/156 (71%), Positives = 139/156 (89%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS  VNCL+ G+K+ R+ +TGG+D  VNLW+IGKP +  +L+GHTS ++
Sbjct  4    KRAYKLQEFVAHSSAVNCLKIGRKSSRVLVTGGEDFKVNLWAIGKPNAILSLTGHTSGID  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++FDS+E+LVAAG++SG IKLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DT
Sbjct  64   SVSFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIRKKGCIHTYKGHTRG++ IRFTPDGRWVV
Sbjct  124  NLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVV  159


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 59/128 (46%), Gaps = 0/128 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GHT  V +I F      V +G     +KLWDL   
Sbjct  116  FASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNTVKLWDLTAG  175

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      ++FHP     A+GS D  +K WD+     I +    T G+  + F
Sbjct  176  KLLHDFKCHEGQVQCIDFHPHEFLLATGSADKTVKFWDLETFELIGSAGPETSGVRCLTF  235

Query  647  TPDGRWVV  670
             PDGR ++
Sbjct  236  NPDGRTLL  243


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN +RF     R  ++GG+D++V LW +           H   V+ I F 
Sbjct  136  IHTYKGHTRGVNAIRFTPDG-RWVVSGGEDNTVKLWDLTAGKLLHDFKCHEGQVQCIDFH  194

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     S    L F+P G     G +  +LK++
Sbjct  195  PHEFLLATGSADKTVKFWDLETFELIGSAGPETSGVRCLTFNPDGRTLLCG-LHESLKVF  253



>ref|XP_008445914.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Cucumis melo]
Length=869

 Score =   258 bits (658),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 111/156 (71%), Positives = 139/156 (89%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS  VNCL+ G+K+ R+ +TGG+D  VNLW+IGKP +  +L+GHTS ++
Sbjct  4    KRAYKLQEFVAHSSAVNCLKIGRKSSRVLVTGGEDFKVNLWAIGKPNAILSLTGHTSGID  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++FDS+E+LVAAG++SG IKLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DT
Sbjct  64   SVSFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIRKKGCIHTYKGHTRG++ IRFTPDGRWVV
Sbjct  124  NLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVV  159


 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 59/129 (46%), Gaps = 0/129 (0%)
 Frame = +2

Query  284  MFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLED  463
             F +G  D ++ +W I K     T  GHT  V +I F      V +G     +KLWDL  
Sbjct  115  FFASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNTVKLWDLTA  174

Query  464  TKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIR  643
             K++     H      ++FHP     A+GS D  +K WD+     I +    T G+  + 
Sbjct  175  GKLLHDFKCHEGQVQCIDFHPHEFLLATGSADKTVKFWDLETFELIGSAGPETSGVRCLT  234

Query  644  FTPDGRWVV  670
            F PDGR ++
Sbjct  235  FNPDGRTLL  243


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN +RF     R  ++GG+D++V LW +           H   V+ I F 
Sbjct  136  IHTYKGHTRGVNAIRFTPDG-RWVVSGGEDNTVKLWDLTAGKLLHDFKCHEGQVQCIDFH  194

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     S    L F+P G     G +  +LK++
Sbjct  195  PHEFLLATGSADKTVKFWDLETFELIGSAGPETSGVRCLTFNPDGRTLLCG-LHESLKVF  253



>ref|XP_002874130.1| transducin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50389.1| transducin family protein [Arabidopsis lyrata subsp. lyrata]
Length=837

 Score =   257 bits (657),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 109/156 (70%), Positives = 138/156 (88%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS  VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +  +L GH+S ++
Sbjct  4    KRAYKLQEFVAHSAAVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLYGHSSGID  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S+ FD++E+LVAAG++SG IKLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DT
Sbjct  64   SVTFDASEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIRKKGCIHTYKGHTRG++ +RFTPDGRWVV
Sbjct  124  NLKIWDIRKKGCIHTYKGHTRGVNVLRFTPDGRWVV  159


 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 60/128 (47%), Gaps = 0/128 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GHT  V  + F      V +G    ++K+WDL   
Sbjct  116  FASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNVLRFTPDGRWVVSGGEDNIVKVWDLTAG  175

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H     +L+FHP     A+GS D  +K WD+     I +    T G+  + F
Sbjct  176  KLLTEFKSHEGQIQSLDFHPHEFLLATGSADRTVKFWDLETFELIGSGGPETAGVRCLSF  235

Query  647  TPDGRWVV  670
             PDG+ V+
Sbjct  236  NPDGKTVL  243


 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 59/120 (49%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN LRF     R  ++GG+D+ V +W +      +    H   ++S+ F 
Sbjct  136  IHTYKGHTRGVNVLRF-TPDGRWVVSGGEDNIVKVWDLTAGKLLTEFKSHEGQIQSLDFH  194

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +    L F+P G+    G +  +LKI+
Sbjct  195  PHEFLLATGSADRTVKFWDLETFELIGSGGPETAGVRCLSFNPDGKTVLCG-LQESLKIF  253



>ref|XP_010546257.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
[Tarenaya hassleriana]
 ref|XP_010546258.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
[Tarenaya hassleriana]
Length=843

 Score =   257 bits (657),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 109/156 (70%), Positives = 138/156 (88%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS  VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +  +L GH+S ++
Sbjct  4    KRAYKLQEFVAHSAAVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLYGHSSGID  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S+ FD++E+LVAAG++SG IK+WDLE+ K++RTL+GHRS C A++FHPFGEFFASGS+DT
Sbjct  64   SVTFDASEVLVAAGAASGTIKIWDLEEAKVVRTLTGHRSNCIAVDFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIRKKGCIHTYKGHTRG++ +RFTPDGRWVV
Sbjct  124  NLKIWDIRKKGCIHTYKGHTRGVNVLRFTPDGRWVV  159


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/128 (30%), Positives = 59/128 (46%), Gaps = 0/128 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GHT  V  + F      V +G    ++K+WDL   
Sbjct  116  FASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNVLRFTPDGRWVVSGGEDNIVKVWDLTAG  175

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      L+FHP     A+GS D  +K WD+     I +    + G+  + F
Sbjct  176  KLLHDFKCHEGQIQCLDFHPHEFLLATGSADRTVKFWDLETFELIGSAGSESTGVRCLTF  235

Query  647  TPDGRWVV  670
             PDG+ V+
Sbjct  236  NPDGKTVL  243


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/120 (28%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN LRF     R  ++GG+D+ V +W +           H   ++ + F 
Sbjct  136  IHTYKGHTRGVNVLRF-TPDGRWVVSGGEDNIVKVWDLTAGKLLHDFKCHEGQIQCLDFH  194

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +    L F+P G+    G +  +LKI+
Sbjct  195  PHEFLLATGSADRTVKFWDLETFELIGSAGSESTGVRCLTFNPDGKTVLCG-LHESLKIF  253



>ref|XP_010933309.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X3 [Elaeis guineensis]
Length=785

 Score =   256 bits (654),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 110/156 (71%), Positives = 137/156 (88%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAH  NVNCL+ G+KT R+ +TGG+DH VNLW+IGKP +  +LSGHTS VE
Sbjct  5    KRSYKLQEFVAHDSNVNCLKIGRKTSRVLVTGGEDHKVNLWAIGKPNTILSLSGHTSAVE  64

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++ DS+E+L+AAG++SG IKLWDL + K++RTL+GHRS C +++FHPFGEF ASGS DT
Sbjct  65   SVSLDSSEVLLAAGAASGTIKLWDLGEAKVVRTLTGHRSNCISIDFHPFGEFIASGSSDT  124

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIR+KGCIHTYKGHTRG+++IRFTPDGRW+V
Sbjct  125  NLKIWDIRRKGCIHTYKGHTRGVNSIRFTPDGRWLV  160


 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 57/123 (46%), Gaps = 0/123 (0%)
 Frame = +2

Query  293  TGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKM  472
            +G  D ++ +W I +     T  GHT  V SI F      + +G    ++KLWDL   K+
Sbjct  119  SGSSDTNLKIWDIRRKGCIHTYKGHTRGVNSIRFTPDGRWLVSGGEDNIVKLWDLTAGKL  178

Query  473  IRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTP  652
            +     H      ++FHP     A+GS D  +K WD+     I +    T  + ++ F P
Sbjct  179  LHDFKCHEGQIQCIDFHPHEFLLATGSADKTVKFWDLETFEMIGSSVPETSSVHSMTFNP  238

Query  653  DGR  661
            DGR
Sbjct  239  DGR  241


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 58/124 (47%), Gaps = 2/124 (2%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            +R   +  +  H+  VN +RF     R  ++GG+D+ V LW +           H   ++
Sbjct  132  RRKGCIHTYKGHTRGVNSIRFTPDG-RWLVSGGEDNIVKLWDLTAGKLLHDFKCHEGQIQ  190

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
             I F   E L+A GS+   +K WDLE  +MI +     S   ++ F+P G     G +  
Sbjct  191  CIDFHPHEFLLATGSADKTVKFWDLETFEMIGSSVPETSSVHSMTFNPDGRTLFCG-LHE  249

Query  563  NLKI  574
            +LK+
Sbjct  250  SLKV  253



>ref|XP_010521766.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
[Tarenaya hassleriana]
 ref|XP_010521774.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
[Tarenaya hassleriana]
Length=841

 Score =   257 bits (657),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 109/156 (70%), Positives = 138/156 (88%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS  VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +  +L GH+S ++
Sbjct  4    KRAYKLQEFVAHSAAVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLYGHSSGID  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S+ FD++E+LVAAG++SG IKLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DT
Sbjct  64   SVTFDASEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIRKKGCIHTYKGHTRG++ +RFTPDGRWVV
Sbjct  124  NLKIWDIRKKGCIHTYKGHTRGVNVLRFTPDGRWVV  159


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 59/128 (46%), Gaps = 0/128 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GHT  V  + F      V +G    ++K+WDL   
Sbjct  116  FASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNVLRFTPDGRWVVSGGEDNIVKVWDLTAG  175

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      L+FHP     A+GS D  +K WD+     I +    T G+  + F
Sbjct  176  KLLHDFKCHEGQIQCLDFHPHEFLLATGSADRTVKFWDLETFELIGSAGPETTGVRCLTF  235

Query  647  TPDGRWVV  670
             PDG+ V+
Sbjct  236  NPDGKAVL  243


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/120 (28%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN LRF     R  ++GG+D+ V +W +           H   ++ + F 
Sbjct  136  IHTYKGHTRGVNVLRF-TPDGRWVVSGGEDNIVKVWDLTAGKLLHDFKCHEGQIQCLDFH  194

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +    L F+P G+    G +  +LKI+
Sbjct  195  PHEFLLATGSADRTVKFWDLETFELIGSAGPETTGVRCLTFNPDGKAVLCG-LHESLKIF  253



>ref|NP_197734.2| Katanin p80 WD40 repeat-containing subunit B1-1 [Arabidopsis 
thaliana]
 gb|AED93167.1| Katanin p80 WD40 repeat-containing subunit B1-1 [Arabidopsis 
thaliana]
Length=836

 Score =   257 bits (656),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 109/156 (70%), Positives = 138/156 (88%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS  VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +  +L GH+S ++
Sbjct  4    KRAYKLQEFVAHSAAVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLYGHSSGID  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S+ FD++E+LVAAG++SG IKLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DT
Sbjct  64   SVTFDASEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIRKKGCIHTYKGHTRG++ +RFTPDGRWVV
Sbjct  124  NLKIWDIRKKGCIHTYKGHTRGVNVLRFTPDGRWVV  159


 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 60/128 (47%), Gaps = 0/128 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GHT  V  + F      V +G    ++K+WDL   
Sbjct  116  FASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNVLRFTPDGRWVVSGGEDNIVKVWDLTAG  175

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H     +L+FHP     A+GS D  +K WD+     I +    T G+  + F
Sbjct  176  KLLTEFKSHEGQIQSLDFHPHEFLLATGSADRTVKFWDLETFELIGSGGPETAGVRCLSF  235

Query  647  TPDGRWVV  670
             PDG+ V+
Sbjct  236  NPDGKTVL  243


 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 59/120 (49%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN LRF     R  ++GG+D+ V +W +      +    H   ++S+ F 
Sbjct  136  IHTYKGHTRGVNVLRF-TPDGRWVVSGGEDNIVKVWDLTAGKLLTEFKSHEGQIQSLDFH  194

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +    L F+P G+    G +  +LKI+
Sbjct  195  PHEFLLATGSADRTVKFWDLETFELIGSGGPETAGVRCLSFNPDGKTVLCG-LQESLKIF  253



>ref|NP_851064.1| Katanin p80 WD40 repeat-containing subunit B1-1 [Arabidopsis 
thaliana]
 sp|Q8H0T9.3|KTNB1_ARATH RecName: Full=Katanin p80 WD40 repeat-containing subunit B1 homolog 
[Arabidopsis thaliana]
 gb|AAN72064.1| putative protein [Arabidopsis thaliana]
 gb|AED93166.1| Katanin p80 WD40 repeat-containing subunit B1-1 [Arabidopsis 
thaliana]
Length=837

 Score =   257 bits (656),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 109/156 (70%), Positives = 138/156 (88%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS  VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +  +L GH+S ++
Sbjct  4    KRAYKLQEFVAHSAAVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLYGHSSGID  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S+ FD++E+LVAAG++SG IKLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DT
Sbjct  64   SVTFDASEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIRKKGCIHTYKGHTRG++ +RFTPDGRWVV
Sbjct  124  NLKIWDIRKKGCIHTYKGHTRGVNVLRFTPDGRWVV  159


 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 60/128 (47%), Gaps = 0/128 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GHT  V  + F      V +G    ++K+WDL   
Sbjct  116  FASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNVLRFTPDGRWVVSGGEDNIVKVWDLTAG  175

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H     +L+FHP     A+GS D  +K WD+     I +    T G+  + F
Sbjct  176  KLLTEFKSHEGQIQSLDFHPHEFLLATGSADRTVKFWDLETFELIGSGGPETAGVRCLSF  235

Query  647  TPDGRWVV  670
             PDG+ V+
Sbjct  236  NPDGKTVL  243


 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 59/120 (49%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN LRF     R  ++GG+D+ V +W +      +    H   ++S+ F 
Sbjct  136  IHTYKGHTRGVNVLRF-TPDGRWVVSGGEDNIVKVWDLTAGKLLTEFKSHEGQIQSLDFH  194

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +    L F+P G+    G +  +LKI+
Sbjct  195  PHEFLLATGSADRTVKFWDLETFELIGSGGPETAGVRCLSFNPDGKTVLCG-LQESLKIF  253



>ref|XP_009392416.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=806

 Score =   256 bits (655),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 135/155 (87%), Gaps = 0/155 (0%)
 Frame = +2

Query  206  RGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVES  385
            RGYKLQEFVAH+ +VNC+  GKK+ R+F+TGG+D  VNLW+IGKPT   +LSGH   VES
Sbjct  5    RGYKLQEFVAHASDVNCVAIGKKSSRVFVTGGEDRKVNLWAIGKPTPLLSLSGHMGSVES  64

Query  386  IAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTN  565
            +AFDSAE+LV  GSS+G+IKLWDLE+ K++RTL+GHRS CT++EFHPFGEFFASGS+DT+
Sbjct  65   VAFDSAEVLVLGGSSTGIIKLWDLEEAKIVRTLTGHRSNCTSVEFHPFGEFFASGSLDTD  124

Query  566  LKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            LKIWDIRKKGCIHTYKGH  GI  IRFTPDGRWVV
Sbjct  125  LKIWDIRKKGCIHTYKGHAGGIQKIRFTPDGRWVV  159


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 56/127 (44%), Gaps = 0/127 (0%)
 Frame = +2

Query  281  RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLE  460
              F +G  D  + +W I K     T  GH   ++ I F      V  G +  ++KLWDL 
Sbjct  114  EFFASGSLDTDLKIWDIRKKGCIHTYKGHAGGIQKIRFTPDGRWVVTGGADNMVKLWDLT  173

Query  461  DTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTI  640
              K++     H      ++FHP     A+GS D  +K WD+     I +      G+ ++
Sbjct  174  AGKLLHDFKFHNGQIRCIDFHPHEFLLATGSADRTVKFWDLETFELIGSVGPEATGVCSM  233

Query  641  RFTPDGR  661
             F PDG+
Sbjct  234  IFHPDGK  240


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/120 (28%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+G +  +RF     R  +TGG D+ V LW +           H   +  I F 
Sbjct  136  IHTYKGHAGGIQKIRFTPDG-RWVVTGGADNMVKLWDLTAGKLLHDFKFHNGQIRCIDFH  194

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I ++    +   ++ FHP G+    G ++  LK++
Sbjct  195  PHEFLLATGSADRTVKFWDLETFELIGSVGPEATGVCSMIFHPDGKTLFCG-LEATLKVF  253



>ref|XP_006848621.1| hypothetical protein AMTR_s00171p00033150 [Amborella trichopoda]
 gb|ERN10202.1| hypothetical protein AMTR_s00171p00033150 [Amborella trichopoda]
Length=800

 Score =   256 bits (654),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 111/150 (74%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = +2

Query  221  QEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDS  400
            +EFVAHS NVNCL+ GKK+ R+ +TGG+DH VNLW+IGKP +  +LSGHTS VES++FDS
Sbjct  20   EEFVAHSSNVNCLKIGKKSSRVLVTGGEDHKVNLWAIGKPNAILSLSGHTSAVESVSFDS  79

Query  401  AEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWD  580
            AE+LVAAG++SG IKLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DTNLKIWD
Sbjct  80   AEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDTNLKIWD  139

Query  581  IRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            IR+KGCIHTYKGHTRG++ IRFTPDGRWVV
Sbjct  140  IRRKGCIHTYKGHTRGVNAIRFTPDGRWVV  169


 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 38/128 (30%), Positives = 60/128 (47%), Gaps = 0/128 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I +     T  GHT  V +I F      V +G    ++KLWDL   
Sbjct  126  FASGSLDTNLKIWDIRRKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNVVKLWDLTAG  185

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      ++FHP     A+GS D  +K WD+     I +      G+ ++ F
Sbjct  186  KLLHDFKCHEGQIQCIDFHPHEFLLATGSADKTVKFWDLETFELIGSAGPEASGVRSMTF  245

Query  647  TPDGRWVV  670
             PDGR ++
Sbjct  246  NPDGRTLL  253


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 59/125 (47%), Gaps = 2/125 (2%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            +R   +  +  H+  VN +RF     R  ++GG+D+ V LW +           H   ++
Sbjct  141  RRKGCIHTYKGHTRGVNAIRFTPDG-RWVVSGGEDNVVKLWDLTAGKLLHDFKCHEGQIQ  199

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
             I F   E L+A GS+   +K WDLE  ++I +     S   ++ F+P G     G +  
Sbjct  200  CIDFHPHEFLLATGSADKTVKFWDLETFELIGSAGPEASGVRSMTFNPDGRTLLCG-LHE  258

Query  563  NLKIW  577
            +LK++
Sbjct  259  SLKVF  263



>ref|XP_010933308.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X2 [Elaeis guineensis]
Length=825

 Score =   256 bits (655),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 110/156 (71%), Positives = 137/156 (88%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAH  NVNCL+ G+KT R+ +TGG+DH VNLW+IGKP +  +LSGHTS VE
Sbjct  5    KRSYKLQEFVAHDSNVNCLKIGRKTSRVLVTGGEDHKVNLWAIGKPNTILSLSGHTSAVE  64

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++ DS+E+L+AAG++SG IKLWDL + K++RTL+GHRS C +++FHPFGEF ASGS DT
Sbjct  65   SVSLDSSEVLLAAGAASGTIKLWDLGEAKVVRTLTGHRSNCISIDFHPFGEFIASGSSDT  124

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIR+KGCIHTYKGHTRG+++IRFTPDGRW+V
Sbjct  125  NLKIWDIRRKGCIHTYKGHTRGVNSIRFTPDGRWLV  160


 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 57/123 (46%), Gaps = 0/123 (0%)
 Frame = +2

Query  293  TGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKM  472
            +G  D ++ +W I +     T  GHT  V SI F      + +G    ++KLWDL   K+
Sbjct  119  SGSSDTNLKIWDIRRKGCIHTYKGHTRGVNSIRFTPDGRWLVSGGEDNIVKLWDLTAGKL  178

Query  473  IRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTP  652
            +     H      ++FHP     A+GS D  +K WD+     I +    T  + ++ F P
Sbjct  179  LHDFKCHEGQIQCIDFHPHEFLLATGSADKTVKFWDLETFEMIGSSVPETSSVHSMTFNP  238

Query  653  DGR  661
            DGR
Sbjct  239  DGR  241


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 34/119 (29%), Positives = 56/119 (47%), Gaps = 2/119 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN +RF     R  ++GG+D+ V LW +           H   ++ I F 
Sbjct  137  IHTYKGHTRGVNSIRFTPDG-RWLVSGGEDNIVKLWDLTAGKLLHDFKCHEGQIQCIDFH  195

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKI  574
              E L+A GS+   +K WDLE  +MI +     S   ++ F+P G     G +  +LK+
Sbjct  196  PHEFLLATGSADKTVKFWDLETFEMIGSSVPETSSVHSMTFNPDGRTLFCG-LHESLKV  253



>ref|XP_009392408.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=826

 Score =   256 bits (655),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 135/155 (87%), Gaps = 0/155 (0%)
 Frame = +2

Query  206  RGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVES  385
            RGYKLQEFVAH+ +VNC+  GKK+ R+F+TGG+D  VNLW+IGKPT   +LSGH   VES
Sbjct  5    RGYKLQEFVAHASDVNCVAIGKKSSRVFVTGGEDRKVNLWAIGKPTPLLSLSGHMGSVES  64

Query  386  IAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTN  565
            +AFDSAE+LV  GSS+G+IKLWDLE+ K++RTL+GHRS CT++EFHPFGEFFASGS+DT+
Sbjct  65   VAFDSAEVLVLGGSSTGIIKLWDLEEAKIVRTLTGHRSNCTSVEFHPFGEFFASGSLDTD  124

Query  566  LKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            LKIWDIRKKGCIHTYKGH  GI  IRFTPDGRWVV
Sbjct  125  LKIWDIRKKGCIHTYKGHAGGIQKIRFTPDGRWVV  159


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 56/127 (44%), Gaps = 0/127 (0%)
 Frame = +2

Query  281  RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLE  460
              F +G  D  + +W I K     T  GH   ++ I F      V  G +  ++KLWDL 
Sbjct  114  EFFASGSLDTDLKIWDIRKKGCIHTYKGHAGGIQKIRFTPDGRWVVTGGADNMVKLWDLT  173

Query  461  DTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTI  640
              K++     H      ++FHP     A+GS D  +K WD+     I +      G+ ++
Sbjct  174  AGKLLHDFKFHNGQIRCIDFHPHEFLLATGSADRTVKFWDLETFELIGSVGPEATGVCSM  233

Query  641  RFTPDGR  661
             F PDG+
Sbjct  234  IFHPDGK  240


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/120 (28%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+G +  +RF     R  +TGG D+ V LW +           H   +  I F 
Sbjct  136  IHTYKGHAGGIQKIRFTPDG-RWVVTGGADNMVKLWDLTAGKLLHDFKFHNGQIRCIDFH  194

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I ++    +   ++ FHP G+    G ++  LK++
Sbjct  195  PHEFLLATGSADRTVKFWDLETFELIGSVGPEATGVCSMIFHPDGKTLFCG-LEATLKVF  253



>emb|CAJ86235.1| H0402C08.11 [Oryza sativa Indica Group]
Length=923

 Score =   258 bits (658),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 111/150 (74%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = +2

Query  221  QEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDS  400
            +EFVAHS NVNCL+ G+KT R+ +TGGDDH VNLW+IGKP S  +LSGHTS VES+ FDS
Sbjct  32   EEFVAHSSNVNCLKIGRKTSRVLVTGGDDHKVNLWAIGKPNSILSLSGHTSAVESVNFDS  91

Query  401  AEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWD  580
             E+ VAAG++SG IKLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DTNLKIWD
Sbjct  92   TEVFVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCMSVDFHPFGEFFASGSLDTNLKIWD  151

Query  581  IRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            IR+KGCIHTYKGHTRG++ IRFTPDGRWVV
Sbjct  152  IRRKGCIHTYKGHTRGVNAIRFTPDGRWVV  181


 Score = 75.1 bits (183),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 59/125 (47%), Gaps = 0/125 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I +     T  GHT  V +I F      V +G    ++KLWDL   
Sbjct  138  FASGSLDTNLKIWDIRRKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNVVKLWDLTAG  197

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      ++FHP     A+GS D  +K WD+     I +    T G+ ++ F
Sbjct  198  KLLHDFKCHEGQIQCIDFHPHEFLLATGSSDKTVKFWDLETFELIGSTGPETTGVRSMTF  257

Query  647  TPDGR  661
             PDGR
Sbjct  258  NPDGR  262


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/120 (28%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN +RF     R  ++GG+D+ V LW +           H   ++ I F 
Sbjct  158  IHTYKGHTRGVNAIRFTPDG-RWVVSGGEDNVVKLWDLTAGKLLHDFKCHEGQIQCIDFH  216

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GSS   +K WDLE  ++I +     +   ++ F+P G     G +  +LK++
Sbjct  217  PHEFLLATGSSDKTVKFWDLETFELIGSTGPETTGVRSMTFNPDGRSLLCG-LHESLKVF  275



>emb|CAJ86243.1| H0801D08.1 [Oryza sativa Indica Group]
Length=909

 Score =   257 bits (657),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 111/150 (74%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = +2

Query  221  QEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDS  400
            +EFVAHS NVNCL+ G+KT R+ +TGGDDH VNLW+IGKP S  +LSGHTS VES+ FDS
Sbjct  32   EEFVAHSSNVNCLKIGRKTSRVLVTGGDDHKVNLWAIGKPNSILSLSGHTSAVESVNFDS  91

Query  401  AEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWD  580
             E+ VAAG++SG IKLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DTNLKIWD
Sbjct  92   TEVFVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCMSVDFHPFGEFFASGSLDTNLKIWD  151

Query  581  IRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            IR+KGCIHTYKGHTRG++ IRFTPDGRWVV
Sbjct  152  IRRKGCIHTYKGHTRGVNAIRFTPDGRWVV  181


 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 59/125 (47%), Gaps = 0/125 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I +     T  GHT  V +I F      V +G    ++KLWDL   
Sbjct  138  FASGSLDTNLKIWDIRRKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNVVKLWDLTAG  197

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      ++FHP     A+GS D  +K WD+     I +    T G+ ++ F
Sbjct  198  KLLHDFKCHEGQIQCIDFHPHEFLLATGSSDKTVKFWDLETFELIGSTGPETTGVRSMTF  257

Query  647  TPDGR  661
             PDGR
Sbjct  258  NPDGR  262


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/120 (28%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN +RF     R  ++GG+D+ V LW +           H   ++ I F 
Sbjct  158  IHTYKGHTRGVNAIRFTPDG-RWVVSGGEDNVVKLWDLTAGKLLHDFKCHEGQIQCIDFH  216

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GSS   +K WDLE  ++I +     +   ++ F+P G     G +  +LK++
Sbjct  217  PHEFLLATGSSDKTVKFWDLETFELIGSTGPETTGVRSMTFNPDGRSLLCG-LHESLKVF  275



>ref|XP_009793706.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X3 [Nicotiana sylvestris]
Length=798

 Score =   256 bits (653),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 111/156 (71%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS +VN L+ G+K+ R+ +TGG+DH VNLWSIGKP +  +LSGH+S ++
Sbjct  5    KRAYKLQEFVAHSLSVNSLKIGRKSSRVLVTGGEDHKVNLWSIGKPDAILSLSGHSSGID  64

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++FDS+E+LVAAG++SG IKLWDLE+ K++RTL+GHRS C +L+FHPFGEFFASGS+DT
Sbjct  65   SVSFDSSEVLVAAGAASGTIKLWDLEEAKILRTLTGHRSNCISLDFHPFGEFFASGSLDT  124

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIR+KGC HTYKGH+RG++TIRFTPDGRWVV
Sbjct  125  NLKIWDIRRKGCTHTYKGHSRGVNTIRFTPDGRWVV  160


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/151 (28%), Positives = 66/151 (44%), Gaps = 1/151 (1%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            L+    H  N   L F       F +G  D ++ +W I +   T T  GH+  V +I F 
Sbjct  95   LRTLTGHRSNCISLDF-HPFGEFFASGSLDTNLKIWDIRRKGCTHTYKGHSRGVNTIRFT  153

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
                 V +G     +K+WDL   K++     H     +++FHP     A+GS D  +K W
Sbjct  154  PDGRWVVSGGEDSTVKIWDLTAGKLLHDFKCHEGQIRSIDFHPHEFLLATGSADKTVKFW  213

Query  578  DIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            D+     I +    T G+  + F  DGR ++
Sbjct  214  DLETFELIGSAGPETTGVRCMAFNTDGRTLL  244


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 54/117 (46%), Gaps = 2/117 (2%)
 Frame = +2

Query  227  FVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAE  406
            +  HS  VN +RF     R  ++GG+D +V +W +           H   + SI F   E
Sbjct  140  YKGHSRGVNTIRFTPDG-RWVVSGGEDSTVKIWDLTAGKLLHDFKCHEGQIRSIDFHPHE  198

Query  407  ILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
             L+A GS+   +K WDLE  ++I +     +    + F+  G     G +  NLK++
Sbjct  199  FLLATGSADKTVKFWDLETFELIGSAGPETTGVRCMAFNTDGRTLLCG-LHENLKVF  254



>ref|XP_010933307.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Elaeis guineensis]
Length=847

 Score =   256 bits (655),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 110/156 (71%), Positives = 137/156 (88%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAH  NVNCL+ G+KT R+ +TGG+DH VNLW+IGKP +  +LSGHTS VE
Sbjct  5    KRSYKLQEFVAHDSNVNCLKIGRKTSRVLVTGGEDHKVNLWAIGKPNTILSLSGHTSAVE  64

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++ DS+E+L+AAG++SG IKLWDL + K++RTL+GHRS C +++FHPFGEF ASGS DT
Sbjct  65   SVSLDSSEVLLAAGAASGTIKLWDLGEAKVVRTLTGHRSNCISIDFHPFGEFIASGSSDT  124

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIR+KGCIHTYKGHTRG+++IRFTPDGRW+V
Sbjct  125  NLKIWDIRRKGCIHTYKGHTRGVNSIRFTPDGRWLV  160


 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 57/123 (46%), Gaps = 0/123 (0%)
 Frame = +2

Query  293  TGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKM  472
            +G  D ++ +W I +     T  GHT  V SI F      + +G    ++KLWDL   K+
Sbjct  119  SGSSDTNLKIWDIRRKGCIHTYKGHTRGVNSIRFTPDGRWLVSGGEDNIVKLWDLTAGKL  178

Query  473  IRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTP  652
            +     H      ++FHP     A+GS D  +K WD+     I +    T  + ++ F P
Sbjct  179  LHDFKCHEGQIQCIDFHPHEFLLATGSADKTVKFWDLETFEMIGSSVPETSSVHSMTFNP  238

Query  653  DGR  661
            DGR
Sbjct  239  DGR  241


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 34/119 (29%), Positives = 56/119 (47%), Gaps = 2/119 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN +RF     R  ++GG+D+ V LW +           H   ++ I F 
Sbjct  137  IHTYKGHTRGVNSIRFTPDG-RWLVSGGEDNIVKLWDLTAGKLLHDFKCHEGQIQCIDFH  195

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKI  574
              E L+A GS+   +K WDLE  +MI +     S   ++ F+P G     G +  +LK+
Sbjct  196  PHEFLLATGSADKTVKFWDLETFEMIGSSVPETSSVHSMTFNPDGRTLFCG-LHESLKV  253



>ref|XP_009793704.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Nicotiana sylvestris]
Length=811

 Score =   256 bits (653),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 111/156 (71%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS +VN L+ G+K+ R+ +TGG+DH VNLWSIGKP +  +LSGH+S ++
Sbjct  5    KRAYKLQEFVAHSLSVNSLKIGRKSSRVLVTGGEDHKVNLWSIGKPDAILSLSGHSSGID  64

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++FDS+E+LVAAG++SG IKLWDLE+ K++RTL+GHRS C +L+FHPFGEFFASGS+DT
Sbjct  65   SVSFDSSEVLVAAGAASGTIKLWDLEEAKILRTLTGHRSNCISLDFHPFGEFFASGSLDT  124

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIR+KGC HTYKGH+RG++TIRFTPDGRWVV
Sbjct  125  NLKIWDIRRKGCTHTYKGHSRGVNTIRFTPDGRWVV  160


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/151 (28%), Positives = 66/151 (44%), Gaps = 1/151 (1%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            L+    H  N   L F       F +G  D ++ +W I +   T T  GH+  V +I F 
Sbjct  95   LRTLTGHRSNCISLDF-HPFGEFFASGSLDTNLKIWDIRRKGCTHTYKGHSRGVNTIRFT  153

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
                 V +G     +K+WDL   K++     H     +++FHP     A+GS D  +K W
Sbjct  154  PDGRWVVSGGEDSTVKIWDLTAGKLLHDFKCHEGQIRSIDFHPHEFLLATGSADKTVKFW  213

Query  578  DIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            D+     I +    T G+  + F  DGR ++
Sbjct  214  DLETFELIGSAGPETTGVRCMAFNTDGRTLL  244


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 54/117 (46%), Gaps = 2/117 (2%)
 Frame = +2

Query  227  FVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAE  406
            +  HS  VN +RF     R  ++GG+D +V +W +           H   + SI F   E
Sbjct  140  YKGHSRGVNTIRFTPDG-RWVVSGGEDSTVKIWDLTAGKLLHDFKCHEGQIRSIDFHPHE  198

Query  407  ILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
             L+A GS+   +K WDLE  ++I +     +    + F+  G     G +  NLK++
Sbjct  199  FLLATGSADKTVKFWDLETFELIGSAGPETTGVRCMAFNTDGRTLLCG-LHENLKVF  254



>ref|XP_009793705.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X2 [Nicotiana sylvestris]
Length=810

 Score =   256 bits (653),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 111/156 (71%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS +VN L+ G+K+ R+ +TGG+DH VNLWSIGKP +  +LSGH+S ++
Sbjct  5    KRAYKLQEFVAHSLSVNSLKIGRKSSRVLVTGGEDHKVNLWSIGKPDAILSLSGHSSGID  64

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S++FDS+E+LVAAG++SG IKLWDLE+ K++RTL+GHRS C +L+FHPFGEFFASGS+DT
Sbjct  65   SVSFDSSEVLVAAGAASGTIKLWDLEEAKILRTLTGHRSNCISLDFHPFGEFFASGSLDT  124

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIR+KGC HTYKGH+RG++TIRFTPDGRWVV
Sbjct  125  NLKIWDIRRKGCTHTYKGHSRGVNTIRFTPDGRWVV  160


 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/151 (28%), Positives = 66/151 (44%), Gaps = 1/151 (1%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            L+    H  N   L F       F +G  D ++ +W I +   T T  GH+  V +I F 
Sbjct  95   LRTLTGHRSNCISLDF-HPFGEFFASGSLDTNLKIWDIRRKGCTHTYKGHSRGVNTIRFT  153

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
                 V +G     +K+WDL   K++     H     +++FHP     A+GS D  +K W
Sbjct  154  PDGRWVVSGGEDSTVKIWDLTAGKLLHDFKCHEGQIRSIDFHPHEFLLATGSADKTVKFW  213

Query  578  DIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            D+     I +    T G+  + F  DGR ++
Sbjct  214  DLETFELIGSAGPETTGVRCMAFNTDGRTLL  244


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 54/117 (46%), Gaps = 2/117 (2%)
 Frame = +2

Query  227  FVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAE  406
            +  HS  VN +RF     R  ++GG+D +V +W +           H   + SI F   E
Sbjct  140  YKGHSRGVNTIRFTPDG-RWVVSGGEDSTVKIWDLTAGKLLHDFKCHEGQIRSIDFHPHE  198

Query  407  ILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
             L+A GS+   +K WDLE  ++I +     +    + F+  G     G +  NLK++
Sbjct  199  FLLATGSADKTVKFWDLETFELIGSAGPETTGVRCMAFNTDGRTLLCG-LHENLKVF  254



>ref|XP_006287049.1| hypothetical protein CARUB_v10000197mg [Capsella rubella]
 gb|EOA19947.1| hypothetical protein CARUB_v10000197mg [Capsella rubella]
Length=864

 Score =   256 bits (654),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 109/156 (70%), Positives = 138/156 (88%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS  VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +  +L GH+S ++
Sbjct  4    KRAYKLQEFVAHSAAVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLYGHSSGID  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S+ FD++E+LVAAG++SG IKLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DT
Sbjct  64   SVTFDASEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIRKKGCIHTYKGHTRG++ +RFTPDGRWVV
Sbjct  124  NLKIWDIRKKGCIHTYKGHTRGVNVLRFTPDGRWVV  159


 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 60/128 (47%), Gaps = 0/128 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GHT  V  + F      V +G    ++K+WDL   
Sbjct  116  FASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNVLRFTPDGRWVVSGGEDNIVKVWDLTAG  175

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H     +L+FHP     A+GS D  +K WD+     I +    T G+  + F
Sbjct  176  KLLTEFKSHEGQIQSLDFHPHEFLLATGSADRTVKFWDLETFELIGSGGPETAGVRCLSF  235

Query  647  TPDGRWVV  670
             PDG+ V+
Sbjct  236  NPDGKTVL  243


 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 59/120 (49%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN LRF     R  ++GG+D+ V +W +      +    H   ++S+ F 
Sbjct  136  IHTYKGHTRGVNVLRFTPDG-RWVVSGGEDNIVKVWDLTAGKLLTEFKSHEGQIQSLDFH  194

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +    L F+P G+    G +  +LKI+
Sbjct  195  PHEFLLATGSADRTVKFWDLETFELIGSGGPETAGVRCLSFNPDGKTVLCG-LQESLKIF  253



>gb|EMS67191.1| Katanin p80 WD40 repeat-containing subunit B1-like protein 1 
[Triticum urartu]
Length=953

 Score =   257 bits (656),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = +2

Query  221  QEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDS  400
            +EFVAH+ NVNCL+ G+KT R+ +TGG+DH VNLW+IGKP S S+L GHTS VES+AFDS
Sbjct  35   EEFVAHASNVNCLKIGRKTSRVLVTGGEDHKVNLWAIGKPNSISSLPGHTSAVESVAFDS  94

Query  401  AEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWD  580
             E+ VAAG++SG +KLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DTNLKIWD
Sbjct  95   TEVFVAAGAASGTVKLWDLEEAKIVRTLTGHRSNCMSVDFHPFGEFFASGSLDTNLKIWD  154

Query  581  IRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            IR+KGCIHTYKGHTRG++ IRFTPDGRWVV
Sbjct  155  IRRKGCIHTYKGHTRGVNAIRFTPDGRWVV  184


 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 59/128 (46%), Gaps = 0/128 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I +     T  GHT  V +I F      V +G     +K+WDL   
Sbjct  141  FASGSLDTNLKIWDIRRKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDSAVKIWDLTAG  200

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      ++FHP     A+GS D  +K WD+     I +      G+ ++ F
Sbjct  201  KLLHEFKSHEGQIQCIDFHPHEFLLATGSADKTVKFWDLETFELIGSTGPEMTGVRSMTF  260

Query  647  TPDGRWVV  670
             PDGR ++
Sbjct  261  NPDGRSLL  268


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 56/119 (47%), Gaps = 2/119 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN +RF     R  ++GG+D +V +W +           H   ++ I F 
Sbjct  161  IHTYKGHTRGVNAIRFTPD-GRWVVSGGEDSAVKIWDLTAGKLLHEFKSHEGQIQCIDFH  219

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKI  574
              E L+A GS+   +K WDLE  ++I +     +   ++ F+P G     G +  +LK+
Sbjct  220  PHEFLLATGSADKTVKFWDLETFELIGSTGPEMTGVRSMTFNPDGRSLLCG-LHESLKV  277



>tpg|DAA35346.1| TPA: hypothetical protein ZEAMMB73_159052 [Zea mays]
Length=877

 Score =   255 bits (652),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 110/150 (73%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = +2

Query  221  QEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDS  400
            +EFVAHS NVNCL+ G+KT R+ +TGG+DH VNLW+IGKP S  +LSGHTS VES+ FDS
Sbjct  24   EEFVAHSSNVNCLKIGRKTSRVLVTGGEDHKVNLWAIGKPNSILSLSGHTSAVESVGFDS  83

Query  401  AEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWD  580
             E+ VAAG++SG IKLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DTNLKIWD
Sbjct  84   TEVFVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCMSVDFHPFGEFFASGSLDTNLKIWD  143

Query  581  IRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            IR+K CIHTYKGHTRG++TIRFTPDGRWVV
Sbjct  144  IRRKNCIHTYKGHTRGVNTIRFTPDGRWVV  173


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 61/128 (48%), Gaps = 0/128 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I +     T  GHT  V +I F      V +G    ++KLWDL   
Sbjct  130  FASGSLDTNLKIWDIRRKNCIHTYKGHTRGVNTIRFTPDGRWVVSGGEDNIVKLWDLTAG  189

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      ++FHP     A+GS D  +K WD+     I +    T G+ ++ F
Sbjct  190  KLLHEFKCHEGQIQCIDFHPHEFLLATGSADKTVKFWDLETFELIGSTGPETTGVRSMTF  249

Query  647  TPDGRWVV  670
             PDGR ++
Sbjct  250  NPDGRSLL  257


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 59/125 (47%), Gaps = 2/125 (2%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            +R   +  +  H+  VN +RF     R  ++GG+D+ V LW +           H   ++
Sbjct  145  RRKNCIHTYKGHTRGVNTIRFTPDG-RWVVSGGEDNIVKLWDLTAGKLLHEFKCHEGQIQ  203

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
             I F   E L+A GS+   +K WDLE  ++I +     +   ++ F+P G     G +  
Sbjct  204  CIDFHPHEFLLATGSADKTVKFWDLETFELIGSTGPETTGVRSMTFNPDGRSLLCG-LHE  262

Query  563  NLKIW  577
            +LK++
Sbjct  263  SLKVF  267



>ref|XP_010454626.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X2 [Camelina sativa]
Length=816

 Score =   254 bits (650),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 109/156 (70%), Positives = 137/156 (88%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS  VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +  +L GH+S ++
Sbjct  4    KRAYKLQEFVAHSAAVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLYGHSSGID  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S+ FD++E LVAAG++SG IKLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DT
Sbjct  64   SVTFDASEGLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIRKKGCIHTYKGHTRG++ +RFTPDGRWVV
Sbjct  124  NLKIWDIRKKGCIHTYKGHTRGVNVLRFTPDGRWVV  159


 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 60/128 (47%), Gaps = 0/128 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GHT  V  + F      V +G    ++K+WDL   
Sbjct  116  FASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNVLRFTPDGRWVVSGGEDNIVKVWDLTAG  175

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H     +L+FHP     A+GS D  +K WD+     I +    T G+  + F
Sbjct  176  KLLTEFKSHEGQIQSLDFHPHEFLLATGSADRTVKFWDLETFELIGSGGPETAGVRCLSF  235

Query  647  TPDGRWVV  670
             PDG+ V+
Sbjct  236  NPDGKTVL  243


 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 59/120 (49%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN LRF     R  ++GG+D+ V +W +      +    H   ++S+ F 
Sbjct  136  IHTYKGHTRGVNVLRF-TPDGRWVVSGGEDNIVKVWDLTAGKLLTEFKSHEGQIQSLDFH  194

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +    L F+P G+    G +  +LKI+
Sbjct  195  PHEFLLATGSADRTVKFWDLETFELIGSGGPETAGVRCLSFNPDGKTVLCG-LQESLKIF  253



>ref|XP_010452825.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
[Camelina sativa]
 ref|XP_010452826.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
[Camelina sativa]
 ref|XP_010452827.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
[Camelina sativa]
 ref|XP_010452828.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
[Camelina sativa]
Length=837

 Score =   254 bits (650),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 110/156 (71%), Positives = 136/156 (87%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS  VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +  +L GH+S V+
Sbjct  4    KRAYKLQEFVAHSAAVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLYGHSSGVD  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S+ FD++E LVAAG++SG IKLWDL++ K++RTL+GHRS C A+ FHPFGEFFASGS+DT
Sbjct  64   SVTFDASEGLVAAGAASGTIKLWDLQEAKVVRTLTGHRSNCVAVNFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIRKKGCIHTYKGHTRGI+ +RFTPDGRW+V
Sbjct  124  NLKIWDIRKKGCIHTYKGHTRGINVLRFTPDGRWIV  159


 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 64/141 (45%), Gaps = 4/141 (3%)
 Frame = +2

Query  248  VNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGS  427
            VN   FG+     F +G  D ++ +W I K     T  GHT  +  + F      + +G 
Sbjct  107  VNFHPFGE----FFASGSLDTNLKIWDIRKKGCIHTYKGHTRGINVLRFTPDGRWIVSGG  162

Query  428  SSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHT  607
               ++K+WDL   K++     H     +L+FHP     A+GS D  +K WD+     I +
Sbjct  163  EDNVVKVWDLTAGKLLHEFKSHEGQIQSLDFHPHEFLLATGSADKTVKFWDLETFELIGS  222

Query  608  YKGHTRGISTIRFTPDGRWVV  670
                T  +  + F PDG+ V+
Sbjct  223  GGTETTAVRCLTFNPDGKSVL  243


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/120 (28%), Positives = 58/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  +N LRF     R  ++GG+D+ V +W +           H   ++S+ F 
Sbjct  136  IHTYKGHTRGINVLRF-TPDGRWIVSGGEDNVVKVWDLTAGKLLHEFKSHEGQIQSLDFH  194

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +    L F+P G+    G +  +LKI+
Sbjct  195  PHEFLLATGSADKTVKFWDLETFELIGSGGTETTAVRCLTFNPDGKSVLCG-LQESLKIF  253



>ref|XP_010454622.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Camelina sativa]
 ref|XP_010454623.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Camelina sativa]
 ref|XP_010454624.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Camelina sativa]
 ref|XP_010454625.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Camelina sativa]
Length=835

 Score =   254 bits (650),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 109/156 (70%), Positives = 137/156 (88%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS  VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +  +L GH+S ++
Sbjct  4    KRAYKLQEFVAHSAAVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLYGHSSGID  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S+ FD++E LVAAG++SG IKLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DT
Sbjct  64   SVTFDASEGLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIRKKGCIHTYKGHTRG++ +RFTPDGRWVV
Sbjct  124  NLKIWDIRKKGCIHTYKGHTRGVNVLRFTPDGRWVV  159


 Score = 74.7 bits (182),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 60/128 (47%), Gaps = 0/128 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GHT  V  + F      V +G    ++K+WDL   
Sbjct  116  FASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNVLRFTPDGRWVVSGGEDNIVKVWDLTAG  175

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H     +L+FHP     A+GS D  +K WD+     I +    T G+  + F
Sbjct  176  KLLTEFKSHEGQIQSLDFHPHEFLLATGSADRTVKFWDLETFELIGSGGPETAGVRCLSF  235

Query  647  TPDGRWVV  670
             PDG+ V+
Sbjct  236  NPDGKTVL  243


 Score = 55.8 bits (133),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 59/120 (49%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN LRF     R  ++GG+D+ V +W +      +    H   ++S+ F 
Sbjct  136  IHTYKGHTRGVNVLRF-TPDGRWVVSGGEDNIVKVWDLTAGKLLTEFKSHEGQIQSLDFH  194

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +    L F+P G+    G +  +LKI+
Sbjct  195  PHEFLLATGSADRTVKFWDLETFELIGSGGPETAGVRCLSFNPDGKTVLCG-LQESLKIF  253



>ref|XP_010105192.1| Katanin p80 WD40 repeat-containing subunit B1-1-like protein 
[Morus notabilis]
 gb|EXC04046.1| Katanin p80 WD40 repeat-containing subunit B1-1-like protein 
[Morus notabilis]
Length=569

 Score =   249 bits (636),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 107/150 (71%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = +2

Query  221  QEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDS  400
            +EFVAHS  VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +  +LSGHTS ++S++FDS
Sbjct  24   EEFVAHSAAVNCLKIGRKSSRLLVTGGEDHKVNLWAIGKPNAILSLSGHTSGIDSVSFDS  83

Query  401  AEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWD  580
            +E+LVAAG++SG IKLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DTNLKIWD
Sbjct  84   SEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDTNLKIWD  143

Query  581  IRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            IRKKGCIHTYKGHTRG++ IRFTPDGRWVV
Sbjct  144  IRKKGCIHTYKGHTRGVNAIRFTPDGRWVV  173



>ref|XP_006399331.1| hypothetical protein EUTSA_v10012683mg [Eutrema salsugineum]
 gb|ESQ40784.1| hypothetical protein EUTSA_v10012683mg [Eutrema salsugineum]
Length=838

 Score =   254 bits (649),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 111/156 (71%), Positives = 135/156 (87%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS  VNCL+ G+K+ R  LTGG+DH+VNLW+IGKP +  +L GHTS ++
Sbjct  4    KRAYKLQEFVAHSAAVNCLKIGRKSSRKLLTGGEDHTVNLWAIGKPNAILSLHGHTSGID  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S+ FD+ E LVAAG++SG IKLWDLE+ K++RTL+GHRS C ++ FHPFGEFFASGS+DT
Sbjct  64   SVTFDATEGLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVNFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIRKKGCIHTYKGHTRG++ +RFTPDGRWVV
Sbjct  124  NLKIWDIRKKGCIHTYKGHTRGVNVLRFTPDGRWVV  159


 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 66/142 (46%), Gaps = 4/142 (3%)
 Frame = +2

Query  245  NVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAG  424
            +VN   FG+     F +G  D ++ +W I K     T  GHT  V  + F      V +G
Sbjct  106  SVNFHPFGE----FFASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNVLRFTPDGRWVVSG  161

Query  425  SSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIH  604
                ++K+WDL   K++     H     +L+FHP     A+GS D  +K WD+     I 
Sbjct  162  GEDNVVKVWDLTAGKLLHEFKSHEGQIQSLDFHPHEFLLATGSADKTVKFWDLETFELIG  221

Query  605  TYKGHTRGISTIRFTPDGRWVV  670
            +    T G+  + F PDG+ V+
Sbjct  222  SGGTETTGVRCLTFNPDGKSVL  243


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 58/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN LRF     R  ++GG+D+ V +W +           H   ++S+ F 
Sbjct  136  IHTYKGHTRGVNVLRF-TPDGRWVVSGGEDNVVKVWDLTAGKLLHEFKSHEGQIQSLDFH  194

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +    L F+P G+    G +  +LKI+
Sbjct  195  PHEFLLATGSADKTVKFWDLETFELIGSGGTETTGVRCLTFNPDGKSVLCG-LHESLKIF  253



>emb|CDY34658.1| BnaC08g42170D [Brassica napus]
Length=766

 Score =   253 bits (646),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 112/158 (71%), Positives = 135/158 (85%), Gaps = 0/158 (0%)
 Frame = +2

Query  197  MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP  376
            MAKRGYKLQEF+AHS NVNCL  GKKT R+ LTGGDD  VNLWSIGK TS ++L GHTSP
Sbjct  1    MAKRGYKLQEFLAHSANVNCLSIGKKTSRLLLTGGDDCKVNLWSIGKSTSLTSLCGHTSP  60

Query  377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM  556
            ++S+ F++ E LV AG+SSG+IKLW+L++ K++R  +GH S C+ALEFHPFG++ ASGS 
Sbjct  61   IDSVTFNTEEALVLAGASSGVIKLWNLQEAKVVRGFTGHISNCSALEFHPFGQYLASGSS  120

Query  557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            D NLKIWDIRKKGCI TYKGHTRGIST++FTPDGRW+V
Sbjct  121  DANLKIWDIRKKGCIQTYKGHTRGISTVKFTPDGRWLV  158


 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/145 (27%), Positives = 66/145 (46%), Gaps = 1/145 (1%)
 Frame = +2

Query  227  FVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAE  406
            F  H  N + L F     +   +G  D ++ +W I K     T  GHT  + ++ F    
Sbjct  96   FTGHISNCSALEF-HPFGQYLASGSSDANLKIWDIRKKGCIQTYKGHTRGISTVKFTPDG  154

Query  407  ILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIR  586
              + +G    ++K+WD+   K++     H     +L+FHP     A+GS D  +K WD+ 
Sbjct  155  RWLVSGGLDNVVKIWDITAGKLLHEFKFHDGPIRSLDFHPLEFLLATGSADRTVKFWDLE  214

Query  587  KKGCIHTYKGHTRGISTIRFTPDGR  661
                I + +    G+ +I F PDG+
Sbjct  215  TFELIGSTRPEATGVRSIAFHPDGQ  239


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/120 (28%), Positives = 59/120 (49%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +Q +  H+  ++ ++F     R  ++GG D+ V +W I           H  P+ S+ F 
Sbjct  135  IQTYKGHTRGISTVKFTPDG-RWLVSGGLDNVVKIWDITAGKLLHEFKFHDGPIRSLDFH  193

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   ++ FHP G+    G +D  LK++
Sbjct  194  PLEFLLATGSADRTVKFWDLETFELIGSTRPEATGVRSIAFHPDGQTLFCG-LDDGLKVY  252



>ref|XP_006287083.1| hypothetical protein CARUB_v10000243mg [Capsella rubella]
 gb|EOA19981.1| hypothetical protein CARUB_v10000243mg [Capsella rubella]
Length=814

 Score =   254 bits (648),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 109/156 (70%), Positives = 136/156 (87%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS  VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +  +L GH+S ++
Sbjct  4    KRAYKLQEFVAHSAAVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLYGHSSGID  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S+ FD++E LVAAG++SG IKLWDLE+ K++RTL+GHRS C A+ FHPFGEFFASGS+DT
Sbjct  64   SVTFDASEGLVAAGAASGTIKLWDLEEAKVVRTLTGHRSNCIAVNFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIRKKGCIHTYKGHTRG++ +RFTPDGRW+V
Sbjct  124  NLKIWDIRKKGCIHTYKGHTRGVNVLRFTPDGRWIV  159


 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/141 (30%), Positives = 65/141 (46%), Gaps = 4/141 (3%)
 Frame = +2

Query  248  VNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGS  427
            VN   FG+     F +G  D ++ +W I K     T  GHT  V  + F      + +G 
Sbjct  107  VNFHPFGE----FFASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNVLRFTPDGRWIVSGG  162

Query  428  SSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHT  607
               ++K+WDL   K++     H     +L+FHP     A+GS D  +K WD+     I +
Sbjct  163  EDNVVKVWDLTAGKLLHEFKSHEGKIQSLDFHPHEFLLATGSADKTVKFWDLETFELIGS  222

Query  608  YKGHTRGISTIRFTPDGRWVV  670
                T G+  + F PDG+ V+
Sbjct  223  GGTETTGVRCLTFNPDGKSVL  243


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 58/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN LRF     R  ++GG+D+ V +W +           H   ++S+ F 
Sbjct  136  IHTYKGHTRGVNVLRF-TPDGRWIVSGGEDNVVKVWDLTAGKLLHEFKSHEGKIQSLDFH  194

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +    L F+P G+    G +  +LKI+
Sbjct  195  PHEFLLATGSADKTVKFWDLETFELIGSGGTETTGVRCLTFNPDGKSVLCG-LQESLKIF  253



>ref|XP_009131065.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
[Brassica rapa]
Length=835

 Score =   254 bits (648),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 111/156 (71%), Positives = 134/156 (86%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS  VNCL+ G+K+ R  +TGG+DH VNLW+IGKP +  +L GHTS V+
Sbjct  4    KRAYKLQEFVAHSAAVNCLKIGRKSSRKLVTGGEDHKVNLWAIGKPNTILSLQGHTSGVD  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S+ FD++E LVAAG++SG IKLWDLE+ K++RTL+GHRS C ++ FHPFGEFFASGS DT
Sbjct  64   SVTFDASEGLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVNFHPFGEFFASGSRDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIRKKGCIHTYKGHTRG++ +RFTPDGRWVV
Sbjct  124  NLKIWDIRKKGCIHTYKGHTRGVNVLRFTPDGRWVV  159


 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 65/141 (46%), Gaps = 4/141 (3%)
 Frame = +2

Query  248  VNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGS  427
            VN   FG+     F +G  D ++ +W I K     T  GHT  V  + F      V +G 
Sbjct  107  VNFHPFGE----FFASGSRDTNLKIWDIRKKGCIHTYKGHTRGVNVLRFTPDGRWVVSGG  162

Query  428  SSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHT  607
               ++K+WDL   K++     H     +L+FHP     A+GS D  +K WD+     I +
Sbjct  163  EDNVVKVWDLTAGKLLHEFKSHEGQIQSLDFHPHEFLLATGSADKTVKFWDLETFELIGS  222

Query  608  YKGHTRGISTIRFTPDGRWVV  670
                T G+  + F PDG+ V+
Sbjct  223  GGTETTGVRCLTFNPDGKSVL  243


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 58/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN LRF     R  ++GG+D+ V +W +           H   ++S+ F 
Sbjct  136  IHTYKGHTRGVNVLRF-TPDGRWVVSGGEDNVVKVWDLTAGKLLHEFKSHEGQIQSLDFH  194

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +    L F+P G+    G +  +LKI+
Sbjct  195  PHEFLLATGSADKTVKFWDLETFELIGSGGTETTGVRCLTFNPDGKSVLCG-LHESLKIF  253



>ref|XP_010491476.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X2 [Camelina sativa]
Length=838

 Score =   253 bits (647),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 109/156 (70%), Positives = 136/156 (87%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS  VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +  +L GH+S ++
Sbjct  4    KRAYKLQEFVAHSAAVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLYGHSSGID  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S+ FD++E LVAAG++SG IKLWDL++ K++RTL+GHRS C A+ FHPFGEFFASGS+DT
Sbjct  64   SVTFDASEGLVAAGAASGTIKLWDLQEAKVVRTLTGHRSNCIAVNFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIRKKGCIHTYKGHTRGI+ +RFTPDGRW+V
Sbjct  124  NLKIWDIRKKGCIHTYKGHTRGINVLRFTPDGRWIV  159


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 65/141 (46%), Gaps = 4/141 (3%)
 Frame = +2

Query  248  VNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGS  427
            VN   FG+     F +G  D ++ +W I K     T  GHT  +  + F      + +G 
Sbjct  107  VNFHPFGE----FFASGSLDTNLKIWDIRKKGCIHTYKGHTRGINVLRFTPDGRWIVSGG  162

Query  428  SSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHT  607
               ++K+WDL   K++     H     +L+FHP     A+GS D  +K WD+     I +
Sbjct  163  EDNVVKVWDLTAGKLLHEFKSHEGQIQSLDFHPHEFLLATGSADKTVKFWDLETFELIGS  222

Query  608  YKGHTRGISTIRFTPDGRWVV  670
                T G+  + F PDG+ V+
Sbjct  223  GGTETTGVRCLTFNPDGKSVL  243


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/120 (28%), Positives = 58/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  +N LRF     R  ++GG+D+ V +W +           H   ++S+ F 
Sbjct  136  IHTYKGHTRGINVLRF-TPDGRWIVSGGEDNVVKVWDLTAGKLLHEFKSHEGQIQSLDFH  194

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +    L F+P G+    G +  +LKI+
Sbjct  195  PHEFLLATGSADKTVKFWDLETFELIGSGGTETTGVRCLTFNPDGKSVLCG-LQESLKIF  253



>ref|XP_010491474.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Camelina sativa]
 ref|XP_010491475.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Camelina sativa]
Length=839

 Score =   253 bits (647),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 109/156 (70%), Positives = 136/156 (87%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS  VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +  +L GH+S ++
Sbjct  4    KRAYKLQEFVAHSAAVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLYGHSSGID  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S+ FD++E LVAAG++SG IKLWDL++ K++RTL+GHRS C A+ FHPFGEFFASGS+DT
Sbjct  64   SVTFDASEGLVAAGAASGTIKLWDLQEAKVVRTLTGHRSNCIAVNFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIRKKGCIHTYKGHTRGI+ +RFTPDGRW+V
Sbjct  124  NLKIWDIRKKGCIHTYKGHTRGINVLRFTPDGRWIV  159


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 65/141 (46%), Gaps = 4/141 (3%)
 Frame = +2

Query  248  VNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGS  427
            VN   FG+     F +G  D ++ +W I K     T  GHT  +  + F      + +G 
Sbjct  107  VNFHPFGE----FFASGSLDTNLKIWDIRKKGCIHTYKGHTRGINVLRFTPDGRWIVSGG  162

Query  428  SSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHT  607
               ++K+WDL   K++     H     +L+FHP     A+GS D  +K WD+     I +
Sbjct  163  EDNVVKVWDLTAGKLLHEFKSHEGQIQSLDFHPHEFLLATGSADKTVKFWDLETFELIGS  222

Query  608  YKGHTRGISTIRFTPDGRWVV  670
                T G+  + F PDG+ V+
Sbjct  223  GGTETTGVRCLTFNPDGKSVL  243


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/120 (28%), Positives = 58/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  +N LRF     R  ++GG+D+ V +W +           H   ++S+ F 
Sbjct  136  IHTYKGHTRGINVLRF-TPDGRWIVSGGEDNVVKVWDLTAGKLLHEFKSHEGQIQSLDFH  194

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +    L F+P G+    G +  +LKI+
Sbjct  195  PHEFLLATGSADKTVKFWDLETFELIGSGGTETTGVRCLTFNPDGKSVLCG-LQESLKIF  253



>ref|XP_010423095.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Camelina sativa]
 ref|XP_010423096.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Camelina sativa]
Length=839

 Score =   253 bits (647),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 109/156 (70%), Positives = 136/156 (87%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS  VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +  +L GH+S ++
Sbjct  4    KRAYKLQEFVAHSAAVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLYGHSSGID  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S+ FD++E LVAAG++SG IKLWDL++ K++RTL+GHRS C A+ FHPFGEFFASGS+DT
Sbjct  64   SVTFDASEGLVAAGAASGTIKLWDLQEAKVVRTLTGHRSNCIAVNFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIRKKGCIHTYKGHTRGI+ +RFTPDGRW+V
Sbjct  124  NLKIWDIRKKGCIHTYKGHTRGINVLRFTPDGRWIV  159


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 65/141 (46%), Gaps = 4/141 (3%)
 Frame = +2

Query  248  VNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGS  427
            VN   FG+     F +G  D ++ +W I K     T  GHT  +  + F      + +G 
Sbjct  107  VNFHPFGE----FFASGSLDTNLKIWDIRKKGCIHTYKGHTRGINVLRFTPDGRWIVSGG  162

Query  428  SSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHT  607
               ++K+WDL   K++     H     +L+FHP     A+GS D  +K WD+     I +
Sbjct  163  EDNVVKVWDLTAGKLLHEFKSHEGQIQSLDFHPHEFLLATGSADKTVKFWDLETFELIGS  222

Query  608  YKGHTRGISTIRFTPDGRWVV  670
                T G+  + F PDG+ V+
Sbjct  223  GGTETTGVRCLTFNPDGKSVL  243


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/120 (28%), Positives = 58/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  +N LRF     R  ++GG+D+ V +W +           H   ++S+ F 
Sbjct  136  IHTYKGHTRGINVLRF-TPDGRWIVSGGEDNVVKVWDLTAGKLLHEFKSHEGQIQSLDFH  194

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +    L F+P G+    G +  +LKI+
Sbjct  195  PHEFLLATGSADKTVKFWDLETFELIGSGGTETTGVRCLTFNPDGKSVLCG-LQESLKIF  253



>ref|XP_011463420.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X2 [Fragaria vesca subsp. vesca]
Length=817

 Score =   253 bits (646),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 142/178 (80%), Gaps = 22/178 (12%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKP--------------  340
            KR YKLQEFVAH+  VNCL+ G+KT R+ +TGG+DH VNLW+IGKP              
Sbjct  4    KRAYKLQEFVAHTSAVNCLKIGRKTSRVLVTGGEDHKVNLWAIGKPNALLVMPHNLSFSI  63

Query  341  --------TSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHR  496
                    +++ +LSGHTS ++S++FDS+E+LVAAG++SG IKLWDLE+ K++RTL+GHR
Sbjct  64   FTCILIYSSTSQSLSGHTSGIDSVSFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHR  123

Query  497  SYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            S C +++FHPFGEFFASGS+DTNLKIWDIRKKGCIHTYKGHTRG++ IRFTPDGRWVV
Sbjct  124  SNCISVDFHPFGEFFASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVV  181


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 61/128 (48%), Gaps = 0/128 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GHT  V +I F      V +G     +KLWDL   
Sbjct  138  FASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNTVKLWDLTAG  197

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      ++FHP     A+GS D  +K WD+     I +    T G+ ++ F
Sbjct  198  KLLHDFKCHEGQIQCIDFHPHEFLLATGSADRTVKFWDLETFELIGSAGPETTGVRSLTF  257

Query  647  TPDGRWVV  670
            +PDGR ++
Sbjct  258  SPDGRALL  265


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/120 (28%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN +RF     R  ++GG+D++V LW +           H   ++ I F 
Sbjct  158  IHTYKGHTRGVNAIRFTPDG-RWVVSGGEDNTVKLWDLTAGKLLHDFKCHEGQIQCIDFH  216

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   +L F P G     G +  +LK++
Sbjct  217  PHEFLLATGSADRTVKFWDLETFELIGSAGPETTGVRSLTFSPDGRALLCG-LHESLKVF  275



>ref|XP_010423097.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X2 [Camelina sativa]
Length=838

 Score =   253 bits (647),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 109/156 (70%), Positives = 136/156 (87%), Gaps = 0/156 (0%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE  382
            KR YKLQEFVAHS  VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +  +L GH+S ++
Sbjct  4    KRAYKLQEFVAHSAAVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLYGHSSGID  63

Query  383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT  562
            S+ FD++E LVAAG++SG IKLWDL++ K++RTL+GHRS C A+ FHPFGEFFASGS+DT
Sbjct  64   SVTFDASEGLVAAGAASGTIKLWDLQEAKVVRTLTGHRSNCIAVNFHPFGEFFASGSLDT  123

Query  563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            NLKIWDIRKKGCIHTYKGHTRGI+ +RFTPDGRW+V
Sbjct  124  NLKIWDIRKKGCIHTYKGHTRGINVLRFTPDGRWIV  159


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 65/141 (46%), Gaps = 4/141 (3%)
 Frame = +2

Query  248  VNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGS  427
            VN   FG+     F +G  D ++ +W I K     T  GHT  +  + F      + +G 
Sbjct  107  VNFHPFGE----FFASGSLDTNLKIWDIRKKGCIHTYKGHTRGINVLRFTPDGRWIVSGG  162

Query  428  SSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHT  607
               ++K+WDL   K++     H     +L+FHP     A+GS D  +K WD+     I +
Sbjct  163  EDNVVKVWDLTAGKLLHEFKSHEGQIQSLDFHPHEFLLATGSADKTVKFWDLETFELIGS  222

Query  608  YKGHTRGISTIRFTPDGRWVV  670
                T G+  + F PDG+ V+
Sbjct  223  GGTETTGVRCLTFNPDGKSVL  243


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/120 (28%), Positives = 58/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  +N LRF     R  ++GG+D+ V +W +           H   ++S+ F 
Sbjct  136  IHTYKGHTRGINVLRF-TPDGRWIVSGGEDNVVKVWDLTAGKLLHEFKSHEGQIQSLDFH  194

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +    L F+P G+    G +  +LKI+
Sbjct  195  PHEFLLATGSADKTVKFWDLETFELIGSGGTETTGVRCLTFNPDGKSVLCG-LQESLKIF  253



>ref|XP_011463421.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X3 [Fragaria vesca subsp. vesca]
Length=817

 Score =   253 bits (646),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 142/178 (80%), Gaps = 22/178 (12%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKP--------------  340
            KR YKLQEFVAH+  VNCL+ G+KT R+ +TGG+DH VNLW+IGKP              
Sbjct  4    KRAYKLQEFVAHTSAVNCLKIGRKTSRVLVTGGEDHKVNLWAIGKPNALLVMPHNLSFSI  63

Query  341  --------TSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHR  496
                    +++ +LSGHTS ++S++FDS+E+LVAAG++SG IKLWDLE+ K++RTL+GHR
Sbjct  64   FTCILIYSSTSQSLSGHTSGIDSVSFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHR  123

Query  497  SYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            S C +++FHPFGEFFASGS+DTNLKIWDIRKKGCIHTYKGHTRG++ IRFTPDGRWVV
Sbjct  124  SNCISVDFHPFGEFFASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVV  181


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 61/128 (48%), Gaps = 0/128 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GHT  V +I F      V +G     +KLWDL   
Sbjct  138  FASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNTVKLWDLTAG  197

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      ++FHP     A+GS D  +K WD+     I +    T G+ ++ F
Sbjct  198  KLLHDFKCHEGQIQCIDFHPHEFLLATGSADRTVKFWDLETFELIGSAGPETTGVRSLTF  257

Query  647  TPDGRWVV  670
            +PDGR ++
Sbjct  258  SPDGRALL  265


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/120 (28%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN +RF     R  ++GG+D++V LW +           H   ++ I F 
Sbjct  158  IHTYKGHTRGVNAIRFTPDG-RWVVSGGEDNTVKLWDLTAGKLLHDFKCHEGQIQCIDFH  216

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   +L F P G     G +  +LK++
Sbjct  217  PHEFLLATGSADRTVKFWDLETFELIGSAGPETTGVRSLTFSPDGRALLCG-LHESLKVF  275



>ref|XP_011463419.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Fragaria vesca subsp. vesca]
Length=818

 Score =   253 bits (646),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 142/178 (80%), Gaps = 22/178 (12%)
 Frame = +2

Query  203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKP--------------  340
            KR YKLQEFVAH+  VNCL+ G+KT R+ +TGG+DH VNLW+IGKP              
Sbjct  4    KRAYKLQEFVAHTSAVNCLKIGRKTSRVLVTGGEDHKVNLWAIGKPNALLVMPHNLSFSI  63

Query  341  --------TSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHR  496
                    +++ +LSGHTS ++S++FDS+E+LVAAG++SG IKLWDLE+ K++RTL+GHR
Sbjct  64   FTCILIYSSTSQSLSGHTSGIDSVSFDSSEVLVAAGAASGTIKLWDLEEAKIVRTLTGHR  123

Query  497  SYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV  670
            S C +++FHPFGEFFASGS+DTNLKIWDIRKKGCIHTYKGHTRG++ IRFTPDGRWVV
Sbjct  124  SNCISVDFHPFGEFFASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVV  181


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 61/128 (48%), Gaps = 0/128 (0%)
 Frame = +2

Query  287  FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT  466
            F +G  D ++ +W I K     T  GHT  V +I F      V +G     +KLWDL   
Sbjct  138  FASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNTVKLWDLTAG  197

Query  467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF  646
            K++     H      ++FHP     A+GS D  +K WD+     I +    T G+ ++ F
Sbjct  198  KLLHDFKCHEGQIQCIDFHPHEFLLATGSADRTVKFWDLETFELIGSAGPETTGVRSLTF  257

Query  647  TPDGRWVV  670
            +PDGR ++
Sbjct  258  SPDGRALL  265


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/120 (28%), Positives = 57/120 (48%), Gaps = 2/120 (2%)
 Frame = +2

Query  218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD  397
            +  +  H+  VN +RF     R  ++GG+D++V LW +           H   ++ I F 
Sbjct  158  IHTYKGHTRGVNAIRFTPDG-RWVVSGGEDNTVKLWDLTAGKLLHDFKCHEGQIQCIDFH  216

Query  398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW  577
              E L+A GS+   +K WDLE  ++I +     +   +L F P G     G +  +LK++
Sbjct  217  PHEFLLATGSADRTVKFWDLETFELIGSAGPETTGVRSLTFSPDGRALLCG-LHESLKVF  275



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1064095936780