BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF051L04

Length=647
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009626256.1|  PREDICTED: histone-lysine N-methyltransferas...    328   8e-107   Nicotiana tomentosiformis
ref|XP_009626255.1|  PREDICTED: histone-lysine N-methyltransferas...    328   1e-106   Nicotiana tomentosiformis
ref|XP_009772814.1|  PREDICTED: histone-lysine N-methyltransferas...    326   7e-106   Nicotiana sylvestris
gb|KDO55675.1|  hypothetical protein CISIN_1g008853mg                   320   9e-106   Citrus sinensis [apfelsine]
gb|KDO55674.1|  hypothetical protein CISIN_1g008853mg                   321   1e-105   Citrus sinensis [apfelsine]
ref|XP_006357187.1|  PREDICTED: histone-lysine N-methyltransferas...    326   1e-105   Solanum tuberosum [potatoes]
emb|CBI40070.3|  unnamed protein product                                323   1e-105   Vitis vinifera
ref|XP_010317061.1|  PREDICTED: uncharacterized protein LOC101250184    324   3e-105   Solanum lycopersicum
ref|XP_011098840.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    323   6e-105   Sesamum indicum [beniseed]
gb|KDO55671.1|  hypothetical protein CISIN_1g008853mg                   322   6e-105   Citrus sinensis [apfelsine]
ref|XP_002264334.1|  PREDICTED: histone-lysine N-methyltransferas...    323   9e-105   Vitis vinifera
ref|XP_003633789.1|  PREDICTED: histone-lysine N-methyltransferas...    323   1e-104   Vitis vinifera
ref|XP_006373263.1|  hypothetical protein POPTR_0017s10180g             323   1e-104   Populus trichocarpa [western balsam poplar]
ref|XP_006470002.1|  PREDICTED: histone-lysine N-methyltransferas...    323   2e-104   
ref|XP_011009073.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    323   2e-104   Populus euphratica
ref|XP_006373264.1|  hypothetical protein POPTR_0017s10180g             322   2e-104   Populus trichocarpa [western balsam poplar]
ref|XP_011009075.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    322   2e-104   Populus euphratica
ref|XP_006447137.1|  hypothetical protein CICLE_v10014955mg             322   2e-104   
ref|XP_006447134.1|  hypothetical protein CICLE_v10014955mg             322   2e-104   
gb|KDO55665.1|  hypothetical protein CISIN_1g008853mg                   322   3e-104   Citrus sinensis [apfelsine]
gb|EYU44861.1|  hypothetical protein MIMGU_mgv1a004981mg                320   1e-103   Erythranthe guttata [common monkey flower]
ref|XP_010492229.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    316   6e-103   Camelina sativa [gold-of-pleasure]
gb|KJB76451.1|  hypothetical protein B456_012G089000                    313   7e-103   Gossypium raimondii
emb|CDP16667.1|  unnamed protein product                                318   1e-102   Coffea canephora [robusta coffee]
ref|XP_008348003.1|  PREDICTED: histone-lysine N-methyltransferas...    318   2e-102   Malus domestica [apple tree]
gb|KDP46324.1|  hypothetical protein JCGZ_10164                         318   2e-102   Jatropha curcas
emb|CDX85607.1|  BnaA02g02060D                                          313   2e-102   
gb|KJB76452.1|  hypothetical protein B456_012G089000                    315   3e-102   Gossypium raimondii
ref|NP_196930.2|  Rubisco methyltransferase family protein              317   3e-102   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002871610.1|  SET domain-containing protein                      317   3e-102   
ref|XP_009121680.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    317   4e-102   Brassica rapa
ref|XP_010453544.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    317   5e-102   Camelina sativa [gold-of-pleasure]
ref|XP_010492227.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    316   6e-102   Camelina sativa [gold-of-pleasure]
ref|XP_010420056.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    316   7e-102   Camelina sativa [gold-of-pleasure]
ref|XP_009370283.1|  PREDICTED: histone-lysine N-methyltransferas...    314   1e-101   Pyrus x bretschneideri [bai li]
ref|XP_006399936.1|  hypothetical protein EUTSA_v10013274mg             315   1e-101   
ref|XP_010930088.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    315   1e-101   Elaeis guineensis
gb|KJB76449.1|  hypothetical protein B456_012G089000                    315   2e-101   Gossypium raimondii
ref|XP_004303999.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    315   2e-101   Fragaria vesca subsp. vesca
gb|KJB40695.1|  hypothetical protein B456_007G073800                    311   4e-101   Gossypium raimondii
gb|AAL67009.1|  unknown protein                                         314   4e-101   Arabidopsis thaliana [mouse-ear cress]
emb|CDX91073.1|  BnaC02g05240D                                          311   4e-101   
ref|XP_009370281.1|  PREDICTED: histone-lysine N-methyltransferas...    314   5e-101   Pyrus x bretschneideri [bai li]
ref|XP_009392603.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    313   5e-101   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO55664.1|  hypothetical protein CISIN_1g008853mg                   314   7e-101   Citrus sinensis [apfelsine]
ref|XP_008807527.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    313   8e-101   Phoenix dactylifera
gb|KJB40696.1|  hypothetical protein B456_007G073800                    311   1e-100   Gossypium raimondii
ref|XP_007031777.1|  Rubisco methyltransferase family protein           312   1e-100   
ref|XP_009371683.1|  PREDICTED: histone-lysine N-methyltransferas...    313   1e-100   Pyrus x bretschneideri [bai li]
ref|XP_007216336.1|  hypothetical protein PRUPE_ppa020142mg             312   2e-100   
ref|XP_008231158.1|  PREDICTED: histone-lysine N-methyltransferas...    312   2e-100   Prunus mume [ume]
ref|XP_004145676.1|  PREDICTED: histone-lysine N-methyltransferas...    313   2e-100   
ref|XP_010111617.1|  hypothetical protein L484_017643                   312   2e-100   Morus notabilis
ref|XP_008450074.1|  PREDICTED: histone-lysine N-methyltransferas...    313   2e-100   Cucumis melo [Oriental melon]
gb|EPS58823.1|  hypothetical protein M569_15990                         307   3e-100   Genlisea aurea
ref|XP_010029028.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    312   3e-100   Eucalyptus grandis [rose gum]
gb|KJB40694.1|  hypothetical protein B456_007G073800                    311   4e-100   Gossypium raimondii
ref|XP_006852184.1|  hypothetical protein AMTR_s00049p00107230          311   6e-100   Amborella trichopoda
ref|XP_010667269.1|  PREDICTED: histone-lysine N-methyltransferas...    311   6e-100   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010250811.1|  PREDICTED: histone-lysine N-methyltransferas...    311   9e-100   Nelumbo nucifera [Indian lotus]
ref|XP_004489592.1|  PREDICTED: histone-lysine N-methyltransferas...    310   9e-100   
gb|KHG04663.1|  Histone-lysine N-methyltransferase setd3                310   1e-99    Gossypium arboreum [tree cotton]
emb|CDY57896.1|  BnaC09g54420D                                          320   2e-99    Brassica napus [oilseed rape]
ref|XP_009125968.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    309   2e-99    Brassica rapa
ref|XP_010912843.1|  PREDICTED: histone-lysine N-methyltransferas...    306   3e-99    
gb|KHG27486.1|  COP9 signalosome complex subunit 3 -like protein        320   3e-99    Gossypium arboreum [tree cotton]
gb|KHG04664.1|  Histone-lysine N-methyltransferase setd3                309   3e-99    Gossypium arboreum [tree cotton]
dbj|BAJ99196.1|  predicted protein                                      306   4e-99    Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDX69594.1|  BnaA10g19430D                                          319   4e-99    
ref|XP_008353375.1|  PREDICTED: histone-lysine N-methyltransferas...    306   5e-99    
gb|KHN18676.1|  Putative ribulose-1,5 bisphosphate carboxylase/ox...    306   6e-99    Glycine soja [wild soybean]
ref|XP_008800377.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    305   2e-98    
ref|XP_010912842.1|  PREDICTED: histone-lysine N-methyltransferas...    306   3e-98    
ref|XP_006664454.1|  PREDICTED: histone-lysine N-methyltransferas...    303   3e-98    
ref|XP_003524489.1|  PREDICTED: Fructose-bisphosphate aldolase-ly...    306   4e-98    Glycine max [soybeans]
ref|XP_003618816.1|  SET domain protein                                 306   4e-98    
dbj|BAJ87354.1|  predicted protein                                      306   4e-98    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003553868.1|  PREDICTED: histone-lysine N-methyltransferas...    306   5e-98    Glycine max [soybeans]
ref|XP_010551929.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    306   6e-98    Tarenaya hassleriana [spider flower]
ref|XP_008800375.1|  PREDICTED: [Fructose-bisphosphate aldolase]-...    305   2e-97    Phoenix dactylifera
ref|XP_008800373.1|  PREDICTED: [Fructose-bisphosphate aldolase]-...    304   3e-97    Phoenix dactylifera
emb|CAB87765.1|  putative protein                                       305   3e-97    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007151549.1|  hypothetical protein PHAVU_004G056200g             303   9e-97    Phaseolus vulgaris [French bean]
gb|EAY82695.1|  hypothetical protein OsI_37912                          302   1e-96    Oryza sativa Indica Group [Indian rice]
ref|NP_001066466.1|  Os12g0236900                                       302   2e-96    
ref|XP_003578740.1|  PREDICTED: [Fructose-bisphosphate aldolase]-...    302   2e-96    Brachypodium distachyon [annual false brome]
gb|KDO55663.1|  hypothetical protein CISIN_1g008853mg                   303   2e-96    Citrus sinensis [apfelsine]
gb|EAZ20075.1|  hypothetical protein OsJ_35675                          302   3e-96    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008341326.1|  PREDICTED: LOW QUALITY PROTEIN: histone-lysi...    299   4e-95    
gb|KJB40697.1|  hypothetical protein B456_007G073800                    298   4e-95    Gossypium raimondii
ref|XP_008656702.1|  PREDICTED: [Fructose-bisphosphate aldolase]-...    291   5e-94    
gb|AGT16868.1|  Rubisco LS methyltransferase, substrate-binding d...    295   7e-94    Saccharum hybrid cultivar R570
ref|XP_008672132.1|  PREDICTED: hypothetical protein isoform X1         294   3e-93    
ref|XP_004960721.1|  PREDICTED: ribosomal N-lysine methyltransfer...    293   8e-93    Setaria italica
ref|XP_002456030.1|  hypothetical protein SORBIDRAFT_03g029140          291   2e-92    Sorghum bicolor [broomcorn]
gb|ABK24248.1|  unknown                                                 291   4e-92    Picea sitchensis
ref|XP_001762568.1|  predicted protein                                  278   3e-88    
ref|XP_001774765.1|  predicted protein                                  278   7e-87    
gb|KDO55673.1|  hypothetical protein CISIN_1g008853mg                   268   6e-85    Citrus sinensis [apfelsine]
ref|XP_002978944.1|  hypothetical protein SELMODRAFT_110000             267   8e-84    
ref|XP_002986460.1|  hypothetical protein SELMODRAFT_269129             267   1e-83    
ref|XP_010250814.1|  PREDICTED: histone-lysine N-methyltransferas...    265   2e-82    Nelumbo nucifera [Indian lotus]
ref|XP_008800376.1|  PREDICTED: [Fructose-bisphosphate aldolase]-...    256   8e-79    
gb|KDO55670.1|  hypothetical protein CISIN_1g008853mg                   244   2e-74    Citrus sinensis [apfelsine]
ref|XP_011396833.1|  Histone-lysine N-methyltransferase setd3           221   6e-66    Auxenochlorella protothecoides
gb|KIY95099.1|  hypothetical protein MNEG_12863                         216   1e-65    Monoraphidium neglectum
ref|XP_005644855.1|  hypothetical protein COCSUDRAFT_48681              213   5e-62    Coccomyxa subellipsoidea C-169
ref|XP_005847730.1|  hypothetical protein CHLNCDRAFT_57818              200   7e-58    Chlorella variabilis
ref|NP_001132025.1|  hypothetical protein                               189   1e-55    
gb|AFW83391.1|  hypothetical protein ZEAMMB73_866859                    187   8e-55    
ref|XP_002955272.1|  hypothetical protein VOLCADRAFT_76643              192   2e-54    Volvox carteri f. nagariensis
gb|AFW83393.1|  hypothetical protein ZEAMMB73_866859                    186   3e-54    
gb|EMT26543.1|  hypothetical protein F775_31105                         155   2e-42    
gb|KDD71504.1|  hypothetical protein H632_c4901p0                       151   5e-42    Helicosporidium sp. ATCC 50920
ref|XP_002509559.1|  conserved hypothetical protein                     120   1e-28    
gb|AFW83390.1|  hypothetical protein ZEAMMB73_201403                    111   4e-27    
gb|EMT26542.1|  hypothetical protein F775_31104                         112   1e-25    
ref|XP_002320530.2|  hypothetical protein POPTR_0014s16720g           79.0    2e-13    
ref|XP_010464405.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...  78.2    3e-13    Camelina sativa [gold-of-pleasure]
ref|XP_002882542.1|  SET domain-containing protein                    77.8    3e-13    Arabidopsis lyrata subsp. lyrata
ref|XP_011008074.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...  77.8    4e-13    Populus euphratica
ref|XP_006297498.1|  hypothetical protein CARUB_v10013517mg           77.4    4e-13    
gb|KCW89047.1|  hypothetical protein EUGRSUZ_A01370                   75.9    7e-13    Eucalyptus grandis [rose gum]
ref|XP_004502116.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...  76.6    8e-13    Cicer arietinum [garbanzo]
gb|AAC14296.1|  putative methyltransferase                            76.6    9e-13    Arabidopsis thaliana [mouse-ear cress]
ref|NP_187424.1|  Rubisco methyltransferase family protein            76.6    1e-12    Arabidopsis thaliana [mouse-ear cress]
gb|AAM61650.1|  putative ribulose-1,5-bisphosphate carboxylase/ox...  76.3    1e-12    Arabidopsis thaliana [mouse-ear cress]
gb|KCW89046.1|  hypothetical protein EUGRSUZ_A01370                   75.9    1e-12    Eucalyptus grandis [rose gum]
ref|XP_010486336.1|  PREDICTED: histone-lysine N-methyltransferas...  76.3    1e-12    Camelina sativa [gold-of-pleasure]
gb|KCW89043.1|  hypothetical protein EUGRSUZ_A01370                   75.9    1e-12    Eucalyptus grandis [rose gum]
ref|XP_006407809.1|  hypothetical protein EUTSA_v10020552mg           76.3    1e-12    Eutrema salsugineum [saltwater cress]
gb|KCW89045.1|  hypothetical protein EUGRSUZ_A01370                   75.9    1e-12    Eucalyptus grandis [rose gum]
ref|XP_009124214.1|  PREDICTED: histone-lysine N-methyltransferas...  75.9    1e-12    Brassica rapa
ref|XP_010252799.1|  PREDICTED: histone-lysine N-methyltransferas...  75.5    2e-12    Nelumbo nucifera [Indian lotus]
emb|CDY22127.1|  BnaC01g39740D                                        75.5    2e-12    Brassica napus [oilseed rape]
ref|XP_010048281.1|  PREDICTED: LOW QUALITY PROTEIN: ribulose-1,5...  75.1    3e-12    Eucalyptus grandis [rose gum]
ref|XP_010524627.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...  75.1    3e-12    Tarenaya hassleriana [spider flower]
ref|XP_010456598.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...  75.1    3e-12    Camelina sativa [gold-of-pleasure]
gb|KFK38228.1|  hypothetical protein AALP_AA3G085300                  74.3    4e-12    Arabis alpina [alpine rockcress]
gb|KHN39942.1|  Ribulose-1,5 bisphosphate carboxylase/oxygenase l...  72.4    2e-11    Glycine soja [wild soybean]
emb|CBI28466.3|  unnamed protein product                              72.8    2e-11    Vitis vinifera
ref|XP_002267469.2|  PREDICTED: ribulose-1,5 bisphosphate carboxy...  72.8    2e-11    Vitis vinifera
ref|XP_007146016.1|  hypothetical protein PHAVU_006G005700g           72.4    2e-11    Phaseolus vulgaris [French bean]
ref|XP_003542190.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...  72.0    3e-11    Glycine max [soybeans]
ref|XP_010088354.1|  Ribulose-1,5 bisphosphate carboxylase/oxygen...  72.0    3e-11    
ref|XP_003601528.1|  SET domain-containing protein                    71.6    3e-11    Medicago truncatula
ref|XP_003605258.1|  SET domain-containing protein                    71.6    4e-11    
gb|EEC73918.1|  hypothetical protein OsI_08761                        70.9    8e-11    Oryza sativa Indica Group [Indian rice]
ref|XP_001754113.1|  predicted protein                                70.9    8e-11    
ref|NP_001047982.1|  Os02g0725200                                     70.5    8e-11    
ref|XP_006649004.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...  69.3    2e-10    
gb|EMS66279.1|  hypothetical protein TRIUR3_22444                     64.7    8e-10    Triticum urartu
ref|XP_001754252.1|  predicted protein                                67.4    8e-10    
ref|XP_010689224.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...  66.2    2e-09    
ref|XP_010689223.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...  66.2    2e-09    Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001140387.1|  uncharacterized protein LOC100272441             66.2    3e-09    Zea mays [maize]
ref|XP_010236007.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...  65.9    3e-09    Brachypodium distachyon [annual false brome]
emb|CBJ29688.1|  putative ribulose-1,5-bisphosphate carboxylase/o...  64.7    7e-09    Ectocarpus siliculosus
ref|XP_004953752.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...  64.7    8e-09    
ref|XP_006857756.1|  hypothetical protein AMTR_s00061p00196800        64.7    9e-09    Amborella trichopoda
gb|ACG45124.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  64.3    9e-09    Zea mays [maize]
gb|KJB22703.1|  hypothetical protein B456_004G061300                  63.5    2e-08    Gossypium raimondii
ref|XP_002185762.1|  ribulose-1,5-bisphosphate carboxylase/oxygen...  63.9    2e-08    Phaeodactylum tricornutum CCAP 1055/1
ref|XP_002454362.1|  hypothetical protein SORBIDRAFT_04g029430        63.5    2e-08    Sorghum bicolor [broomcorn]
ref|XP_005719244.1|  unnamed protein product                          62.8    3e-08    Chondrus crispus [carageen]
ref|XP_004305682.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...  62.4    5e-08    Fragaria vesca subsp. vesca
ref|XP_002974548.1|  hypothetical protein SELMODRAFT_101776           62.0    6e-08    
gb|EJK62256.1|  hypothetical protein THAOC_17139                      61.6    8e-08    Thalassiosira oceanica
ref|XP_003081307.1|  putative methyltransferase (ISS)                 61.2    1e-07    
emb|CEF99133.1|  Rubisco LS methyltransferase, substrate-binding ...  60.8    1e-07    Ostreococcus tauri
ref|XP_005705388.1|  ribulose-1,5-bisphosphate carboxylase/oxygen...  60.5    2e-07    Galdieria sulphuraria
gb|AFK46204.1|  unknown                                               59.7    2e-07    Lotus japonicus
ref|XP_002965462.1|  hypothetical protein SELMODRAFT_406852           60.1    2e-07    Selaginella moellendorffii
ref|XP_002286075.1|  rubisco small subunit small subunit n-methyl...  59.3    4e-07    Thalassiosira pseudonana CCMP1335
ref|XP_002993188.1|  hypothetical protein SELMODRAFT_449044           59.3    4e-07    
ref|XP_005718157.1|  unnamed protein product                          58.9    6e-07    Chondrus crispus [carageen]
ref|XP_002963244.1|  hypothetical protein SELMODRAFT_80789            58.5    7e-07    
ref|XP_002508524.1|  set domain protein                               57.8    1e-06    Micromonas commoda
ref|XP_001783777.1|  predicted protein                                57.0    3e-06    
gb|AFP65462.1|  putative ribulose-1,5-bisphosphate carboxylase/ox...  55.8    6e-06    Chroomonas mesostigmatica CCMP1168
gb|KIZ05290.1|  hypothetical protein MNEG_2664                        55.5    8e-06    Monoraphidium neglectum
ref|XP_001419603.1|  predicted protein                                54.7    2e-05    Ostreococcus lucimarinus CCE9901
ref|XP_007510589.1|  predicted protein                                54.7    2e-05    Bathycoccus prasinos
gb|ETS04896.1|  SET domain-containing protein                         53.5    3e-05    Trichoderma reesei RUT C-30
ref|XP_001774257.1|  predicted protein                                53.5    4e-05    
dbj|GAA97699.1|  hypothetical protein E5Q_04377                       53.1    5e-05    Mixia osmundae IAM 14324
ref|XP_009033030.1|  hypothetical protein AURANDRAFT_61181            53.1    6e-05    Aureococcus anophagefferens
ref|XP_005831105.1|  hypothetical protein GUITHDRAFT_109909           52.8    8e-05    Guillardia theta CCMP2712
ref|XP_003057276.1|  set domain protein                               51.6    1e-04    Micromonas pusilla CCMP1545
ref|XP_002988920.1|  hypothetical protein SELMODRAFT_129035           50.8    3e-04    
ref|XP_009384903.1|  PREDICTED: [Fructose-bisphosphate aldolase]-...  50.1    6e-04    Musa acuminata subsp. malaccensis [pisang utan]
gb|AAI55279.1|  SET domain containing 3                               50.1    7e-04    Danio rerio [leopard danio]
gb|KIW25341.1|  hypothetical protein PV07_08528                       49.3    0.001    Cladophialophora immunda
gb|KIH94008.1|  set domain containing protein                         49.3    0.001    Sporothrix brasiliensis 5110
gb|ERS98967.1|  hypothetical protein HMPREF1624_04162                 49.3    0.001    Sporothrix schenckii ATCC 58251
gb|EWM24078.1|  ribulose- -bisphosphate carboxylase oxygenase sma...  49.3    0.001    Nannochloropsis gaditana
gb|KGQ05489.1|  Ribulose-1,5 bisphosphate carboxylase/oxygenase l...  49.3    0.001    Beauveria bassiana D1-5



>ref|XP_009626256.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X2 
[Nicotiana tomentosiformis]
Length=480

 Score =   328 bits (840),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 163/170 (96%), Gaps = 0/170 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            V+ERAEGIKREY+ELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  185  VLERAEGIKREYNELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  244

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            SLARRFALVPLGPPLLSYCSNC+AMLAAVDGAVQLVVDR Y+ G+PIVVWCGPQPNSKLL
Sbjct  245  SLARRFALVPLGPPLLSYCSNCRAMLAAVDGAVQLVVDRSYRAGDPIVVWCGPQPNSKLL  304

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLI  510
            INYGFVDE+N YDR+ +EAALNTEDPQYQDKRLAAQRNGK SVQAF V +
Sbjct  305  INYGFVDEENSYDRLMVEAALNTEDPQYQDKRLAAQRNGKLSVQAFQVCV  354



>ref|XP_009626255.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X1 
[Nicotiana tomentosiformis]
Length=513

 Score =   328 bits (841),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 163/170 (96%), Gaps = 0/170 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            V+ERAEGIKREY+ELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  218  VLERAEGIKREYNELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  277

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            SLARRFALVPLGPPLLSYCSNC+AMLAAVDGAVQLVVDR Y+ G+PIVVWCGPQPNSKLL
Sbjct  278  SLARRFALVPLGPPLLSYCSNCRAMLAAVDGAVQLVVDRSYRAGDPIVVWCGPQPNSKLL  337

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLI  510
            INYGFVDE+N YDR+ +EAALNTEDPQYQDKRLAAQRNGK SVQAF V +
Sbjct  338  INYGFVDEENSYDRLMVEAALNTEDPQYQDKRLAAQRNGKLSVQAFQVCV  387



>ref|XP_009772814.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Nicotiana 
sylvestris]
Length=512

 Score =   326 bits (836),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 153/170 (90%), Positives = 163/170 (96%), Gaps = 0/170 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            V+ERAEGIKREY+ELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  217  VLERAEGIKREYNELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  276

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            SLARRFALVPLGPPLLSYCSNC+AMLAAV+GAVQLVVDR Y+ G+PIVVWCGPQPNSKLL
Sbjct  277  SLARRFALVPLGPPLLSYCSNCRAMLAAVNGAVQLVVDRSYRAGDPIVVWCGPQPNSKLL  336

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLI  510
            INYGFVDE+N YDR+ +EAALNTEDPQYQDKRLAAQRNGK SVQAF V +
Sbjct  337  INYGFVDEENSYDRLMVEAALNTEDPQYQDKRLAAQRNGKLSVQAFQVCV  386



>gb|KDO55675.1| hypothetical protein CISIN_1g008853mg [Citrus sinensis]
Length=348

 Score =   320 bits (821),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 151/168 (90%), Positives = 158/168 (94%), Gaps = 0/168 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            ++ERAEGIKREY+ELDTVWFMAGSLFQQYPYDIPTEAF FEIFKQAFVAVQSCVVHLQKV
Sbjct  53   ILERAEGIKREYNELDTVWFMAGSLFQQYPYDIPTEAFTFEIFKQAFVAVQSCVVHLQKV  112

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            SLARRFALVPLGPPLL+Y S CKAMLAAVD AVQLVVDRPYK GE IVVWCGPQPNSKLL
Sbjct  113  SLARRFALVPLGPPLLAYSSKCKAMLAAVDDAVQLVVDRPYKAGESIVVWCGPQPNSKLL  172

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHV  504
            INYGFVDEDNPYDR+ +EAALNTEDPQYQDKR+ AQRNGK SVQ FHV
Sbjct  173  INYGFVDEDNPYDRLVVEAALNTEDPQYQDKRMVAQRNGKLSVQVFHV  220



>gb|KDO55674.1| hypothetical protein CISIN_1g008853mg [Citrus sinensis]
Length=376

 Score =   321 bits (823),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 151/168 (90%), Positives = 158/168 (94%), Gaps = 0/168 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            ++ERAEGIKREY+ELDTVWFMAGSLFQQYPYDIPTEAF FEIFKQAFVAVQSCVVHLQKV
Sbjct  81   ILERAEGIKREYNELDTVWFMAGSLFQQYPYDIPTEAFTFEIFKQAFVAVQSCVVHLQKV  140

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            SLARRFALVPLGPPLL+Y S CKAMLAAVD AVQLVVDRPYK GE IVVWCGPQPNSKLL
Sbjct  141  SLARRFALVPLGPPLLAYSSKCKAMLAAVDDAVQLVVDRPYKAGESIVVWCGPQPNSKLL  200

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHV  504
            INYGFVDEDNPYDR+ +EAALNTEDPQYQDKR+ AQRNGK SVQ FHV
Sbjct  201  INYGFVDEDNPYDRLVVEAALNTEDPQYQDKRMVAQRNGKLSVQVFHV  248



>ref|XP_006357187.1| PREDICTED: histone-lysine N-methyltransferase setd3-like isoform 
X1 [Solanum tuberosum]
Length=511

 Score =   326 bits (835),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            V+ERAEGIKREY+ELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  216  VLERAEGIKREYNELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  275

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            SLARRFALVPLGPPLLSYCSNCKAMLAAV+GAVQLVVDR Y  G+PIVVWCGPQPNSKLL
Sbjct  276  SLARRFALVPLGPPLLSYCSNCKAMLAAVNGAVQLVVDRSYSVGDPIVVWCGPQPNSKLL  335

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLI  510
            INYGFVDE+N YDR+ +EAALNTEDPQYQDKRLAAQRNGK SVQAF V +
Sbjct  336  INYGFVDEENSYDRLMVEAALNTEDPQYQDKRLAAQRNGKLSVQAFQVCV  385



>emb|CBI40070.3| unnamed protein product [Vitis vinifera]
Length=428

 Score =   323 bits (827),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 150/170 (88%), Positives = 161/170 (95%), Gaps = 0/170 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            V+ERAEGIKREY+ELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVA+QSCVVHLQKV
Sbjct  133  VLERAEGIKREYNELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAIQSCVVHLQKV  192

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            SLARRFALVPLGPPLL+Y SNCKAMLAAVDG+VQLVVDRPYK GE IVVWCGPQPNSKLL
Sbjct  193  SLARRFALVPLGPPLLAYRSNCKAMLAAVDGSVQLVVDRPYKAGESIVVWCGPQPNSKLL  252

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLI  510
            +NYGFVDEDN YDR+ +EAALNTEDPQYQDKR+ AQRNGK +VQ FHV +
Sbjct  253  LNYGFVDEDNSYDRIVVEAALNTEDPQYQDKRMVAQRNGKLTVQKFHVSV  302



>ref|XP_010317061.1| PREDICTED: uncharacterized protein LOC101250184 [Solanum lycopersicum]
 ref|XP_010317062.1| PREDICTED: uncharacterized protein LOC101250184 [Solanum lycopersicum]
 ref|XP_010317063.1| PREDICTED: uncharacterized protein LOC101250184 [Solanum lycopersicum]
Length=511

 Score =   324 bits (831),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 153/170 (90%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            V+ERAEGIKREY+ELDTVWFMAGSLFQQYPY+IPTEAFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  216  VLERAEGIKREYNELDTVWFMAGSLFQQYPYEIPTEAFPFEIFKQAFVAVQSCVVHLQKV  275

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDR Y  G+PIVVWCGPQPNSKLL
Sbjct  276  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRSYSAGDPIVVWCGPQPNSKLL  335

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLI  510
            INYGFVDE+N +DR+ +EAALNTEDPQYQDKRLAAQRNGK SVQAF V +
Sbjct  336  INYGFVDEENSHDRLMVEAALNTEDPQYQDKRLAAQRNGKLSVQAFQVCV  385



>ref|XP_011098840.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Sesamum indicum]
Length=501

 Score =   323 bits (829),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 152/170 (89%), Positives = 161/170 (95%), Gaps = 0/170 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            V+ERAEGIKREY+ELDTVWFMAGSLF+QYPYDIPTEAFPF+IFKQAFVAVQSCVVHLQKV
Sbjct  206  VLERAEGIKREYNELDTVWFMAGSLFEQYPYDIPTEAFPFKIFKQAFVAVQSCVVHLQKV  265

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            SLARRFALVPLGPPLLSY SNCKAML AVDG VQLVVDRPYK GEPIVVWCGPQPNSKLL
Sbjct  266  SLARRFALVPLGPPLLSYRSNCKAMLTAVDGTVQLVVDRPYKAGEPIVVWCGPQPNSKLL  325

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLI  510
            INYGFVDE+N YDR+ +EA+LNTEDPQYQDKRLAAQRNGK SVQAF V +
Sbjct  326  INYGFVDEENSYDRMVVEASLNTEDPQYQDKRLAAQRNGKLSVQAFQVFV  375



>gb|KDO55671.1| hypothetical protein CISIN_1g008853mg [Citrus sinensis]
 gb|KDO55672.1| hypothetical protein CISIN_1g008853mg [Citrus sinensis]
Length=467

 Score =   322 bits (826),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 151/168 (90%), Positives = 158/168 (94%), Gaps = 0/168 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            ++ERAEGIKREY+ELDTVWFMAGSLFQQYPYDIPTEAF FEIFKQAFVAVQSCVVHLQKV
Sbjct  217  ILERAEGIKREYNELDTVWFMAGSLFQQYPYDIPTEAFTFEIFKQAFVAVQSCVVHLQKV  276

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            SLARRFALVPLGPPLL+Y S CKAMLAAVD AVQLVVDRPYK GE IVVWCGPQPNSKLL
Sbjct  277  SLARRFALVPLGPPLLAYSSKCKAMLAAVDDAVQLVVDRPYKAGESIVVWCGPQPNSKLL  336

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHV  504
            INYGFVDEDNPYDR+ +EAALNTEDPQYQDKR+ AQRNGK SVQ FHV
Sbjct  337  INYGFVDEDNPYDRLVVEAALNTEDPQYQDKRMVAQRNGKLSVQVFHV  384



>ref|XP_002264334.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X2 
[Vitis vinifera]
Length=509

 Score =   323 bits (828),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 150/170 (88%), Positives = 161/170 (95%), Gaps = 0/170 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            V+ERAEGIKREY+ELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVA+QSCVVHLQKV
Sbjct  214  VLERAEGIKREYNELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAIQSCVVHLQKV  273

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            SLARRFALVPLGPPLL+Y SNCKAMLAAVDG+VQLVVDRPYK GE IVVWCGPQPNSKLL
Sbjct  274  SLARRFALVPLGPPLLAYRSNCKAMLAAVDGSVQLVVDRPYKAGESIVVWCGPQPNSKLL  333

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLI  510
            +NYGFVDEDN YDR+ +EAALNTEDPQYQDKR+ AQRNGK +VQ FHV +
Sbjct  334  LNYGFVDEDNSYDRIVVEAALNTEDPQYQDKRMVAQRNGKLTVQKFHVSV  383



>ref|XP_003633789.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X1 
[Vitis vinifera]
Length=515

 Score =   323 bits (828),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 150/170 (88%), Positives = 161/170 (95%), Gaps = 0/170 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            V+ERAEGIKREY+ELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVA+QSCVVHLQKV
Sbjct  220  VLERAEGIKREYNELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAIQSCVVHLQKV  279

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            SLARRFALVPLGPPLL+Y SNCKAMLAAVDG+VQLVVDRPYK GE IVVWCGPQPNSKLL
Sbjct  280  SLARRFALVPLGPPLLAYRSNCKAMLAAVDGSVQLVVDRPYKAGESIVVWCGPQPNSKLL  339

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLI  510
            +NYGFVDEDN YDR+ +EAALNTEDPQYQDKR+ AQRNGK +VQ FHV +
Sbjct  340  LNYGFVDEDNSYDRIVVEAALNTEDPQYQDKRMVAQRNGKLTVQKFHVSV  389



>ref|XP_006373263.1| hypothetical protein POPTR_0017s10180g [Populus trichocarpa]
 gb|ERP51060.1| hypothetical protein POPTR_0017s10180g [Populus trichocarpa]
Length=502

 Score =   323 bits (827),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 149/168 (89%), Positives = 159/168 (95%), Gaps = 0/168 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            V++RA+GIKREY ELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVA+QSCVVHLQKV
Sbjct  207  VLDRADGIKREYEELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAIQSCVVHLQKV  266

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            SLARRFALVPLGPPLL+Y SNCKAML AVDGAV+LVVDRPYK GEPIVVWCGPQPNSKLL
Sbjct  267  SLARRFALVPLGPPLLAYSSNCKAMLTAVDGAVELVVDRPYKAGEPIVVWCGPQPNSKLL  326

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHV  504
            +NYGFVDEDNPYDR+ +EAALNTEDPQYQDKR+ AQRNGK SVQ F V
Sbjct  327  LNYGFVDEDNPYDRIAVEAALNTEDPQYQDKRMVAQRNGKLSVQVFQV  374



>ref|XP_006470002.1| PREDICTED: histone-lysine N-methyltransferase setd3-like isoform 
X2 [Citrus sinensis]
Length=505

 Score =   323 bits (827),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 151/168 (90%), Positives = 158/168 (94%), Gaps = 0/168 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            ++ERAEGIKREY+ELDTVWFMAGSLFQQYPYDIPTEAF FEIFKQAFVAVQSCVVHLQKV
Sbjct  217  ILERAEGIKREYNELDTVWFMAGSLFQQYPYDIPTEAFTFEIFKQAFVAVQSCVVHLQKV  276

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            SLARRFALVPLGPPLL+Y S CKAMLAAVD AVQLVVDRPYK GE IVVWCGPQPNSKLL
Sbjct  277  SLARRFALVPLGPPLLAYSSKCKAMLAAVDDAVQLVVDRPYKAGESIVVWCGPQPNSKLL  336

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHV  504
            INYGFVDEDNPYDR+ +EAALNTEDPQYQDKR+ AQRNGK SVQ FHV
Sbjct  337  INYGFVDEDNPYDRLVVEAALNTEDPQYQDKRMVAQRNGKLSVQVFHV  384



>ref|XP_011009073.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic isoform X1 [Populus 
euphratica]
 ref|XP_011009074.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic isoform X1 [Populus 
euphratica]
Length=505

 Score =   323 bits (827),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 149/168 (89%), Positives = 159/168 (95%), Gaps = 0/168 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            V++RA+GIKREY ELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVA+QSCVVHLQKV
Sbjct  207  VLDRADGIKREYEELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAIQSCVVHLQKV  266

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            SLARRFALVPLGPPLL+Y SNCKAML AVDGAV+LVVDRPYK GEPIVVWCGPQPNSKLL
Sbjct  267  SLARRFALVPLGPPLLAYSSNCKAMLTAVDGAVELVVDRPYKAGEPIVVWCGPQPNSKLL  326

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHV  504
            +NYGFVDEDNPYDR+ +EAALNTEDPQYQDKR+ AQRNGK SVQ F V
Sbjct  327  LNYGFVDEDNPYDRIAVEAALNTEDPQYQDKRMVAQRNGKLSVQVFQV  374



>ref|XP_006373264.1| hypothetical protein POPTR_0017s10180g [Populus trichocarpa]
 gb|ERP51061.1| hypothetical protein POPTR_0017s10180g [Populus trichocarpa]
Length=505

 Score =   322 bits (826),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 149/168 (89%), Positives = 159/168 (95%), Gaps = 0/168 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            V++RA+GIKREY ELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVA+QSCVVHLQKV
Sbjct  207  VLDRADGIKREYEELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAIQSCVVHLQKV  266

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            SLARRFALVPLGPPLL+Y SNCKAML AVDGAV+LVVDRPYK GEPIVVWCGPQPNSKLL
Sbjct  267  SLARRFALVPLGPPLLAYSSNCKAMLTAVDGAVELVVDRPYKAGEPIVVWCGPQPNSKLL  326

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHV  504
            +NYGFVDEDNPYDR+ +EAALNTEDPQYQDKR+ AQRNGK SVQ F V
Sbjct  327  LNYGFVDEDNPYDRIAVEAALNTEDPQYQDKRMVAQRNGKLSVQVFQV  374



>ref|XP_011009075.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic isoform X2 [Populus 
euphratica]
Length=502

 Score =   322 bits (826),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 149/168 (89%), Positives = 159/168 (95%), Gaps = 0/168 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            V++RA+GIKREY ELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVA+QSCVVHLQKV
Sbjct  207  VLDRADGIKREYEELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAIQSCVVHLQKV  266

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            SLARRFALVPLGPPLL+Y SNCKAML AVDGAV+LVVDRPYK GEPIVVWCGPQPNSKLL
Sbjct  267  SLARRFALVPLGPPLLAYSSNCKAMLTAVDGAVELVVDRPYKAGEPIVVWCGPQPNSKLL  326

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHV  504
            +NYGFVDEDNPYDR+ +EAALNTEDPQYQDKR+ AQRNGK SVQ F V
Sbjct  327  LNYGFVDEDNPYDRIAVEAALNTEDPQYQDKRMVAQRNGKLSVQVFQV  374



>ref|XP_006447137.1| hypothetical protein CICLE_v10014955mg [Citrus clementina]
 gb|ESR60377.1| hypothetical protein CICLE_v10014955mg [Citrus clementina]
Length=484

 Score =   322 bits (824),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 151/168 (90%), Positives = 158/168 (94%), Gaps = 0/168 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            ++ERAEGIKREY+ELDTVWFMAGSLFQQYPYDIPTEAF FEIFKQAFVAVQSCVVHLQKV
Sbjct  217  ILERAEGIKREYNELDTVWFMAGSLFQQYPYDIPTEAFTFEIFKQAFVAVQSCVVHLQKV  276

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            SLARRFALVPLGPPLL+Y S CKAMLAAVD AVQLVVDRPYK GE IVVWCGPQPNSKLL
Sbjct  277  SLARRFALVPLGPPLLAYSSKCKAMLAAVDDAVQLVVDRPYKAGESIVVWCGPQPNSKLL  336

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHV  504
            INYGFVDEDNPYDR+ +EAALNTEDPQYQDKR+ AQRNGK SVQ FHV
Sbjct  337  INYGFVDEDNPYDRLVVEAALNTEDPQYQDKRMVAQRNGKLSVQVFHV  384



>ref|XP_006447134.1| hypothetical protein CICLE_v10014955mg [Citrus clementina]
 ref|XP_006447135.1| hypothetical protein CICLE_v10014955mg [Citrus clementina]
 ref|XP_006447136.1| hypothetical protein CICLE_v10014955mg [Citrus clementina]
 ref|XP_006470001.1| PREDICTED: histone-lysine N-methyltransferase setd3-like isoform 
X1 [Citrus sinensis]
 gb|ESR60374.1| hypothetical protein CICLE_v10014955mg [Citrus clementina]
 gb|ESR60375.1| hypothetical protein CICLE_v10014955mg [Citrus clementina]
 gb|ESR60376.1| hypothetical protein CICLE_v10014955mg [Citrus clementina]
Length=512

 Score =   322 bits (826),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 151/168 (90%), Positives = 158/168 (94%), Gaps = 0/168 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            ++ERAEGIKREY+ELDTVWFMAGSLFQQYPYDIPTEAF FEIFKQAFVAVQSCVVHLQKV
Sbjct  217  ILERAEGIKREYNELDTVWFMAGSLFQQYPYDIPTEAFTFEIFKQAFVAVQSCVVHLQKV  276

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            SLARRFALVPLGPPLL+Y S CKAMLAAVD AVQLVVDRPYK GE IVVWCGPQPNSKLL
Sbjct  277  SLARRFALVPLGPPLLAYSSKCKAMLAAVDDAVQLVVDRPYKAGESIVVWCGPQPNSKLL  336

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHV  504
            INYGFVDEDNPYDR+ +EAALNTEDPQYQDKR+ AQRNGK SVQ FHV
Sbjct  337  INYGFVDEDNPYDRLVVEAALNTEDPQYQDKRMVAQRNGKLSVQVFHV  384



>gb|KDO55665.1| hypothetical protein CISIN_1g008853mg [Citrus sinensis]
 gb|KDO55666.1| hypothetical protein CISIN_1g008853mg [Citrus sinensis]
 gb|KDO55667.1| hypothetical protein CISIN_1g008853mg [Citrus sinensis]
 gb|KDO55668.1| hypothetical protein CISIN_1g008853mg [Citrus sinensis]
 gb|KDO55669.1| hypothetical protein CISIN_1g008853mg [Citrus sinensis]
Length=512

 Score =   322 bits (825),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 151/168 (90%), Positives = 158/168 (94%), Gaps = 0/168 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            ++ERAEGIKREY+ELDTVWFMAGSLFQQYPYDIPTEAF FEIFKQAFVAVQSCVVHLQKV
Sbjct  217  ILERAEGIKREYNELDTVWFMAGSLFQQYPYDIPTEAFTFEIFKQAFVAVQSCVVHLQKV  276

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            SLARRFALVPLGPPLL+Y S CKAMLAAVD AVQLVVDRPYK GE IVVWCGPQPNSKLL
Sbjct  277  SLARRFALVPLGPPLLAYSSKCKAMLAAVDDAVQLVVDRPYKAGESIVVWCGPQPNSKLL  336

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHV  504
            INYGFVDEDNPYDR+ +EAALNTEDPQYQDKR+ AQRNGK SVQ FHV
Sbjct  337  INYGFVDEDNPYDRLVVEAALNTEDPQYQDKRMVAQRNGKLSVQVFHV  384



>gb|EYU44861.1| hypothetical protein MIMGU_mgv1a004981mg [Erythranthe guttata]
 gb|EYU44862.1| hypothetical protein MIMGU_mgv1a004981mg [Erythranthe guttata]
Length=502

 Score =   320 bits (820),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 149/170 (88%), Positives = 160/170 (94%), Gaps = 0/170 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            V ER+EGIKREY+ELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  207  VFERSEGIKREYNELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  266

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            SLARRFALVPLGPPLLSY SNCKAML AVDGAVQLV+DRPYK G+PIVVWCGPQPNSKLL
Sbjct  267  SLARRFALVPLGPPLLSYRSNCKAMLTAVDGAVQLVIDRPYKAGDPIVVWCGPQPNSKLL  326

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLI  510
            INYGFVDEDN YDR+ +EA+LNTEDPQYQ+KRLAAQRN K SVQ F +++
Sbjct  327  INYGFVDEDNSYDRLVVEASLNTEDPQYQNKRLAAQRNAKLSVQTFQIVV  376



>ref|XP_010492229.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like [Camelina 
sativa]
Length=432

 Score =   316 bits (810),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 145/170 (85%), Positives = 158/170 (93%), Gaps = 0/170 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            V+ERAEGIKREY+ELDTVWFMAGSLFQQYP+DIPTEAF FEIFKQAFVA+QSCVVHLQ V
Sbjct  222  VLERAEGIKREYNELDTVWFMAGSLFQQYPFDIPTEAFSFEIFKQAFVAIQSCVVHLQNV  281

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
             LARRFALVPLGPPLL+YCSNCKAML AVDGAV+LVVDRPYK G+PIVVWCGPQPN+KLL
Sbjct  282  GLARRFALVPLGPPLLAYCSNCKAMLTAVDGAVELVVDRPYKAGDPIVVWCGPQPNAKLL  341

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLI  510
            +NYGFVDEDNPYDR+ +EAALNTEDPQYQDKR+ AQRNGK S Q F V +
Sbjct  342  LNYGFVDEDNPYDRIIVEAALNTEDPQYQDKRMVAQRNGKLSQQIFQVRV  391



>gb|KJB76451.1| hypothetical protein B456_012G089000 [Gossypium raimondii]
Length=348

 Score =   313 bits (802),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 149/168 (89%), Positives = 158/168 (94%), Gaps = 0/168 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            ++ERAEGIKREY+ELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  53   ILERAEGIKREYNELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  112

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
             LARRFALVPLGPPLL+Y SNCKAML+AV GAV+LVVDRPYK GEPIVVWCGPQPNSKLL
Sbjct  113  PLARRFALVPLGPPLLAYRSNCKAMLSAVAGAVELVVDRPYKAGEPIVVWCGPQPNSKLL  172

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHV  504
            INYGFVD+DN YDR+ +EAALNTEDPQYQDKRL  QRNGK SVQAF V
Sbjct  173  INYGFVDDDNSYDRLVVEAALNTEDPQYQDKRLVVQRNGKLSVQAFPV  220



>emb|CDP16667.1| unnamed protein product [Coffea canephora]
Length=512

 Score =   318 bits (814),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 150/168 (89%), Positives = 157/168 (93%), Gaps = 0/168 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            ++ERAEGIKREY+ELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  217  LLERAEGIKREYNELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  276

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            SLARRFALVPLGPPLLSY SNCKAML AVD AVQL VDRPY+ G PIVVWCGPQPNSKLL
Sbjct  277  SLARRFALVPLGPPLLSYRSNCKAMLTAVDDAVQLAVDRPYEAGHPIVVWCGPQPNSKLL  336

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHV  504
            INYGFVDEDN YDR+ +EAALN EDPQYQDKRLAAQRNGK S+Q FHV
Sbjct  337  INYGFVDEDNAYDRLVVEAALNIEDPQYQDKRLAAQRNGKLSLQTFHV  384



>ref|XP_008348003.1| PREDICTED: histone-lysine N-methyltransferase setd3-like [Malus 
domestica]
Length=516

 Score =   318 bits (814),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 151/178 (85%), Positives = 160/178 (90%), Gaps = 0/178 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            V  RAEGIKREY+ELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  221  VRARAEGIKREYNELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  280

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            SLA+RFALVPLGPPLL+Y SNC+AML AVDGAVQLVVDRPYK GE IVVWCGPQPNSKLL
Sbjct  281  SLAQRFALVPLGPPLLAYGSNCRAMLTAVDGAVQLVVDRPYKAGESIVVWCGPQPNSKLL  340

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLICSLFHLIF  534
            INYGFVDEDNPYDR+ +EAALNTEDPQYQDKR+ AQRNGK SVQ F V +      +F
Sbjct  341  INYGFVDEDNPYDRLVVEAALNTEDPQYQDKRMVAQRNGKLSVQTFQVYVGKEKETVF  398



>gb|KDP46324.1| hypothetical protein JCGZ_10164 [Jatropha curcas]
Length=515

 Score =   318 bits (814),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 146/170 (86%), Positives = 158/170 (93%), Gaps = 0/170 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            ++ERA+GI+REY ELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVA+QSCVVHLQKV
Sbjct  220  ILERADGIRREYDELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAIQSCVVHLQKV  279

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            SLARRFALVPLGPPLL+Y SNCKAML AVDGAV+LVVD PYK GEPI VWCGPQPNSKLL
Sbjct  280  SLARRFALVPLGPPLLAYKSNCKAMLIAVDGAVELVVDCPYKAGEPIAVWCGPQPNSKLL  339

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLI  510
            INYGFVDEDNPYDR+ +EAALNTEDPQYQDKR+ AQRNGK SVQ F + +
Sbjct  340  INYGFVDEDNPYDRIVVEAALNTEDPQYQDKRMVAQRNGKLSVQVFQICV  389



>emb|CDX85607.1| BnaA02g02060D [Brassica napus]
Length=371

 Score =   313 bits (801),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 144/170 (85%), Positives = 157/170 (92%), Gaps = 0/170 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            V+ERAEGIKREYSELDTVWFMAGSLFQQYP+DIPTEAF FEIFKQAFVA+QSCVVHLQ V
Sbjct  198  VLERAEGIKREYSELDTVWFMAGSLFQQYPFDIPTEAFSFEIFKQAFVAIQSCVVHLQNV  257

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            SLARRFALVPLGPPLL+YCSNCKAML AVDGAV+LVVDR YK G+PIV WCGPQPN+KLL
Sbjct  258  SLARRFALVPLGPPLLAYCSNCKAMLTAVDGAVELVVDRAYKAGDPIVAWCGPQPNAKLL  317

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLI  510
            +NYGFVDEDNPYDR+ +EAAL+T+DPQYQDKRL AQRNGK S Q F V +
Sbjct  318  LNYGFVDEDNPYDRIIVEAALSTDDPQYQDKRLVAQRNGKLSQQVFQVRV  367



>gb|KJB76452.1| hypothetical protein B456_012G089000 [Gossypium raimondii]
Length=460

 Score =   315 bits (808),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 149/168 (89%), Positives = 158/168 (94%), Gaps = 0/168 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            ++ERAEGIKREY+ELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  202  ILERAEGIKREYNELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  261

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
             LARRFALVPLGPPLL+Y SNCKAML+AV GAV+LVVDRPYK GEPIVVWCGPQPNSKLL
Sbjct  262  PLARRFALVPLGPPLLAYRSNCKAMLSAVAGAVELVVDRPYKAGEPIVVWCGPQPNSKLL  321

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHV  504
            INYGFVD+DN YDR+ +EAALNTEDPQYQDKRL  QRNGK SVQAF V
Sbjct  322  INYGFVDDDNSYDRLVVEAALNTEDPQYQDKRLVVQRNGKLSVQAFPV  369



>ref|NP_196930.2| Rubisco methyltransferase family protein [Arabidopsis thaliana]
 ref|NP_851038.1| Rubisco methyltransferase family protein [Arabidopsis thaliana]
 ref|NP_974778.1| Rubisco methyltransferase family protein [Arabidopsis thaliana]
 gb|AAL38260.1| putative protein [Arabidopsis thaliana]
 gb|AAN13005.1| unknown protein [Arabidopsis thaliana]
 gb|AED92007.1| Rubisco methyltransferase family protein [Arabidopsis thaliana]
 gb|AED92008.1| Rubisco methyltransferase family protein [Arabidopsis thaliana]
 gb|AED92009.1| Rubisco methyltransferase family protein [Arabidopsis thaliana]
Length=514

 Score =   317 bits (812),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 146/170 (86%), Positives = 158/170 (93%), Gaps = 0/170 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            V+ERAEGIKREY+ELDTVWFMAGSLFQQYP+DIPTEAF FEIFKQAFVA+QSCVVHLQ V
Sbjct  219  VLERAEGIKREYNELDTVWFMAGSLFQQYPFDIPTEAFSFEIFKQAFVAIQSCVVHLQNV  278

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
             LARRFALVPLGPPLL+YCSNCKAML AVDGAV+LVVDRPYK G+PIVVWCGPQPN+KLL
Sbjct  279  GLARRFALVPLGPPLLAYCSNCKAMLTAVDGAVELVVDRPYKAGDPIVVWCGPQPNAKLL  338

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLI  510
            +NYGFVDEDNPYDRV +EAALNTEDPQYQDKR+ AQRNGK S Q F V +
Sbjct  339  LNYGFVDEDNPYDRVIVEAALNTEDPQYQDKRMVAQRNGKLSQQVFQVRV  388



>ref|XP_002871610.1| SET domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47869.1| SET domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=516

 Score =   317 bits (812),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 145/170 (85%), Positives = 158/170 (93%), Gaps = 0/170 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            V+ERAEGIKREY+ELDTVWFMAGSLFQQYP+DIPTEAF FEIFKQAFVA+QSCVVHLQ V
Sbjct  221  VLERAEGIKREYNELDTVWFMAGSLFQQYPFDIPTEAFSFEIFKQAFVAIQSCVVHLQNV  280

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
             LARRFALVPLGPPLL+YCSNCKAML AVDGAV+LVVDRPYK G+PIVVWCGPQPN+KLL
Sbjct  281  GLARRFALVPLGPPLLAYCSNCKAMLTAVDGAVELVVDRPYKAGDPIVVWCGPQPNAKLL  340

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLI  510
            +NYGFVDEDNPYDR+ +EAALNTEDPQYQDKR+ AQRNGK S Q F V +
Sbjct  341  LNYGFVDEDNPYDRIIVEAALNTEDPQYQDKRMVAQRNGKLSQQVFQVRV  390



>ref|XP_009121680.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Brassica rapa]
Length=516

 Score =   317 bits (811),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 146/170 (86%), Positives = 158/170 (93%), Gaps = 0/170 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            V+ERAEGIKREYSELDTVWFMAGSLFQQYP+DIPTEAF FEIFKQAF AVQSCVVHLQ V
Sbjct  221  VLERAEGIKREYSELDTVWFMAGSLFQQYPFDIPTEAFTFEIFKQAFAAVQSCVVHLQNV  280

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            SLARRFALVPLGPPLL+YCSNCKAML AVDGAVQLVVDRPYK G+PIVVWCGPQPN+KLL
Sbjct  281  SLARRFALVPLGPPLLAYCSNCKAMLTAVDGAVQLVVDRPYKAGDPIVVWCGPQPNAKLL  340

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLI  510
            +NYGF+DEDNPYDR+ +EAAL+T+DPQYQDKRL AQRNGK S Q F V +
Sbjct  341  LNYGFIDEDNPYDRIIVEAALSTDDPQYQDKRLVAQRNGKLSQQVFQVRV  390



>ref|XP_010453544.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Camelina sativa]
 ref|XP_010453545.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Camelina sativa]
Length=517

 Score =   317 bits (811),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 145/170 (85%), Positives = 158/170 (93%), Gaps = 0/170 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            V+ERAEGIKREY+ELDTVWFMAGSLFQQYP+DIPTEAF FEIFKQAFVA+QSCVVHLQ V
Sbjct  222  VLERAEGIKREYNELDTVWFMAGSLFQQYPFDIPTEAFSFEIFKQAFVAIQSCVVHLQNV  281

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
             LARRFALVPLGPPLL+YCSNCKAML AVDGAV+LVVDRPYK G+PIVVWCGPQPN+KLL
Sbjct  282  GLARRFALVPLGPPLLAYCSNCKAMLTAVDGAVELVVDRPYKAGDPIVVWCGPQPNAKLL  341

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLI  510
            +NYGFVDEDNPYDR+ +EAALNTEDPQYQDKR+ AQRNGK S Q F V +
Sbjct  342  LNYGFVDEDNPYDRIIVEAALNTEDPQYQDKRMVAQRNGKLSQQIFQVRV  391



>ref|XP_010492227.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like [Camelina 
sativa]
Length=517

 Score =   316 bits (810),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 145/170 (85%), Positives = 158/170 (93%), Gaps = 0/170 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            V+ERAEGIKREY+ELDTVWFMAGSLFQQYP+DIPTEAF FEIFKQAFVA+QSCVVHLQ V
Sbjct  222  VLERAEGIKREYNELDTVWFMAGSLFQQYPFDIPTEAFSFEIFKQAFVAIQSCVVHLQNV  281

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
             LARRFALVPLGPPLL+YCSNCKAML AVDGAV+LVVDRPYK G+PIVVWCGPQPN+KLL
Sbjct  282  GLARRFALVPLGPPLLAYCSNCKAMLTAVDGAVELVVDRPYKAGDPIVVWCGPQPNAKLL  341

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLI  510
            +NYGFVDEDNPYDR+ +EAALNTEDPQYQDKR+ AQRNGK S Q F V +
Sbjct  342  LNYGFVDEDNPYDRIIVEAALNTEDPQYQDKRMVAQRNGKLSQQIFQVRV  391



>ref|XP_010420056.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like [Camelina 
sativa]
 ref|XP_010420057.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like [Camelina 
sativa]
Length=517

 Score =   316 bits (810),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 145/170 (85%), Positives = 158/170 (93%), Gaps = 0/170 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            V+ERAEGIKREY+ELDTVWFMAGSLFQQYP+DIPTEAF FEIFKQAFVA+QSCVVHLQ V
Sbjct  222  VLERAEGIKREYNELDTVWFMAGSLFQQYPFDIPTEAFSFEIFKQAFVAIQSCVVHLQNV  281

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
             LARRFALVPLGPPLL+YCSNCKAML AVDGAV+LVVDRPYK G+PIVVWCGPQPN+KLL
Sbjct  282  GLARRFALVPLGPPLLAYCSNCKAMLTAVDGAVELVVDRPYKAGDPIVVWCGPQPNAKLL  341

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLI  510
            +NYGFVDEDNPYDR+ +EAALNTEDPQYQDKR+ AQRNGK S Q F V +
Sbjct  342  LNYGFVDEDNPYDRIIVEAALNTEDPQYQDKRMVAQRNGKLSQQIFQVRV  391



>ref|XP_009370283.1| PREDICTED: histone-lysine N-methyltransferase setd3-like isoform 
X2 [Pyrus x bretschneideri]
Length=466

 Score =   314 bits (804),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 147/175 (84%), Positives = 157/175 (90%), Gaps = 0/175 (0%)
 Frame = +1

Query  10   RAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLA  189
            RAEGIKREY+ELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLA
Sbjct  224  RAEGIKREYNELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLA  283

Query  190  RRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLLINY  369
            +RFALVPLGPPLL+Y SNC+AML A+DGAVQLVVDRPYK GE I VWCGPQPNSKLLINY
Sbjct  284  QRFALVPLGPPLLAYGSNCRAMLTAIDGAVQLVVDRPYKAGESIAVWCGPQPNSKLLINY  343

Query  370  GFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLICSLFHLIF  534
            GFVDEDN YDR+ +EAALNTEDPQYQDKR+ AQRNGK SVQ F V +      +F
Sbjct  344  GFVDEDNSYDRLVVEAALNTEDPQYQDKRMVAQRNGKLSVQTFQVYVGKEKETVF  398



>ref|XP_006399936.1| hypothetical protein EUTSA_v10013274mg [Eutrema salsugineum]
 ref|XP_006399937.1| hypothetical protein EUTSA_v10013274mg [Eutrema salsugineum]
 gb|ESQ41389.1| hypothetical protein EUTSA_v10013274mg [Eutrema salsugineum]
 gb|ESQ41390.1| hypothetical protein EUTSA_v10013274mg [Eutrema salsugineum]
Length=516

 Score =   315 bits (808),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 144/170 (85%), Positives = 158/170 (93%), Gaps = 0/170 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            V+ERAEGI+REY ELDTVWFMAGSLFQQYPYDIPTEAF FEIFKQAFVA+QSCVVHLQ V
Sbjct  221  VLERAEGIRREYKELDTVWFMAGSLFQQYPYDIPTEAFTFEIFKQAFVAIQSCVVHLQNV  280

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            SLARRFALVPLGPPLL+YCSNCKAML AVDGAV+LVVDRPYK G+PIV WCGPQPN+KLL
Sbjct  281  SLARRFALVPLGPPLLAYCSNCKAMLTAVDGAVELVVDRPYKAGDPIVAWCGPQPNAKLL  340

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLI  510
            +NYGFVDEDNPYDR+T+EAAL+T+DPQYQDKR+ AQRNGK S Q F V +
Sbjct  341  LNYGFVDEDNPYDRITVEAALSTQDPQYQDKRMVAQRNGKLSQQVFQVRV  390



>ref|XP_010930088.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like [Elaeis 
guineensis]
 ref|XP_010930089.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like [Elaeis 
guineensis]
Length=512

 Score =   315 bits (807),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 146/170 (86%), Positives = 159/170 (94%), Gaps = 0/170 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            V+ER EGIKREY+ELDTVWFMAGSLFQQYP+DIPTEAFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  217  VLERDEGIKREYNELDTVWFMAGSLFQQYPFDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  276

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            SLARRFALVPLGPPLL+Y SNCKAML AV  AVQLVVDRPYK GEPIVVWCGPQPNS+LL
Sbjct  277  SLARRFALVPLGPPLLAYKSNCKAMLTAVSDAVQLVVDRPYKAGEPIVVWCGPQPNSRLL  336

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLI  510
            +NYGFVDEDNPYDR+ +EA+LNTEDPQYQ+KR+ AQRNGK +VQ FHV +
Sbjct  337  LNYGFVDEDNPYDRIVVEASLNTEDPQYQEKRMVAQRNGKLAVQVFHVYV  386



>gb|KJB76449.1| hypothetical protein B456_012G089000 [Gossypium raimondii]
 gb|KJB76450.1| hypothetical protein B456_012G089000 [Gossypium raimondii]
 gb|KJB76453.1| hypothetical protein B456_012G089000 [Gossypium raimondii]
 gb|KJB76454.1| hypothetical protein B456_012G089000 [Gossypium raimondii]
Length=497

 Score =   315 bits (806),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 149/168 (89%), Positives = 158/168 (94%), Gaps = 0/168 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            ++ERAEGIKREY+ELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  202  ILERAEGIKREYNELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  261

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
             LARRFALVPLGPPLL+Y SNCKAML+AV GAV+LVVDRPYK GEPIVVWCGPQPNSKLL
Sbjct  262  PLARRFALVPLGPPLLAYRSNCKAMLSAVAGAVELVVDRPYKAGEPIVVWCGPQPNSKLL  321

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHV  504
            INYGFVD+DN YDR+ +EAALNTEDPQYQDKRL  QRNGK SVQAF V
Sbjct  322  INYGFVDDDNSYDRLVVEAALNTEDPQYQDKRLVVQRNGKLSVQAFPV  369



>ref|XP_004303999.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Fragaria vesca 
subsp. vesca]
Length=505

 Score =   315 bits (806),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 149/170 (88%), Positives = 156/170 (92%), Gaps = 0/170 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            V ERAEGIKREY+ELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  210  VHERAEGIKREYNELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  269

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            SLA+RFALVPLGPPLL+Y S CKAML A D AVQLVVDRPYK GE I VWCGPQPNSKLL
Sbjct  270  SLAQRFALVPLGPPLLAYGSKCKAMLTATDDAVQLVVDRPYKAGESIAVWCGPQPNSKLL  329

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLI  510
            INYGFVDEDNPYDR+ +EAALNTEDPQYQDKR+ AQRNGK SVQAF V +
Sbjct  330  INYGFVDEDNPYDRLMVEAALNTEDPQYQDKRMVAQRNGKLSVQAFQVYV  379



>gb|KJB40695.1| hypothetical protein B456_007G073800 [Gossypium raimondii]
Length=417

 Score =   311 bits (797),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 147/168 (88%), Positives = 157/168 (93%), Gaps = 0/168 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            V+ERAEGIKREY+ELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  202  VLERAEGIKREYNELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  261

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
             LA+RFALVPLGPPLL+Y SNCKAML+AV+GAV+LVVDR  K GEPIVVWCGPQPNSKLL
Sbjct  262  PLAQRFALVPLGPPLLAYRSNCKAMLSAVNGAVELVVDRACKAGEPIVVWCGPQPNSKLL  321

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHV  504
            INYGFVD+DN YDR+ +EAALNTEDPQYQDKRL  QRNGK SVQ FHV
Sbjct  322  INYGFVDDDNSYDRLVVEAALNTEDPQYQDKRLVVQRNGKLSVQVFHV  369



>gb|AAL67009.1| unknown protein [Arabidopsis thaliana]
Length=514

 Score =   314 bits (805),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 145/170 (85%), Positives = 157/170 (92%), Gaps = 0/170 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            V+ERAEGIKREY+ELDTVWFMAGSLFQQYP+DIPTEAF FEIFKQAFVA+QSCVVHLQ V
Sbjct  219  VLERAEGIKREYNELDTVWFMAGSLFQQYPFDIPTEAFSFEIFKQAFVAIQSCVVHLQNV  278

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
             LARRFALVPLGPPLL+YCSNCKAML AVDGAV+LVVDRPYK G+PIVVWCGPQPN+KLL
Sbjct  279  GLARRFALVPLGPPLLAYCSNCKAMLTAVDGAVELVVDRPYKAGDPIVVWCGPQPNAKLL  338

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLI  510
            +NYGFVDEDNPYDRV +EAALNTE PQYQDKR+ AQRNGK S Q F V +
Sbjct  339  LNYGFVDEDNPYDRVIVEAALNTEGPQYQDKRMVAQRNGKLSQQVFQVRV  388



>emb|CDX91073.1| BnaC02g05240D [Brassica napus]
Length=429

 Score =   311 bits (797),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 143/170 (84%), Positives = 156/170 (92%), Gaps = 0/170 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            V+ERAEGIKREYSELDTVWFMAGSLFQQYP+DIPTEAF FEIFKQAFVA+QSCVVHLQ V
Sbjct  134  VLERAEGIKREYSELDTVWFMAGSLFQQYPFDIPTEAFSFEIFKQAFVAIQSCVVHLQNV  193

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            SLARRFALVPLGPPLL+YCSNCKAML AVD AV+LVVDR YK G+PIV WCGPQPN+KLL
Sbjct  194  SLARRFALVPLGPPLLAYCSNCKAMLTAVDSAVELVVDRAYKAGDPIVAWCGPQPNAKLL  253

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLI  510
            +NYGFVDEDNPYDR+ +EAAL+T+DPQYQDKRL AQRNGK S Q F V +
Sbjct  254  LNYGFVDEDNPYDRIIVEAALSTDDPQYQDKRLVAQRNGKLSQQVFQVRV  303



>ref|XP_009370281.1| PREDICTED: histone-lysine N-methyltransferase setd3-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009370282.1| PREDICTED: histone-lysine N-methyltransferase setd3-like isoform 
X1 [Pyrus x bretschneideri]
Length=516

 Score =   314 bits (804),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 147/175 (84%), Positives = 157/175 (90%), Gaps = 0/175 (0%)
 Frame = +1

Query  10   RAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLA  189
            RAEGIKREY+ELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLA
Sbjct  224  RAEGIKREYNELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLA  283

Query  190  RRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLLINY  369
            +RFALVPLGPPLL+Y SNC+AML A+DGAVQLVVDRPYK GE I VWCGPQPNSKLLINY
Sbjct  284  QRFALVPLGPPLLAYGSNCRAMLTAIDGAVQLVVDRPYKAGESIAVWCGPQPNSKLLINY  343

Query  370  GFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLICSLFHLIF  534
            GFVDEDN YDR+ +EAALNTEDPQYQDKR+ AQRNGK SVQ F V +      +F
Sbjct  344  GFVDEDNSYDRLVVEAALNTEDPQYQDKRMVAQRNGKLSVQTFQVYVGKEKETVF  398



>ref|XP_009392603.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Musa acuminata 
subsp. malaccensis]
Length=509

 Score =   313 bits (803),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 144/170 (85%), Positives = 159/170 (94%), Gaps = 0/170 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            V+ER EGIKREY+ELDTVWFMAGSLF+QYP+DIPTEAFP+EIFKQAFVAVQSCVVHLQ V
Sbjct  213  VLEREEGIKREYNELDTVWFMAGSLFKQYPFDIPTEAFPYEIFKQAFVAVQSCVVHLQNV  272

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            SLARRFALVPLGPPLL+Y SNCKAML AVD AVQLVVDRPYK GEPIVVWCGPQPNS+LL
Sbjct  273  SLARRFALVPLGPPLLAYKSNCKAMLTAVDDAVQLVVDRPYKAGEPIVVWCGPQPNSRLL  332

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLI  510
            +NYGFVDEDNPYDR+ +EA+LNTEDPQYQ+KR+ AQRNGK +VQ FHV +
Sbjct  333  LNYGFVDEDNPYDRIVIEASLNTEDPQYQEKRMVAQRNGKLAVQVFHVYV  382



>gb|KDO55664.1| hypothetical protein CISIN_1g008853mg [Citrus sinensis]
Length=523

 Score =   314 bits (804),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 158/179 (88%), Gaps = 11/179 (6%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            ++ERAEGIKREY+ELDTVWFMAGSLFQQYPYDIPTEAF FEIFKQAFVAVQSCVVHLQKV
Sbjct  217  ILERAEGIKREYNELDTVWFMAGSLFQQYPYDIPTEAFTFEIFKQAFVAVQSCVVHLQKV  276

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVW----------  330
            SLARRFALVPLGPPLL+Y S CKAMLAAVD AVQLVVDRPYK GE IVVW          
Sbjct  277  SLARRFALVPLGPPLLAYSSKCKAMLAAVDDAVQLVVDRPYKAGESIVVWYNISFTGHDF  336

Query  331  -CGPQPNSKLLINYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHV  504
             CGPQPNSKLLINYGFVDEDNPYDR+ +EAALNTEDPQYQDKR+ AQRNGK SVQ FHV
Sbjct  337  KCGPQPNSKLLINYGFVDEDNPYDRLVVEAALNTEDPQYQDKRMVAQRNGKLSVQVFHV  395



>ref|XP_008807527.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like [Phoenix 
dactylifera]
 ref|XP_008807529.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like [Phoenix 
dactylifera]
 ref|XP_008807530.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like [Phoenix 
dactylifera]
 ref|XP_008807531.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like [Phoenix 
dactylifera]
Length=514

 Score =   313 bits (802),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 144/170 (85%), Positives = 160/170 (94%), Gaps = 0/170 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            V+ER EGIKREY+ELDTVWFMAGSLFQQYP+DIPTEAFPF+IFK+AFVAVQSCVVHLQKV
Sbjct  219  VLERDEGIKREYNELDTVWFMAGSLFQQYPFDIPTEAFPFKIFKEAFVAVQSCVVHLQKV  278

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            SLARRFALVPLGPPLL+Y SNCKAML AV+ AVQLVVDRPYK GEPIVVWCGPQPNS+LL
Sbjct  279  SLARRFALVPLGPPLLAYKSNCKAMLTAVNDAVQLVVDRPYKAGEPIVVWCGPQPNSRLL  338

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLI  510
            +NYGFVDEDNPYDR+ +EA+LNTEDPQYQ+KR+ AQRNGK +VQ FHV +
Sbjct  339  LNYGFVDEDNPYDRIVVEASLNTEDPQYQEKRMVAQRNGKLAVQVFHVYV  388



>gb|KJB40696.1| hypothetical protein B456_007G073800 [Gossypium raimondii]
Length=445

 Score =   311 bits (796),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 147/168 (88%), Positives = 157/168 (93%), Gaps = 0/168 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            V+ERAEGIKREY+ELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  202  VLERAEGIKREYNELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  261

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
             LA+RFALVPLGPPLL+Y SNCKAML+AV+GAV+LVVDR  K GEPIVVWCGPQPNSKLL
Sbjct  262  PLAQRFALVPLGPPLLAYRSNCKAMLSAVNGAVELVVDRACKAGEPIVVWCGPQPNSKLL  321

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHV  504
            INYGFVD+DN YDR+ +EAALNTEDPQYQDKRL  QRNGK SVQ FHV
Sbjct  322  INYGFVDDDNSYDRLVVEAALNTEDPQYQDKRLVVQRNGKLSVQVFHV  369



>ref|XP_007031777.1| Rubisco methyltransferase family protein [Theobroma cacao]
 gb|EOY02703.1| Rubisco methyltransferase family protein [Theobroma cacao]
Length=497

 Score =   312 bits (800),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 147/168 (88%), Positives = 158/168 (94%), Gaps = 0/168 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            V+ERAEGIKREY+ELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  202  VLERAEGIKREYNELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  261

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            +LARRFALVPLGPPLL+Y SNCKAML+AVDGAV+LVVDRPYK GE IVVWCGPQPNSKLL
Sbjct  262  ALARRFALVPLGPPLLAYRSNCKAMLSAVDGAVELVVDRPYKAGESIVVWCGPQPNSKLL  321

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHV  504
            INYGFVD+DN YDR+ +EAALNTEDPQYQ+KR+  QRNGK SVQ F V
Sbjct  322  INYGFVDDDNSYDRLVVEAALNTEDPQYQEKRMVVQRNGKLSVQVFRV  369



>ref|XP_009371683.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Pyrus x 
bretschneideri]
 ref|XP_009371684.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Pyrus x 
bretschneideri]
Length=516

 Score =   313 bits (801),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 146/175 (83%), Positives = 157/175 (90%), Gaps = 0/175 (0%)
 Frame = +1

Query  10   RAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLA  189
            RAEGIKREY+ELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLA
Sbjct  224  RAEGIKREYNELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLA  283

Query  190  RRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLLINY  369
            +RFALVPLGPPLL+Y SNC+AML A+DGAVQLVVDRPYK GE I VWCGPQPNSKLLINY
Sbjct  284  QRFALVPLGPPLLAYGSNCRAMLTAIDGAVQLVVDRPYKAGESIAVWCGPQPNSKLLINY  343

Query  370  GFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLICSLFHLIF  534
            GF+DEDN YDR+ +EAALNTEDPQYQDKR+ AQRNGK SVQ F V +      +F
Sbjct  344  GFIDEDNSYDRLVVEAALNTEDPQYQDKRMVAQRNGKLSVQTFQVYVGKEKETVF  398



>ref|XP_007216336.1| hypothetical protein PRUPE_ppa020142mg, partial [Prunus persica]
 gb|EMJ17535.1| hypothetical protein PRUPE_ppa020142mg, partial [Prunus persica]
Length=495

 Score =   312 bits (799),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 148/178 (83%), Positives = 157/178 (88%), Gaps = 0/178 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            V ER EGIKREY+ELDTVWFMAGSLFQQYPYD PTEAFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  219  VHERGEGIKREYNELDTVWFMAGSLFQQYPYDSPTEAFPFEIFKQAFVAVQSCVVHLQKV  278

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            SLA+RFALVPLGPPLL+Y SNCKAML A DGAVQLVVDRPYK GE I VWCGPQPNSKLL
Sbjct  279  SLAQRFALVPLGPPLLAYRSNCKAMLTATDGAVQLVVDRPYKAGESICVWCGPQPNSKLL  338

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLICSLFHLIF  534
            INYGFVDEDN YDR+ +EA+LNTEDPQYQDKR+ AQRNGK SVQAF V +      +F
Sbjct  339  INYGFVDEDNSYDRLVVEASLNTEDPQYQDKRMVAQRNGKLSVQAFQVNVGKEKETVF  396



>ref|XP_008231158.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Prunus mume]
 ref|XP_008231159.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Prunus mume]
 ref|XP_008231160.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Prunus mume]
 ref|XP_008231161.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Prunus mume]
 ref|XP_008231162.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Prunus mume]
Length=514

 Score =   312 bits (800),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 149/178 (84%), Positives = 158/178 (89%), Gaps = 0/178 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            V ERAEGIKREY+ELDTVWFMAGSLFQQYPYD PTEAFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  219  VHERAEGIKREYNELDTVWFMAGSLFQQYPYDSPTEAFPFEIFKQAFVAVQSCVVHLQKV  278

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            SLA+RFALVPLGPPLL+Y SNCKAML A DGAVQLVVDRPYK GE I VWCGPQPNSKLL
Sbjct  279  SLAQRFALVPLGPPLLAYRSNCKAMLTATDGAVQLVVDRPYKAGESICVWCGPQPNSKLL  338

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLICSLFHLIF  534
            INYGFVDEDN YDR+ +EA+LNTEDPQYQDKR+ AQRNGK SVQAF V +      +F
Sbjct  339  INYGFVDEDNSYDRLVVEASLNTEDPQYQDKRMVAQRNGKLSVQAFQVNVGKEKETVF  396



>ref|XP_004145676.1| PREDICTED: histone-lysine N-methyltransferase setd3-like [Cucumis 
sativus]
 ref|XP_004159127.1| PREDICTED: histone-lysine N-methyltransferase setd3-like [Cucumis 
sativus]
 gb|KGN58197.1| hypothetical protein Csa_3G589550 [Cucumis sativus]
Length=521

 Score =   313 bits (801),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 146/168 (87%), Positives = 158/168 (94%), Gaps = 0/168 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            V+ERAEGIK+EY+ELDTVWFMAGSLFQQYPYDIPTEAF FEIFKQAFVAVQSCVVHLQKV
Sbjct  226  VLERAEGIKKEYNELDTVWFMAGSLFQQYPYDIPTEAFSFEIFKQAFVAVQSCVVHLQKV  285

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            SLARRFALVPLGPPLL+Y SNCKAML AVDGAV+LVVDRPYK GE I VWCGPQPNSKLL
Sbjct  286  SLARRFALVPLGPPLLAYRSNCKAMLTAVDGAVELVVDRPYKAGESIAVWCGPQPNSKLL  345

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHV  504
            +NYGFVDEDN YDR+ +EAALNTEDPQYQDKR+ AQRNG+ S+QAF+V
Sbjct  346  LNYGFVDEDNRYDRLVVEAALNTEDPQYQDKRMVAQRNGRLSIQAFYV  393



>ref|XP_010111617.1| hypothetical protein L484_017643 [Morus notabilis]
 gb|EXC31362.1| hypothetical protein L484_017643 [Morus notabilis]
Length=500

 Score =   312 bits (799),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 147/170 (86%), Positives = 155/170 (91%), Gaps = 0/170 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            V+ER EGIKREY+ELDTVWFMAGSLFQQYPYDIPTEAFPF+IFKQAFVAVQSCVVHLQKV
Sbjct  205  VLERDEGIKREYNELDTVWFMAGSLFQQYPYDIPTEAFPFKIFKQAFVAVQSCVVHLQKV  264

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            SLARRFALVPLGPPLL+Y S CKAML AVD AVQLVVDRPYK GE IV WCGPQPNSKLL
Sbjct  265  SLARRFALVPLGPPLLAYSSKCKAMLTAVDDAVQLVVDRPYKAGESIVAWCGPQPNSKLL  324

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLI  510
            +NYGFVDEDN YDR+ +EAALN EDPQYQDKRL AQRNGK SVQ FHV +
Sbjct  325  LNYGFVDEDNSYDRLVVEAALNREDPQYQDKRLVAQRNGKLSVQTFHVYV  374



>ref|XP_008450074.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Cucumis 
melo]
 ref|XP_008450075.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Cucumis 
melo]
Length=521

 Score =   313 bits (801),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 146/168 (87%), Positives = 158/168 (94%), Gaps = 0/168 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            V+ERAEGIK+EY+ELDTVWFMAGSLFQQYPYDIPTEAF FEIFKQAFVAVQSCVVHLQKV
Sbjct  226  VLERAEGIKKEYNELDTVWFMAGSLFQQYPYDIPTEAFSFEIFKQAFVAVQSCVVHLQKV  285

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            SLARRFALVPLGPPLL+Y SNCKAML AVDGAV+LVVDRPYK GE I VWCGPQPNSKLL
Sbjct  286  SLARRFALVPLGPPLLAYRSNCKAMLTAVDGAVELVVDRPYKGGESIAVWCGPQPNSKLL  345

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHV  504
            +NYGFVDEDN YDR+ +EAALNTEDPQYQDKR+ AQRNG+ S+QAF+V
Sbjct  346  LNYGFVDEDNRYDRLVVEAALNTEDPQYQDKRMVAQRNGRLSIQAFNV  393



>gb|EPS58823.1| hypothetical protein M569_15990, partial [Genlisea aurea]
Length=370

 Score =   307 bits (787),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 142/168 (85%), Positives = 155/168 (92%), Gaps = 0/168 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            +++RAEG+++EY ELDTVWFMAGSLF+QYP+DIPTEAFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  203  ILKRAEGVRKEYDELDTVWFMAGSLFKQYPFDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  262

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            SLA+RFALVPLGPPLLSY S CKAML  VDGAVQLVVDR YK+GEPIVVWCGPQPNSKLL
Sbjct  263  SLAKRFALVPLGPPLLSYGSKCKAMLTVVDGAVQLVVDRHYKSGEPIVVWCGPQPNSKLL  322

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHV  504
            INYGFVDEDNPYDR+  E +LNTEDP YQDKRLAAQRNGK S+Q F V
Sbjct  323  INYGFVDEDNPYDRMVFEVSLNTEDPLYQDKRLAAQRNGKLSIQDFQV  370



>ref|XP_010029028.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Eucalyptus grandis]
 ref|XP_010029029.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Eucalyptus grandis]
 gb|KCW55857.1| hypothetical protein EUGRSUZ_I01666 [Eucalyptus grandis]
 gb|KCW55858.1| hypothetical protein EUGRSUZ_I01666 [Eucalyptus grandis]
Length=514

 Score =   312 bits (799),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 145/168 (86%), Positives = 158/168 (94%), Gaps = 0/168 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            V+ERAEGI+REY+ELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVA+QSCVVHLQKV
Sbjct  219  VLERAEGIRREYNELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAIQSCVVHLQKV  278

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            SLARRFALVPLGPPLL+Y SNCKAML AVDGAV+LVVDR YK GEPIVVWCGPQPNS+LL
Sbjct  279  SLARRFALVPLGPPLLTYRSNCKAMLTAVDGAVELVVDRAYKAGEPIVVWCGPQPNSRLL  338

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHV  504
            +NYGFVDEDN YDR+ +EA+LNTEDPQYQDKR+ AQRNGK S Q F+V
Sbjct  339  LNYGFVDEDNSYDRLGVEASLNTEDPQYQDKRIVAQRNGKLSKQLFYV  386



>gb|KJB40694.1| hypothetical protein B456_007G073800 [Gossypium raimondii]
 gb|KJB40698.1| hypothetical protein B456_007G073800 [Gossypium raimondii]
Length=497

 Score =   311 bits (797),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 147/168 (88%), Positives = 157/168 (93%), Gaps = 0/168 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            V+ERAEGIKREY+ELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  202  VLERAEGIKREYNELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  261

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
             LA+RFALVPLGPPLL+Y SNCKAML+AV+GAV+LVVDR  K GEPIVVWCGPQPNSKLL
Sbjct  262  PLAQRFALVPLGPPLLAYRSNCKAMLSAVNGAVELVVDRACKAGEPIVVWCGPQPNSKLL  321

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHV  504
            INYGFVD+DN YDR+ +EAALNTEDPQYQDKRL  QRNGK SVQ FHV
Sbjct  322  INYGFVDDDNSYDRLVVEAALNTEDPQYQDKRLVVQRNGKLSVQVFHV  369



>ref|XP_006852184.1| hypothetical protein AMTR_s00049p00107230 [Amborella trichopoda]
 gb|ERN13651.1| hypothetical protein AMTR_s00049p00107230 [Amborella trichopoda]
Length=514

 Score =   311 bits (797),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 145/168 (86%), Positives = 157/168 (93%), Gaps = 0/168 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            V+ERAEGIKREY ELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQ V
Sbjct  219  VLERAEGIKREYDELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQNV  278

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            SLARRFALVPLGPPLL+Y SNCKAML AV+ AVQLVVDR YK GE IVVWCGPQPNS+LL
Sbjct  279  SLARRFALVPLGPPLLAYKSNCKAMLTAVENAVQLVVDRAYKAGEAIVVWCGPQPNSRLL  338

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHV  504
            +NYGFVDEDNPYDR+ ++A+LNT+DPQYQDKR+ AQRNGK +VQAFHV
Sbjct  339  LNYGFVDEDNPYDRLFIKASLNTDDPQYQDKRMIAQRNGKLTVQAFHV  386



>ref|XP_010667269.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Beta vulgaris 
subsp. vulgaris]
Length=518

 Score =   311 bits (797),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 145/170 (85%), Positives = 157/170 (92%), Gaps = 0/170 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            ++ RAEGIK+EY+ELDTVWFMAGSLFQQYPYDIPTEAF FEIFKQAFVAVQSCVVHLQ V
Sbjct  223  ILGRAEGIKKEYNELDTVWFMAGSLFQQYPYDIPTEAFSFEIFKQAFVAVQSCVVHLQGV  282

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            SLARRFALVPLGPPLL+Y S C+AML AVD AVQLVVDR YK GEPIVVWCGPQPNSKLL
Sbjct  283  SLARRFALVPLGPPLLAYKSTCRAMLTAVDDAVQLVVDRQYKAGEPIVVWCGPQPNSKLL  342

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLI  510
            INYGFVDEDNPYDR+ +EAALNTEDPQYQDKR+ AQRNGK S Q+F+VL+
Sbjct  343  INYGFVDEDNPYDRIVVEAALNTEDPQYQDKRMVAQRNGKLSQQSFYVLV  392



>ref|XP_010250811.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X1 
[Nelumbo nucifera]
 ref|XP_010250812.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X1 
[Nelumbo nucifera]
 ref|XP_010250813.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X1 
[Nelumbo nucifera]
Length=516

 Score =   311 bits (796),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 141/168 (84%), Positives = 160/168 (95%), Gaps = 0/168 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            V+ER+EGIKREY+ELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVA+QSCVVHLQKV
Sbjct  221  VLERSEGIKREYNELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAIQSCVVHLQKV  280

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            SLARRFALVPLGPPLL+Y S+CKAML AV+GA+QLVVDRPYK G+ IVVWCGPQPNS+LL
Sbjct  281  SLARRFALVPLGPPLLAYKSDCKAMLEAVEGAIQLVVDRPYKAGDSIVVWCGPQPNSRLL  340

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHV  504
            +NYGFVDE+NPYDR+ +EA+LNTEDPQYQ+KR+ AQR+GK +VQ FHV
Sbjct  341  LNYGFVDENNPYDRIMVEASLNTEDPQYQEKRIVAQRHGKLAVQVFHV  388



>ref|XP_004489592.1| PREDICTED: histone-lysine N-methyltransferase setd3-like isoform 
X1 [Cicer arietinum]
 ref|XP_004489593.1| PREDICTED: histone-lysine N-methyltransferase setd3-like isoform 
X2 [Cicer arietinum]
Length=495

 Score =   310 bits (794),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 141/168 (84%), Positives = 156/168 (93%), Gaps = 0/168 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            +++R EGI++EY+ELDTVWFM+GSLFQQYPYDIPTEAFPFEIFKQAF AVQSCVVHLQ V
Sbjct  200  IVQRIEGIRKEYNELDTVWFMSGSLFQQYPYDIPTEAFPFEIFKQAFAAVQSCVVHLQNV  259

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            SLARRFALVPLGPPLL+YCSNCKAMLA+VDG+VQLVVDRPYK G+PIVVWCGPQPNSKLL
Sbjct  260  SLARRFALVPLGPPLLAYCSNCKAMLASVDGSVQLVVDRPYKAGDPIVVWCGPQPNSKLL  319

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHV  504
             NYGFVDEDN  DR+ +EAALNTEDPQYQDKR+ AQRNGK S+Q F V
Sbjct  320  TNYGFVDEDNSNDRLIIEAALNTEDPQYQDKRMVAQRNGKLSIQTFQV  367



>gb|KHG04663.1| Histone-lysine N-methyltransferase setd3 [Gossypium arboreum]
Length=497

 Score =   310 bits (793),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 147/168 (88%), Positives = 156/168 (93%), Gaps = 0/168 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            V+ERAEGIKREY ELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  202  VLERAEGIKREYDELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  261

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
             LA+RFALVPLGPPLL+Y SNCKAML+AV+GAV+LVVDR  K GEPIVVWCGPQPNSKLL
Sbjct  262  PLAQRFALVPLGPPLLAYRSNCKAMLSAVNGAVELVVDRACKAGEPIVVWCGPQPNSKLL  321

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHV  504
            INYGFVD+DN YDR+ +EAALNTEDPQYQDKRL  QRNGK SVQ FHV
Sbjct  322  INYGFVDDDNSYDRLVVEAALNTEDPQYQDKRLVVQRNGKLSVQVFHV  369



>emb|CDY57896.1| BnaC09g54420D [Brassica napus]
Length=917

 Score =   320 bits (820),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 147/170 (86%), Positives = 158/170 (93%), Gaps = 0/170 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            V+ERAEGIKREYSELDTVWFMAGSLFQQYP+DIPTEAF FEIFKQAF AVQSCVVHLQ V
Sbjct  622  VLERAEGIKREYSELDTVWFMAGSLFQQYPFDIPTEAFSFEIFKQAFAAVQSCVVHLQNV  681

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            SLARRFALVPLGPPLL+YCSNCKAML AVDGAVQLVVDRPYK G+PIVVWCGPQPN+KLL
Sbjct  682  SLARRFALVPLGPPLLAYCSNCKAMLTAVDGAVQLVVDRPYKAGDPIVVWCGPQPNAKLL  741

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLI  510
            +NYGFVDEDNPYDR+ +EAAL+T+DPQYQDKRL AQRNGK S Q F V +
Sbjct  742  LNYGFVDEDNPYDRIIVEAALSTDDPQYQDKRLVAQRNGKLSQQVFQVRV  791



>ref|XP_009125968.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like [Brassica 
rapa]
Length=505

 Score =   309 bits (792),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 143/170 (84%), Positives = 156/170 (92%), Gaps = 0/170 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            V+ERAEGIKREYSELDTVWFMAGSLFQQYP+DIPTEAF FEIFKQAFVA+QSCVVHLQ V
Sbjct  210  VLERAEGIKREYSELDTVWFMAGSLFQQYPFDIPTEAFSFEIFKQAFVAIQSCVVHLQNV  269

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            SLARRFALVPLGPPLL+YCSNCKAML AVD AV+LVVDR YK G+PIV WCGPQPN+KLL
Sbjct  270  SLARRFALVPLGPPLLAYCSNCKAMLTAVDDAVELVVDRAYKAGDPIVAWCGPQPNAKLL  329

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLI  510
            +NYGFVDEDNPYDR+ +EAAL+T+DPQYQDKRL AQRNGK S Q F V +
Sbjct  330  LNYGFVDEDNPYDRIIVEAALSTDDPQYQDKRLVAQRNGKLSQQVFQVRV  379



>ref|XP_010912843.1| PREDICTED: histone-lysine N-methyltransferase setd3-like isoform 
X2 [Elaeis guineensis]
Length=423

 Score =   306 bits (784),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 139/170 (82%), Positives = 157/170 (92%), Gaps = 0/170 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            ++ER EGIKREY+ELDTVWFMAGSLFQQYP+DIPTEAFPFEIFKQAFVA+QSCVVHLQKV
Sbjct  217  LLERDEGIKREYNELDTVWFMAGSLFQQYPFDIPTEAFPFEIFKQAFVAIQSCVVHLQKV  276

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            +LARRFALVPLGPPLL+Y SNCKAML AV  AV+LVVDRP+K GEPIVVWCGPQPNS+LL
Sbjct  277  NLARRFALVPLGPPLLAYKSNCKAMLTAVSDAVELVVDRPFKAGEPIVVWCGPQPNSRLL  336

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLI  510
            +NYG VDEDNPYDR+ +EA+LN EDPQYQ+KR+ AQRNGK +VQ FHV +
Sbjct  337  LNYGLVDEDNPYDRIAVEASLNMEDPQYQEKRMVAQRNGKLAVQVFHVFV  386



>gb|KHG27486.1| COP9 signalosome complex subunit 3 -like protein [Gossypium arboreum]
Length=965

 Score =   320 bits (820),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 150/168 (89%), Positives = 159/168 (95%), Gaps = 0/168 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            ++ERAEGIKREY+ELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  670  IVERAEGIKREYNELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  729

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
             LARRFALVPLGPPLL+Y SNCKAML+AV GAV+LVVDRPYK GEPIVVWCGPQPNSKLL
Sbjct  730  PLARRFALVPLGPPLLAYRSNCKAMLSAVAGAVELVVDRPYKAGEPIVVWCGPQPNSKLL  789

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHV  504
            INYGFVD+DNPYDR+ +EAALNTEDPQYQDKRL  QRNGK SVQAF V
Sbjct  790  INYGFVDDDNPYDRLVVEAALNTEDPQYQDKRLVVQRNGKLSVQAFPV  837



>gb|KHG04664.1| Histone-lysine N-methyltransferase setd3 [Gossypium arboreum]
Length=515

 Score =   309 bits (792),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 147/168 (88%), Positives = 156/168 (93%), Gaps = 0/168 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            V+ERAEGIKREY ELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  202  VLERAEGIKREYDELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  261

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
             LA+RFALVPLGPPLL+Y SNCKAML+AV+GAV+LVVDR  K GEPIVVWCGPQPNSKLL
Sbjct  262  PLAQRFALVPLGPPLLAYRSNCKAMLSAVNGAVELVVDRACKAGEPIVVWCGPQPNSKLL  321

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHV  504
            INYGFVD+DN YDR+ +EAALNTEDPQYQDKRL  QRNGK SVQ FHV
Sbjct  322  INYGFVDDDNSYDRLVVEAALNTEDPQYQDKRLVVQRNGKLSVQVFHV  369



>dbj|BAJ99196.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=425

 Score =   306 bits (784),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 137/170 (81%), Positives = 159/170 (94%), Gaps = 0/170 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            V+ R EGIK+EY+ELDT+WFMAGSLF+QYP+D+PTEAFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  223  VVVRDEGIKKEYNELDTLWFMAGSLFKQYPFDVPTEAFPFEIFKQAFVAVQSCVVHLQKV  282

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            SLARRFALVPLGPPLL+Y SNCKAML AVDG+V+L+VDRPYK GEPI+VWCGPQPNS+LL
Sbjct  283  SLARRFALVPLGPPLLTYKSNCKAMLTAVDGSVRLLVDRPYKAGEPIIVWCGPQPNSRLL  342

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLI  510
            +NYGFVDEDNPYDR+ +EA+LNTEDPQYQ+KR+ AQRNGK ++Q F V +
Sbjct  343  LNYGFVDEDNPYDRIAIEASLNTEDPQYQEKRMVAQRNGKLAIQKFQVCV  392



>emb|CDX69594.1| BnaA10g19430D [Brassica napus]
Length=917

 Score =   319 bits (817),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 146/170 (86%), Positives = 158/170 (93%), Gaps = 0/170 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            V+ERAEGIKREYSELDTVWFMAGSLFQQYP+DIPTEAF FEIFKQAF AVQSCVVHLQ V
Sbjct  622  VLERAEGIKREYSELDTVWFMAGSLFQQYPFDIPTEAFTFEIFKQAFAAVQSCVVHLQNV  681

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            SLARRFALVPLGPPLL+YCSNCKAML AVDGAVQLVVDRPYK G+PIVVWCGPQPN+KLL
Sbjct  682  SLARRFALVPLGPPLLAYCSNCKAMLTAVDGAVQLVVDRPYKAGDPIVVWCGPQPNAKLL  741

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLI  510
            +NYGF+DEDNPYDR+ +EAAL+T+DPQYQDKRL AQRNGK S Q F V +
Sbjct  742  LNYGFIDEDNPYDRIIVEAALSTDDPQYQDKRLVAQRNGKLSQQVFQVRV  791



>ref|XP_008353375.1| PREDICTED: histone-lysine N-methyltransferase setd3-like [Malus 
domestica]
Length=429

 Score =   306 bits (783),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 144/168 (86%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            V  RA GIKREY+ELDTVWFMAGSLFQQYPYDIPT+AFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  221  VHARAXGIKREYNELDTVWFMAGSLFQQYPYDIPTDAFPFEIFKQAFVAVQSCVVHLQKV  280

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            SLA+RFALVPLGPPLL+Y SNC+AML A+DGAVQLVVDRPYK GE I VWCGPQPNSKLL
Sbjct  281  SLAQRFALVPLGPPLLAYGSNCRAMLTAIDGAVQLVVDRPYKAGESIAVWCGPQPNSKLL  340

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHV  504
            INYGFVDEDN YDR+ +EAALNTEDPQYQDKR+ AQ NGK SVQ F V
Sbjct  341  INYGFVDEDNSYDRLVVEAALNTEDPQYQDKRMVAQGNGKLSVQTFQV  388



>gb|KHN18676.1| Putative ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Glycine soja]
Length=429

 Score =   306 bits (783),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            VI+R E I++EY ELDTVWFMAGSLFQQYPYDIPTEAF FEIFKQAF A+QSCVVHLQKV
Sbjct  133  VIQREEAIRKEYKELDTVWFMAGSLFQQYPYDIPTEAFSFEIFKQAFAAIQSCVVHLQKV  192

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            SLARRFALVPLGPPLLSY SNCKAML AVDGAV+L VDRPYK G+PIVVWCGPQPNSKLL
Sbjct  193  SLARRFALVPLGPPLLSYQSNCKAMLTAVDGAVELAVDRPYKAGDPIVVWCGPQPNSKLL  252

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHV  504
            INYGFVDE+N  DR+ +EAALNTEDPQYQDKR+ AQRNGK SVQ FHV
Sbjct  253  INYGFVDENNSNDRLIVEAALNTEDPQYQDKRMVAQRNGKLSVQVFHV  300



>ref|XP_008800377.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like isoform 
X4 [Phoenix dactylifera]
Length=432

 Score =   305 bits (780),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 141/170 (83%), Positives = 157/170 (92%), Gaps = 0/170 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            ++ER EGIKREY+ELDTVWFMAGSLFQQYP+DIPTEAFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  224  LLERDEGIKREYNELDTVWFMAGSLFQQYPFDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  283

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            +LARRFALVPLGPPLL+Y SNCKAML AV  AV+LVVDRPYK GEPIVVWCGPQPNS+LL
Sbjct  284  NLARRFALVPLGPPLLAYKSNCKAMLTAVSDAVKLVVDRPYKAGEPIVVWCGPQPNSRLL  343

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLI  510
            +NYGFVDEDNPYDRV +EA+LN EDPQ+Q+KR+ AQRNGK +VQ F V +
Sbjct  344  LNYGFVDEDNPYDRVVVEASLNMEDPQFQEKRMVAQRNGKLAVQVFRVYV  393



>ref|XP_010912842.1| PREDICTED: histone-lysine N-methyltransferase setd3-like isoform 
X1 [Elaeis guineensis]
Length=512

 Score =   306 bits (785),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 139/170 (82%), Positives = 157/170 (92%), Gaps = 0/170 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            ++ER EGIKREY+ELDTVWFMAGSLFQQYP+DIPTEAFPFEIFKQAFVA+QSCVVHLQKV
Sbjct  217  LLERDEGIKREYNELDTVWFMAGSLFQQYPFDIPTEAFPFEIFKQAFVAIQSCVVHLQKV  276

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            +LARRFALVPLGPPLL+Y SNCKAML AV  AV+LVVDRP+K GEPIVVWCGPQPNS+LL
Sbjct  277  NLARRFALVPLGPPLLAYKSNCKAMLTAVSDAVELVVDRPFKAGEPIVVWCGPQPNSRLL  336

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLI  510
            +NYG VDEDNPYDR+ +EA+LN EDPQYQ+KR+ AQRNGK +VQ FHV +
Sbjct  337  LNYGLVDEDNPYDRIAVEASLNMEDPQYQEKRMVAQRNGKLAVQVFHVFV  386



>ref|XP_006664454.1| PREDICTED: histone-lysine N-methyltransferase setd3-like [Oryza 
brachyantha]
Length=402

 Score =   303 bits (776),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 138/170 (81%), Positives = 157/170 (92%), Gaps = 0/170 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            V  R EGI+REY+ELDT+WFMAGSLFQQYP+DIPTEAFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  107  VFARDEGIRREYNELDTLWFMAGSLFQQYPFDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  166

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            SLARRFALVPLGPPLL+Y SNCKAML A   +V+LVVDRPYK+GEPI+VWCGPQPNS+LL
Sbjct  167  SLARRFALVPLGPPLLTYKSNCKAMLTAGGDSVRLVVDRPYKSGEPIIVWCGPQPNSRLL  226

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLI  510
            +NYGFVDEDNPYDRV +EA+LNTEDPQ+Q+KR+ AQRNGK ++Q FHV +
Sbjct  227  LNYGFVDEDNPYDRVVIEASLNTEDPQFQEKRMVAQRNGKLAIQNFHVCV  276



>ref|XP_003524489.1| PREDICTED: Fructose-bisphosphate aldolase-lysine-lysine N-methyltransferase, 
chloroplastic-like isoform X1 [Glycine max]
 ref|XP_006579696.1| PREDICTED: Fructose-bisphosphate aldolase-lysine-lysine N-methyltransferase, 
chloroplastic-like isoform X2 [Glycine max]
 ref|XP_006579697.1| PREDICTED: Fructose-bisphosphate aldolase-lysine-lysine N-methyltransferase, 
chloroplastic-like isoform X3 [Glycine max]
 ref|XP_006579698.1| PREDICTED: Fructose-bisphosphate aldolase-lysine-lysine N-methyltransferase, 
chloroplastic-like isoform X4 [Glycine max]
Length=503

 Score =   306 bits (784),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            VI+R E I++EY ELDTVWFMAGSLFQQYPYDIPTEAF FEIFKQAF A+QSCVVHLQKV
Sbjct  207  VIQREEAIRKEYKELDTVWFMAGSLFQQYPYDIPTEAFSFEIFKQAFAAIQSCVVHLQKV  266

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            SLARRFALVPLGPPLLSY SNCKAML AVDGAV+L VDRPYK G+PIVVWCGPQPNSKLL
Sbjct  267  SLARRFALVPLGPPLLSYQSNCKAMLTAVDGAVELAVDRPYKAGDPIVVWCGPQPNSKLL  326

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHV  504
            INYGFVDE+N  DR+ +EAALNTEDPQYQDKR+ AQRNGK SVQ FHV
Sbjct  327  INYGFVDENNSNDRLIVEAALNTEDPQYQDKRMVAQRNGKLSVQVFHV  374



>ref|XP_003618816.1| SET domain protein [Medicago truncatula]
 gb|AES75034.1| rubisco methyltransferase family protein [Medicago truncatula]
Length=501

 Score =   306 bits (783),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 138/168 (82%), Positives = 155/168 (92%), Gaps = 0/168 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            +++R EGI++EY+ELDTVWFM+GSLFQQYPYD+PTEAFPFEIFKQAF AVQSCVVHLQ V
Sbjct  206  IVKRIEGIRKEYNELDTVWFMSGSLFQQYPYDLPTEAFPFEIFKQAFAAVQSCVVHLQNV  265

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            SLARRFALVPLGPPLL+YCSNCKAML AVDGAVQLVVDRPYK G+PIVVWCGPQPN+KLL
Sbjct  266  SLARRFALVPLGPPLLAYCSNCKAMLTAVDGAVQLVVDRPYKAGDPIVVWCGPQPNTKLL  325

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHV  504
             NYGFVDEDN  DR+ +E AL+TEDPQYQDKR+ AQRNGK S+Q F+V
Sbjct  326  TNYGFVDEDNSNDRLIVEVALSTEDPQYQDKRIVAQRNGKLSIQTFYV  373



>dbj|BAJ87354.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88824.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=523

 Score =   306 bits (785),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 137/170 (81%), Positives = 159/170 (94%), Gaps = 0/170 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            V+ R EGIK+EY+ELDT+WFMAGSLF+QYP+D+PTEAFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  228  VVVRDEGIKKEYNELDTLWFMAGSLFKQYPFDVPTEAFPFEIFKQAFVAVQSCVVHLQKV  287

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            SLARRFALVPLGPPLL+Y SNCKAML AVDG+V+L+VDRPYK GEPI+VWCGPQPNS+LL
Sbjct  288  SLARRFALVPLGPPLLTYKSNCKAMLTAVDGSVRLLVDRPYKAGEPIIVWCGPQPNSRLL  347

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLI  510
            +NYGFVDEDNPYDR+ +EA+LNTEDPQYQ+KR+ AQRNGK ++Q F V +
Sbjct  348  LNYGFVDEDNPYDRIAIEASLNTEDPQYQEKRMVAQRNGKLAIQKFQVCV  397



>ref|XP_003553868.1| PREDICTED: histone-lysine N-methyltransferase setd3-like isoformX1 
[Glycine max]
 ref|XP_006604092.1| PREDICTED: histone-lysine N-methyltransferase setd3-like isoform 
X2 [Glycine max]
 gb|KHN09879.1| Putative ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Glycine soja]
Length=502

 Score =   306 bits (783),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 154/168 (92%), Gaps = 0/168 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            VI+R E I++EY+ELDTVWFMAGSLFQQYPYDIPTEAF FEIFKQAF A+QSCVVHLQKV
Sbjct  207  VIQREEAIRKEYNELDTVWFMAGSLFQQYPYDIPTEAFSFEIFKQAFAAIQSCVVHLQKV  266

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            SLARRFALVPLGPPLLSY SNCKAML AVDGAV+L VDRPYK G+PIVVWCGPQPNSKLL
Sbjct  267  SLARRFALVPLGPPLLSYQSNCKAMLTAVDGAVELAVDRPYKAGDPIVVWCGPQPNSKLL  326

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHV  504
            INYGFVDE+N  DR+ +EAALNTEDPQYQDKR+ AQRNGK SVQ FHV
Sbjct  327  INYGFVDENNSNDRLIVEAALNTEDPQYQDKRMVAQRNGKLSVQVFHV  374



>ref|XP_010551929.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Tarenaya hassleriana]
 ref|XP_010551930.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Tarenaya hassleriana]
Length=516

 Score =   306 bits (783),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 141/170 (83%), Positives = 154/170 (91%), Gaps = 0/170 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            V+ERAEGIKREY ELDTVWFMAGSLFQQYPYDIPTEAF FEIFKQAFVA+QSCVVHLQ V
Sbjct  221  VLERAEGIKREYKELDTVWFMAGSLFQQYPYDIPTEAFTFEIFKQAFVAIQSCVVHLQNV  280

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            SLARRFALVP GPPLL+Y  NCKAML AVDGAV+LVVDRPYK G+PIV WCGPQPN++LL
Sbjct  281  SLARRFALVPFGPPLLAYSCNCKAMLTAVDGAVELVVDRPYKYGDPIVAWCGPQPNARLL  340

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLI  510
            +NYGFVDEDNPYDR+ +EAAL+TEDPQYQDKR+ AQRNGK S Q F V +
Sbjct  341  LNYGFVDEDNPYDRIIVEAALSTEDPQYQDKRMVAQRNGKLSQQVFQVRV  390



>ref|XP_008800375.1| PREDICTED: [Fructose-bisphosphate aldolase]-lysine N-methyltransferase, 
chloroplastic-like isoform X2 [Phoenix dactylifera]
Length=512

 Score =   305 bits (780),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 141/170 (83%), Positives = 157/170 (92%), Gaps = 0/170 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            ++ER EGIKREY+ELDTVWFMAGSLFQQYP+DIPTEAFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  217  LLERDEGIKREYNELDTVWFMAGSLFQQYPFDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  276

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            +LARRFALVPLGPPLL+Y SNCKAML AV  AV+LVVDRPYK GEPIVVWCGPQPNS+LL
Sbjct  277  NLARRFALVPLGPPLLAYKSNCKAMLTAVSDAVKLVVDRPYKAGEPIVVWCGPQPNSRLL  336

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLI  510
            +NYGFVDEDNPYDRV +EA+LN EDPQ+Q+KR+ AQRNGK +VQ F V +
Sbjct  337  LNYGFVDEDNPYDRVVVEASLNMEDPQFQEKRMVAQRNGKLAVQVFRVYV  386



>ref|XP_008800373.1| PREDICTED: [Fructose-bisphosphate aldolase]-lysine N-methyltransferase, 
chloroplastic-like isoform X1 [Phoenix dactylifera]
 ref|XP_008800374.1| PREDICTED: [Fructose-bisphosphate aldolase]-lysine N-methyltransferase, 
chloroplastic-like isoform X1 [Phoenix dactylifera]
Length=519

 Score =   304 bits (779),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 141/170 (83%), Positives = 157/170 (92%), Gaps = 0/170 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            ++ER EGIKREY+ELDTVWFMAGSLFQQYP+DIPTEAFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  224  LLERDEGIKREYNELDTVWFMAGSLFQQYPFDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  283

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            +LARRFALVPLGPPLL+Y SNCKAML AV  AV+LVVDRPYK GEPIVVWCGPQPNS+LL
Sbjct  284  NLARRFALVPLGPPLLAYKSNCKAMLTAVSDAVKLVVDRPYKAGEPIVVWCGPQPNSRLL  343

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLI  510
            +NYGFVDEDNPYDRV +EA+LN EDPQ+Q+KR+ AQRNGK +VQ F V +
Sbjct  344  LNYGFVDEDNPYDRVVVEASLNMEDPQFQEKRMVAQRNGKLAVQVFRVYV  393



>emb|CAB87765.1| putative protein [Arabidopsis thaliana]
Length=537

 Score =   305 bits (781),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 146/188 (78%), Positives = 158/188 (84%), Gaps = 18/188 (10%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQ--  174
            V+ERAEGIKREY+ELDTVWFMAGSLFQQYP+DIPTEAF FEIFKQAFVA+QSCVVHLQ  
Sbjct  219  VLERAEGIKREYNELDTVWFMAGSLFQQYPFDIPTEAFSFEIFKQAFVAIQSCVVHLQVV  278

Query  175  ----------------KVSLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYK  306
                             V LARRFALVPLGPPLL+YCSNCKAML AVDGAV+LVVDRPYK
Sbjct  279  LVASSNLDCYASSCTQNVGLARRFALVPLGPPLLAYCSNCKAMLTAVDGAVELVVDRPYK  338

Query  307  TGEPIVVWCGPQPNSKLLINYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSS  486
             G+PIVVWCGPQPN+KLL+NYGFVDEDNPYDRV +EAALNTEDPQYQDKR+ AQRNGK S
Sbjct  339  AGDPIVVWCGPQPNAKLLLNYGFVDEDNPYDRVIVEAALNTEDPQYQDKRMVAQRNGKLS  398

Query  487  VQAFHVLI  510
             Q F V +
Sbjct  399  QQVFQVRV  406



>ref|XP_007151549.1| hypothetical protein PHAVU_004G056200g [Phaseolus vulgaris]
 ref|XP_007151550.1| hypothetical protein PHAVU_004G056200g [Phaseolus vulgaris]
 ref|XP_007151551.1| hypothetical protein PHAVU_004G056200g [Phaseolus vulgaris]
 gb|ESW23543.1| hypothetical protein PHAVU_004G056200g [Phaseolus vulgaris]
 gb|ESW23544.1| hypothetical protein PHAVU_004G056200g [Phaseolus vulgaris]
 gb|ESW23545.1| hypothetical protein PHAVU_004G056200g [Phaseolus vulgaris]
Length=504

 Score =   303 bits (775),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 142/168 (85%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            VIER E I++EY+ELDTVWFMAGSLFQQYPYDIPTEAF FEIFKQAF A+QSCVVHLQKV
Sbjct  209  VIERTEAIRKEYNELDTVWFMAGSLFQQYPYDIPTEAFSFEIFKQAFAAIQSCVVHLQKV  268

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            SLARRFALVPLGPPLLSY SNCKAML AVDGAV+L VDRPYK G+PIVVWCGPQPNSKLL
Sbjct  269  SLARRFALVPLGPPLLSYQSNCKAMLTAVDGAVELAVDRPYKAGDPIVVWCGPQPNSKLL  328

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHV  504
            INYGFVDE+N  DR+ +EAAL+TEDPQYQDKR+ AQRNGK SVQ F V
Sbjct  329  INYGFVDENNSNDRLIVEAALDTEDPQYQDKRIVAQRNGKLSVQVFRV  376



>gb|EAY82695.1| hypothetical protein OsI_37912 [Oryza sativa Indica Group]
Length=505

 Score =   302 bits (774),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 136/170 (80%), Positives = 157/170 (92%), Gaps = 0/170 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            V+ R EGI+REY+ELDT+WFMAGSLFQQYP+DIPTEAFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  210  VVARDEGIRREYNELDTLWFMAGSLFQQYPFDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  269

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            SLARRFALVPLGPPLL+Y SNCKAML AV  +V+LVVDRPYK GEPI+VWCGPQPNS+LL
Sbjct  270  SLARRFALVPLGPPLLTYKSNCKAMLTAVGDSVRLVVDRPYKAGEPIIVWCGPQPNSRLL  329

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLI  510
            +NYGF+DEDNPYDR+ +EA+LN EDPQ+Q+KR+ AQRNGK ++Q FHV +
Sbjct  330  LNYGFIDEDNPYDRIVIEASLNIEDPQFQEKRMVAQRNGKLAIQNFHVCV  379



>ref|NP_001066466.1| Os12g0236900 [Oryza sativa Japonica Group]
 gb|ABA96840.1| SET domain containing protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF29485.1| Os12g0236900 [Oryza sativa Japonica Group]
Length=509

 Score =   302 bits (774),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 136/170 (80%), Positives = 157/170 (92%), Gaps = 0/170 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            V+ R EGI+REY+ELDT+WFMAGSLFQQYP+DIPTEAFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  214  VVARDEGIRREYNELDTLWFMAGSLFQQYPFDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  273

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            SLARRFALVPLGPPLL+Y SNCKAML AV  +V+LVVDRPYK GEPI+VWCGPQPNS+LL
Sbjct  274  SLARRFALVPLGPPLLTYKSNCKAMLTAVGDSVRLVVDRPYKAGEPIIVWCGPQPNSRLL  333

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLI  510
            +NYGF+DEDNPYDR+ +EA+LN EDPQ+Q+KR+ AQRNGK ++Q FHV +
Sbjct  334  LNYGFIDEDNPYDRIVIEASLNIEDPQFQEKRMVAQRNGKLAIQNFHVCV  383



>ref|XP_003578740.1| PREDICTED: [Fructose-bisphosphate aldolase]-lysine N-methyltransferase, 
chloroplastic [Brachypodium distachyon]
Length=516

 Score =   302 bits (774),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 136/170 (80%), Positives = 157/170 (92%), Gaps = 0/170 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            V+ R EGI+REY+ELDT+WFMAGSLF+QYP+D+PTEAFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  221  VVVRDEGIRREYNELDTLWFMAGSLFKQYPFDVPTEAFPFEIFKQAFVAVQSCVVHLQKV  280

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            SLARRFALVPLGPPLL+Y SNCKAML AVD +V+LVVDRPYK GEPI+VWCGPQPNS+LL
Sbjct  281  SLARRFALVPLGPPLLTYKSNCKAMLTAVDDSVRLVVDRPYKAGEPIIVWCGPQPNSRLL  340

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLI  510
            +NYGFVDEDNPYDR+ +EA+LN EDPQYQ+KR+ AQRNGK ++Q F V +
Sbjct  341  LNYGFVDEDNPYDRIAIEASLNMEDPQYQEKRMVAQRNGKLAIQKFQVCV  390



>gb|KDO55663.1| hypothetical protein CISIN_1g008853mg [Citrus sinensis]
Length=551

 Score =   303 bits (775),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 151/207 (73%), Positives = 158/207 (76%), Gaps = 39/207 (19%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQ--  174
            ++ERAEGIKREY+ELDTVWFMAGSLFQQYPYDIPTEAF FEIFKQAFVAVQSCVVHLQ  
Sbjct  217  ILERAEGIKREYNELDTVWFMAGSLFQQYPYDIPTEAFTFEIFKQAFVAVQSCVVHLQRC  276

Query  175  -------------------------------------KVSLARRFALVPLGPPLLSYCSN  243
                                                 KVSLARRFALVPLGPPLL+Y S 
Sbjct  277  GCTPQMGTESFASHLVHLQTSCTTTRTPLSPTHNPKEKVSLARRFALVPLGPPLLAYSSK  336

Query  244  CKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLLINYGFVDEDNPYDRVTLEAAL  423
            CKAMLAAVD AVQLVVDRPYK GE IVVWCGPQPNSKLLINYGFVDEDNPYDR+ +EAAL
Sbjct  337  CKAMLAAVDDAVQLVVDRPYKAGESIVVWCGPQPNSKLLINYGFVDEDNPYDRLVVEAAL  396

Query  424  NTEDPQYQDKRLAAQRNGKSSVQAFHV  504
            NTEDPQYQDKR+ AQRNGK SVQ FHV
Sbjct  397  NTEDPQYQDKRMVAQRNGKLSVQVFHV  423



>gb|EAZ20075.1| hypothetical protein OsJ_35675 [Oryza sativa Japonica Group]
Length=536

 Score =   302 bits (774),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 136/170 (80%), Positives = 157/170 (92%), Gaps = 0/170 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            V+ R EGI+REY+ELDT+WFMAGSLFQQYP+DIPTEAFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  241  VVARDEGIRREYNELDTLWFMAGSLFQQYPFDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  300

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            SLARRFALVPLGPPLL+Y SNCKAML AV  +V+LVVDRPYK GEPI+VWCGPQPNS+LL
Sbjct  301  SLARRFALVPLGPPLLTYKSNCKAMLTAVGDSVRLVVDRPYKAGEPIIVWCGPQPNSRLL  360

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLI  510
            +NYGF+DEDNPYDR+ +EA+LN EDPQ+Q+KR+ AQRNGK ++Q FHV +
Sbjct  361  LNYGFIDEDNPYDRIVIEASLNIEDPQFQEKRMVAQRNGKLAIQNFHVCV  410



>ref|XP_008341326.1| PREDICTED: LOW QUALITY PROTEIN: histone-lysine N-methyltransferase 
setd3 [Malus domestica]
Length=516

 Score =   299 bits (765),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 142/168 (85%), Positives = 151/168 (90%), Gaps = 0/168 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            V  RA GIKREY+ELDTVWFMAGSLFQQYPYDIPT+AFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  221  VHARAXGIKREYNELDTVWFMAGSLFQQYPYDIPTDAFPFEIFKQAFVAVQSCVVHLQKV  280

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            SLA+RFALV LG PLL+Y SNC+AML A+DGAVQLVVDRPYK GE I VWCGPQPNSKLL
Sbjct  281  SLAQRFALVLLGXPLLAYGSNCRAMLTAIDGAVQLVVDRPYKAGESIAVWCGPQPNSKLL  340

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHV  504
            INYGFVDEDN YDR+ +EAALNTEDPQYQDKR+ AQ NGK SVQ F V
Sbjct  341  INYGFVDEDNSYDRLVVEAALNTEDPQYQDKRMVAQGNGKLSVQTFQV  388



>gb|KJB40697.1| hypothetical protein B456_007G073800 [Gossypium raimondii]
Length=491

 Score =   298 bits (763),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 152/168 (90%), Gaps = 6/168 (4%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            V+ERAEGIKREY+ELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQ  
Sbjct  202  VLERAEGIKREYNELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQ--  259

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
                RFALVPLGPPLL+Y SNCKAML+AV+GAV+LVVDR  K GEPIVVWCGPQPNSKLL
Sbjct  260  ----RFALVPLGPPLLAYRSNCKAMLSAVNGAVELVVDRACKAGEPIVVWCGPQPNSKLL  315

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHV  504
            INYGFVD+DN YDR+ +EAALNTEDPQYQDKRL  QRNGK SVQ FHV
Sbjct  316  INYGFVDDDNSYDRLVVEAALNTEDPQYQDKRLVVQRNGKLSVQVFHV  363



>ref|XP_008656702.1| PREDICTED: [Fructose-bisphosphate aldolase]-lysine N-methyltransferase, 
chloroplastic-like [Zea mays]
Length=379

 Score =   291 bits (746),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 130/170 (76%), Positives = 155/170 (91%), Gaps = 0/170 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            V+ R E I+REY+ELDT+WFMAGSLFQQYP+DIPTEAFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  84   VVARDEAIRREYNELDTLWFMAGSLFQQYPFDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  143

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            SLARRFALVPLGPPLL+Y SNCKAML     +V+LVVDRPYK GEPI++WCGPQ NS+L+
Sbjct  144  SLARRFALVPLGPPLLTYKSNCKAMLTVDGESVRLVVDRPYKAGEPIIIWCGPQTNSRLV  203

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLI  510
            +NYGFVDE+NP+DR+++EA+LNTEDPQYQ+KR+ AQRNGK ++Q F+V +
Sbjct  204  LNYGFVDENNPFDRISIEASLNTEDPQYQEKRMVAQRNGKHAIQNFNVYV  253



>gb|AGT16868.1| Rubisco LS methyltransferase, substrate-binding domain [Saccharum 
hybrid cultivar R570]
Length=495

 Score =   295 bits (755),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 132/170 (78%), Positives = 155/170 (91%), Gaps = 0/170 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            ++ R E I+REY+ELDT+WFMAGSLFQQYP+DIPTEAFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  200  IVARDEAIRREYNELDTLWFMAGSLFQQYPFDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  259

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            SLARRFALVPLGPPLL+Y SNCKAML A   +V+LVVDRPYK GEPI++WCGPQ NS+L+
Sbjct  260  SLARRFALVPLGPPLLTYKSNCKAMLTADGDSVRLVVDRPYKAGEPIIIWCGPQTNSRLV  319

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLI  510
            +NYGFVDEDNP+DR+ +EA+LNTEDPQYQDKR+ AQRNGK ++Q F+V +
Sbjct  320  LNYGFVDEDNPFDRIAIEASLNTEDPQYQDKRMVAQRNGKLAIQNFNVYV  369



>ref|XP_008672132.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 ref|XP_008672133.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 tpg|DAA58397.1| TPA: hypothetical protein ZEAMMB73_027665 [Zea mays]
Length=512

 Score =   294 bits (752),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 133/170 (78%), Positives = 155/170 (91%), Gaps = 0/170 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            V+ R E I+REY+ELDT+WFMAGSLFQQYP+DIPTEAFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  217  VVARDEAIRREYNELDTLWFMAGSLFQQYPFDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  276

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            SLARRFALVPLGPPLL+Y SNCKAML A   +V+LVVDRPYK GEPI++WCGPQ NS+L+
Sbjct  277  SLARRFALVPLGPPLLTYRSNCKAMLTADGDSVRLVVDRPYKAGEPIIIWCGPQTNSRLV  336

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLI  510
            +NYGFVDEDNP+DRV +EA+LNTEDPQYQ+KR+ AQRNGK ++Q F+V +
Sbjct  337  LNYGFVDEDNPFDRVAIEASLNTEDPQYQEKRMVAQRNGKLAIQNFNVYV  386



>ref|XP_004960721.1| PREDICTED: ribosomal N-lysine methyltransferase set10-like [Setaria 
italica]
Length=514

 Score =   293 bits (749),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 132/170 (78%), Positives = 156/170 (92%), Gaps = 0/170 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            VI R E ++REY+ELDT+WFMAGSLFQQYP+DIPTEAFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  219  VIARDEAVRREYNELDTLWFMAGSLFQQYPFDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  278

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            SLARRFALVPLGPPLL+Y SNCKAML A   +V+LVVDRPYK GEPI+VWCGPQ NS+L+
Sbjct  279  SLARRFALVPLGPPLLTYKSNCKAMLTADGDSVRLVVDRPYKAGEPIIVWCGPQTNSRLV  338

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLI  510
            +NYGFVDEDNP+DR+++EA+LNTEDPQ+Q+KR+ AQRNGK ++Q F+V +
Sbjct  339  LNYGFVDEDNPFDRISIEASLNTEDPQFQEKRMVAQRNGKLAIQNFNVYV  388



>ref|XP_002456030.1| hypothetical protein SORBIDRAFT_03g029140 [Sorghum bicolor]
 gb|EES01150.1| hypothetical protein SORBIDRAFT_03g029140 [Sorghum bicolor]
Length=512

 Score =   291 bits (746),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 131/170 (77%), Positives = 155/170 (91%), Gaps = 0/170 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            V+ R E I+REY+ELDT+WFMAGSLFQQYP+DIPTEAFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  217  VVARDEAIRREYNELDTLWFMAGSLFQQYPFDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  276

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            SLARRFALVPLGPPLL+Y SNCKAML A   +V+LVVDRPYK GEPI++WCGPQ NS+L+
Sbjct  277  SLARRFALVPLGPPLLTYKSNCKAMLTADGDSVRLVVDRPYKAGEPIIIWCGPQTNSRLV  336

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLI  510
            +NYGFVDEDNP+DR+ +EA+LN+EDPQYQ+KR+ AQRNGK ++Q F+V +
Sbjct  337  LNYGFVDEDNPFDRIAIEASLNSEDPQYQEKRMVAQRNGKLAIQNFNVYV  386



>gb|ABK24248.1| unknown [Picea sitchensis]
Length=507

 Score =   291 bits (744),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 135/170 (79%), Positives = 152/170 (89%), Gaps = 0/170 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            ++ER  GIKREY ELDTVWFMAGSLF+QYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQ V
Sbjct  212  MLERNSGIKREYEELDTVWFMAGSLFKQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQNV  271

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            +LARRFALVPLGPPLLSY SNCKAML AV  +VQL VDR YK GEPIVVWCGPQPN++LL
Sbjct  272  NLARRFALVPLGPPLLSYKSNCKAMLKAVGDSVQLEVDREYKAGEPIVVWCGPQPNARLL  331

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLI  510
            +NYGFVDEDNP+DR+ +E +L+T+DP YQDKR+ AQRNGK SVQ F++ I
Sbjct  332  LNYGFVDEDNPHDRLIVEVSLDTKDPLYQDKRIIAQRNGKLSVQTFNIYI  381



>ref|XP_001762568.1| predicted protein [Physcomitrella patens]
 gb|EDQ72691.1| predicted protein [Physcomitrella patens]
Length=427

 Score =   278 bits (712),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 128/168 (76%), Positives = 144/168 (86%), Gaps = 0/168 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            V+ER  GIKREY ELDTVWFMAGSLF+QYP+D+PTEAF FEIFKQAFVAVQSCVVHLQ V
Sbjct  135  VLERLAGIKREYEELDTVWFMAGSLFKQYPFDLPTEAFSFEIFKQAFVAVQSCVVHLQGV  194

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            SLARRFALVPLGPPLL+Y SNCKAML AV   VQL VD  YKTG+PI VWCGPQPNSKLL
Sbjct  195  SLARRFALVPLGPPLLAYKSNCKAMLKAVGDNVQLEVDHAYKTGDPIAVWCGPQPNSKLL  254

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHV  504
            +NYGFVDEDNP+DR+ +EA+LNTEDP YQ KR   Q+N + ++Q F +
Sbjct  255  LNYGFVDEDNPFDRLAVEASLNTEDPLYQQKRAVVQKNNRLTIQTFQI  302



>ref|XP_001774765.1| predicted protein [Physcomitrella patens]
 gb|EDQ60436.1| predicted protein [Physcomitrella patens]
Length=523

 Score =   278 bits (710),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 128/168 (76%), Positives = 144/168 (86%), Gaps = 0/168 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            V+ER  GIKREY ELDTVWFMAGSLF+QYP+D+PTEAF FEIFKQAFVAVQSCVVHLQ V
Sbjct  231  VLERLAGIKREYEELDTVWFMAGSLFKQYPFDLPTEAFSFEIFKQAFVAVQSCVVHLQGV  290

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            SLARRFALVPLGPPLL+Y SNCKAML AVD  V L VDR YK G+PI VWCGPQPNSKLL
Sbjct  291  SLARRFALVPLGPPLLAYKSNCKAMLKAVDDNVVLEVDRAYKAGDPIAVWCGPQPNSKLL  350

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHV  504
            +NYGFVDEDNPYDR+ +EA+L+TEDP YQ KR   Q+N + ++Q F +
Sbjct  351  LNYGFVDEDNPYDRLAVEASLDTEDPLYQQKRAIVQKNNRLTIQTFQI  398



>gb|KDO55673.1| hypothetical protein CISIN_1g008853mg [Citrus sinensis]
Length=355

 Score =   268 bits (684),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 125/138 (91%), Positives = 131/138 (95%), Gaps = 0/138 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            ++ERAEGIKREY+ELDTVWFMAGSLFQQYPYDIPTEAF FEIFKQAFVAVQSCVVHLQKV
Sbjct  217  ILERAEGIKREYNELDTVWFMAGSLFQQYPYDIPTEAFTFEIFKQAFVAVQSCVVHLQKV  276

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            SLARRFALVPLGPPLL+Y S CKAMLAAVD AVQLVVDRPYK GE IVVWCGPQPNSKLL
Sbjct  277  SLARRFALVPLGPPLLAYSSKCKAMLAAVDDAVQLVVDRPYKAGESIVVWCGPQPNSKLL  336

Query  361  INYGFVDEDNPYDRVTLE  414
            INYGFVDEDNPYDR+ +E
Sbjct  337  INYGFVDEDNPYDRLVVE  354



>ref|XP_002978944.1| hypothetical protein SELMODRAFT_110000 [Selaginella moellendorffii]
 gb|EFJ19901.1| hypothetical protein SELMODRAFT_110000 [Selaginella moellendorffii]
Length=432

 Score =   267 bits (682),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 144/169 (85%), Gaps = 0/169 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            V+ER EGIKREY ELDTVWFMAGSLF++YP+DIPTEAF FEIFKQAFVAVQSCVVHLQ V
Sbjct  134  VLERLEGIKREYQELDTVWFMAGSLFKEYPFDIPTEAFSFEIFKQAFVAVQSCVVHLQGV  193

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            SL RRFALVPLGPPLL+Y SNCKAML A    V+L VDR YK GE I+VWCGPQPN++LL
Sbjct  194  SLPRRFALVPLGPPLLAYKSNCKAMLKAAGDLVRLEVDRAYKKGEQILVWCGPQPNTRLL  253

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVL  507
            +NYGFVD DNP+DR+++EA+LNT DP YQ+KR+  Q+N + ++Q F + 
Sbjct  254  LNYGFVDPDNPHDRLSVEASLNTRDPFYQNKRIIVQKNNRLTIQNFQIF  302



>ref|XP_002986460.1| hypothetical protein SELMODRAFT_269129 [Selaginella moellendorffii]
 gb|EFJ12317.1| hypothetical protein SELMODRAFT_269129 [Selaginella moellendorffii]
Length=432

 Score =   267 bits (682),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 144/169 (85%), Gaps = 0/169 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            V+ER EGIKREY ELDTVWFMAGSLF++YP+DIPTEAF FEIFKQAFVAVQSCVVHLQ V
Sbjct  134  VLERLEGIKREYQELDTVWFMAGSLFKEYPFDIPTEAFSFEIFKQAFVAVQSCVVHLQGV  193

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            SL RRFALVPLGPPLL+Y SNCKAML A    V+L VDR YK GE I+VWCGPQPN++LL
Sbjct  194  SLPRRFALVPLGPPLLAYKSNCKAMLKAAGDLVRLEVDRAYKKGEQILVWCGPQPNTRLL  253

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVL  507
            +NYGFVD DNP+DR+++EA+LNT DP YQ+KR+  Q+N + ++Q F + 
Sbjct  254  LNYGFVDPDNPHDRLSVEASLNTRDPFYQNKRIIVQKNNRLTIQNFQIF  302



>ref|XP_010250814.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X2 
[Nelumbo nucifera]
Length=487

 Score =   265 bits (677),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/156 (78%), Positives = 142/156 (91%), Gaps = 3/156 (2%)
 Frame = +1

Query  37   SELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLARRFALVPLG  216
            +ELD   ++ GS  +QYPYDIPTEAFPFEIFKQAFVA+QSCVVHLQKVSLARRFALVPLG
Sbjct  207  AELD---YLTGSATKQYPYDIPTEAFPFEIFKQAFVAIQSCVVHLQKVSLARRFALVPLG  263

Query  217  PPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLLINYGFVDEDNPY  396
            PPLL+Y S+CKAML AV+GA+QLVVDRPYK G+ IVVWCGPQPNS+LL+NYGFVDE+NPY
Sbjct  264  PPLLAYKSDCKAMLEAVEGAIQLVVDRPYKAGDSIVVWCGPQPNSRLLLNYGFVDENNPY  323

Query  397  DRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHV  504
            DR+ +EA+LNTEDPQYQ+KR+ AQR+GK +VQ FHV
Sbjct  324  DRIMVEASLNTEDPQYQEKRIVAQRHGKLAVQVFHV  359



>ref|XP_008800376.1| PREDICTED: [Fructose-bisphosphate aldolase]-lysine N-methyltransferase, 
chloroplastic-like isoform X3 [Phoenix dactylifera]
Length=494

 Score =   256 bits (654),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 139/170 (82%), Gaps = 18/170 (11%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            ++ER EGIKREY+ELDTVWFMAGSLFQ                  AFVAVQSCVVHLQKV
Sbjct  217  LLERDEGIKREYNELDTVWFMAGSLFQ------------------AFVAVQSCVVHLQKV  258

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            +LARRFALVPLGPPLL+Y SNCKAML AV  AV+LVVDRPYK GEPIVVWCGPQPNS+LL
Sbjct  259  NLARRFALVPLGPPLLAYKSNCKAMLTAVSDAVKLVVDRPYKAGEPIVVWCGPQPNSRLL  318

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLI  510
            +NYGFVDEDNPYDRV +EA+LN EDPQ+Q+KR+ AQRNGK +VQ F V +
Sbjct  319  LNYGFVDEDNPYDRVVVEASLNMEDPQFQEKRMVAQRNGKLAVQVFRVYV  368



>gb|KDO55670.1| hypothetical protein CISIN_1g008853mg [Citrus sinensis]
Length=481

 Score =   244 bits (623),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 121/168 (72%), Positives = 128/168 (76%), Gaps = 31/168 (18%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            ++ERAEGIKREY+ELDTVWFMAGSLFQ                               KV
Sbjct  217  ILERAEGIKREYNELDTVWFMAGSLFQ-------------------------------KV  245

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  360
            SLARRFALVPLGPPLL+Y S CKAMLAAVD AVQLVVDRPYK GE IVVWCGPQPNSKLL
Sbjct  246  SLARRFALVPLGPPLLAYSSKCKAMLAAVDDAVQLVVDRPYKAGESIVVWCGPQPNSKLL  305

Query  361  INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHV  504
            INYGFVDEDNPYDR+ +EAALNTEDPQYQDKR+ AQRNGK SVQ FHV
Sbjct  306  INYGFVDEDNPYDRLVVEAALNTEDPQYQDKRMVAQRNGKLSVQVFHV  353



>ref|XP_011396833.1| Histone-lysine N-methyltransferase setd3 [Auxenochlorella protothecoides]
 gb|KFM23955.1| Histone-lysine N-methyltransferase setd3 [Auxenochlorella protothecoides]
Length=453

 Score =   221 bits (564),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 109/172 (63%), Positives = 126/172 (73%), Gaps = 4/172 (2%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            V ER +GI REY+ELDTVWFMAGSLF QYPYDIPTE F  E+F+QAF AVQSCVVHLQ V
Sbjct  183  VNERMKGIDREYAELDTVWFMAGSLFNQYPYDIPTEQFTPEVFRQAFAAVQSCVVHLQGV  242

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLA--AVDGAVQLVVDRPYKTGEPIVVWCGPQPNSK  354
             L++RFALVPLGPPLL+Y S   AML        VQL  DR Y+ GEP++ WCGPQPNS+
Sbjct  243  PLSQRFALVPLGPPLLTYSSTASAMLRYDPTSREVQLAADRAYRPGEPVLAWCGPQPNSR  302

Query  355  LLINYGFVDEDNPYDRVTLEAALNTEDPQYQDK--RLAAQRNGKSSVQAFHV  504
            LL+NYG VDE NPYDR+ LEA +   DP Y  K  RLA Q  G ++ Q F +
Sbjct  303  LLLNYGIVDEANPYDRLPLEAIIPASDPLYSLKRGRLAEQGGGLATQQLFQL  354



>gb|KIY95099.1| hypothetical protein MNEG_12863, partial [Monoraphidium neglectum]
Length=281

 Score =   216 bits (549),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 100/160 (63%), Positives = 124/160 (78%), Gaps = 2/160 (1%)
 Frame = +1

Query  22   IKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLARRFA  201
            +++EY  LD VWFMAGSLF +YP+DIPTEAFPFE F+QAF AVQ+ VVHLQ V+ +RRFA
Sbjct  1    MRKEYEALDGVWFMAGSLFNKYPFDIPTEAFPFERFRQAFAAVQASVVHLQGVAPSRRFA  60

Query  202  LVPLGPPLLSYCSNCKAMLAAVDGA--VQLVVDRPYKTGEPIVVWCGPQPNSKLLINYGF  375
            LVPLGPPLLSY S CKAML+  D A  V+LVVDR Y+ G+P+  WCGPQPNS+LL+NYG 
Sbjct  61   LVPLGPPLLSYSSTCKAMLSHNDAAKRVELVVDRDYQVGDPVYAWCGPQPNSRLLLNYGI  120

Query  376  VDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQA  495
            VDE NP+D++ L   L + DP Y+ KR    + G S++QA
Sbjct  121  VDESNPFDKLQLTVTLPSSDPLYKAKRDKLDKAGLSTMQA  160



>ref|XP_005644855.1| hypothetical protein COCSUDRAFT_48681 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE20311.1| hypothetical protein COCSUDRAFT_48681 [Coccomyxa subellipsoidea 
C-169]
Length=539

 Score =   213 bits (542),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 100/170 (59%), Positives = 124/170 (73%), Gaps = 2/170 (1%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            + ER +GI++EY+ELDTVWFMAGSLF+ YPYD+PTEAF  ++F+Q F AVQ+ VVHLQ V
Sbjct  152  IKERLKGIEKEYAELDTVWFMAGSLFKSYPYDVPTEAFSLKLFRQGFAAVQASVVHLQGV  211

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGA--VQLVVDRPYKTGEPIVVWCGPQPNSK  354
             L++RFALVPLGPPLLSY S  KAML     A  VQL VDR Y  GEPI  WCGPQPN +
Sbjct  212  PLSKRFALVPLGPPLLSYSSTAKAMLTYNREAKEVQLAVDRSYTKGEPIEAWCGPQPNRR  271

Query  355  LLINYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHV  504
            LL+NYG V ++NP+D++ L   L   DP +Q KR   Q+N  S+ Q F +
Sbjct  272  LLLNYGIVTDNNPHDKMALTVTLPHADPLFQAKRAVLQQNNLSTQQTFQL  321



>ref|XP_005847730.1| hypothetical protein CHLNCDRAFT_57818 [Chlorella variabilis]
 gb|EFN55628.1| hypothetical protein CHLNCDRAFT_57818 [Chlorella variabilis]
Length=435

 Score =   200 bits (508),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 97/188 (52%), Positives = 126/188 (67%), Gaps = 3/188 (2%)
 Frame = +1

Query  10   RAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLA  189
            R +GI++EY ELDTVW++AGSLF + P+  PTE F F +F+QAF AVQS VVHLQ V+L 
Sbjct  146  RLQGIRKEYEELDTVWYLAGSLFNRQPFSPPTEQFSFPVFRQAFTAVQSSVVHLQGVALG  205

Query  190  RRFALVPLGPPLLSYCSNCKAMLA--AVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLLI  363
            +RFALVP+GPPLL+Y S  KAML        V+L VDR Y+ GE ++ WCGPQPNS+LLI
Sbjct  206  KRFALVPMGPPLLTYSSTAKAMLKFDPESHEVRLAVDRAYQPGEAVLAWCGPQPNSRLLI  265

Query  364  NYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLICSLFHLIFL*S  543
            NYG VDE NPYD++ L   + ++DP Y+ KR      G S+ Q F +   +      L  
Sbjct  266  NYGIVDESNPYDKLPLSITIPSDDPLYRLKRDRLAERGLSTQQTFQLQAAASLPAQLL-P  324

Query  544  FRRFYYST  567
            + R  +ST
Sbjct  325  YLRLVHST  332



>ref|NP_001132025.1| hypothetical protein [Zea mays]
 gb|ACF80700.1| unknown [Zea mays]
 tpg|DAA58395.1| TPA: hypothetical protein ZEAMMB73_027665 [Zea mays]
 tpg|DAA58396.1| TPA: hypothetical protein ZEAMMB73_027665 [Zea mays]
Length=252

 Score =   189 bits (479),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = +1

Query  160  VVHLQKVSLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGP  339
            ++  QKVSLARRFALVPLGPPLL+Y SNCKAML A   +V+LVVDRPYK GEPI++WCGP
Sbjct  10   LIQEQKVSLARRFALVPLGPPLLTYRSNCKAMLTADGDSVRLVVDRPYKAGEPIIIWCGP  69

Query  340  QPNSKLLINYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLI  510
            Q NS+L++NYGFVDEDNP+DRV +EA+LNTEDPQYQ+KR+ AQRNGK ++Q F+V +
Sbjct  70   QTNSRLVLNYGFVDEDNPFDRVAIEASLNTEDPQYQEKRMVAQRNGKLAIQNFNVYV  126



>gb|AFW83391.1| hypothetical protein ZEAMMB73_866859 [Zea mays]
 gb|AFW83392.1| hypothetical protein ZEAMMB73_866859 [Zea mays]
Length=252

 Score =   187 bits (474),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = +1

Query  160  VVHLQKVSLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGP  339
            ++  QKVSLARRFALVPLGPPLL+Y SNCKAML     +V+LVVDRPYK GEPI++WCGP
Sbjct  10   LIQEQKVSLARRFALVPLGPPLLTYKSNCKAMLTVDGESVRLVVDRPYKAGEPIIIWCGP  69

Query  340  QPNSKLLINYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLI  510
            Q NS+L++NYGFVDE+NP+DR+++EA+LNTEDPQYQ+KR+ AQRNGK ++Q F+V +
Sbjct  70   QTNSRLVLNYGFVDENNPFDRISIEASLNTEDPQYQEKRMVAQRNGKHAIQNFNVYV  126



>ref|XP_002955272.1| hypothetical protein VOLCADRAFT_76643 [Volvox carteri f. nagariensis]
 gb|EFJ43572.1| hypothetical protein VOLCADRAFT_76643 [Volvox carteri f. nagariensis]
Length=488

 Score =   192 bits (488),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/175 (51%), Positives = 120/175 (69%), Gaps = 4/175 (2%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            V +R  GI++EY  LDTVWFMAGSLF +YP+D+PTE F FE+F+QAF  VQ+ +VHLQ V
Sbjct  180  VRQRQAGIRKEYEALDTVWFMAGSLFNKYPFDLPTETFSFELFQQAFAVVQASIVHLQGV  239

Query  181  SLARRFALVPLGPPLLSYCSNCKAMLAAVDG--AVQLVVDRPYKTGEPIVVWCGPQPNSK  354
             +A+RFALVPLGPPL++Y S  K M+   +   +V+LVV  P + G P+  WCGPQPNS+
Sbjct  240  PIAKRFALVPLGPPLMAYSSTSKNMMTYDEDSRSVRLVVSGPVEAGRPVAAWCGPQPNSR  299

Query  355  LLINYGFVDEDNPYDRV--TLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLIC  513
            LL+NYG VDE NP+D++       L T DP +  KR      G ++ Q+F V + 
Sbjct  300  LLLNYGVVDEHNPFDKLQARFTFTLPTSDPLFPAKRAVLSEAGLATQQSFDVSVA  354



>gb|AFW83393.1| hypothetical protein ZEAMMB73_866859 [Zea mays]
Length=281

 Score =   186 bits (472),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = +1

Query  160  VVHLQKVSLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGP  339
            ++  QKVSLARRFALVPLGPPLL+Y SNCKAML     +V+LVVDRPYK GEPI++WCGP
Sbjct  10   LIQEQKVSLARRFALVPLGPPLLTYKSNCKAMLTVDGESVRLVVDRPYKAGEPIIIWCGP  69

Query  340  QPNSKLLINYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLI  510
            Q NS+L++NYGFVDE+NP+DR+++EA+LNTEDPQYQ+KR+ AQRNGK ++Q F+V +
Sbjct  70   QTNSRLVLNYGFVDENNPFDRISIEASLNTEDPQYQEKRMVAQRNGKHAIQNFNVYV  126



>gb|EMT26543.1| hypothetical protein F775_31105 [Aegilops tauschii]
Length=257

 Score =   155 bits (391),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = +1

Query  172  QKVSLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNS  351
            QKVSLARRFALVPLGPPLL+Y SNCKAML AVDG+V+L+VDRPYK GEPI+VWCGPQPNS
Sbjct  48   QKVSLARRFALVPLGPPLLTYKSNCKAMLTAVDGSVRLLVDRPYKAGEPIIVWCGPQPNS  107

Query  352  KLLINYGFVDEDNPYDRVTLEAALNTE  432
            +LL+NYGFVDEDNPYDR+ +E  +  E
Sbjct  108  RLLLNYGFVDEDNPYDRIAIEVCVGKE  134



>gb|KDD71504.1| hypothetical protein H632_c4901p0, partial [Helicosporidium sp. 
ATCC 50920]
Length=168

 Score =   151 bits (381),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 78/138 (57%), Positives = 94/138 (68%), Gaps = 4/138 (3%)
 Frame = +1

Query  97   IPTEAFPFEIFKQAFVAVQSCVVHLQKVSLARRFALVPLGPPLLSYCSNCKAMLAAVDGA  276
            +PTE F   +F QAF AVQS VVHLQ V LARRFA+VPLGPPLL Y S C+A L   + +
Sbjct  1    MPTEQFDLPLFAQAFAAVQSSVVHLQGVPLARRFAIVPLGPPLLRYSSRCRAALRYDEES  60

Query  277  --VQLVVDRPYKTGEPIVVWCGPQPNSKLLINYGFVDEDNPYDRVTLEAALNTEDPQYQD  450
              V+L VDR    GE +V WCGPQPNS+LLINYGFVD DNPYD + L  +L++EDP +  
Sbjct  61   DQVRLAVDRDVAAGEALVAWCGPQPNSRLLINYGFVDPDNPYDMLELVVSLSSEDPLFHR  120

Query  451  K--RLAAQRNGKSSVQAF  498
            K  RLA  +    + Q F
Sbjct  121  KRSRLAGTQAKLGTRQVF  138



>ref|XP_002509559.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50946.1| conserved hypothetical protein [Ricinus communis]
Length=348

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/58 (93%), Positives = 57/58 (98%), Gaps = 0/58 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQ  174
            V+ERA+GIKREY ELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVA+QSCVVHLQ
Sbjct  133  VLERADGIKREYDELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAIQSCVVHLQ  190


 Score = 57.8 bits (138),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +1

Query  403  VTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLI  510
            V L+AALNTEDPQYQDKR+ AQRNGK S+Q F + +
Sbjct  187  VHLQAALNTEDPQYQDKRMVAQRNGKLSIQVFQIYV  222


 Score = 45.4 bits (106),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = +3

Query  576  QVYVGREKETISEMLPYLRLGYVS  647
            Q+YVG+EKE IS++LPYLRLGYVS
Sbjct  219  QIYVGKEKEAISDILPYLRLGYVS  242



>gb|AFW83390.1| hypothetical protein ZEAMMB73_201403, partial [Zea mays]
Length=130

 Score =   111 bits (277),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 50/58 (86%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQ  174
            V+ R E I+REY+ELDT+WFMAGSLFQQYP+DIPTEAFPFEIFKQAFVAVQSCVVHLQ
Sbjct  71   VVARDEAIRREYNELDTLWFMAGSLFQQYPFDIPTEAFPFEIFKQAFVAVQSCVVHLQ  128



>gb|EMT26542.1| hypothetical protein F775_31104 [Aegilops tauschii]
Length=393

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            V+ R EGI+REY+ELDT+WFMAGSLF+QYP+D+PTEAFPFEIFKQAFVAVQSCVVHLQ +
Sbjct  240  VVVRDEGIRREYNELDTLWFMAGSLFKQYPFDVPTEAFPFEIFKQAFVAVQSCVVHLQDL  299

Query  181  S  183
            +
Sbjct  300  N  300



>ref|XP_002320530.2| hypothetical protein POPTR_0014s16720g [Populus trichocarpa]
 gb|EEE98845.2| hypothetical protein POPTR_0014s16720g [Populus trichocarpa]
Length=561

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 56/169 (33%), Positives = 84/169 (50%), Gaps = 13/169 (8%)
 Frame = +1

Query  4    IERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVS  183
            IER   +   Y++L         +F +YP+  P E F  E FK +F  + S +V L   S
Sbjct  259  IERITNVTGTYNDLRL------RIFSKYPHLFPEEVFNMETFKWSFGILFSRLVRLP--S  310

Query  184  LARRFALVPLGPPLLSYCSNCKAMLA--AVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKL  357
            +  R ALVP    +L++ S  +  L        V    DRPY+ GE + +  G + N +L
Sbjct  311  MDGRVALVPWAD-MLNHSSEVETFLDYDKSSKGVVFTTDRPYQPGEQVFISYGRKSNGEL  369

Query  358  LINYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAF  498
            L++YGFV  +  NP D V L  +L   D  Y++K  A +++G S  Q F
Sbjct  370  LLSYGFVPREGTNPSDSVELSLSLKKSDKCYKEKLEALKKHGLSVSQCF  418



>ref|XP_010464405.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like [Camelina 
sativa]
Length=507

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 56/172 (33%), Positives = 87/172 (51%), Gaps = 7/172 (4%)
 Frame = +1

Query  10   RAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLA  189
            R   I+R  + + T   +   +F ++P+  P E F  E FK +F  + S +V L   S+ 
Sbjct  199  RERAIERITNVVGTYEDLRSRIFSKHPHLFPKEVFNDETFKWSFGILFSRLVRLP--SMD  256

Query  190  RRFALVPLGPPLLSYCSNCKAMLA--AVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLLI  363
             RFALVP    +L++    +  L        V    DRPY+ GE + +  G + N +LL+
Sbjct  257  GRFALVPWAD-MLNHNCEVETFLDYDKSSKGVVFTTDRPYQPGEQVFISYGNKSNGELLL  315

Query  364  NYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLIC  513
            +YGFV  +  NP D V L  +L   D  Y++K  A +++G S+ Q F V I 
Sbjct  316  SYGFVPREGTNPSDSVELALSLRKNDKCYKEKLDALKKHGLSTPQCFPVRIT  367



>ref|XP_002882542.1| SET domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58801.1| SET domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=504

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 56/171 (33%), Positives = 87/171 (51%), Gaps = 7/171 (4%)
 Frame = +1

Query  10   RAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLA  189
            R   I+R  + + T   +   +F ++P+  P E F  E FK +F  + S +V L   S+ 
Sbjct  198  RERAIERITNVVGTYEDLRSRIFSKHPHLFPKEVFNDETFKWSFGILFSRLVRLP--SMD  255

Query  190  RRFALVPLGPPLLSYCSNCKAMLA--AVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLLI  363
             RFALVP    +L++    +  L        V    DRPY+ GE + +  G + N +LL+
Sbjct  256  GRFALVPWAD-MLNHNCEVETFLDYDKSSKGVVFTTDRPYQPGEQVFISYGNKSNGELLL  314

Query  364  NYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLI  510
            +YGFV  +  NP D V L  +L   D  Y++K  A +++G S+ Q F V I
Sbjct  315  SYGFVPREGTNPSDSVELALSLRKNDKCYKEKLDALKKHGLSTPQCFPVRI  365



>ref|XP_011008074.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Populus euphratica]
Length=503

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 55/169 (33%), Positives = 84/169 (50%), Gaps = 13/169 (8%)
 Frame = +1

Query  4    IERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVS  183
            IER   +   Y++L         +F +YP+  P E F  E FK +F  + S +V L   S
Sbjct  201  IERITNVTGTYNDLRL------RIFSKYPHLFPEEVFNMETFKWSFGILFSRLVRLP--S  252

Query  184  LARRFALVPLGPPLLSYCSNCKAMLA--AVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKL  357
            +  R ALVP    +L++    +  L        V    DRPY+ GE + +  G + N +L
Sbjct  253  MDGRVALVPWAD-MLNHSCEVETFLDYDKSSKGVVFTTDRPYQPGEQVFISYGRKSNGEL  311

Query  358  LINYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAF  498
            L++YGFV  +  NP D V L  +L   D  Y++K  A +++G S+ Q F
Sbjct  312  LLSYGFVPSEGTNPSDSVELPLSLKKSDKYYKEKLEALKKHGLSASQCF  360



>ref|XP_006297498.1| hypothetical protein CARUB_v10013517mg [Capsella rubella]
 gb|EOA30396.1| hypothetical protein CARUB_v10013517mg [Capsella rubella]
Length=498

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 56/171 (33%), Positives = 87/171 (51%), Gaps = 7/171 (4%)
 Frame = +1

Query  10   RAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLA  189
            R   I+R  + + T   +   +F ++P+  P E F  E FK +F  + S +V L   S+ 
Sbjct  199  RERAIERITNVVGTYEDLRSRIFSKHPHLFPKEVFNDETFKWSFGILFSRLVRLP--SMD  256

Query  190  RRFALVPLGPPLLSYCSNCKAMLA--AVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLLI  363
             RFALVP    +L++    +  L        V    DRPY+ GE + +  G + N +LL+
Sbjct  257  GRFALVPWAD-MLNHNCEVETFLDYDKSSKGVVFTTDRPYQPGEQVFISYGNKSNGELLL  315

Query  364  NYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLI  510
            +YGFV  +  NP D V L  +L   D  Y++K  A +++G S+ Q F V I
Sbjct  316  SYGFVPREGTNPSDSVELALSLRKTDECYKEKLDALKKHGLSTPQCFPVRI  366



>gb|KCW89047.1| hypothetical protein EUGRSUZ_A01370 [Eucalyptus grandis]
Length=344

 Score = 75.9 bits (185),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 85/172 (49%), Gaps = 7/172 (4%)
 Frame = +1

Query  10   RAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLA  189
            R   I+R  + + T   +   +F ++P   P E F  E FK +F  + S +V L   S+ 
Sbjct  38   RERAIERITNVIGTYDDLRSRIFSKHPELFPEEVFNLETFKWSFGILFSRLVRLP--SMD  95

Query  190  RRFALVPLGPPLLSYCSNCKAMLA--AVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLLI  363
             R ALVP    +L++    +  L   +    +    DRPY+ GE + +  G + N +LL+
Sbjct  96   GRVALVPWAD-MLNHSCEVETFLDYDSSSRGIVFTTDRPYQAGEQVFISYGRKSNGELLL  154

Query  364  NYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLIC  513
            +YGFV ++  NP D V L  +L   D  Y  K  A +++G S+ Q F V I 
Sbjct  155  SYGFVPKEGTNPSDSVELLLSLKKSDKSYSQKLEALRKHGLSASQCFPVQIT  206



>ref|XP_004502116.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like [Cicer arietinum]
Length=503

 Score = 76.6 bits (187),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 55/173 (32%), Positives = 86/173 (50%), Gaps = 13/173 (8%)
 Frame = +1

Query  4    IERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVS  183
            IER   +   Y++L         +F +YP   P E F  + FK +F  + S +V L   S
Sbjct  201  IERTNNVIGTYNDLRL------RIFSKYPDFFPEEVFNIDSFKWSFGILFSRMVRLP--S  252

Query  184  LARRFALVPLGPPLLSYCSNCKAMLA--AVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKL  357
            +  + ALVP    +L++  + +  L    V   +    DRPY+ GE + +  G + N +L
Sbjct  253  MDGKVALVPWAD-MLNHSCDVETFLDYDKVSKGIVFTTDRPYQPGEQVFISYGKKSNGEL  311

Query  358  LINYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLI  510
            L++YGFV ++  NP D V L  +LN  D  Y++K    ++ G S  Q F V I
Sbjct  312  LLSYGFVPKEGTNPCDSVELSLSLNKSDESYEEKLELLKKYGLSGSQCFPVRI  364



>gb|AAC14296.1| putative methyltransferase [Arabidopsis thaliana]
Length=504

 Score = 76.6 bits (187),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 56/171 (33%), Positives = 86/171 (50%), Gaps = 7/171 (4%)
 Frame = +1

Query  10   RAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLA  189
            R   I+R  + + T   +   +F ++P   P E F  E FK +F  + S +V L   S+ 
Sbjct  198  RERAIERITNVVGTYEDLRSRIFSKHPQLFPKEVFNDETFKWSFGILFSRLVRLP--SMD  255

Query  190  RRFALVPLGPPLLSYCSNCKAMLA--AVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLLI  363
             RFALVP    +L++    +  L        V    DRPY+ GE + +  G + N +LL+
Sbjct  256  GRFALVPWAD-MLNHNCEVETFLDYDKSSKGVVFTTDRPYQPGEQVFISYGNKSNGELLL  314

Query  364  NYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLI  510
            +YGFV  +  NP D V L  +L   D  Y++K  A +++G S+ Q F V I
Sbjct  315  SYGFVPREGTNPSDSVELALSLRKNDKCYEEKLDALKKHGLSTPQCFPVRI  365



>ref|NP_187424.1| Rubisco methyltransferase family protein [Arabidopsis thaliana]
 gb|AAF13085.1|AC009176_12 putative ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit N-methyltransferase I [Arabidopsis thaliana]
 gb|AAF21177.1|AC013483_1 putative ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit N-methyltransferase I [Arabidopsis thaliana]
 gb|AAK76599.1| putative ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit N-methyltransferase I [Arabidopsis thaliana]
 gb|AAL85066.1| putative ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit N-methyltransferase I [Arabidopsis thaliana]
 gb|AEE74585.1| Rubisco methyltransferase family protein [Arabidopsis thaliana]
Length=504

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 56/171 (33%), Positives = 86/171 (50%), Gaps = 7/171 (4%)
 Frame = +1

Query  10   RAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLA  189
            R   I+R  + + T   +   +F ++P   P E F  E FK +F  + S +V L   S+ 
Sbjct  198  RERAIERITNVVGTYEDLRSRIFSKHPQLFPKEVFNDETFKWSFGILFSRLVRLP--SMD  255

Query  190  RRFALVPLGPPLLSYCSNCKAMLA--AVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLLI  363
             RFALVP    +L++    +  L        V    DRPY+ GE + +  G + N +LL+
Sbjct  256  GRFALVPWAD-MLNHNCEVETFLDYDKSSKGVVFTTDRPYQPGEQVFISYGNKSNGELLL  314

Query  364  NYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLI  510
            +YGFV  +  NP D V L  +L   D  Y++K  A +++G S+ Q F V I
Sbjct  315  SYGFVPREGTNPSDSVELALSLRKNDKCYEEKLDALKKHGLSTPQCFPVRI  365



>gb|AAM61650.1| putative ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit N-methyltransferase I [Arabidopsis thaliana]
Length=504

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 56/171 (33%), Positives = 86/171 (50%), Gaps = 7/171 (4%)
 Frame = +1

Query  10   RAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLA  189
            R   I+R  + + T   +   +F ++P   P E F  E FK +F  + S +V L   S+ 
Sbjct  198  RERAIERITNVVGTYEDLRSRIFSKHPQLFPKEVFNDETFKWSFGILFSRLVRLP--SMD  255

Query  190  RRFALVPLGPPLLSYCSNCKAMLA--AVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLLI  363
             RFALVP    +L++    +  L        V    DRPY+ GE + +  G + N +LL+
Sbjct  256  GRFALVPWAD-MLNHNCEVETFLDYDKSSKGVIFTTDRPYQPGEQVFISYGNKSNGELLL  314

Query  364  NYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLI  510
            +YGFV  +  NP D V L  +L   D  Y++K  A +++G S+ Q F V I
Sbjct  315  SYGFVPREGTNPSDSVELALSLRKNDKCYEEKLDALKKHGLSTPQCFPVRI  365



>gb|KCW89046.1| hypothetical protein EUGRSUZ_A01370 [Eucalyptus grandis]
Length=381

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 85/172 (49%), Gaps = 7/172 (4%)
 Frame = +1

Query  10   RAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLA  189
            R   I+R  + + T   +   +F ++P   P E F  E FK +F  + S +V L   S+ 
Sbjct  75   RERAIERITNVIGTYDDLRSRIFSKHPELFPEEVFNLETFKWSFGILFSRLVRLP--SMD  132

Query  190  RRFALVPLGPPLLSYCSNCKAMLA--AVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLLI  363
             R ALVP    +L++    +  L   +    +    DRPY+ GE + +  G + N +LL+
Sbjct  133  GRVALVPWAD-MLNHSCEVETFLDYDSSSRGIVFTTDRPYQAGEQVFISYGRKSNGELLL  191

Query  364  NYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLIC  513
            +YGFV ++  NP D V L  +L   D  Y  K  A +++G S+ Q F V I 
Sbjct  192  SYGFVPKEGTNPSDSVELLLSLKKSDKSYSQKLEALRKHGLSASQCFPVQIT  243



>ref|XP_010486336.1| PREDICTED: histone-lysine N-methyltransferase setd3-like [Camelina 
sativa]
Length=507

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 56/172 (33%), Positives = 86/172 (50%), Gaps = 7/172 (4%)
 Frame = +1

Query  10   RAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLA  189
            R   I+R  + + T   +   +F ++P   P E F  E FK +F  + S +V L   S+ 
Sbjct  199  RERAIERITNVVGTYEDLRSRIFSKHPNLFPKEVFNDETFKWSFGILFSRLVRLP--SMD  256

Query  190  RRFALVPLGPPLLSYCSNCKAMLA--AVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLLI  363
             RFALVP    +L++    +  L        V    DRPY+ GE + +  G + N +LL+
Sbjct  257  GRFALVPWAD-MLNHNCEVETFLDYDKSSKGVVFTTDRPYQPGEQVFISYGNKSNGELLL  315

Query  364  NYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLIC  513
            +YGFV  +  NP D V L  +L   D  Y++K  A +++G S+ Q F V I 
Sbjct  316  SYGFVPREGTNPSDSVELALSLRKNDKCYKEKLDALKKHGLSTPQCFPVRIT  367



>gb|KCW89043.1| hypothetical protein EUGRSUZ_A01370 [Eucalyptus grandis]
 gb|KCW89044.1| hypothetical protein EUGRSUZ_A01370 [Eucalyptus grandis]
Length=439

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 85/172 (49%), Gaps = 7/172 (4%)
 Frame = +1

Query  10   RAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLA  189
            R   I+R  + + T   +   +F ++P   P E F  E FK +F  + S +V L   S+ 
Sbjct  133  RERAIERITNVIGTYDDLRSRIFSKHPELFPEEVFNLETFKWSFGILFSRLVRLP--SMD  190

Query  190  RRFALVPLGPPLLSYCSNCKAMLA--AVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLLI  363
             R ALVP    +L++    +  L   +    +    DRPY+ GE + +  G + N +LL+
Sbjct  191  GRVALVPWAD-MLNHSCEVETFLDYDSSSRGIVFTTDRPYQAGEQVFISYGRKSNGELLL  249

Query  364  NYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLIC  513
            +YGFV ++  NP D V L  +L   D  Y  K  A +++G S+ Q F V I 
Sbjct  250  SYGFVPKEGTNPSDSVELLLSLKKSDKSYSQKLEALRKHGLSASQCFPVQIT  301



>ref|XP_006407809.1| hypothetical protein EUTSA_v10020552mg [Eutrema salsugineum]
 gb|ESQ49262.1| hypothetical protein EUTSA_v10020552mg [Eutrema salsugineum]
Length=506

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 56/172 (33%), Positives = 86/172 (50%), Gaps = 7/172 (4%)
 Frame = +1

Query  10   RAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLA  189
            R   I+R  + + T   +   +F ++P   P E F  E FK +F  + S +V L   S+ 
Sbjct  199  RERAIERITNVVGTYEDLRSRIFSKHPNLFPKEVFNDETFKWSFGILFSRLVRLP--SMD  256

Query  190  RRFALVPLGPPLLSYCSNCKAMLA--AVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLLI  363
             RFALVP    +L++    +  L        V    DRPY+ GE + +  G + N +LL+
Sbjct  257  GRFALVPWAD-MLNHNCEVETYLDYDTSSKGVVFTADRPYQPGEQVFISYGNKSNGELLL  315

Query  364  NYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLIC  513
            +YGFV  +  NP D V L  +L   D  Y++K  A +++G S+ Q F V I 
Sbjct  316  SYGFVPREGTNPSDSVELAMSLRKNDKCYKEKLDALKKHGLSTPQCFPVRIT  367



>gb|KCW89045.1| hypothetical protein EUGRSUZ_A01370 [Eucalyptus grandis]
Length=464

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 85/172 (49%), Gaps = 7/172 (4%)
 Frame = +1

Query  10   RAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLA  189
            R   I+R  + + T   +   +F ++P   P E F  E FK +F  + S +V L   S+ 
Sbjct  133  RERAIERITNVIGTYDDLRSRIFSKHPELFPEEVFNLETFKWSFGILFSRLVRLP--SMD  190

Query  190  RRFALVPLGPPLLSYCSNCKAMLA--AVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLLI  363
             R ALVP    +L++    +  L   +    +    DRPY+ GE + +  G + N +LL+
Sbjct  191  GRVALVPWAD-MLNHSCEVETFLDYDSSSRGIVFTTDRPYQAGEQVFISYGRKSNGELLL  249

Query  364  NYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLIC  513
            +YGFV ++  NP D V L  +L   D  Y  K  A +++G S+ Q F V I 
Sbjct  250  SYGFVPKEGTNPSDSVELLLSLKKSDKSYSQKLEALRKHGLSASQCFPVQIT  301



>ref|XP_009124214.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Brassica 
rapa]
Length=507

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 56/171 (33%), Positives = 83/171 (49%), Gaps = 5/171 (3%)
 Frame = +1

Query  10   RAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLA  189
            R   I+R  + + T   +   +F ++P   P E F  E FK +F  + S +V L   S+ 
Sbjct  200  RERAIERITNVVGTYEDLRSRIFSKHPNLFPKEVFNDETFKWSFGILFSRLVRLP--SMD  257

Query  190  RRFALVPLGPPLLSYCSNCKAM-LAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLLIN  366
             RFALVP    L   C     +        V    DRPY+ GE + +  G + N +LL++
Sbjct  258  GRFALVPWADMLNHNCEVETYLDYDKSSKGVVFTADRPYQPGEQVFISYGNKSNGELLLS  317

Query  367  YGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLIC  513
            YGFV  +  NP D V L  +L   D  Y++K  A +++G S+ Q F V I 
Sbjct  318  YGFVPREGTNPSDSVELAMSLRKNDTCYKEKLDALKKHGLSTPQCFPVRIT  368



>ref|XP_010252799.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Nelumbo 
nucifera]
Length=502

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 59/176 (34%), Positives = 88/176 (50%), Gaps = 17/176 (10%)
 Frame = +1

Query  4    IERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVS  183
            IER   +   Y++L         +F +YP+  P E F  E FK +F  + S +V L   S
Sbjct  200  IERITDVTGTYNDLRL------RIFSKYPHLFPEEVFNMETFKWSFGILFSRLVRLP--S  251

Query  184  LARRFALVPLGPPLLSYCSNCKA-MLAAVDGAVQLVV---DRPYKTGEPIVVWCGPQPNS  351
            +  R ALVP    L     NC+       D + Q +V   D+PY+ GE + +  G + N 
Sbjct  252  MDGRVALVPWADML---NHNCEVETYLDYDKSSQGIVFTTDQPYQPGEQVFISYGKKSNG  308

Query  352  KLLINYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLIC  513
            +LL++YGFV  +  NP D V L  +LN  D  Y++K  A +++G S  Q F + I 
Sbjct  309  ELLLSYGFVPREGTNPNDMVELPLSLNKSDKCYREKSEALRKHGLSVSQRFPLQIT  364



>emb|CDY22127.1| BnaC01g39740D [Brassica napus]
Length=507

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 57/174 (33%), Positives = 83/174 (48%), Gaps = 11/174 (6%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
             IER   +   Y +L +       +F ++P   P E F  E FK +F  + S +V L   
Sbjct  203  AIERITNVVVTYEDLRS------RIFSKHPNLFPKEVFNDETFKWSFGILFSRLVRLP--  254

Query  181  SLARRFALVPLGPPLLSYCSNCKAM-LAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKL  357
            S+  RFALVP    L   C     +        V    DRPY+ GE + +  G + N +L
Sbjct  255  SMDGRFALVPWADMLNHNCEVETYLDYDKSSKGVVFTADRPYQPGEQVFISYGNKSNGEL  314

Query  358  LINYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLIC  513
            L++YGFV  +  NP D V L  +L   D  Y++K  A +++G S+ Q F V I 
Sbjct  315  LLSYGFVPREGTNPSDSVELAMSLRKNDTCYKEKLDALKKHGLSTPQCFPVRIT  368



>ref|XP_010048281.1| PREDICTED: LOW QUALITY PROTEIN: ribulose-1,5 bisphosphate carboxylase/oxygenase 
large subunit N-methyltransferase, chloroplastic 
[Eucalyptus grandis]
Length=506

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 85/172 (49%), Gaps = 7/172 (4%)
 Frame = +1

Query  10   RAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLA  189
            R   I+R  + + T   +   +F ++P   P E F  E FK +F  + S +V L   S+ 
Sbjct  200  RERAIERITNVIGTYDDLRSRIFSKHPELFPEEVFNLETFKWSFGILFSRLVRLP--SMD  257

Query  190  RRFALVPLGPPLLSYCSNCKAMLA--AVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLLI  363
             R ALVP    +L++    +  L   +    +    DRPY+ GE + +  G + N +LL+
Sbjct  258  GRVALVPWAD-MLNHSCEVETFLDYDSSSRGIVFTTDRPYQAGEQVFISYGRKSNGELLL  316

Query  364  NYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLIC  513
            +YGFV ++  NP D V L  +L   D  Y  K  A +++G S+ Q F V I 
Sbjct  317  SYGFVPKEGTNPSDSVELLLSLKKSDKSYSQKLEALRKHGLSASQCFPVQIT  368



>ref|XP_010524627.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Tarenaya hassleriana]
Length=508

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 85/172 (49%), Gaps = 7/172 (4%)
 Frame = +1

Query  10   RAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLA  189
            R   I+R  + L T   +   +F ++P   P E F  E F  +F  + S +V L   S+ 
Sbjct  202  RERAIERVTNVLGTYDDLRSRIFSKHPLLFPEEVFNVETFIWSFGILFSRLVRLP--SMD  259

Query  190  RRFALVPLGPPLLSYCSNCKAMLA--AVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLLI  363
             RFALVP    +L++    K  L        V    DRPY+ GE + +  G + N +LL+
Sbjct  260  GRFALVPWAD-MLNHNCEVKTFLDYDKSSKGVVFTTDRPYQPGEQVFISYGNKSNGELLL  318

Query  364  NYGFV--DEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLIC  513
            +YGFV  +  NP D V L  +L   D  Y++K  A +++G ++ Q F + + 
Sbjct  319  SYGFVPGEGTNPSDSVELSVSLRKTDKCYKEKLDALRKHGLTTPQCFPIRVT  370



>ref|XP_010456598.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like [Camelina 
sativa]
Length=507

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 55/172 (32%), Positives = 86/172 (50%), Gaps = 7/172 (4%)
 Frame = +1

Query  10   RAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLA  189
            R   I+R  + + T   +   +F ++P   P E F  + FK +F  + S +V L   S+ 
Sbjct  199  RERAIERITNVVGTYEDLRSRIFSKHPNLFPKEVFNDDTFKWSFGILFSRLVRLP--SMD  256

Query  190  RRFALVPLGPPLLSYCSNCKAMLA--AVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLLI  363
             RFALVP    +L++    +  L        V    DRPY+ GE + +  G + N +LL+
Sbjct  257  GRFALVPWAD-MLNHNCEVETFLDYDKSSKGVVFTTDRPYQPGEQVFISYGNKSNGELLL  315

Query  364  NYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLIC  513
            +YGFV  +  NP D V L  +L   D  Y++K  A +++G S+ Q F V I 
Sbjct  316  SYGFVPREGTNPSDSVELALSLRKNDKCYKEKLDALKKHGLSTPQCFPVRIT  367



>gb|KFK38228.1| hypothetical protein AALP_AA3G085300 [Arabis alpina]
Length=506

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 55/172 (32%), Positives = 86/172 (50%), Gaps = 7/172 (4%)
 Frame = +1

Query  10   RAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLA  189
            R   I+R  + + T   +   +F ++P   P E F  + FK +F  + S +V L   S+ 
Sbjct  199  RERAIERITNVVGTYEDLRSRIFSKHPNLFPKEVFNDDTFKWSFGILFSRLVRLP--SMD  256

Query  190  RRFALVPLGPPLLSYCSNCKAMLA--AVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLLI  363
             RFALVP    +L++    +  L        V    DRPY+ GE + +  G + N +LL+
Sbjct  257  GRFALVPWAD-MLNHNCEVETYLDYDKSSKGVVFTADRPYQPGEQVFISYGNKSNGELLL  315

Query  364  NYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLIC  513
            +YGFV  +  NP D V L  +L   D  Y++K  A +++G S+ Q F V I 
Sbjct  316  SYGFVPREGTNPSDSVELAVSLRKNDACYKEKLDALKKHGLSTPQCFPVRIT  367



>gb|KHN39942.1| Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit 
N-methyltransferase, chloroplastic [Glycine soja]
Length=409

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 53/174 (30%), Positives = 83/174 (48%), Gaps = 13/174 (7%)
 Frame = +1

Query  4    IERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVS  183
            IER   +   Y++L         +F +YP   P E F  E FK +F  + S +V L   S
Sbjct  112  IERINNVIGTYNDLRL------RIFSKYPDLFPDEVFNIESFKWSFGILFSRLVRLP--S  163

Query  184  LARRFALVPLGPPLLSYCSNCKAMLA--AVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKL  357
            +    ALVP    +L++  + +  L        +    DRPY+ GE + +  G + N +L
Sbjct  164  MGGNVALVPWAD-MLNHSCDVETFLDYDKTSKGIVFTTDRPYQPGEQVFISYGKKSNGEL  222

Query  358  LINYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLIC  513
            L++YGFV ++  NP D V L  +L   D  Y++K    +  G S+ Q F + I 
Sbjct  223  LLSYGFVPKEGANPSDSVELSLSLKKSDASYKEKLELLKNYGLSASQCFPIQIT  276



>emb|CBI28466.3| unnamed protein product [Vitis vinifera]
Length=497

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 55/174 (32%), Positives = 89/174 (51%), Gaps = 15/174 (9%)
 Frame = +1

Query  4    IERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVS  183
            IER   +   Y++L         +F ++P+  P E F  E FK +F  + S +V L   S
Sbjct  195  IERINDVTGTYNDLRL------RIFSKHPHLFPEEVFNMETFKWSFGILFSRLVRLP--S  246

Query  184  LARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVV---DRPYKTGEPIVVWCGPQPNSK  354
            +  + ALVP    +L++    +  L   D + Q VV   DR Y+  E + +  G + N +
Sbjct  247  MDEKIALVPWAD-MLNHSCEVETFLD-YDKSSQGVVFTTDRTYQPSEQVFISYGKKSNGE  304

Query  355  LLINYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLI  510
            LL++YGFV  +  NP D+V L  +L   D  Y++K  A +++G S+ Q F + I
Sbjct  305  LLLSYGFVPREGTNPNDKVELLLSLKKSDKCYKEKSEAMKKHGLSTSQCFPIQI  358



>ref|XP_002267469.2| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Vitis vinifera]
Length=577

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 55/174 (32%), Positives = 89/174 (51%), Gaps = 15/174 (9%)
 Frame = +1

Query  4    IERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVS  183
            IER   +   Y++L         +F ++P+  P E F  E FK +F  + S +V L   S
Sbjct  275  IERINDVTGTYNDLRL------RIFSKHPHLFPEEVFNMETFKWSFGILFSRLVRLP--S  326

Query  184  LARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVV---DRPYKTGEPIVVWCGPQPNSK  354
            +  + ALVP    +L++    +  L   D + Q VV   DR Y+  E + +  G + N +
Sbjct  327  MDEKIALVPWAD-MLNHSCEVETFLD-YDKSSQGVVFTTDRTYQPSEQVFISYGKKSNGE  384

Query  355  LLINYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLI  510
            LL++YGFV  +  NP D+V L  +L   D  Y++K  A +++G S+ Q F + I
Sbjct  385  LLLSYGFVPREGTNPNDKVELLLSLKKSDKCYKEKSEAMKKHGLSTSQCFPIQI  438



>ref|XP_007146016.1| hypothetical protein PHAVU_006G005700g [Phaseolus vulgaris]
 gb|ESW18010.1| hypothetical protein PHAVU_006G005700g [Phaseolus vulgaris]
Length=492

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 53/174 (30%), Positives = 85/174 (49%), Gaps = 13/174 (7%)
 Frame = +1

Query  4    IERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVS  183
            IER   +   Y++L         +F +YP   P E F  E FK +F  + S +V L   S
Sbjct  190  IERINNVIGTYNDLRL------RIFSKYPDLFPEEVFNIESFKWSFGILFSRLVRLP--S  241

Query  184  LARRFALVPLGPPLLSYCSNCKAMLA--AVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKL  357
            +  + ALVP    +L++    +  L        +    DRPY+ GE + +  G + N +L
Sbjct  242  MDGQVALVPWAD-MLNHSCEVETFLDYDKQSKGIVFTTDRPYQPGEQVFISYGKKSNGEL  300

Query  358  LINYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLIC  513
            L++YGFV ++  NP D V L  +L   D  Y++K +  ++ G S+ Q F + I 
Sbjct  301  LLSYGFVPKEGGNPSDSVELSLSLKKSDASYKEKLVLLKKYGLSASQCFPIQIT  354



>ref|XP_003542190.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Glycine max]
Length=499

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 53/174 (30%), Positives = 83/174 (48%), Gaps = 13/174 (7%)
 Frame = +1

Query  4    IERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVS  183
            IER   +   Y++L         +F +YP   P E F  E FK +F  + S +V L   S
Sbjct  197  IERINNVIGTYNDLRL------RIFSKYPDLFPDEVFNIESFKWSFGILFSRLVRLP--S  248

Query  184  LARRFALVPLGPPLLSYCSNCKAMLA--AVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKL  357
            +    ALVP    +L++  + +  L        +    DRPY+ GE + +  G + N +L
Sbjct  249  MGGNVALVPWAD-MLNHSCDVETFLDYDKTSKGIVFTTDRPYQPGEQVFISYGKKSNGEL  307

Query  358  LINYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLIC  513
            L++YGFV ++  NP D V L  +L   D  Y++K    +  G S+ Q F + I 
Sbjct  308  LLSYGFVPKEGANPSDSVELSLSLKKSDASYKEKLELLKNYGLSASQCFPIQIT  361



>ref|XP_010088354.1| Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit 
N-methyltransferase [Morus notabilis]
 gb|EXB34472.1| Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit 
N-methyltransferase [Morus notabilis]
Length=527

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 51/172 (30%), Positives = 85/172 (49%), Gaps = 7/172 (4%)
 Frame = +1

Query  10   RAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLA  189
            R   I+R  + + T   +   +F +YP+  P E +  E F  +F  + S +V L   S+ 
Sbjct  196  RERAIERVTNVIGTYKDLRLRIFSKYPHLFPEEVYNLETFSWSFGILFSRLVRLP--SMD  253

Query  190  RRFALVPLGPPLLSYCSNCKAMLA--AVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLLI  363
             +FALVP    +L++    +  L        V    DRPY+ GE + +  G + N +LL+
Sbjct  254  GKFALVPWAD-MLNHNCEVETFLDYDKSSQGVLFTTDRPYQPGEQVFISYGKKSNGELLL  312

Query  364  NYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLIC  513
            +YGFV ++  NP D V L  +L+  D  Y+ K  A +++G    Q + + I 
Sbjct  313  SYGFVPKEGTNPSDSVELSLSLSKSDKCYKQKLAALRKHGLQVSQRYPIRIT  364



>ref|XP_003601528.1| SET domain-containing protein [Medicago truncatula]
 gb|AES71779.1| rubisco methyltransferase family protein [Medicago truncatula]
 gb|AFK38105.1| unknown [Medicago truncatula]
Length=497

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 85/172 (49%), Gaps = 7/172 (4%)
 Frame = +1

Query  10   RAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLA  189
            R   I+R  + + T   M   +F +YP   P E F  E FK +F  + S +V L   S+ 
Sbjct  191  RERAIERTNNVIGTYNDMRVRIFSKYPDFFPEEVFNIESFKWSFGILFSRMVRLP--SMD  248

Query  190  RRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLV--VDRPYKTGEPIVVWCGPQPNSKLLI  363
             + ALVP    ++++    +  L     +  +V   DRPY+ GE + +  G + N +LL+
Sbjct  249  GKNALVPWAD-MMNHSCEVETFLDYDKSSKGIVFPTDRPYQPGEQVFISYGKKSNGELLL  307

Query  364  NYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLIC  513
            +YGFV ++  NP D V L  +L   D  Y++K    ++ G S  Q F + + 
Sbjct  308  SYGFVPKEGTNPSDSVELSLSLKKSDESYKEKLELLKKYGLSGSQCFPIRVT  359



>ref|XP_003605258.1| SET domain-containing protein [Medicago truncatula]
Length=494

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 85/172 (49%), Gaps = 7/172 (4%)
 Frame = +1

Query  10   RAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLA  189
            R   I+R  + + T   M   +F +YP   P E F  E FK +F  + S +V L   S+ 
Sbjct  188  RERAIERTNNVIGTYNDMRVRIFSKYPDFFPEEVFNIESFKWSFGILFSRMVRLP--SMD  245

Query  190  RRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLV--VDRPYKTGEPIVVWCGPQPNSKLLI  363
             + ALVP    ++++    +  L     +  +V   DRPY+ GE + +  G + N +LL+
Sbjct  246  GKNALVPWAD-MMNHSCEVETFLDYDKSSKGIVFPTDRPYQPGEQVFISYGKKSNGELLL  304

Query  364  NYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLIC  513
            +YGFV ++  NP D V L  +L   D  Y++K    ++ G S  Q F + + 
Sbjct  305  SYGFVPKEGTNPSDSVELSLSLKKSDESYKEKLELLKKYGLSGSQCFPIRVT  356



>gb|EEC73918.1| hypothetical protein OsI_08761 [Oryza sativa Indica Group]
Length=502

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 50/167 (30%), Positives = 83/167 (50%), Gaps = 7/167 (4%)
 Frame = +1

Query  10   RAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLA  189
            R   I+R    + T   +   +F ++    P E +  E F+ +F  + S +V L   S+ 
Sbjct  196  RERAIQRITDVVGTYNDLRDRIFSKHSDLFPEEVYNLETFRWSFGILFSRLVRLP--SMD  253

Query  190  RRFALVPLGPPLLSYCSNCKAMLA--AVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLLI  363
             R ALVP    +L++    +  L      G +    DR Y+ GE + +  G + + +LL+
Sbjct  254  GRVALVPWAD-MLNHSPEVETFLDYDKSSGGIVFTTDRSYQPGEQVFISYGKKSSGELLL  312

Query  364  NYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAF  498
            +YGFV ++  NP D V L  +LN  D  Y++K  A +RNG S  ++F
Sbjct  313  SYGFVPKEGTNPNDSVELLVSLNKSDKCYKEKLQALKRNGLSEFESF  359



>ref|XP_001754113.1| predicted protein [Physcomitrella patens]
 gb|EDQ81014.1| predicted protein [Physcomitrella patens]
Length=638

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 54/144 (38%), Positives = 73/144 (51%), Gaps = 14/144 (10%)
 Frame = +1

Query  1    VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  180
            V +R+  ++ EY +L        S F + P   P E F  E FK AF  + S  V+L   
Sbjct  207  VQQRSAALEGEYEDLQ-------SYFTKDPQAFPQEYFSLEAFKSAFSVILSRAVYLPSA  259

Query  181  SLARRFALVPLGPPLLSYCSNCKAML--AAVDGAVQLVVDRPYKTGEPIVVWCG-PQPNS  351
             L   FALVP    L ++ ++ +A L  +  D AV   VDR YK GE +    G  + N+
Sbjct  260  DL---FALVPYADAL-NHRADSQAYLDYSMEDQAVVFPVDRNYKEGEQVFTSYGRERSNA  315

Query  352  KLLINYGFVDEDNPYDRVTLEAAL  423
             LLI YGFVDE+N  D + LE  L
Sbjct  316  DLLITYGFVDENNAMDYLDLEVGL  339



>ref|NP_001047982.1| Os02g0725200 [Oryza sativa Japonica Group]
 dbj|BAD12920.1| putative ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit N-methyltransferase [Oryza sativa Japonica Group]
 dbj|BAD13045.1| putative ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit N-methyltransferase [Oryza sativa Japonica Group]
 dbj|BAF09896.1| Os02g0725200 [Oryza sativa Japonica Group]
 dbj|BAG96165.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57721.1| hypothetical protein OsJ_08208 [Oryza sativa Japonica Group]
Length=502

 Score = 70.5 bits (171),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 50/167 (30%), Positives = 83/167 (50%), Gaps = 7/167 (4%)
 Frame = +1

Query  10   RAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLA  189
            R   I+R    + T   +   +F ++    P E +  E F+ +F  + S +V L   S+ 
Sbjct  196  RERAIQRITDVVGTYNDLRDRIFSKHSDLFPEEVYNLETFRWSFGILFSRLVRLP--SMD  253

Query  190  RRFALVPLGPPLLSYCSNCKAMLA--AVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLLI  363
             R ALVP    +L++    +  L      G +    DR Y+ GE + +  G + + +LL+
Sbjct  254  GRVALVPWAD-MLNHSPEVETFLDYDKSSGGIVFTTDRSYQPGEQVFISYGKKSSGELLL  312

Query  364  NYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAF  498
            +YGFV ++  NP D V L  +LN  D  Y++K  A +RNG S  ++F
Sbjct  313  SYGFVPKEGTNPNDSVELLVSLNKSDKCYKEKLQALKRNGLSEFESF  359



>ref|XP_006649004.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like [Oryza brachyantha]
Length=551

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 49/167 (29%), Positives = 82/167 (49%), Gaps = 7/167 (4%)
 Frame = +1

Query  10   RAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLA  189
            R   I+R    + T   +   +F ++ Y  P E +  E F+ +F  + S +V L   S+ 
Sbjct  245  RERAIQRITDVIGTYNDLRDRIFSKHSYLFPEEVYNLETFRWSFGILFSRLVRLP--SMD  302

Query  190  RRFALVPLGPPLLSYCSNCKAMLA--AVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLLI  363
               ALVP    +L++    +  L      G +    DR Y+ GE + +  G + + +LL+
Sbjct  303  GNVALVPWAD-MLNHSPEVETFLDYDKSSGGIVFTTDRSYQPGEQVFISYGKKSSGELLL  361

Query  364  NYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAF  498
            +YGFV ++  NP D V L  +L   D  Y++K  A +RNG S  ++F
Sbjct  362  SYGFVPKEGTNPNDSVELFVSLKKSDECYKEKLQALKRNGLSEFESF  408



>gb|EMS66279.1| hypothetical protein TRIUR3_22444 [Triticum urartu]
Length=174

 Score = 64.7 bits (156),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +1

Query  283  LVVDRPYKTGEPIVVWCGPQPNSKLLINYGFVDEDNPYDRVTLEAALNTE  432
            +V+   Y  G    V CGPQPNS+LL+NYGFVDEDNPYDR+ +E  +  E
Sbjct  2    VVMGNQYDRGVRAKVRCGPQPNSRLLLNYGFVDEDNPYDRIAIEVCVGKE  51



>ref|XP_001754252.1| predicted protein [Physcomitrella patens]
 gb|EDQ80702.1| predicted protein, partial [Physcomitrella patens]
Length=431

 Score = 67.4 bits (163),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 46/152 (30%), Positives = 78/152 (51%), Gaps = 8/152 (5%)
 Frame = +1

Query  61   MAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLARRFALVPLGPPLLSYCS  240
            +  ++F ++P   P++ +    FK AF  + S +V L  V    + ALVP    +L++  
Sbjct  154  LRATIFLKHPEVFPSQVYTLAAFKWAFGILFSRLVRLPSVG---KLALVPWAD-MLNHSP  209

Query  241  NCKAMLAAVDG---AVQLVVDRPYKTGEPIVVWCGPQPNSKLLINYGFV-DEDNPYDRVT  408
               + L        +V  V DR Y++GE + +  G + + +L + YGF+  E N +D V 
Sbjct  210  QVDSFLDFDQNNAKSVVTVTDRAYQSGEQVFISYGKRSSGELFLAYGFIPSELNVHDSVE  269

Query  409  LEAALNTEDPQYQDKRLAAQRNGKSSVQAFHV  504
            LE  ++++DP ++ K  AA   G SS Q F V
Sbjct  270  LEMEIDSDDPSFEAKLRAANEQGLSSPQRFPV  301



>ref|XP_010689224.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=413

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 83/170 (49%), Gaps = 15/170 (9%)
 Frame = +1

Query  4    IERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVS  183
            IER+  +   Y++L         +F ++P   P E F  E F+ +F  + S +V L   S
Sbjct  111  IERSNDVIGTYNDLKL------RIFSKHPDLFPEEVFNMETFRWSFGILFSRLVRLP--S  162

Query  184  LARRFALVPLGPPLLSYCSNCKAML---AAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSK  354
            +  + ALVP    +L++    +  L    + +G V     RPY+ GE + +  G + N +
Sbjct  163  MDGKVALVPWAD-MLNHSCEVETYLDYDKSSEGIV-FTTGRPYQPGEQVFISYGKKSNGE  220

Query  355  LLINYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAF  498
            LL++YGFV ++  NP D   L  +L   D  Y++K  A  + G S  Q F
Sbjct  221  LLLSYGFVPKEGTNPSDSAELSLSLKKSDKCYKEKMEALMKYGLSGSQCF  270



>ref|XP_010689223.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=500

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 83/170 (49%), Gaps = 15/170 (9%)
 Frame = +1

Query  4    IERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVS  183
            IER+  +   Y++L         +F ++P   P E F  E F+ +F  + S +V L   S
Sbjct  198  IERSNDVIGTYNDLKL------RIFSKHPDLFPEEVFNMETFRWSFGILFSRLVRLP--S  249

Query  184  LARRFALVPLGPPLLSYCSNCKAML---AAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSK  354
            +  + ALVP    +L++    +  L    + +G V     RPY+ GE + +  G + N +
Sbjct  250  MDGKVALVPWAD-MLNHSCEVETYLDYDKSSEGIV-FTTGRPYQPGEQVFISYGKKSNGE  307

Query  355  LLINYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAF  498
            LL++YGFV ++  NP D   L  +L   D  Y++K  A  + G S  Q F
Sbjct  308  LLLSYGFVPKEGTNPSDSAELSLSLKKSDKCYKEKMEALMKYGLSGSQCF  357



>ref|NP_001140387.1| uncharacterized protein LOC100272441 [Zea mays]
 gb|ACF83720.1| unknown [Zea mays]
 gb|AFW63676.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
N-methyltransferase I [Zea mays]
Length=503

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 49/167 (29%), Positives = 82/167 (49%), Gaps = 7/167 (4%)
 Frame = +1

Query  10   RAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLA  189
            R   I+R    + T   +   +F ++P   P E +  E F  +F  + S +V L   S+ 
Sbjct  197  RKRAIQRITDVIGTYNDLRDRIFSRHPDLFPEEVYNIETFLWSFGILFSRLVRLP--SMD  254

Query  190  RRFALVPLGPPLLSYCSNCKAMLA--AVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLLI  363
             R ALVP    +L++    +  L        +    DR Y+ GE + +  G + + +LL+
Sbjct  255  GRVALVPWAD-MLNHSPEVETFLDFDKSSRGIVFTTDRSYQPGEQVFISYGKKSSGELLL  313

Query  364  NYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAF  498
            +YGFV ++  NP D V L  +L+  D  Y++K  A +RNG S  ++F
Sbjct  314  SYGFVPKEGTNPNDSVELLVSLDKSDNCYKEKLQALKRNGLSESESF  360



>ref|XP_010236007.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Brachypodium 
distachyon]
Length=506

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 85/168 (51%), Gaps = 9/168 (5%)
 Frame = +1

Query  10   RAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLA  189
            R   I R    + T   +   +F ++P   P E +  E F+ +F  + S +V L   S+ 
Sbjct  199  RERAISRIGDVIGTYNDLRDRIFSKHPELFPEEVYNMENFRWSFGILFSRLVRLP--SMD  256

Query  190  RRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVV---DRPYKTGEPIVVWCGPQPNSKLL  360
             + ALVP    +L++     A L   D + Q +V   DR Y+ GE + +  G + + +LL
Sbjct  257  GKVALVPWAD-MLNHNPEVDAFLD-FDKSSQGIVFTTDRSYQPGEQVFISYGKKSSGELL  314

Query  361  INYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAF  498
            ++YGFV ++  NP D V    +LN  D  Y++K  A +R+G S  ++F
Sbjct  315  LSYGFVPKEGTNPNDSVEFSVSLNKSDDCYREKLQALKRHGLSESESF  362



>emb|CBJ29688.1| putative ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit N-methyltransferase I [Ectocarpus siliculosus]
Length=521

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 51/174 (29%), Positives = 79/174 (45%), Gaps = 11/174 (6%)
 Frame = +1

Query  1    VIERAEGIKREYS-ELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQK  177
            VI   E ++R+   E  TV      L  ++P  +P E   +E F+ AF  + S  + L  
Sbjct  228  VIAATESMRRKLEVEYATV---ENDLLDKFPEILPREVHTYEEFQWAFAMLFSRAIRLGG  284

Query  178  VSLARRFALVPLG------PPLLSYC-SNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCG  336
            +S     ALVP        P   SY  +  + +  +    V +  DR YK  E + +  G
Sbjct  285  LSTGEAVALVPYADLFNHNPFANSYIDARQQGLFFSKTDEVVVYADRSYKKMEQVYISYG  344

Query  337  PQPNSKLLINYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAF  498
            P+ NS LL+ YGF  + NPY+ V +  +L+  D  Y+ K+      G    +AF
Sbjct  345  PKGNSDLLLLYGFSLDRNPYNSVDVTVSLDENDELYERKKAFLSEAGLPPTKAF  398



>ref|XP_004953752.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like isoform 
X1 [Setaria italica]
 ref|XP_004953753.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like isoform 
X2 [Setaria italica]
 ref|XP_004953754.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like isoform 
X3 [Setaria italica]
Length=503

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 51/173 (29%), Positives = 88/173 (51%), Gaps = 9/173 (5%)
 Frame = +1

Query  10   RAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLA  189
            R   I+R    + T   +   +F ++    P E +  E F  +F  + S +V L   S+ 
Sbjct  197  RERAIQRITDVIGTYNDLRDRIFSKHSDLFPEEVYNIETFLWSFGILFSRLVRLP--SMD  254

Query  190  RRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVV---DRPYKTGEPIVVWCGPQPNSKLL  360
             R ALVP    +L++    +  L   D + Q +V   DR Y+ GE + +  G + + +LL
Sbjct  255  GRVALVPWAD-MLNHSPEVETFLD-FDKSSQGIVFTTDRSYQPGEQVFISYGKKSSGELL  312

Query  361  INYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLIC  513
            ++YGFV ++  NP D V L  +L+  D  Y++K  A +RNG S+ ++F + + 
Sbjct  313  LSYGFVPKEGTNPNDSVELLVSLDKSDKCYKEKLQALKRNGLSASESFPLRVT  365



>ref|XP_006857756.1| hypothetical protein AMTR_s00061p00196800 [Amborella trichopoda]
 gb|ERN19223.1| hypothetical protein AMTR_s00061p00196800 [Amborella trichopoda]
Length=541

 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 52/175 (30%), Positives = 87/175 (50%), Gaps = 15/175 (9%)
 Frame = +1

Query  4    IERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVS  183
            IER   +   Y++L+        +F +     P E +  + F+ +F  + S +V L   S
Sbjct  237  IERITDVTGTYNDLNL------RIFSKQRDLFPEEVYNMDTFRWSFGILFSRLVKLP--S  288

Query  184  LARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVV---DRPYKTGEPIVVWCGPQPNSK  354
            +  R  LVP    +L++ S  +  L   D + Q +V   DR Y+ GE + +  G + N +
Sbjct  289  MDGRVTLVPWAD-MLNHSSEVETFLD-YDKSSQGIVFTTDRSYQPGEQVFISYGKKSNGE  346

Query  355  LLINYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLIC  513
            LL++YGFV  +  NP D V +  ++N  DP Y +K  A  ++G S+ Q F + I 
Sbjct  347  LLLSYGFVSREGTNPNDSVDVAMSINKSDPCYVEKVEALMKHGLSTPQRFPLQIT  401



>gb|ACG45124.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
N-methyltransferase I [Zea mays]
Length=503

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 48/167 (29%), Positives = 81/167 (49%), Gaps = 7/167 (4%)
 Frame = +1

Query  10   RAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLA  189
            R   I+R    + T   +   +F ++P   P E +  E F  +F  + S +V L   S+ 
Sbjct  197  RKRAIQRITDVIGTYNDLRDRIFSRHPDLFPEEVYNIETFLWSFGILFSRLVRLP--SMD  254

Query  190  RRFALVPLGPPLLSYCSNCKAMLA--AVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLLI  363
             R  LVP    +L++    +  L        +    DR Y+ GE + +  G + + +LL+
Sbjct  255  GRVVLVPWAD-MLNHSPEVETFLDFDKSSRGIVFTTDRSYQPGEQVFISYGKKSSGELLL  313

Query  364  NYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAF  498
            +YGFV ++  NP D V L  +L+  D  Y++K  A +RNG S  ++F
Sbjct  314  SYGFVPKEGTNPNDSVELLVSLDKSDNCYKEKLQALKRNGLSESESF  360



>gb|KJB22703.1| hypothetical protein B456_004G061300 [Gossypium raimondii]
Length=489

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 78/151 (52%), Gaps = 7/151 (5%)
 Frame = +1

Query  73   LFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLARRFALVPLGPPLLSYCSNCKA  252
            +  ++P+  P E F    F+ +F  + S +++L   S+  + ALVP    +L++    + 
Sbjct  216  ILSKHPHLFPKEIFNLVTFRWSFGILLSRLIYLS--SMDGKVALVPWAD-MLNHSCEVET  272

Query  253  MLA--AVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLLINYGFVDED--NPYDRVTLEAA  420
             L       AV    DR Y++GE + +  G + N++LL++YGFV ++  N  D V L  +
Sbjct  273  YLNYDKSSQAVVFTTDRAYQSGEQVFISYGKKSNAELLLSYGFVPKEGTNLNDSVELPLS  332

Query  421  LNTEDPQYQDKRLAAQRNGKSSVQAFHVLIC  513
            L   D  Y+ K  A +++G S+ Q + + I 
Sbjct  333  LKISDKCYKQKLKALKKHGLSASQCYTIQIS  363



>ref|XP_002185762.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
N-methyltransferase I [Phaeodactylum tricornutum CCAP 1055/1]
 gb|ACI65232.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
N-methyltransferase I [Phaeodactylum tricornutum CCAP 1055/1]
Length=575

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 69/144 (48%), Gaps = 14/144 (10%)
 Frame = +1

Query  22   IKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLARRFA  201
            ++REY   D +      L  +YP   P EAF F+ ++ AF  + S  + L+ +      A
Sbjct  234  LRREY---DALLGGEDGLLAKYPDRFPAEAFNFKAWEWAFTMLFSRAIRLRSLKQGETLA  290

Query  202  LVPLGPPLLSYC----------SNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNS  351
            LVP    L+++            N   +  + D  V L  DR Y+  E I +  GP+ N+
Sbjct  291  LVPYAD-LINHSPFSQAYIDARQNGDWLFKSGDEEVILYADRGYRRMEQIYISYGPKSNA  349

Query  352  KLLINYGFVDEDNPYDRVTLEAAL  423
            +LL+ YGF  E NP++ V +  ++
Sbjct  350  ELLLLYGFAVERNPFNSVDVTVSI  373



>ref|XP_002454362.1| hypothetical protein SORBIDRAFT_04g029430 [Sorghum bicolor]
 gb|EES07338.1| hypothetical protein SORBIDRAFT_04g029430 [Sorghum bicolor]
Length=499

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 50/168 (30%), Positives = 85/168 (51%), Gaps = 9/168 (5%)
 Frame = +1

Query  10   RAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLA  189
            R   I+R    + T   +   +F ++    P E +  E F  +F  + S +V L   S+ 
Sbjct  193  RKRAIQRITDVIGTYNDLRDRIFSRHSDLFPEEVYNIETFLWSFGILFSRLVRLP--SMD  250

Query  190  RRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVV---DRPYKTGEPIVVWCGPQPNSKLL  360
             + ALVP    +L++    +  L   D + Q +V   DR Y+ GE + +  G + + +LL
Sbjct  251  EKVALVPWAD-MLNHSPEVETFLD-FDKSSQGIVFTTDRSYQPGEQVFISYGKKSSGELL  308

Query  361  INYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAF  498
            ++YGFV ++  NP D V L  +L+  D  Y++K  A +RNG S  ++F
Sbjct  309  LSYGFVPKEGTNPNDSVELLVSLDKSDKCYKEKLQALKRNGLSESESF  356



>ref|XP_005719244.1| unnamed protein product [Chondrus crispus]
 emb|CDF39333.1| unnamed protein product [Chondrus crispus]
Length=464

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 67/139 (48%), Gaps = 10/139 (7%)
 Frame = +1

Query  100  PTEAFPFEIFKQAFVAVQSCVVHLQKVSLARRFALVPLGPPLLSYCSNCKAMLAAVDGA-  276
            P + F ++ ++ AF  + S  + L   +  +R ALVP    LL++   C   +   +   
Sbjct  212  PDDVFTWDQWEWAFAILFSRAIML---TAEQRIALVPYAD-LLNHNPFCSTYIDVQEKQL  267

Query  277  -----VQLVVDRPYKTGEPIVVWCGPQPNSKLLINYGFVDEDNPYDRVTLEAALNTEDPQ  441
                 V L  DRPY   + + V  GP+ N  LL+ YGF+ + NPYD V L  AL+ ED  
Sbjct  268  TGKRFVTLYTDRPYAQMDQVFVTYGPKSNGDLLLLYGFITDRNPYDSVELVVALSDEDEL  327

Query  442  YQDKRLAAQRNGKSSVQAF  498
            ++ K+     +G  +   F
Sbjct  328  FERKKKYLDESGVGTTATF  346



>ref|XP_004305682.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Fragaria vesca 
subsp. vesca]
Length=498

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 54/181 (30%), Positives = 82/181 (45%), Gaps = 27/181 (15%)
 Frame = +1

Query  4    IERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVS  183
            IER   +   Y++L         +F ++P   P E F  E FK +F  + S +V L   S
Sbjct  196  IERVTNVVGTYNDLRL------RIFSKHPDLFPEEVFNIETFKWSFGILFSRLVRLP--S  247

Query  184  LARRFALVPLGPPL---------LSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCG  336
            +  + ALVP    L         L Y  + K ++    G        PY+ GE + +  G
Sbjct  248  MDGKVALVPWADMLNHSCEVDTFLDYDQSSKGVVFTTAG--------PYQPGEQVFISYG  299

Query  337  PQPNSKLLINYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVLI  510
             + N +LL++YGFV     NP D V L  +L   D  Y++K  A ++ G S+ + F V I
Sbjct  300  KKSNGELLLSYGFVPSKGANPSDSVELSVSLLKSDKCYEEKVEALRKYGLSARECFPVRI  359

Query  511  C  513
             
Sbjct  360  T  360



>ref|XP_002974548.1| hypothetical protein SELMODRAFT_101776 [Selaginella moellendorffii]
 gb|EFJ24068.1| hypothetical protein SELMODRAFT_101776 [Selaginella moellendorffii]
Length=467

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 45/156 (29%), Positives = 78/156 (50%), Gaps = 6/156 (4%)
 Frame = +1

Query  46   DTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLARRFALVPLGPPL  225
            DT   +   +F +   + P E F  E FK AF  + S +V L   SL ++ AL+P G  +
Sbjct  174  DTFNDLNKQVFMKNREEFPPEVFNLESFKWAFGILFSRLVRLP--SLGQKLALIPFGD-M  230

Query  226  LSYCSNCKAMLAAVDGA--VQLVVDRPYKTGEPIVVWCGPQPNSKLLINYGFV-DEDNPY  396
            L++ +     L    G+  +   +DR Y++ + + +  G + N +LL+ YGFV    N  
Sbjct  231  LNHDTEVTTFLDFDSGSKSITCTLDRGYESNKEVFISYGKRSNGELLVAYGFVPSGKNSE  290

Query  397  DRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHV  504
            D V++   L+  D  Y+ K  A + +G S  Q++ +
Sbjct  291  DSVSITLGLDPADEMYEAKLGALKEHGLSPQQSYPI  326



>gb|EJK62256.1| hypothetical protein THAOC_17139 [Thalassiosira oceanica]
Length=648

 Score = 61.6 bits (148),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 73/146 (50%), Gaps = 18/146 (12%)
 Frame = +1

Query  22   IKREYSELDTVWFMAG--SLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLARR  195
            ++REY +L     + G   L  ++P   P E + FE ++ AF  + S  + L+ + +  R
Sbjct  313  LRREYDDL-----LGGPDGLVAKFPLRFPAEHYTFENWEWAFTMLFSRAIRLRNLQVGER  367

Query  196  FALVPLGPPLLSYCSNCKAMLAAVDGA----------VQLVVDRPYKTGEPIVVWCGPQP  345
             A+VP    L+++ +  +A + A +            V L  DR Y+  E + +  G + 
Sbjct  368  LAMVPYAD-LINHSAFSQAFIDARESGDWLFKSGEEEVILYADRGYRQMEQVYISYGQKS  426

Query  346  NSKLLINYGFVDEDNPYDRVTLEAAL  423
            N++LL+ YGF  E NPY+ V +  ++
Sbjct  427  NAELLLLYGFALERNPYNSVDVTVSI  452



>ref|XP_003081307.1| putative methyltransferase (ISS) [Ostreococcus tauri]
Length=505

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 63/126 (50%), Gaps = 5/126 (4%)
 Frame = +1

Query  127  FKQAFVAVQSCVVHLQKVSLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYK  306
             + AF  + S ++ L   ++    ALVP    +L++   C A +     AV L  DR Y 
Sbjct  218  LRWAFDILFSRLIRLD--AMGGELALVPWAD-MLNHKPGCAAFIDLNGSAVNLTTDRAYA  274

Query  307  TGEPIVVWCGPQPNSKLLINYGFVDE--DNPYDRVTLEAALNTEDPQYQDKRLAAQRNGK  480
             GE +    G +P+S+LLI+YGF  E  +NP D  +L   ++  DP  Q K    +R G 
Sbjct  275  AGEQVWASYGQRPSSELLISYGFAPEVGENPDDEYSLTLGVDVNDPYAQAKADVLRRMGL  334

Query  481  SSVQAF  498
            S V+ F
Sbjct  335  SPVETF  340



>emb|CEF99133.1| Rubisco LS methyltransferase, substrate-binding domain [Ostreococcus 
tauri]
Length=531

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 63/126 (50%), Gaps = 5/126 (4%)
 Frame = +1

Query  127  FKQAFVAVQSCVVHLQKVSLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYK  306
             + AF  + S ++ L   ++    ALVP    +L++   C A +     AV L  DR Y 
Sbjct  244  LRWAFDILFSRLIRLD--AMGGELALVPWAD-MLNHKPGCAAFIDLNGSAVNLTTDRAYA  300

Query  307  TGEPIVVWCGPQPNSKLLINYGFVDE--DNPYDRVTLEAALNTEDPQYQDKRLAAQRNGK  480
             GE +    G +P+S+LLI+YGF  E  +NP D  +L   ++  DP  Q K    +R G 
Sbjct  301  AGEQVWASYGQRPSSELLISYGFAPEVGENPDDEYSLTLGVDVNDPYAQAKADVLRRMGL  360

Query  481  SSVQAF  498
            S V+ F
Sbjct  361  SPVETF  366



>ref|XP_005705388.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
N-methyltransferase I [Galdieria sulphuraria]
 gb|EME28868.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
N-methyltransferase I [Galdieria sulphuraria]
Length=490

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 50/164 (30%), Positives = 81/164 (49%), Gaps = 18/164 (11%)
 Frame = +1

Query  28   REYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLARRFALV  207
            REY+      ++  ++  Q P +  ++   F+ F+ AF  + S  +       ++R ALV
Sbjct  230  REYT------YLGKNIIPQIP-NFASKPIDFKQFQWAFGILFSRAICFPS---SKRIALV  279

Query  208  PLGPPLLSYCSNCKAMLAAV-----DGAVQLVV--DRPYKTGEPIVVWCGPQPNSKLLIN  366
            P    LL++   C A +        +G  + VV  DR Y+  E + V  GP+ N +LL+ 
Sbjct  280  PYAD-LLNHSPFCSAFIDEEKIPFGNGVTEAVVYVDRLYEPYEQVYVSYGPRSNQELLLL  338

Query  367  YGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAF  498
            YGF  E NP+D V +   L+  DP Y +K    +  GKS +Q+F
Sbjct  339  YGFSLERNPFDCVEITIGLDKTDPLYLEKCRMLESYGKSPLQSF  382



>gb|AFK46204.1| unknown [Lotus japonicus]
Length=271

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 67/135 (50%), Gaps = 7/135 (5%)
 Frame = +1

Query  121  EIFKQAFVAVQSCVVHLQKVSLARRFALVPLGPPLLSYCSNCKAMLA--AVDGAVQLVVD  294
            E FK +F  + S +V L   S+  + ALVP    +L++  + +  L        +    D
Sbjct  2    ESFKWSFGILFSRMVRLP--SMDGKVALVPWAD-MLNHSCDVETFLDYDKQSKGIVFTTD  58

Query  295  RPYKTGEPIVVWCGPQPNSKLLINYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQ  468
            RPY+ GE + +  G + N +LL++YGFV  +  NP D V L  +L   D  Y++K    +
Sbjct  59   RPYQPGEQVFISYGKKSNGELLLSYGFVTREGANPSDSVELSLSLKKSDGSYKEKLELLK  118

Query  469  RNGKSSVQAFHVLIC  513
            + G S  Q F + I 
Sbjct  119  KYGLSGSQCFPIRIT  133



>ref|XP_002965462.1| hypothetical protein SELMODRAFT_406852 [Selaginella moellendorffii]
 gb|EFJ32882.1| hypothetical protein SELMODRAFT_406852 [Selaginella moellendorffii]
Length=481

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 46/140 (33%), Positives = 63/140 (45%), Gaps = 4/140 (3%)
 Frame = +1

Query  94   DIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLARRFALVPLGPPLLSYCSNCKAMLAAVDG  273
            D P E F F  FK AF  V S  V+L    L   FALVP G  +    S         + 
Sbjct  195  DFPMEKFTFSAFKAAFSVVLSRAVYLPSAEL---FALVPFGDLINHESSRSLLDYDIEEQ  251

Query  274  AVQLVVDRPYKTGEPIVV-WCGPQPNSKLLINYGFVDEDNPYDRVTLEAALNTEDPQYQD  450
             V+L VD+ YK G+ +   +     ++  LI YGF+DE +  D + +E  L + D     
Sbjct  252  KVKLAVDKRYKKGDQVFASYAQNLTSADFLIRYGFLDESDENDFIEIEVGLVSGDSLAPL  311

Query  451  KRLAAQRNGKSSVQAFHVLI  510
            KR   Q  G +  Q F V +
Sbjct  312  KREILQEVGLTVPQKFPVYL  331



>ref|XP_002286075.1| rubisco small subunit small subunit n-methyltransferase [Thalassiosira 
pseudonana CCMP1335]
 gb|EED95716.1| rubisco small subunit small subunit n-methyltransferase, partial 
[Thalassiosira pseudonana CCMP1335]
Length=434

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 69/144 (48%), Gaps = 14/144 (10%)
 Frame = +1

Query  22   IKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLARRFA  201
            ++REY   D +      L  ++P   P E F +E +  AF  + S  + L+ + +  R A
Sbjct  153  LRREY---DALLGGQDGLIAKFPDRFPAEHFTYENWVWAFTMLFSRAIRLRNLQVGERLA  209

Query  202  LVPLGPPLLSYCSNCKAMLAAVDGA----------VQLVVDRPYKTGEPIVVWCGPQPNS  351
            +VP    L+++ +   A + A +            V L  DR Y+  E + +  G + N+
Sbjct  210  MVPYAD-LINHSAFSGAFIDARESGDWLFKNGEEEVILYADRGYRQMEQVYISYGQKSNA  268

Query  352  KLLINYGFVDEDNPYDRVTLEAAL  423
            +LL+ YGF  E NPY+ V +  ++
Sbjct  269  ELLLLYGFALERNPYNSVDVTVSI  292



>ref|XP_002993188.1| hypothetical protein SELMODRAFT_449044 [Selaginella moellendorffii]
 gb|EFJ05708.1| hypothetical protein SELMODRAFT_449044 [Selaginella moellendorffii]
Length=600

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 61/136 (45%), Gaps = 4/136 (3%)
 Frame = +1

Query  94   DIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLARRFALVPLGPPLLSYCSNCKAMLAAVDG  273
            D P E F F  FK AF  V S  V+L    L   FALVP G  +    S         + 
Sbjct  195  DFPMEKFTFSAFKTAFSVVLSRAVYLPSAEL---FALVPFGDLINHESSRSLLDYDIEEQ  251

Query  274  AVQLVVDRPYKTGEPIVV-WCGPQPNSKLLINYGFVDEDNPYDRVTLEAALNTEDPQYQD  450
             V+L VD+ YK G+ +   +     ++  LI YGF+DE +  D + +E  L + D     
Sbjct  252  KVKLAVDKRYKKGDQVFASYAQNLTSADFLIRYGFLDESDENDCIEIEVGLVSGDSLAPL  311

Query  451  KRLAAQRNGKSSVQAF  498
            KR   Q  G +  Q F
Sbjct  312  KREILQEVGLTVPQKF  327



>ref|XP_005718157.1| unnamed protein product [Chondrus crispus]
 emb|CDF38272.1| unnamed protein product [Chondrus crispus]
Length=978

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 48/155 (31%), Positives = 69/155 (45%), Gaps = 21/155 (14%)
 Frame = +1

Query  22   IKREYSELDTVWFM---AGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLAR  192
            ++ E  E+   WF+      L + YP D  T    FE F +A   ++S    ++ V++  
Sbjct  263  LRGEIDEMYKEWFLPYAVNRLPETYPADFCT----FETFMRAHAVIESRAFKIESVTMLA  318

Query  193  RFALVPLGPPLLSYCSNCKAM-LAAVD-------------GAVQLVVDRPYKTGEPIVVW  330
             FA +    P+ S C N KA    AVD             G    V DR  + GE I + 
Sbjct  319  PFADMANHQPVESECRNAKARGWIAVDSPESVVDRNVSDLGLELHVGDRLVRQGEEICIS  378

Query  331  CGPQPNSKLLINYGFVDEDNPYDRVTLEAALNTED  435
             G  PN +LL++YGF    NP D V L  ++  ED
Sbjct  379  YGALPNWQLLLHYGFAMPSNPADSVLLSLSIPEED  413



>ref|XP_002963244.1| hypothetical protein SELMODRAFT_80789 [Selaginella moellendorffii]
 gb|EFJ35115.1| hypothetical protein SELMODRAFT_80789 [Selaginella moellendorffii]
Length=467

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 43/156 (28%), Positives = 76/156 (49%), Gaps = 6/156 (4%)
 Frame = +1

Query  46   DTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLARRFALVPLGPPL  225
            DT   +   +F +   + P E F  + FK AF  + S +V L   SL ++ AL+P G  +
Sbjct  174  DTFNDLNKQVFMKNREEFPPEVFNLKSFKWAFGILFSRLVRLP--SLGQKLALIPFGD-M  230

Query  226  LSYCSNCKAMLAAVDGA--VQLVVDRPYKTGEPIVVWCGPQPNSKLLINYGFV-DEDNPY  396
            L++ +     L    G+  +   +DR Y++   + +  G + N +LL+ YGFV    N  
Sbjct  231  LNHDTEVTTFLDFDSGSKSITCTLDRGYESNREVFISYGKRSNGELLVAYGFVPSGKNSE  290

Query  397  DRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHV  504
            D V++   L+  D  Y+ K    + +G S  Q++ +
Sbjct  291  DSVSITLGLDPADEMYEAKLGTLKEHGLSPQQSYPI  326



>ref|XP_002508524.1| set domain protein [Micromonas sp. RCC299]
 gb|ACO69782.1| set domain protein [Micromonas sp. RCC299]
Length=425

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/103 (38%), Positives = 54/103 (52%), Gaps = 3/103 (3%)
 Frame = +1

Query  196  FALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLLINYGF  375
             ALVP    +L++   C A +    GAV L  DR YK GE +    GP+P+S+LLI+YGF
Sbjct  171  LALVPWAD-MLNHRPGCDAYIDDTGGAVCLSPDRRYKPGEQVYASYGPRPSSELLISYGF  229

Query  376  VDE--DNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAF  498
                 +NP D   +   ++  D     K  A +R G S V+AF
Sbjct  230  APAVGENPDDEFEVVLGIDPNDRHADAKADALRRIGLSPVEAF  272



>ref|XP_001783777.1| predicted protein [Physcomitrella patens]
 gb|EDQ51429.1| predicted protein, partial [Physcomitrella patens]
Length=395

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 69/141 (49%), Gaps = 9/141 (6%)
 Frame = +1

Query  73   LFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLARRFALVPLGPPLLSYCSNCKA  252
            + Q+ P+ I  E      FKQA+   +S      + S   R   VP      ++ SNC+A
Sbjct  116  VLQKCPH-IFGERVLHSKFKQAYATGKSL-----RRSSNTRILTVPF-VDFFNHDSNCRA  168

Query  253  MLAAVD--GAVQLVVDRPYKTGEPIVVWCGPQPNSKLLINYGFVDEDNPYDRVTLEAALN  426
            +L+  +     +++ D+ Y  GE +V+  G  PN+ L +++GF    NPYD+V +  AL+
Sbjct  169  LLSYDEERACAEVIADKNYARGEQVVISYGRLPNTTLALDFGFTISCNPYDQVEVWMALS  228

Query  427  TEDPQYQDKRLAAQRNGKSSV  489
              DP  + K      +G  +V
Sbjct  229  HRDPLRKMKLALLHAHGMPTV  249



>gb|AFP65462.1| putative ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit N-methyltransferase I [Chroomonas mesostigmatica CCMP1168]
Length=464

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 35/136 (26%), Positives = 64/136 (47%), Gaps = 8/136 (6%)
 Frame = +1

Query  61   MAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLARRFALVPLGP-----PL  225
            +  ++F +     P + F  + ++ A   + S  + LQ +   ++ ALVP        P 
Sbjct  206  IEKTIFSKNRLVYPEKIFNLQSWEWAISLLLSRAIFLQNM---KKIALVPYADFINHNPF  262

Query  226  LSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLLINYGFVDEDNPYDRV  405
             +   N K +  + +  + +  D+ Y   + I    G + N +LL+ YGF+ E NP+D +
Sbjct  263  STSYINSKKIAFSENNEIVMYADKDYNKFDQIFTTYGQKTNLELLVLYGFIIERNPFDSI  322

Query  406  TLEAALNTEDPQYQDK  453
             L  AL+T+D  Y  K
Sbjct  323  ELRVALSTKDELYNKK  338



>gb|KIZ05290.1| hypothetical protein MNEG_2664 [Monoraphidium neglectum]
Length=449

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 68/147 (46%), Gaps = 6/147 (4%)
 Frame = +1

Query  70   SLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLARRFALVPLGPPL--LSYCSN  243
            + F + P       F    F +AF  V   + H   +  A  FAL+PL   L      + 
Sbjct  149  AFFSKDPARFDPATFNEAAFLRAFCVV---LAHASYLPSAELFALLPLAGQLGRTGNENG  205

Query  244  CKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLLINYGFVDEDNPYDRVTLEAAL  423
            C     A  GAV L   RPY+ G+ +++  G +PN +LL+ +G V ++N  D +   A+L
Sbjct  206  CDLDYDAGSGAVVLKSARPYREGQEVLLNDG-RPNGELLLCFGTVQDNNLSDFLLFNASL  264

Query  424  NTEDPQYQDKRLAAQRNGKSSVQAFHV  504
               D  YQ K+   Q  G SS + F V
Sbjct  265  VRADKYYQSKQQLLQAMGMSSEERFPV  291



>ref|XP_001419603.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO97896.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=524

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 60/126 (48%), Gaps = 5/126 (4%)
 Frame = +1

Query  127  FKQAFVAVQSCVVHLQKVSLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYK  306
             + AF  + S ++ L   ++    ALVP    +L++   C A +     AV L  DR Y 
Sbjct  235  LRWAFDILFSRLIRLD--AMGGELALVPWAD-MLNHKPGCAAFIDLNGDAVNLTTDRSYV  291

Query  307  TGEPIVVWCGPQPNSKLLINYGFVDE--DNPYDRVTLEAALNTEDPQYQDKRLAAQRNGK  480
             GE +    G +P+S+LLI+YGF  E  +NP D   L   ++  DP    K    +  G 
Sbjct  292  KGEQVWASYGQRPSSELLISYGFAPEVGENPDDEYALTLGVDVNDPLADAKAQVLRDMGL  351

Query  481  SSVQAF  498
            S V+ F
Sbjct  352  SPVETF  357



>ref|XP_007510589.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18122.1| predicted protein [Bathycoccus prasinos]
Length=543

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 58/184 (32%), Positives = 83/184 (45%), Gaps = 27/184 (15%)
 Frame = +1

Query  10   RAEGIKREYSELDTVWFMAGS--LFQQYPYDIPTEAFPFEI-----------FKQAFVAV  150
            R+ G   E+ E D    +AGS  LF          A   EI            + AF  +
Sbjct  197  RSTGSVLEWPESDVRTLLAGSPSLFSALERRASVAAAIAEIRVNFPELNEKTLQWAFDIL  256

Query  151  QSCVVHLQKVSLARRFALVPLGPPLLSYCSNCKAMLAAVDGA--VQLVVDRPYKTGEPIV  324
             S ++ L+  SL    ALVP    +L++   C+A +    G+  V L  DR Y+ GE + 
Sbjct  257  FSRLIRLE--SLGGNLALVPWAD-MLNHQPGCEAFIDLDRGSRKVCLTTDRSYEPGEQVW  313

Query  325  VWCGPQPNSKLLINYGFVDE--DNPYDRVTLEAALNTEDPQYQDK--RLAAQRNGKSSVQ  492
               G +P+S+LLI+YGF     DNP D   L   ++ EDP    K   LA+Q     ++Q
Sbjct  314  ASYGQRPSSELLISYGFAPAVGDNPDDEYALNLQIDEEDPFASAKVNALASQ-----NIQ  368

Query  493  AFHV  504
            AF  
Sbjct  369  AFET  372



>gb|ETS04896.1| SET domain-containing protein [Trichoderma reesei RUT C-30]
Length=460

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 66/147 (45%), Gaps = 9/147 (6%)
 Frame = +1

Query  22   IKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLARRFA  201
            IK +Y +L      A  LF Q+P   P + F  E +K A   V S  +       +    
Sbjct  135  IKDDYRQL------AVRLFAQHPDLFPLQKFTIEDYKWALCTVWSRSMDFTLPDGSSIRL  188

Query  202  LVPLGPPLLSYCSNCKAMLA--AVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLLINYGF  375
            L P    +L++ S  K   A     G + +   + Y+ G+ + ++ GP PN++LL  YGF
Sbjct  189  LAPFAD-MLNHSSEVKQCHAYDVKSGDLSVFAGKDYEIGDQVYIYYGPIPNNRLLRLYGF  247

Query  376  VDEDNPYDRVTLEAALNTEDPQYQDKR  456
            V  DNP D   L    +   P Y+ K+
Sbjct  248  VIPDNPNDSYDLVLTTHPMAPFYEQKQ  274



>ref|XP_001774257.1| predicted protein [Physcomitrella patens]
 gb|EDQ60893.1| predicted protein [Physcomitrella patens]
Length=458

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 35/130 (27%), Positives = 64/130 (49%), Gaps = 7/130 (5%)
 Frame = +1

Query  70   SLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLARRFALVPLGPPLLSYCSNCK  249
            ++  +YP ++  E    E FK A+    S    ++ +       +VP    + ++ S+ +
Sbjct  176  AVVNKYP-ELFGETVTLESFKHAYCVASSRSWGVEALG---SITMVPF-VDMFNHDSSAR  230

Query  250  AMLA--AVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLLINYGFVDEDNPYDRVTLEAAL  423
            A+LA    +G  ++V D+ Y  G  +V+  G  PNS L +++GF   DNP+D V +    
Sbjct  231  ALLAYYEEEGYAEVVADKDYNQGSQVVITYGTLPNSSLALDFGFTLPDNPHDEVQIWMEA  290

Query  424  NTEDPQYQDK  453
             + DP   +K
Sbjct  291  PSGDPLRAEK  300



>dbj|GAA97699.1| hypothetical protein E5Q_04377 [Mixia osmundae IAM 14324]
 gb|KEI36285.1| hypothetical protein L969DRAFT_97486 [Mixia osmundae IAM 14324]
Length=347

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 36/107 (34%), Positives = 53/107 (50%), Gaps = 4/107 (4%)
 Frame = +1

Query  106  EAFPFEIFKQAFVAVQS-CV-VHLQKVSLARRFALVPLGPPLLSYCSNCKAMLAAVDGA-  276
            E   F+ F+ A++ V S CV + L   +    F LVPL   + ++ S C       D A 
Sbjct  122  EIIDFDAFRWAWLCVNSRCVWLDLDYEAHEENFTLVPL-LDMANHSSTCANATVKYDHAH  180

Query  277  VQLVVDRPYKTGEPIVVWCGPQPNSKLLINYGFVDEDNPYDRVTLEA  417
             +L + RP K GE IV   G    + L   YGF++  NP++R+ L A
Sbjct  181  FELKLTRPVKRGEEIVFEYGGHDQATLWAEYGFIESSNPHERIDLTA  227



>ref|XP_009033030.1| hypothetical protein AURANDRAFT_61181 [Aureococcus anophagefferens]
 gb|EGB11917.1| hypothetical protein AURANDRAFT_61181 [Aureococcus anophagefferens]
Length=516

 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 41/149 (28%), Positives = 63/149 (42%), Gaps = 10/149 (7%)
 Frame = +1

Query  106  EAFPFEIFKQAFVAVQSCVVHLQKVSLARRFALVPL-----GPPLLSYCSNCKAMLAAV-  267
            E F FE ++ AF  + S  + L+        A+VP        P  S   + + +  A  
Sbjct  247  EIFTFEAWQWAFTNLFSRAIRLKASRAGELLAMVPYVDFINHSPFSSSYVDAREVPKAFP  306

Query  268  ----DGAVQLVVDRPYKTGEPIVVWCGPQPNSKLLINYGFVDEDNPYDRVTLEAALNTED  435
                +  V L  DR YK  E + +  GP+ N+ LL+ YGF  + NP++ V L    + +D
Sbjct  307  WEEKEDEVVLFADRAYKKFEQVFISYGPKSNADLLLLYGFALDRNPFNSVDLAVGASKDD  366

Query  436  PQYQDKRLAAQRNGKSSVQAFHVLICSLF  522
              Y  K   A+  G+    A   L    F
Sbjct  367  ALYDAKERFARGAGRDVSSAAFPLYADRF  395



>ref|XP_005831105.1| hypothetical protein GUITHDRAFT_109909 [Guillardia theta CCMP2712]
 gb|EKX44125.1| hypothetical protein GUITHDRAFT_109909 [Guillardia theta CCMP2712]
Length=442

 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 32/129 (25%), Positives = 56/129 (43%), Gaps = 3/129 (2%)
 Frame = +1

Query  94   DIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLA---RRFALVPLGPPLLSYCSNCKAMLAA  264
            D+P   +  + FK A+  + +    +   S     R+  + P+                A
Sbjct  210  DLPKAIYSLKEFKWAYATIFARAFDVDGKSFGFSGRQRIMAPMADLFNHGDVKTSYTFNA  269

Query  265  VDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLLINYGFVDEDNPYDRVTLEAALNTEDPQY  444
              G  +L   + +  GE I +    + N++ L+ YGFV E NP+D V + A++  + P Y
Sbjct  270  ASGHFELFTQQFFSRGEQIFMNYDSKNNAEFLLQYGFVIESNPHDYVGIAASIGNDQPFY  329

Query  445  QDKRLAAQR  471
            +DK L   R
Sbjct  330  RDKSLDCLR  338



>ref|XP_003057276.1| set domain protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH58921.1| set domain protein, partial [Micromonas pusilla CCMP1545]
Length=308

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 56/104 (54%), Gaps = 5/104 (5%)
 Frame = +1

Query  196  FALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLLINYGF  375
             ALVP    +L++   C A +    G V L  DR YK GE +    G +P+++LLI+YGF
Sbjct  172  LALVPWAD-MLNHKPGCNAYIDDSGGKVCLQPDRAYKPGEQVFASYGQRPSAELLISYGF  230

Query  376  VDE--DNPYDRVTLEAALNTEDPQYQDKRLAA-QRNGKSSVQAF  498
              E  +NP D   +   ++  D +Y D + AA ++ G   V++F
Sbjct  231  APEVGENPDDEYEITLGIDPND-RYADAKAAALEKIGLRPVESF  273



>ref|XP_002988920.1| hypothetical protein SELMODRAFT_129035, partial [Selaginella 
moellendorffii]
 gb|EFJ09949.1| hypothetical protein SELMODRAFT_129035, partial [Selaginella 
moellendorffii]
Length=389

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 37/125 (30%), Positives = 66/125 (53%), Gaps = 8/125 (6%)
 Frame = +1

Query  127  FKQAFVAVQSCVVHLQKVSLARRFALVPLGPPLLSYCSNCKAMLAAVD--GAVQLVVDRP  300
            FK A+  V S    ++ +   +  ALVP      ++ +NC+AML+  +     ++V DR 
Sbjct  133  FKHAYATVCSRAWGIETI---KSLALVPF-VDFFNHDANCRAMLSYDEDRHCAEVVSDRD  188

Query  301  YKTGEPIVVWCGPQPNSKLLINYGFVDEDNPYDRVT-LEAALNTEDPQYQDK-RLAAQRN  474
            Y TG+ +V+  G   N+ L +++GF    NP+D+V  +  +L+ +DP    K +L    N
Sbjct  189  YATGDQVVISYGQLSNATLALDFGFALPFNPHDQVAGIWLSLSEKDPLRDSKLKLLHSHN  248

Query  475  GKSSV  489
             ++ V
Sbjct  249  MQTCV  253



>ref|XP_009384903.1| PREDICTED: [Fructose-bisphosphate aldolase]-lysine N-methyltransferase, 
chloroplastic isoform X1 [Musa acuminata subsp. malaccensis]
Length=477

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 69/146 (47%), Gaps = 17/146 (12%)
 Frame = +1

Query  22   IKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLARRFA  201
            IK+EYS L       G + +Q+PY           F  A+  V S     +    ++  +
Sbjct  183  IKKEYSVL-------GPVLEQFPYVFGD--VHLMDFMHAYALVTS-----RAWDTSKGVS  228

Query  202  LVPLGPPLLSYCSNCKA-MLAAVDGAV-QLVVDRPYKTGEPIVVWCGPQPNSKLLINYGF  375
            L+P     L++   C A +L+ V   + +++ DR Y  GE +++  G   N+ LL+++GF
Sbjct  229  LIPFAD-FLNHDGTCDAVLLSDVHNEISEVIADRDYAVGEQVMIRYGKFSNATLLLDFGF  287

Query  376  VDEDNPYDRVTLEAALNTEDPQYQDK  453
                N YD+V L   + + DP Y  K
Sbjct  288  TLPYNRYDQVQLLLDIPSHDPLYGMK  313



>gb|AAI55279.1| SET domain containing 3 [Danio rerio]
Length=596

 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 37/139 (27%), Positives = 66/139 (47%), Gaps = 11/139 (8%)
 Frame = +1

Query  106  EAFPFEIFKQAFVAVQSCVVHLQKVSLAR-RFALVPLGPPLLSYCSNCKAMLAA----VD  270
            +AF F+ ++ A  +V +    +     +R   AL+PL       C++   ++       D
Sbjct  237  DAFTFDDYRWAVSSVMTRQNQIPTADGSRVTLALIPL----WDMCNHTNGLITTGYNLED  292

Query  271  GAVQLVVDRPYKTGEPIVVWCGPQPNSKLLINYGFVDEDNPYDRVTLEAALNTEDPQYQD  450
               + V  + YK GE I ++ G + N++ +I+ GF  EDN +DRV ++  ++  +  Y  
Sbjct  293  DRCECVALKDYKEGEQIYIFYGTRSNAEFVIHNGFFFEDNAHDRVKIKLGVSKSERLYAM  352

Query  451  KRLAAQRNG--KSSVQAFH  501
            K     R G   SS+ A H
Sbjct  353  KAEVLARAGIPASSIFALH  371



>gb|KIW25341.1| hypothetical protein PV07_08528 [Cladophialophora immunda]
Length=381

 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 39/76 (51%), Gaps = 2/76 (3%)
 Frame = +1

Query  196  FALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLLINYGF  375
             ALVP G       + CK   +A     +  VD   + GE + +  G  PN  LL+ YGF
Sbjct  182  LALVPFGDYFNHSDAGCKVAYSAT--GYEFKVDHTIEKGEELYISYGSHPNDFLLVEYGF  239

Query  376  VDEDNPYDRVTLEAAL  423
            + E+N +D V+L+A +
Sbjct  240  ILEENKWDEVSLDAVV  255



>gb|KIH94008.1| set domain containing protein [Sporothrix brasiliensis 5110]
Length=468

 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 42/79 (53%), Gaps = 5/79 (6%)
 Frame = +1

Query  193  RFALVPLGPPLLSYCSN--CKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLLIN  366
            R A+ P+   L ++ ++  C+A  AA       V DRPY  G+ + +  G   N  LL+ 
Sbjct  217  RIAMQPVAD-LFNHAADRGCRAAYAAQ--GFSFVADRPYSEGDEVPISYGAHANDALLVE  273

Query  367  YGFVDEDNPYDRVTLEAAL  423
            YGFV  DN +D V L+A L
Sbjct  274  YGFVLADNRWDEVALDAVL  292



>gb|ERS98967.1| hypothetical protein HMPREF1624_04162 [Sporothrix schenckii ATCC 
58251]
Length=463

 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 42/79 (53%), Gaps = 5/79 (6%)
 Frame = +1

Query  193  RFALVPLGPPLLSYCSN--CKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLLIN  366
            R A+ P+   L ++ ++  C+A  AA       V DRPY  G+ + +  G   N  LL+ 
Sbjct  216  RIAMQPVAD-LFNHAADRGCRAAYAA--QGFSFVADRPYSEGDEVPISYGAHANDALLVE  272

Query  367  YGFVDEDNPYDRVTLEAAL  423
            YGFV  DN +D V L+A L
Sbjct  273  YGFVLADNRWDEVALDAVL  291



>gb|EWM24078.1| ribulose- -bisphosphate carboxylase oxygenase small subunit n-methyltransferase 
i [Nannochloropsis gaditana]
Length=647

 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 42/74 (57%), Gaps = 0/74 (0%)
 Frame = +1

Query  277  VQLVVDRPYKTGEPIVVWCGPQPNSKLLINYGFVDEDNPYDRVTLEAALNTEDPQYQDKR  456
            + +  D+ YK  E + +  GP+ N+ LL+ YGF  + NP++ V L  AL  +DP +++KR
Sbjct  448  ITIYADKDYKKMEQVYISYGPKSNADLLLLYGFCLDRNPFNSVDLTVALLPDDPLFEEKR  507

Query  457  LAAQRNGKSSVQAF  498
                +  +   +AF
Sbjct  508  AFLAQAERREKEAF  521



>gb|KGQ05489.1| Ribulose-1,5 bisphosphate carboxylase/oxygenase la rge subunit 
N-methyltransferaseic [Beauveria bassiana D1-5]
Length=406

 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 35/130 (27%), Positives = 63/130 (48%), Gaps = 3/130 (2%)
 Frame = +1

Query  73   LFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLARRFALVPLGPPLLSYCSNCKA  252
            +F ++    P + F F+ +K A  ++ S  +    +S      L+     +L++ S+ K 
Sbjct  148  VFMRHRDLFPLDKFSFQHYKWALSSIWSRGMDF-TISEGNSVRLMAPFADMLNHASDAKQ  206

Query  253  MLA--AVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLLINYGFVDEDNPYDRVTLEAALN  426
              A     G++ ++  R YK G+ + ++ G   NS+LL  YGFV  DNP D   L    +
Sbjct  207  CHAYDPSTGSLTVLACRDYKVGDQVFIYYGNVSNSRLLRLYGFVLPDNPSDNYELVLQTS  266

Query  427  TEDPQYQDKR  456
            +  P Y+ K+
Sbjct  267  SMAPLYEQKQ  276



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 974366829000