BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF051K24

Length=309
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004516386.1|  PREDICTED: long chain base biosynthesis prot...    110   5e-26   Cicer arietinum [garbanzo]
dbj|BAC55228.1|  serine palmitoyltransferase                            109   9e-26   Lotus japonicus
gb|KEH25646.1|  long chain base biosynthesis 2a-like protein            109   9e-26   Medicago truncatula
gb|KHG30176.1|  Serine palmitoyltransferase 2                           108   1e-25   Gossypium arboreum [tree cotton]
ref|XP_007038096.1|  Long chain base2 isoform 2                         108   1e-25   
ref|XP_007038095.1|  Long chain base2 isoform 1                         108   2e-25   
ref|XP_003518128.1|  PREDICTED: long chain base biosynthesis prot...    108   2e-25   Glycine max [soybeans]
ref|XP_002512864.1|  serine palmitoyltransferase, putative              107   4e-25   Ricinus communis
ref|XP_008464380.1|  PREDICTED: long chain base biosynthesis prot...    107   8e-25   Cucumis melo [Oriental melon]
ref|XP_004138028.1|  PREDICTED: long chain base biosynthesis prot...    106   8e-25   Cucumis sativus [cucumbers]
ref|XP_003548027.1|  PREDICTED: long chain base biosynthesis prot...    106   1e-24   Glycine max [soybeans]
gb|KHN13380.1|  Serine palmitoyltransferase 2                           106   1e-24   Glycine soja [wild soybean]
ref|XP_009611514.1|  PREDICTED: long chain base biosynthesis prot...    105   2e-24   Nicotiana tomentosiformis
dbj|BAG68298.1|  serine palmitoyltransferase                            105   2e-24   Nicotiana benthamiana
ref|XP_009761445.1|  PREDICTED: long chain base biosynthesis prot...    105   2e-24   Nicotiana sylvestris
gb|KJB51268.1|  hypothetical protein B456_008G209600                    105   3e-24   Gossypium raimondii
ref|XP_004241473.1|  PREDICTED: long chain base biosynthesis prot...    104   4e-24   Solanum lycopersicum
ref|XP_010036863.1|  PREDICTED: long chain base biosynthesis prot...    104   4e-24   Eucalyptus grandis [rose gum]
ref|XP_006347368.1|  PREDICTED: long chain base biosynthesis prot...    104   5e-24   Solanum tuberosum [potatoes]
ref|XP_010093950.1|  Serine palmitoyltransferase 2                      105   5e-24   
ref|XP_002284409.1|  PREDICTED: long chain base biosynthesis prot...    104   6e-24   Vitis vinifera
emb|CBI15735.3|  unnamed protein product                                104   6e-24   Vitis vinifera
ref|XP_007151745.1|  hypothetical protein PHAVU_004G071100g             104   7e-24   Phaseolus vulgaris [French bean]
gb|ABV57769.1|  serine C-palmitoyltransferase                           102   1e-23   Gossypium hirsutum [American cotton]
ref|XP_004235384.1|  PREDICTED: long chain base biosynthesis prot...    103   1e-23   
ref|XP_002318160.1|  serine palmitoyltransferase family protein         103   1e-23   Populus trichocarpa [western balsam poplar]
ref|XP_011042943.1|  PREDICTED: long chain base biosynthesis prot...    103   1e-23   Populus euphratica
dbj|BAE96963.1|  serine palmitpoyltransferase subunit2                  103   2e-23   Nicotiana tabacum [American tobacco]
gb|KHN00617.1|  Serine palmitoyltransferase 2                           103   2e-23   Glycine soja [wild soybean]
gb|KCW48525.1|  hypothetical protein EUGRSUZ_K02201                     103   2e-23   Eucalyptus grandis [rose gum]
ref|XP_006364387.1|  PREDICTED: long chain base biosynthesis prot...    102   2e-23   Solanum tuberosum [potatoes]
ref|XP_006468870.1|  PREDICTED: long chain base biosynthesis prot...    102   3e-23   Citrus sinensis [apfelsine]
gb|KDO47369.1|  hypothetical protein CISIN_1g040324mg                   102   3e-23   Citrus sinensis [apfelsine]
ref|XP_006446965.1|  hypothetical protein CICLE_v10015046mg             102   3e-23   Citrus clementina [clementine]
emb|CAB44316.1|  serine palmitoyltransferase                            102   3e-23   Solanum tuberosum [potatoes]
emb|CDO98665.1|  unnamed protein product                                102   5e-23   Coffea canephora [robusta coffee]
ref|XP_004304557.1|  PREDICTED: long chain base biosynthesis prot...    101   6e-23   Fragaria vesca subsp. vesca
ref|XP_004161364.1|  PREDICTED: LOW QUALITY PROTEIN: long chain b...    101   8e-23   
gb|EYU24476.1|  hypothetical protein MIMGU_mgv1a004686mg                101   9e-23   Erythranthe guttata [common monkey flower]
ref|XP_011083372.1|  PREDICTED: long chain base biosynthesis prot...    100   1e-22   Sesamum indicum [beniseed]
gb|KDP41837.1|  hypothetical protein JCGZ_26855                         100   1e-22   Jatropha curcas
ref|XP_010096046.1|  Serine palmitoyltransferase 2                      100   2e-22   
ref|XP_010678318.1|  PREDICTED: long chain base biosynthesis prot...    100   2e-22   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007215280.1|  hypothetical protein PRUPE_ppa004859mg           99.4    4e-22   
gb|KJB51269.1|  hypothetical protein B456_008G209600                  99.4    4e-22   Gossypium raimondii
ref|XP_008379061.1|  PREDICTED: long chain base biosynthesis prot...  99.0    6e-22   
ref|XP_009378026.1|  PREDICTED: long chain base biosynthesis prot...  99.0    7e-22   Pyrus x bretschneideri [bai li]
ref|XP_008341247.1|  PREDICTED: long chain base biosynthesis prot...  99.0    7e-22   Malus domestica [apple tree]
ref|XP_007031987.1|  Long chain base2 isoform 1                       98.6    8e-22   Theobroma cacao [chocolate]
ref|XP_010929641.1|  PREDICTED: long chain base biosynthesis prot...  98.6    1e-21   Elaeis guineensis
ref|XP_007209963.1|  hypothetical protein PRUPE_ppa004890mg           98.2    1e-21   Prunus persica
ref|XP_008239635.1|  PREDICTED: long chain base biosynthesis prot...  97.8    1e-21   Prunus mume [ume]
ref|XP_006446964.1|  hypothetical protein CICLE_v10017847mg           97.8    2e-21   Citrus clementina [clementine]
ref|XP_011073130.1|  PREDICTED: long chain base biosynthesis prot...  97.8    2e-21   Sesamum indicum [beniseed]
ref|XP_010907607.1|  PREDICTED: long chain base biosynthesis prot...  97.4    2e-21   Elaeis guineensis
ref|XP_010249161.1|  PREDICTED: long chain base biosynthesis prot...  97.4    2e-21   Nelumbo nucifera [Indian lotus]
ref|XP_008775142.1|  PREDICTED: long chain base biosynthesis prot...  97.1    3e-21   Phoenix dactylifera
ref|XP_008231042.1|  PREDICTED: long chain base biosynthesis prot...  97.1    3e-21   Prunus mume [ume]
ref|NP_197756.1|  serine palmitoyltransferase subunit LCB2            97.1    4e-21   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB03231.1|  serine palmitoyltransferase                          97.1    4e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002872066.1|  LCB2 subunit protein                             96.7    5e-21   Arabidopsis lyrata subsp. lyrata
ref|XP_008778939.1|  PREDICTED: long chain base biosynthesis prot...  96.7    6e-21   
ref|XP_002275468.1|  PREDICTED: long chain base biosynthesis prot...  95.9    7e-21   Vitis vinifera
gb|EPS63051.1|  serine palmitoyltransferase                           94.4    9e-21   Genlisea aurea
gb|EMT23338.1|  Serine palmitoyltransferase 2                         95.1    2e-20   
emb|CDX87007.1|  BnaC03g52770D                                        95.1    2e-20   
gb|EMS48138.1|  Serine palmitoyltransferase 2                         95.1    2e-20   Triticum urartu
ref|XP_006287613.1|  hypothetical protein CARUB_v10000825mg           94.4    3e-20   Capsella rubella
ref|XP_010421176.1|  PREDICTED: long chain base biosynthesis prot...  94.4    3e-20   Camelina sativa [gold-of-pleasure]
ref|NP_001045279.1|  Os01g0928800                                     94.4    3e-20   
ref|XP_010454654.1|  PREDICTED: long chain base biosynthesis prot...  93.2    8e-20   Camelina sativa [gold-of-pleasure]
ref|XP_009403557.1|  PREDICTED: long chain base biosynthesis prot...  93.2    9e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004979342.1|  PREDICTED: long chain base biosynthesis prot...  93.2    9e-20   Setaria italica
ref|NP_001148953.1|  serine palmitoyltransferase 2                    93.2    9e-20   
ref|XP_002450805.1|  hypothetical protein SORBIDRAFT_05g018880        93.2    9e-20   Sorghum bicolor [broomcorn]
emb|CDM85908.1|  unnamed protein product                              94.0    9e-20   Triticum aestivum [Canadian hard winter wheat]
gb|ABW97708.1|  serine palmitoyltransferase long chain base subunit   93.2    9e-20   Brassica rapa subsp. chinensis [bok-choy]
ref|NP_001067972.1|  Os11g0516000                                     92.8    9e-20   
ref|XP_009150176.1|  PREDICTED: long chain base biosynthesis prot...  92.8    9e-20   Brassica rapa
ref|NP_001151995.1|  LOC100285632                                     92.8    1e-19   Zea mays [maize]
gb|AFW84059.1|  putative serine palmitoyltransferase                  91.3    1e-19   
ref|XP_009404745.1|  PREDICTED: long chain base biosynthesis prot...  92.4    1e-19   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK34178.1|  hypothetical protein AALP_AA5G110700                  92.4    1e-19   Arabis alpina [alpine rockcress]
ref|XP_009403784.1|  PREDICTED: long chain base biosynthesis prot...  92.4    1e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006404217.1|  hypothetical protein EUTSA_v10010322mg           92.4    2e-19   Eutrema salsugineum [saltwater cress]
ref|XP_006662956.1|  PREDICTED: long chain base biosynthesis prot...  92.0    2e-19   Oryza brachyantha
ref|XP_011073128.1|  PREDICTED: long chain base biosynthesis prot...  92.0    2e-19   
ref|XP_004971156.1|  PREDICTED: long chain base biosynthesis prot...  91.7    2e-19   Setaria italica
ref|XP_002459025.1|  hypothetical protein SORBIDRAFT_03g044700        91.7    3e-19   Sorghum bicolor [broomcorn]
ref|XP_008656901.1|  PREDICTED: long chain base biosynthesis prot...  91.7    3e-19   
ref|XP_008791061.1|  PREDICTED: long chain base biosynthesis prot...  91.7    3e-19   Phoenix dactylifera
ref|XP_010660694.1|  PREDICTED: long chain base biosynthesis prot...  91.7    3e-19   Vitis vinifera
ref|XP_006645277.1|  PREDICTED: long chain base biosynthesis prot...  91.3    4e-19   Oryza brachyantha
ref|XP_009421040.1|  PREDICTED: long chain base biosynthesis prot...  91.3    5e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010515202.1|  PREDICTED: long chain base biosynthesis prot...  90.9    5e-19   Camelina sativa [gold-of-pleasure]
ref|XP_009419359.1|  PREDICTED: long chain base biosynthesis prot...  90.9    5e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_190447.1|  serine palmitoyltransferase 1                       90.9    6e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010503519.1|  PREDICTED: long chain base biosynthesis prot...  90.9    6e-19   Camelina sativa [gold-of-pleasure]
ref|XP_006290987.1|  hypothetical protein CARUB_v10017101mg           90.9    6e-19   Capsella rubella
emb|CDX68498.1|  BnaC01g25760D                                        90.5    9e-19   
ref|XP_009151545.1|  PREDICTED: long chain base biosynthesis prot...  90.1    1e-18   Brassica rapa
emb|CDX83048.1|  BnaA01g20480D                                        90.1    1e-18   
ref|XP_002321740.1|  serine palmitoyltransferase family protein       89.0    2e-18   Populus trichocarpa [western balsam poplar]
emb|CAP16702.1|  putative serine palmitoyltransferase subunit LCB2    87.4    3e-18   Nicotiana benthamiana
ref|XP_003577540.1|  PREDICTED: long chain base biosynthesis prot...  89.0    3e-18   Brachypodium distachyon [annual false brome]
ref|XP_010519476.1|  PREDICTED: long chain base biosynthesis prot...  88.6    3e-18   Tarenaya hassleriana [spider flower]
ref|XP_006394629.1|  hypothetical protein EUTSA_v10004251mg           87.8    4e-18   
ref|XP_011002110.1|  PREDICTED: long chain base biosynthesis prot...  88.6    4e-18   Populus euphratica
ref|XP_006394630.1|  hypothetical protein EUTSA_v10004251mg           87.8    5e-18   
ref|XP_002875925.1|  hypothetical protein ARALYDRAFT_485232           87.8    6e-18   
ref|XP_010493489.1|  PREDICTED: long chain base biosynthesis prot...  87.8    6e-18   Camelina sativa [gold-of-pleasure]
gb|KFK27657.1|  hypothetical protein AALP_AA8G411600                  87.8    7e-18   Arabis alpina [alpine rockcress]
ref|XP_003564989.1|  PREDICTED: long chain base biosynthesis prot...  87.8    8e-18   Brachypodium distachyon [annual false brome]
ref|XP_009363696.1|  PREDICTED: long chain base biosynthesis prot...  84.0    2e-17   Pyrus x bretschneideri [bai li]
ref|XP_009411041.1|  PREDICTED: long chain base biosynthesis prot...  81.3    2e-15   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMS46639.1|  Serine palmitoyltransferase 2                         78.2    2e-14   Triticum urartu
ref|XP_002450804.1|  hypothetical protein SORBIDRAFT_05g018870        73.2    1e-12   
ref|XP_006828786.1|  hypothetical protein AMTR_s00001p00112910        71.6    4e-12   Amborella trichopoda
gb|ABR18369.1|  unknown                                               68.6    5e-11   Picea sitchensis
ref|XP_011073129.1|  PREDICTED: long chain base biosynthesis prot...  66.6    2e-10   
ref|XP_006645276.1|  PREDICTED: long chain base biosynthesis prot...  65.9    4e-10   Oryza brachyantha
ref|NP_001045278.1|  Os01g0928700                                     65.9    4e-10   
ref|XP_006645275.1|  PREDICTED: long chain base biosynthesis prot...  65.9    4e-10   Oryza brachyantha
ref|XP_008678154.1|  PREDICTED: long chain base biosynthesis prot...  65.1    6e-10   Zea mays [maize]
gb|EEE52176.1|  hypothetical protein OsJ_34042                        65.1    7e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008678152.1|  PREDICTED: long chain base biosynthesis prot...  65.1    9e-10   
ref|XP_009150173.1|  PREDICTED: long chain base biosynthesis prot...  62.8    5e-09   Brassica rapa
ref|XP_009369635.1|  PREDICTED: long chain base biosynthesis prot...  60.1    5e-09   
gb|AFW60854.1|  hypothetical protein ZEAMMB73_652361                  60.8    8e-09   
ref|XP_009394362.1|  PREDICTED: long chain base biosynthesis prot...  62.0    9e-09   
ref|XP_001783810.1|  predicted protein                                61.6    1e-08   
gb|EAY77076.1|  hypothetical protein OsI_05036                        60.5    3e-08   Oryza sativa Indica Group [Indian rice]
sp|Q8RYL1.1|LCB2B_ORYSJ  RecName: Full=Long chain base biosynthes...  60.1    3e-08   Oryza sativa Japonica Group [Japonica rice]
emb|CDY37910.1|  BnaA06g19070D                                        55.5    8e-08   Brassica napus [oilseed rape]
gb|EPZ34220.1|  Pyridoxal phosphate-dependent transferase domain-...  55.5    1e-06   Rozella allomycis CSF55
ref|XP_003298216.1|  hypothetical protein PTT_08848                   54.7    3e-06   
ref|XP_001936333.1|  serine palmitoyltransferase 2                    54.3    4e-06   Pyrenophora tritici-repentis Pt-1C-BFP
ref|XP_011401811.1|  Serine palmitoyltransferase 2                    53.9    4e-06   Auxenochlorella protothecoides
gb|KIW03829.1|  hypothetical protein PV09_05128                       54.3    4e-06   Verruconis gallopava
gb|EMD88052.1|  hypothetical protein COCHEDRAFT_1227287               52.4    2e-05   Bipolaris maydis C5
ref|XP_007688714.1|  hypothetical protein COCMIDRAFT_5986             52.4    2e-05   Bipolaris oryzae ATCC 44560
ref|XP_007713154.1|  hypothetical protein COCCADRAFT_5787             52.4    2e-05   Bipolaris zeicola 26-R-13
ref|XP_007699462.1|  hypothetical protein COCSADRAFT_316156           52.4    2e-05   Bipolaris sorokiniana ND90Pr
ref|XP_008025168.1|  hypothetical protein SETTUDRAFT_73160            52.0    2e-05   Exserohilum turcica Et28A
ref|XP_005848468.1|  hypothetical protein CHLNCDRAFT_144864           52.0    2e-05   Chlorella variabilis
ref|XP_005706634.1|  serine palmitoyltransferase                      52.0    2e-05   Galdieria sulphuraria
gb|EWC48527.1|  serine palmitoyltransferase 2                         52.0    2e-05   Drechslerella stenobrocha 248
ref|XP_011127662.1|  hypothetical protein AOL_s00215g158              51.6    3e-05   Arthrobotrys oligospora ATCC 24927
gb|KIK44721.1|  hypothetical protein CY34DRAFT_10860                  51.2    4e-05   Suillus luteus UH-Slu-Lm8-n1
ref|XP_005647033.1|  PLP-dependent transferase                        51.2    4e-05   Coccomyxa subellipsoidea C-169
gb|EWM21787.1|  serine palmitoyltransferase                           50.8    6e-05   Nannochloropsis gaditana
gb|KIN04887.1|  hypothetical protein OIDMADRAFT_115587                50.8    6e-05   Oidiodendron maius Zn
gb|ESA21945.1|  hypothetical protein GLOINDRAFT_342892                50.4    6e-05   
gb|KIK29494.1|  hypothetical protein PISMIDRAFT_672183                50.4    7e-05   Pisolithus microcarpus 441
ref|XP_011107452.1|  hypothetical protein H072_1460                   50.4    9e-05   
ref|XP_007303817.1|  serine palmitoyltransferase 2                    50.1    1e-04   Stereum hirsutum FP-91666 SS1
ref|XP_007869602.1|  PLP-dependent transferase                        50.1    1e-04   Gloeophyllum trabeum ATCC 11539
gb|KFY75400.1|  hypothetical protein V499_04622                       49.7    1e-04   Pseudogymnoascus sp. VKM F-103
ref|XP_003840146.1|  similar to serine palmitoyltransferase 2         49.7    1e-04   Leptosphaeria maculans JN3
gb|KFX90109.1|  hypothetical protein V490_06649                       49.7    1e-04   Pseudogymnoascus sp. VKM F-3557
gb|KFY25007.1|  hypothetical protein V493_04894                       49.7    1e-04   Pseudogymnoascus sp. VKM F-4281 (FW-2241)
gb|KFZ07335.1|  hypothetical protein V501_06551                       49.7    1e-04   Pseudogymnoascus sp. VKM F-4519 (FW-2642)
gb|KFY12487.1|  hypothetical protein V491_06778                       49.7    1e-04   Pseudogymnoascus sp. VKM F-3775
gb|KFY10100.1|  hypothetical protein V492_05191                       49.7    1e-04   Pseudogymnoascus sp. VKM F-4246
gb|KFY85583.1|  hypothetical protein V500_08288                       49.7    1e-04   Pseudogymnoascus sp. VKM F-4518 (FW-2643)
gb|ELR04857.1|  serine palmitoyltransferase                           49.7    2e-04   Pseudogymnoascus destructans 20631-21
gb|KFY93153.1|  hypothetical protein V498_04536                       49.7    2e-04   Pseudogymnoascus sp. VKM F-4517 (FW-2822)
gb|KFY59490.1|  hypothetical protein V496_05676                       49.7    2e-04   Pseudogymnoascus sp. VKM F-4515 (FW-2607)
ref|XP_007595827.1|  aminotransferase class I and II                  49.3    2e-04   
ref|XP_461423.2|  DEHA2F24926p                                        49.3    2e-04   Debaryomyces hansenii CBS767
ref|XP_007797940.1|  putative serine palmitoyltransferase 2 protein   49.3    2e-04   
gb|EKG16858.1|  Aminotransferase class I/classII                      49.3    2e-04   Macrophomina phaseolina MS6
ref|XP_003348860.1|  hypothetical protein SMAC_01883                  49.3    2e-04   Sordaria macrospora k-hell
gb|KDN61953.1|  putative aminotransferase class I and II              48.9    2e-04   Colletotrichum sublineola
gb|ENH86493.1|  serine palmitoyltransferase                           48.9    2e-04   
ref|XP_007587353.1|  putative serine palmitoyltransferase protein     48.9    3e-04   
gb|EFQ25280.1|  aminotransferase class I and II                       48.9    3e-04   Colletotrichum graminicola M1.001
ref|XP_009851217.1|  serine palmitoyltransferase 2                    48.9    3e-04   Neurospora tetrasperma FGSC 2508
ref|XP_007394593.1|  hypothetical protein PHACADRAFT_254057           48.5    3e-04   Phanerochaete carnosa HHB-10118-sp
gb|KIO02524.1|  hypothetical protein M404DRAFT_1002135                48.5    3e-04   Pisolithus tinctorius Marx 270
emb|CDS13464.1|  hypothetical protein LRAMOSA05640                    48.5    3e-04   Lichtheimia ramosa
ref|XP_956766.1|  serine palmitoyltransferase 2                       48.5    3e-04   Neurospora crassa OR74A
ref|XP_002839631.1|  hypothetical protein                             48.5    3e-04   Tuber melanosporum Mel28
gb|KFX46982.1|  Serine palmitoyltransferase 2                         48.5    4e-04   Talaromyces marneffei PM1
ref|XP_007919029.1|  putative serine palmitoyltransferase 2 protein   48.1    5e-04   Phaeoacremonium minimum UCRPA7
ref|XP_007832647.1|  Serine palmitoyltransferase 2                    48.1    5e-04   Pestalotiopsis fici W106-1
gb|AAP47107.1|  serine palmitoyl transferase subunit                  47.8    5e-04   Aspergillus nidulans
ref|XP_001239438.1|  hypothetical protein CIMG_09059                  47.8    5e-04   Coccidioides immitis RS
ref|XP_003067044.1|  Serine palmitoyltransferase 2 , putative         47.8    5e-04   Coccidioides posadasii C735 delta SOWgp
ref|XP_007769766.1|  serine palmitoyltransferase 2                    47.8    6e-04   Coniophora puteana RWD-64-598 SS2
ref|XP_658706.1|  hypothetical protein AN1102.2                       47.8    6e-04   Aspergillus nidulans FGSC A4
gb|KIK39668.1|  hypothetical protein CY34DRAFT_14231                  48.1    6e-04   Suillus luteus UH-Slu-Lm8-n1
ref|XP_007303814.1|  serine palmitoyltransferase 2                    47.8    7e-04   Stereum hirsutum FP-91666 SS1
gb|EER37408.1|  serine palmitoyltransferase                           47.8    7e-04   Histoplasma capsulatum H143
gb|EEH03654.1|  serine palmitoyltransferase                           47.8    7e-04   Histoplasma capsulatum G186AR
gb|KEQ73715.1|  serine palmitoyl transferase subunit 2                47.8    7e-04   Aureobasidium namibiae CBS 147.97
ref|XP_001212205.1|  serine palmitoyltransferase 2                    47.8    7e-04   Aspergillus terreus NIH2624
gb|KEQ94532.1|  hypothetical protein AUEXF2481DRAFT_41119             47.4    7e-04   Aureobasidium subglaciale EXF-2481
ref|XP_001392526.1|  serine palmitoyltransferase 2                    47.4    7e-04   Aspergillus niger CBS 513.88
ref|XP_001818901.1|  serine palmitoyltransferase 2                    47.4    7e-04   Aspergillus oryzae RIB40
ref|XP_003031688.1|  hypothetical protein SCHCODRAFT_82237            47.4    8e-04   Schizophyllum commune H4-8
gb|KIM92390.1|  hypothetical protein PILCRDRAFT_810446                47.4    8e-04   Piloderma croceum F 1598
gb|KEQ84476.1|  putative serine palmitoyltransferase 2                47.4    8e-04   Aureobasidium pullulans EXF-150
gb|EPQ62028.1|  hypothetical protein BGT96224_A20663                  47.4    8e-04   Blumeria graminis f. sp. tritici 96224
gb|EHL00610.1|  putative Serine palmitoyltransferase 2                47.4    8e-04   Glarea lozoyensis 74030
ref|XP_007674599.1|  hypothetical protein BAUCODRAFT_66436            47.4    9e-04   Baudoinia panamericana UAMH 10762
ref|XP_008086364.1|  PLP-dependent transferase                        47.4    9e-04   Glarea lozoyensis ATCC 20868



>ref|XP_004516386.1| PREDICTED: long chain base biosynthesis protein 2a-like [Cicer 
arietinum]
Length=489

 Score =   110 bits (274),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 47/55 (85%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            MI IPY TALTT+FSY LLFAFGQFRDFFRK FDWC S+NLQGYAPICLG EDFY
Sbjct  1    MIAIPYLTALTTYFSYGLLFAFGQFRDFFRKIFDWCSSNNLQGYAPICLGLEDFY  55



>dbj|BAC55228.1| serine palmitoyltransferase [Lotus japonicus]
Length=489

 Score =   109 bits (272),  Expect = 9e-26, Method: Composition-based stats.
 Identities = 47/55 (85%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            MI IPY TALTT+FSY LLFAFGQFRDFFRK FDWC S+NLQGYAPICLG EDFY
Sbjct  1    MIAIPYLTALTTYFSYGLLFAFGQFRDFFRKIFDWCSSNNLQGYAPICLGLEDFY  55



>gb|KEH25646.1| long chain base biosynthesis 2a-like protein [Medicago truncatula]
Length=490

 Score =   109 bits (272),  Expect = 9e-26, Method: Composition-based stats.
 Identities = 47/55 (85%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            MI IPY TALTT+FSY LLFAFGQFRDFFRK FDWC S+NLQGYAPICLG EDFY
Sbjct  1    MIAIPYLTALTTYFSYGLLFAFGQFRDFFRKIFDWCSSNNLQGYAPICLGLEDFY  55



>gb|KHG30176.1| Serine palmitoyltransferase 2 [Gossypium arboreum]
Length=496

 Score =   108 bits (271),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 47/56 (84%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFYT  309
            MI IPY TALTT+FSY LLFAFGQFRDFFRK FDW H+SNL+GYAPICLG EDFYT
Sbjct  1    MITIPYLTALTTYFSYGLLFAFGQFRDFFRKIFDWWHASNLEGYAPICLGLEDFYT  56



>ref|XP_007038096.1| Long chain base2 isoform 2 [Theobroma cacao]
 gb|EOY22597.1| Long chain base2 isoform 2 [Theobroma cacao]
Length=489

 Score =   108 bits (271),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 47/55 (85%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            MI IPY TALTT+FSY LLFAFGQFRDFFRK FDW H+SNLQGYAPICLG EDFY
Sbjct  1    MITIPYLTALTTYFSYGLLFAFGQFRDFFRKIFDWWHASNLQGYAPICLGLEDFY  55



>ref|XP_007038095.1| Long chain base2 isoform 1 [Theobroma cacao]
 gb|EOY22596.1| Long chain base2 isoform 1 [Theobroma cacao]
Length=512

 Score =   108 bits (271),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 47/55 (85%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            MI IPY TALTT+FSY LLFAFGQFRDFFRK FDW H+SNLQGYAPICLG EDFY
Sbjct  1    MITIPYLTALTTYFSYGLLFAFGQFRDFFRKIFDWWHASNLQGYAPICLGLEDFY  55



>ref|XP_003518128.1| PREDICTED: long chain base biosynthesis protein 2a-like [Glycine 
max]
Length=489

 Score =   108 bits (270),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 46/55 (84%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            MI IPY TALTT+FSY LLFAFGQFRDFFRK FDWC ++NLQGYAPICLG EDFY
Sbjct  1    MIAIPYLTALTTYFSYGLLFAFGQFRDFFRKIFDWCSANNLQGYAPICLGLEDFY  55



>ref|XP_002512864.1| serine palmitoyltransferase, putative [Ricinus communis]
 gb|EEF49367.1| serine palmitoyltransferase, putative [Ricinus communis]
Length=488

 Score =   107 bits (268),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 46/55 (84%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            MI IPY TALTT+FSY LLFAFGQ RDFFRK FDWC S+NLQGYAPICLG EDFY
Sbjct  1    MIAIPYLTALTTYFSYGLLFAFGQIRDFFRKIFDWCKSNNLQGYAPICLGLEDFY  55



>ref|XP_008464380.1| PREDICTED: long chain base biosynthesis protein 2a [Cucumis melo]
Length=490

 Score =   107 bits (266),  Expect = 8e-25, Method: Composition-based stats.
 Identities = 47/55 (85%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            MI IPY TALTT+FSY LLFAFGQFRDFFRK FDW +SSNLQGYAPICLG EDFY
Sbjct  1    MITIPYLTALTTYFSYGLLFAFGQFRDFFRKIFDWWNSSNLQGYAPICLGLEDFY  55



>ref|XP_004138028.1| PREDICTED: long chain base biosynthesis protein 2a-like [Cucumis 
sativus]
 gb|KGN63448.1| hypothetical protein Csa_1G000720 [Cucumis sativus]
Length=490

 Score =   106 bits (265),  Expect = 8e-25, Method: Composition-based stats.
 Identities = 47/55 (85%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            MI IPY TALTT+FSY LLFAFGQFRDFFRK FDW +SSNLQGYAPICLG EDFY
Sbjct  1    MITIPYLTALTTYFSYGLLFAFGQFRDFFRKIFDWWNSSNLQGYAPICLGLEDFY  55



>ref|XP_003548027.1| PREDICTED: long chain base biosynthesis protein 2a-like [Glycine 
max]
Length=490

 Score =   106 bits (264),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 45/55 (82%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            MI IPY TALTT+FSY LLFAFGQFRDFFRK FDWC ++ LQGYAPICLG EDFY
Sbjct  1    MIAIPYLTALTTYFSYGLLFAFGQFRDFFRKIFDWCSANTLQGYAPICLGLEDFY  55



>gb|KHN13380.1| Serine palmitoyltransferase 2 [Glycine soja]
Length=490

 Score =   106 bits (264),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 45/55 (82%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            MI IPY TALTT+FSY LLFAFGQFRDFFRK FDWC ++ LQGYAPICLG EDFY
Sbjct  1    MIAIPYLTALTTYFSYGLLFAFGQFRDFFRKIFDWCSANTLQGYAPICLGLEDFY  55



>ref|XP_009611514.1| PREDICTED: long chain base biosynthesis protein 2a [Nicotiana 
tomentosiformis]
Length=489

 Score =   105 bits (263),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 46/55 (84%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            MI IPY TALTT+FSY LLFAFGQFRDFFRK FDW  +SNLQGYAPICLG EDFY
Sbjct  1    MITIPYLTALTTYFSYGLLFAFGQFRDFFRKIFDWWKASNLQGYAPICLGLEDFY  55



>dbj|BAG68298.1| serine palmitoyltransferase [Nicotiana benthamiana]
Length=489

 Score =   105 bits (263),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 46/55 (84%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            MI IPY TALTT+FSY LLFAFGQFRDFFRK FDW  +SNLQGYAPICLG EDFY
Sbjct  1    MITIPYLTALTTYFSYGLLFAFGQFRDFFRKIFDWWKASNLQGYAPICLGLEDFY  55



>ref|XP_009761445.1| PREDICTED: long chain base biosynthesis protein 2a [Nicotiana 
sylvestris]
Length=489

 Score =   105 bits (263),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 46/55 (84%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            MI IPY TALTT+FSY LLFAFGQFRDFFRK FDW  +SNLQGYAPICLG EDFY
Sbjct  1    MITIPYLTALTTYFSYGLLFAFGQFRDFFRKIFDWWKASNLQGYAPICLGLEDFY  55



>gb|KJB51268.1| hypothetical protein B456_008G209600 [Gossypium raimondii]
Length=496

 Score =   105 bits (261),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 45/55 (82%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            MI IPY TALTT+FSY LLFAFGQFRDFFR  FDW H+SNL+GYAPICLG EDFY
Sbjct  1    MITIPYLTALTTYFSYGLLFAFGQFRDFFRNIFDWWHASNLEGYAPICLGLEDFY  55



>ref|XP_004241473.1| PREDICTED: long chain base biosynthesis protein 2a-like [Solanum 
lycopersicum]
Length=489

 Score =   104 bits (260),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 45/55 (82%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            MI IPY TAL+T+FSY LLFAFGQFRDFFRK FDW ++SNLQGYAPICLG EDFY
Sbjct  1    MINIPYLTALSTYFSYGLLFAFGQFRDFFRKIFDWWNASNLQGYAPICLGLEDFY  55



>ref|XP_010036863.1| PREDICTED: long chain base biosynthesis protein 2a [Eucalyptus 
grandis]
 gb|KCW48524.1| hypothetical protein EUGRSUZ_K02201 [Eucalyptus grandis]
Length=489

 Score =   104 bits (260),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 45/56 (80%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFYT  309
            MI IPY TAL+T+FSY LLFAFGQFRDFFRK FDW  S +LQGYAPICLG EDFYT
Sbjct  1    MITIPYLTALSTYFSYGLLFAFGQFRDFFRKIFDWWRSGDLQGYAPICLGLEDFYT  56



>ref|XP_006347368.1| PREDICTED: long chain base biosynthesis protein 2a-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006347369.1| PREDICTED: long chain base biosynthesis protein 2a-like isoform 
X2 [Solanum tuberosum]
Length=489

 Score =   104 bits (260),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 45/55 (82%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            MI IPY TAL+T+FSY LLFAFGQFRDFFRK FDW ++SNLQGYAPICLG EDFY
Sbjct  1    MITIPYLTALSTYFSYGLLFAFGQFRDFFRKIFDWWNASNLQGYAPICLGLEDFY  55



>ref|XP_010093950.1| Serine palmitoyltransferase 2 [Morus notabilis]
 gb|EXB54913.1| Serine palmitoyltransferase 2 [Morus notabilis]
Length=530

 Score =   105 bits (261),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 46/55 (84%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            MI IPY TALTT+FSY LLFAFGQFRDFFRK  DW +SSNLQGYAPICLG EDFY
Sbjct  1    MITIPYLTALTTYFSYGLLFAFGQFRDFFRKIIDWWNSSNLQGYAPICLGLEDFY  55



>ref|XP_002284409.1| PREDICTED: long chain base biosynthesis protein 2a [Vitis vinifera]
Length=489

 Score =   104 bits (259),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 46/55 (84%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            MI IPY TALTT FSY LLFAFGQFRDFFRK FDW  +SNLQGYAPICLG EDFY
Sbjct  1    MITIPYLTALTTLFSYGLLFAFGQFRDFFRKIFDWWKASNLQGYAPICLGLEDFY  55



>emb|CBI15735.3| unnamed protein product [Vitis vinifera]
Length=513

 Score =   104 bits (260),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 46/55 (84%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            MI IPY TALTT FSY LLFAFGQFRDFFRK FDW  +SNLQGYAPICLG EDFY
Sbjct  1    MITIPYLTALTTLFSYGLLFAFGQFRDFFRKIFDWWKASNLQGYAPICLGLEDFY  55



>ref|XP_007151745.1| hypothetical protein PHAVU_004G071100g [Phaseolus vulgaris]
 gb|ESW23739.1| hypothetical protein PHAVU_004G071100g [Phaseolus vulgaris]
Length=487

 Score =   104 bits (259),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 47/55 (85%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            MI IPY TALTT+FSY LLFAFGQFRDFFRK FDWC S+NLQGYAPICLG EDFY
Sbjct  1    MIAIPYLTALTTYFSYGLLFAFGQFRDFFRKIFDWCSSNNLQGYAPICLGLEDFY  55



>gb|ABV57769.1| serine C-palmitoyltransferase [Gossypium hirsutum]
Length=292

 Score =   102 bits (253),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFYT  309
            MI IPY TALTT+FSY LLFAFGQFRDFFRK FDW H+SNL+GYAPICLG EDFYT
Sbjct  1    MITIPYLTALTTYFSYGLLFAFGQFRDFFRKIFDWWHASNLEGYAPICLGLEDFYT  56



>ref|XP_004235384.1| PREDICTED: long chain base biosynthesis protein 2b [Solanum lycopersicum]
Length=489

 Score =   103 bits (257),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 45/55 (82%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            MI IPY TALTT+FSY LLFAFGQFR+FFRK FDW   SNLQGYAPICLG EDFY
Sbjct  1    MITIPYLTALTTYFSYGLLFAFGQFREFFRKIFDWWRGSNLQGYAPICLGLEDFY  55



>ref|XP_002318160.1| serine palmitoyltransferase family protein [Populus trichocarpa]
 gb|EEE96380.1| serine palmitoyltransferase family protein [Populus trichocarpa]
Length=489

 Score =   103 bits (257),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 46/55 (84%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            MI+IPY TAL+T+FSY LLFAFGQFRDFFRK FD  HSSNLQGYAPICLG EDFY
Sbjct  1    MIKIPYLTALSTYFSYGLLFAFGQFRDFFRKIFDSWHSSNLQGYAPICLGLEDFY  55



>ref|XP_011042943.1| PREDICTED: long chain base biosynthesis protein 2a [Populus euphratica]
Length=489

 Score =   103 bits (257),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 46/55 (84%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            MI+IPY TAL+T+FSY LLFAFGQFRDFFRK FD  HSSNLQGYAPICLG EDFY
Sbjct  1    MIKIPYLTALSTYFSYGLLFAFGQFRDFFRKIFDSWHSSNLQGYAPICLGLEDFY  55



>dbj|BAE96963.1| serine palmitpoyltransferase subunit2 [Nicotiana tabacum]
 gb|ABW97709.1| serine palmitoyltransferase long chain base subunit [Nicotiana 
benthamiana]
Length=489

 Score =   103 bits (256),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 45/55 (82%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            MI IPY TALTT+FSY LLFAFGQFRDFFRK FDW    NLQGYAPICLG EDFY
Sbjct  1    MITIPYLTALTTYFSYGLLFAFGQFRDFFRKIFDWWRPRNLQGYAPICLGLEDFY  55



>gb|KHN00617.1| Serine palmitoyltransferase 2 [Glycine soja]
Length=505

 Score =   103 bits (256),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            MI IPY TALTT+FSY LLFAFGQFRDFFRK FDWC ++NLQGYAPICLG EDFY
Sbjct  1    MIAIPYLTALTTYFSYGLLFAFGQFRDFFRKIFDWCSANNLQGYAPICLGLEDFY  55



>gb|KCW48525.1| hypothetical protein EUGRSUZ_K02201 [Eucalyptus grandis]
Length=501

 Score =   103 bits (256),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 45/56 (80%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFYT  309
            MI IPY TAL+T+FSY LLFAFGQFRDFFRK FDW  S +LQGYAPICLG EDFYT
Sbjct  1    MITIPYLTALSTYFSYGLLFAFGQFRDFFRKIFDWWRSGDLQGYAPICLGLEDFYT  56



>ref|XP_006364387.1| PREDICTED: long chain base biosynthesis protein 2b-like [Solanum 
tuberosum]
Length=489

 Score =   102 bits (255),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 44/55 (80%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            MI IPY TALTT+FSY LLFAFGQFR+FFRK FDW   +NLQGYAPICLG EDFY
Sbjct  1    MITIPYLTALTTYFSYGLLFAFGQFREFFRKIFDWWRGNNLQGYAPICLGLEDFY  55



>ref|XP_006468870.1| PREDICTED: long chain base biosynthesis protein 2a-like isoform 
X1 [Citrus sinensis]
 ref|XP_006468871.1| PREDICTED: long chain base biosynthesis protein 2a-like isoform 
X2 [Citrus sinensis]
 ref|XP_006468872.1| PREDICTED: long chain base biosynthesis protein 2a-like isoform 
X3 [Citrus sinensis]
Length=488

 Score =   102 bits (255),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 44/55 (80%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            MI IPYFTALTT+FSY LLF FGQFRDFFRK  DW  + NLQGYAPICLG EDFY
Sbjct  1    MIAIPYFTALTTYFSYGLLFVFGQFRDFFRKILDWWSTDNLQGYAPICLGLEDFY  55



>gb|KDO47369.1| hypothetical protein CISIN_1g040324mg [Citrus sinensis]
Length=488

 Score =   102 bits (255),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 44/55 (80%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            MI IPYFTALTT+FSY LLF FGQFRDFFRK  DW  + NLQGYAPICLG EDFY
Sbjct  1    MIAIPYFTALTTYFSYGLLFVFGQFRDFFRKILDWWSTDNLQGYAPICLGLEDFY  55



>ref|XP_006446965.1| hypothetical protein CICLE_v10015046mg [Citrus clementina]
 gb|ESR60205.1| hypothetical protein CICLE_v10015046mg [Citrus clementina]
Length=488

 Score =   102 bits (255),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 44/55 (80%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            MI IPYFTALTT+FSY LLF FGQFRDFFRK  DW  + NLQGYAPICLG EDFY
Sbjct  1    MIAIPYFTALTTYFSYGLLFVFGQFRDFFRKILDWWSTDNLQGYAPICLGLEDFY  55



>emb|CAB44316.1| serine palmitoyltransferase [Solanum tuberosum]
Length=489

 Score =   102 bits (254),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 44/55 (80%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            MI IPY TALTT+FSY LLFAFGQFR+FFRK FDW   +NLQGYAPICLG EDFY
Sbjct  1    MITIPYLTALTTYFSYGLLFAFGQFREFFRKIFDWWRGNNLQGYAPICLGLEDFY  55



>emb|CDO98665.1| unnamed protein product [Coffea canephora]
Length=489

 Score =   102 bits (253),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 45/56 (80%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFYT  309
            MI IPY TALTT+FSY LLF FGQFRDFFRK  DW   SNLQGYAPICLG EDFYT
Sbjct  1    MITIPYLTALTTYFSYGLLFVFGQFRDFFRKIVDWWLGSNLQGYAPICLGLEDFYT  56



>ref|XP_004304557.1| PREDICTED: long chain base biosynthesis protein 2a [Fragaria 
vesca subsp. vesca]
Length=489

 Score =   101 bits (252),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 45/56 (80%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFYT  309
            MI IPY TALTT+FSY LLFAFGQ RDFFRK  DW  S+NLQGYAPICLG EDFYT
Sbjct  1    MIAIPYLTALTTYFSYGLLFAFGQVRDFFRKFIDWRSSNNLQGYAPICLGLEDFYT  56



>ref|XP_004161364.1| PREDICTED: LOW QUALITY PROTEIN: long chain base biosynthesis 
protein 2a-like [Cucumis sativus]
Length=490

 Score =   101 bits (251),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 47/55 (85%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            MI IPY TALTT+FSY LLFAFGQFRDFFRK FDW +SSNLQGYAPICLG EDFY
Sbjct  1    MITIPYLTALTTYFSYGLLFAFGQFRDFFRKIFDWWNSSNLQGYAPICLGLEDFY  55



>gb|EYU24476.1| hypothetical protein MIMGU_mgv1a004686mg [Erythranthe guttata]
Length=515

 Score =   101 bits (252),  Expect = 9e-23, Method: Composition-based stats.
 Identities = 45/56 (80%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = +1

Query  139  KMIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            KMI IPY TALTT+FSY LLFAFGQ RDFFRK FDW   S LQGYAPICLG EDFY
Sbjct  26   KMITIPYVTALTTYFSYGLLFAFGQLRDFFRKIFDWWSKSTLQGYAPICLGLEDFY  81



>ref|XP_011083372.1| PREDICTED: long chain base biosynthesis protein 2a [Sesamum indicum]
Length=489

 Score =   100 bits (250),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 44/55 (80%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            MI IPY TALTT+FSY LLFAFGQ RDFFRK  DW   SNLQGYAPICLG EDFY
Sbjct  1    MITIPYLTALTTYFSYGLLFAFGQLRDFFRKILDWWSKSNLQGYAPICLGLEDFY  55



>gb|KDP41837.1| hypothetical protein JCGZ_26855 [Jatropha curcas]
Length=489

 Score =   100 bits (250),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 44/55 (80%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            MI IPY TALTT+FSY LLFAFGQ RDFFRK  DW  S+NLQGYAPICLG EDFY
Sbjct  1    MIAIPYLTALTTYFSYGLLFAFGQIRDFFRKIIDWWSSNNLQGYAPICLGLEDFY  55



>ref|XP_010096046.1| Serine palmitoyltransferase 2 [Morus notabilis]
 gb|EXB62852.1| Serine palmitoyltransferase 2 [Morus notabilis]
Length=508

 Score =   100 bits (250),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 44/55 (80%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            MI IPY TALTT+FSY LLFAFGQ RDFFRK  DW  S+NLQGYAPICLG EDFY
Sbjct  1    MIAIPYLTALTTYFSYGLLFAFGQLRDFFRKFIDWWSSNNLQGYAPICLGLEDFY  55



>ref|XP_010678318.1| PREDICTED: long chain base biosynthesis protein 2a [Beta vulgaris 
subsp. vulgaris]
Length=489

 Score =   100 bits (248),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 44/55 (80%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            MI IPY TALTT+FSY LLFAFGQ RDFFRK FDW  S +LQGYAPICLG EDFY
Sbjct  1    MITIPYLTALTTYFSYGLLFAFGQLRDFFRKIFDWWTSGSLQGYAPICLGLEDFY  55



>ref|XP_007215280.1| hypothetical protein PRUPE_ppa004859mg [Prunus persica]
 gb|EMJ16479.1| hypothetical protein PRUPE_ppa004859mg [Prunus persica]
Length=488

 Score = 99.4 bits (246),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 44/55 (80%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            MI IPY TALTT+FSY LLF FGQ RDFFRK  DW  SSNLQGYAPICLG EDFY
Sbjct  1    MIAIPYLTALTTYFSYGLLFVFGQVRDFFRKFIDWWSSSNLQGYAPICLGLEDFY  55



>gb|KJB51269.1| hypothetical protein B456_008G209600 [Gossypium raimondii]
Length=478

 Score = 99.4 bits (246),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            MI IPY TALTT+FSY LLFAFGQFRDFFR  FDW H+SNL+GYAPICLG EDFY
Sbjct  1    MITIPYLTALTTYFSYGLLFAFGQFRDFFRNIFDWWHASNLEGYAPICLGLEDFY  55



>ref|XP_008379061.1| PREDICTED: long chain base biosynthesis protein 2a-like [Malus 
domestica]
Length=490

 Score = 99.0 bits (245),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 43/55 (78%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            MI IPY TALTT+FSY LLF FGQ RDFFRK  DW  +SNLQGYAPICLG EDFY
Sbjct  1    MIAIPYLTALTTYFSYGLLFVFGQVRDFFRKIIDWWSASNLQGYAPICLGLEDFY  55



>ref|XP_009378026.1| PREDICTED: long chain base biosynthesis protein 2a [Pyrus x bretschneideri]
Length=490

 Score = 99.0 bits (245),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 43/55 (78%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            MI IPY TALTT+FSY LLF FGQ RDFFRK  DW  +SNLQGYAPICLG EDFY
Sbjct  1    MIAIPYLTALTTYFSYGLLFVFGQVRDFFRKIIDWWSASNLQGYAPICLGLEDFY  55



>ref|XP_008341247.1| PREDICTED: long chain base biosynthesis protein 2a [Malus domestica]
Length=490

 Score = 99.0 bits (245),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 43/55 (78%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            MI IPY TALTT+FSY LLF FGQ RDFFRK  DW  +SNLQGYAPICLG EDFY
Sbjct  1    MIAIPYLTALTTYFSYGLLFVFGQVRDFFRKIIDWWSASNLQGYAPICLGLEDFY  55



>ref|XP_007031987.1| Long chain base2 isoform 1 [Theobroma cacao]
 gb|EOY02913.1| Long chain base2 isoform 1 [Theobroma cacao]
Length=489

 Score = 98.6 bits (244),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 44/56 (79%), Positives = 47/56 (84%), Gaps = 1/56 (2%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDW-CHSSNLQGYAPICLGXEDFY  306
            MI IPY TALTT+FSY LLF+FGQ RDFFRK  DW C S+NLQGYAPICLG EDFY
Sbjct  1    MIAIPYLTALTTYFSYGLLFSFGQIRDFFRKFIDWCCTSNNLQGYAPICLGLEDFY  56



>ref|XP_010929641.1| PREDICTED: long chain base biosynthesis protein 2a-like [Elaeis 
guineensis]
Length=487

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 42/56 (75%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFYT  309
            M+ +PY TALTT FSY LLFAFGQ RDFFRK  DW  S NL+GYAPICLG EDFYT
Sbjct  1    MVRLPYLTALTTLFSYGLLFAFGQLRDFFRKLIDWPKSKNLKGYAPICLGLEDFYT  56



>ref|XP_007209963.1| hypothetical protein PRUPE_ppa004890mg [Prunus persica]
 gb|EMJ11162.1| hypothetical protein PRUPE_ppa004890mg [Prunus persica]
Length=487

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 42/55 (76%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            MI IPY TAL+T+FSY LLFAFGQ RDFFRK  DW  S +LQGYAPICLG EDFY
Sbjct  1    MITIPYLTALSTYFSYGLLFAFGQLRDFFRKIIDWWQSGDLQGYAPICLGLEDFY  55



>ref|XP_008239635.1| PREDICTED: long chain base biosynthesis protein 2a [Prunus mume]
Length=464

 Score = 97.8 bits (242),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 42/55 (76%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            MI IPY TAL+T+FSY LLFAFGQ RDFFRK  DW  S +LQGYAPICLG EDFY
Sbjct  1    MITIPYLTALSTYFSYGLLFAFGQLRDFFRKIIDWWQSGDLQGYAPICLGLEDFY  55



>ref|XP_006446964.1| hypothetical protein CICLE_v10017847mg [Citrus clementina]
 ref|XP_006468873.1| PREDICTED: long chain base biosynthesis protein 2a-like [Citrus 
sinensis]
 gb|ESR60204.1| hypothetical protein CICLE_v10017847mg [Citrus clementina]
 gb|KDO47368.1| hypothetical protein CISIN_1g046230mg [Citrus sinensis]
Length=489

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 42/55 (76%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            MI IPY TALTT+FSY LLF FGQ RDFFRK  DW  ++NLQGYAPICLG EDFY
Sbjct  1    MISIPYLTALTTYFSYGLLFVFGQIRDFFRKIIDWWSANNLQGYAPICLGLEDFY  55



>ref|XP_011073130.1| PREDICTED: long chain base biosynthesis protein 2b isoform X3 
[Sesamum indicum]
Length=489

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 42/55 (76%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            MI IPY TALTT+FSY LLFAFGQ RDFFRK FDW   ++L+GYAPICLG EDFY
Sbjct  1    MITIPYLTALTTYFSYGLLFAFGQLRDFFRKIFDWWSHNSLEGYAPICLGLEDFY  55



>ref|XP_010907607.1| PREDICTED: long chain base biosynthesis protein 2a [Elaeis guineensis]
Length=487

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 41/56 (73%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFYT  309
            M+ +PY TALTT FSY LLFAFGQ RDFFRK  DW  S +L+GYAPICLG EDFYT
Sbjct  1    MVRLPYLTALTTLFSYGLLFAFGQLRDFFRKLIDWSKSKDLKGYAPICLGLEDFYT  56



>ref|XP_010249161.1| PREDICTED: long chain base biosynthesis protein 2a [Nelumbo nucifera]
Length=489

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 42/55 (76%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            MI IPY TALTT+FSY LLFAFGQ RD FRK  DW  + NLQGYAPICLG EDFY
Sbjct  1    MITIPYLTALTTYFSYGLLFAFGQIRDLFRKILDWWSADNLQGYAPICLGLEDFY  55



>ref|XP_008775142.1| PREDICTED: long chain base biosynthesis protein 2a [Phoenix dactylifera]
Length=487

 Score = 97.1 bits (240),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 41/56 (73%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFYT  309
            M+ +PY TALTT FSY LLFAFGQ RDFFRK  DW  S +L+GYAPICLG EDFYT
Sbjct  1    MVRLPYLTALTTLFSYGLLFAFGQLRDFFRKLIDWTKSKDLKGYAPICLGLEDFYT  56



>ref|XP_008231042.1| PREDICTED: long chain base biosynthesis protein 2a-like [Prunus 
mume]
Length=489

 Score = 97.1 bits (240),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 43/55 (78%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            MI IPY TALTT+FSY LLF FGQ RD FRK  DW  SSNLQGYAPICLG EDFY
Sbjct  1    MIAIPYLTALTTYFSYGLLFVFGQVRDVFRKFIDWWSSSNLQGYAPICLGLEDFY  55



>ref|NP_197756.1| serine palmitoyltransferase subunit LCB2 [Arabidopsis thaliana]
 ref|NP_001031932.1| serine palmitoyltransferase subunit LCB2 [Arabidopsis thaliana]
 sp|Q9LSZ9.1|LCB2A_ARATH RecName: Full=Long chain base biosynthesis protein 2a; Short=AtLCB2a; 
AltName: Full=Long chain base biosynthesis protein 
2; Short=AtLCB2 [Arabidopsis thaliana]
 dbj|BAA97234.1| serine palmitoyltransferase [Arabidopsis thaliana]
 gb|AAK92764.1| putative serine palmitoyltransferase [Arabidopsis thaliana]
 gb|AAM91761.1| putative serine palmitoyltransferase [Arabidopsis thaliana]
 gb|AED93196.1| serine palmitoyltransferase subunit LCB2 [Arabidopsis thaliana]
 gb|AED93197.1| serine palmitoyltransferase subunit LCB2 [Arabidopsis thaliana]
Length=489

 Score = 97.1 bits (240),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 41/55 (75%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            MI IPY TA++T+FSY LLFAFGQ RDFFR+  DW  +SNLQGYAPICLG EDFY
Sbjct  1    MITIPYLTAVSTYFSYGLLFAFGQLRDFFRRFIDWWFTSNLQGYAPICLGHEDFY  55



>dbj|BAB03231.1| serine palmitoyltransferase [Arabidopsis thaliana]
Length=489

 Score = 97.1 bits (240),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 41/55 (75%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            MI IPY TA++T+FSY LLFAFGQ RDFFR+  DW  +SNLQGYAPICLG EDFY
Sbjct  1    MITIPYLTAVSTYFSYGLLFAFGQLRDFFRRFIDWWFTSNLQGYAPICLGHEDFY  55



>ref|XP_002872066.1| LCB2 subunit protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48325.1| LCB2 subunit protein [Arabidopsis lyrata subsp. lyrata]
Length=489

 Score = 96.7 bits (239),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 41/55 (75%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            MI IPY TA++T+FSY LLFAFGQ RDFFR+  DW  +SNLQGYAPICLG EDFY
Sbjct  1    MITIPYLTAVSTYFSYGLLFAFGQLRDFFRRFIDWWLTSNLQGYAPICLGHEDFY  55



>ref|XP_008778939.1| PREDICTED: long chain base biosynthesis protein 2a-like [Phoenix 
dactylifera]
Length=554

 Score = 96.7 bits (239),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 41/56 (73%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFYT  309
            M+ +PY TALTT FSY LLFAFGQ RDFFRK  DW  S +L+GYAPICLG EDFYT
Sbjct  1    MVRLPYLTALTTLFSYGLLFAFGQLRDFFRKLIDWTKSKDLKGYAPICLGLEDFYT  56



>ref|XP_002275468.1| PREDICTED: long chain base biosynthesis protein 2a isoform X2 
[Vitis vinifera]
 emb|CBI21293.3| unnamed protein product [Vitis vinifera]
Length=489

 Score = 95.9 bits (237),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 41/55 (75%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            MI +PY TALTT+FSY LLF FGQ RD FRK  DW  S+NLQGYAPICLG EDFY
Sbjct  1    MIAVPYVTALTTYFSYGLLFVFGQIRDLFRKILDWFRSNNLQGYAPICLGFEDFY  55



>gb|EPS63051.1| serine palmitoyltransferase, partial [Genlisea aurea]
Length=326

 Score = 94.4 bits (233),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 41/55 (75%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            M  IPY  ALTT+FSY LLFAFGQ RDFFR+ FDW   S LQGYAPICLG EDFY
Sbjct  1    MTTIPYIAALTTYFSYGLLFAFGQLRDFFRRIFDWWSQSRLQGYAPICLGLEDFY  55



>gb|EMT23338.1| Serine palmitoyltransferase 2 [Aegilops tauschii]
Length=489

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 41/56 (73%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFYT  309
            M+ +PY TALTT FSY LLFAFG FRDFFR+  D   SSNL+GYAPICLG EDFYT
Sbjct  1    MVRLPYLTALTTLFSYGLLFAFGHFRDFFRRILDAGKSSNLKGYAPICLGYEDFYT  56



>emb|CDX87007.1| BnaC03g52770D [Brassica napus]
Length=489

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 39/55 (71%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            MI IPY TA++T+FSY LLFAFGQ RD+ R  FDWC ++NLQGYAPICL  EDFY
Sbjct  1    MITIPYLTAVSTYFSYGLLFAFGQLRDYSRLIFDWCSTNNLQGYAPICLAHEDFY  55



>gb|EMS48138.1| Serine palmitoyltransferase 2 [Triticum urartu]
Length=508

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 41/56 (73%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFYT  309
            M+ +PY TALTT FSY LLFAFG FRDFFR+  D   SSNL+GYAPICLG EDFYT
Sbjct  1    MVRLPYLTALTTLFSYGLLFAFGHFRDFFRRILDAGKSSNLKGYAPICLGYEDFYT  56



>ref|XP_006287613.1| hypothetical protein CARUB_v10000825mg [Capsella rubella]
 gb|EOA20511.1| hypothetical protein CARUB_v10000825mg [Capsella rubella]
Length=489

 Score = 94.4 bits (233),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 40/55 (73%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            MI IPY TA++T+FSY LLFAFGQ RDFFR+  DW  +SNL GYAPICLG EDFY
Sbjct  1    MITIPYLTAVSTYFSYGLLFAFGQLRDFFRRFIDWWLTSNLHGYAPICLGHEDFY  55



>ref|XP_010421176.1| PREDICTED: long chain base biosynthesis protein 2a [Camelina 
sativa]
Length=489

 Score = 94.4 bits (233),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 40/55 (73%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            MI IPY TA++T+FSY LLFAFGQ RDFFR+  DW  +SNL GYAPICLG EDFY
Sbjct  1    MITIPYLTAVSTYFSYGLLFAFGQLRDFFRRFIDWWLTSNLHGYAPICLGHEDFY  55



>ref|NP_001045279.1| Os01g0928800 [Oryza sativa Japonica Group]
 sp|Q5JK39.1|LCB2D_ORYSJ RecName: Full=Long chain base biosynthesis protein 2d [Oryza 
sativa Japonica Group]
 dbj|BAD88168.1| putative serine palmitoyltransferase [Oryza sativa Japonica Group]
 dbj|BAF07193.1| Os01g0928800 [Oryza sativa Japonica Group]
 dbj|BAH00095.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC72091.1| hypothetical protein OsI_05038 [Oryza sativa Indica Group]
 gb|EEE55940.1| hypothetical protein OsJ_04635 [Oryza sativa Japonica Group]
Length=489

 Score = 94.4 bits (233),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 41/56 (73%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFYT  309
            M+ +PY TALTT FSY LLFAFGQ RDFFR+  D   SSNL+GYAPICLG EDFYT
Sbjct  1    MVRLPYVTALTTLFSYGLLFAFGQLRDFFRRILDAGKSSNLKGYAPICLGLEDFYT  56



>ref|XP_010454654.1| PREDICTED: long chain base biosynthesis protein 2a-like [Camelina 
sativa]
Length=489

 Score = 93.2 bits (230),  Expect = 8e-20, Method: Composition-based stats.
 Identities = 39/55 (71%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            MI IPY TA++T+FSY LLFAFGQ RDFFR+  DW  ++NL GYAPICLG EDFY
Sbjct  1    MITIPYLTAVSTYFSYGLLFAFGQLRDFFRRFIDWWLTTNLHGYAPICLGHEDFY  55



>ref|XP_009403557.1| PREDICTED: long chain base biosynthesis protein 2a-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=490

 Score = 93.2 bits (230),  Expect = 9e-20, Method: Composition-based stats.
 Identities = 42/58 (72%), Positives = 46/58 (79%), Gaps = 2/58 (3%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSS--NLQGYAPICLGXEDFYT  309
            M+ +PY TALTT FSY LLFAFGQ RDFFRK  DW  SS  +L+GYAPICLG EDFYT
Sbjct  1    MVRLPYLTALTTLFSYGLLFAFGQLRDFFRKIIDWFKSSSKDLKGYAPICLGLEDFYT  58



>ref|XP_004979342.1| PREDICTED: long chain base biosynthesis protein 2a-like [Setaria 
italica]
Length=488

 Score = 93.2 bits (230),  Expect = 9e-20, Method: Composition-based stats.
 Identities = 39/55 (71%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            M+ +PY TALTT FSY LLFAFGQ RDFFRK  DW  + N++GYAPICLG EDFY
Sbjct  1    MVRLPYTTALTTLFSYGLLFAFGQLRDFFRKLVDWFKAKNVKGYAPICLGLEDFY  55



>ref|NP_001148953.1| serine palmitoyltransferase 2 [Zea mays]
 gb|ACG33631.1| serine palmitoyltransferase 2 [Zea mays]
 gb|ACN26506.1| unknown [Zea mays]
 tpg|DAA42006.1| TPA: Serine palmitoyltransferase 2 [Zea mays]
Length=488

 Score = 93.2 bits (230),  Expect = 9e-20, Method: Composition-based stats.
 Identities = 39/55 (71%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            M+ +PY TALTT FSY LLFAFGQ RDFFRK  DW  + N++GYAPICLG EDFY
Sbjct  1    MVRLPYTTALTTLFSYGLLFAFGQLRDFFRKFVDWFKAKNVKGYAPICLGLEDFY  55



>ref|XP_002450805.1| hypothetical protein SORBIDRAFT_05g018880 [Sorghum bicolor]
 gb|EES09793.1| hypothetical protein SORBIDRAFT_05g018880 [Sorghum bicolor]
Length=488

 Score = 93.2 bits (230),  Expect = 9e-20, Method: Composition-based stats.
 Identities = 39/55 (71%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            M+ +PY TALTT FSY LLFAFGQ RDFFRK  DW  + N++GYAPICLG EDFY
Sbjct  1    MVRLPYTTALTTLFSYGLLFAFGQLRDFFRKFVDWFKAKNVKGYAPICLGLEDFY  55



>emb|CDM85908.1| unnamed protein product [Triticum aestivum]
Length=757

 Score = 94.0 bits (232),  Expect = 9e-20, Method: Composition-based stats.
 Identities = 41/56 (73%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFYT  309
            M+ +PY TALTT FSY LLFAFG FRDFFR+  D   SSNL+GYAPICLG EDFYT
Sbjct  1    MVRLPYLTALTTLFSYGLLFAFGHFRDFFRRILDAGKSSNLKGYAPICLGYEDFYT  56



>gb|ABW97708.1| serine palmitoyltransferase long chain base subunit [Brassica 
rapa subsp. chinensis]
Length=489

 Score = 93.2 bits (230),  Expect = 9e-20, Method: Composition-based stats.
 Identities = 38/55 (69%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            MI IPY TA++T+FSY LLFAFGQ RD+ R  FDWC ++NL GYAPICL  EDFY
Sbjct  1    MITIPYLTAVSTYFSYGLLFAFGQLRDYSRLIFDWCSTNNLHGYAPICLAHEDFY  55



>ref|NP_001067972.1| Os11g0516000 [Oryza sativa Japonica Group]
 sp|Q2R3K3.1|LCB2A_ORYSJ RecName: Full=Long chain base biosynthesis protein 2a [Oryza 
sativa Japonica Group]
 gb|ABA93932.1| Serine palmitoyltransferase 2, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF28335.1| Os11g0516000 [Oryza sativa Japonica Group]
 gb|EEC68247.1| hypothetical protein OsI_36267 [Oryza sativa Indica Group]
Length=488

 Score = 92.8 bits (229),  Expect = 9e-20, Method: Composition-based stats.
 Identities = 39/55 (71%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            M+ +PY TALTT FSY LLFAFGQ RDFFRK  DW  + N++GYAPICLG EDFY
Sbjct  1    MVRLPYTTALTTLFSYGLLFAFGQLRDFFRKLIDWFKAKNVKGYAPICLGLEDFY  55



>ref|XP_009150176.1| PREDICTED: long chain base biosynthesis protein 2b [Brassica 
rapa]
 emb|CDY37911.1| BnaA06g19060D [Brassica napus]
Length=489

 Score = 92.8 bits (229),  Expect = 9e-20, Method: Composition-based stats.
 Identities = 38/55 (69%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            MI IPY TA++T+FSY LLFAFGQ RD+ R  FDWC ++NL GYAPICL  EDFY
Sbjct  1    MITIPYLTAVSTYFSYGLLFAFGQLRDYSRLIFDWCSTNNLHGYAPICLAHEDFY  55



>ref|NP_001151995.1| LOC100285632 [Zea mays]
 gb|ACG45307.1| serine palmitoyltransferase 2 [Zea mays]
 gb|ACN25731.1| unknown [Zea mays]
 gb|AFW60856.1| Serine palmitoyltransferase 2 [Zea mays]
Length=488

 Score = 92.8 bits (229),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 39/55 (71%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            M+ +PY TALTT FSY LLFAFGQ RDFFRK  DW  + N++GYAPICLG EDFY
Sbjct  1    MVRLPYTTALTTLFSYGLLFAFGQLRDFFRKFVDWFKAKNVKGYAPICLGLEDFY  55



>gb|AFW84059.1| putative serine palmitoyltransferase [Zea mays]
Length=335

 Score = 91.3 bits (225),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 40/56 (71%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFYT  309
            M+ +PY TALTT FSY LLFAFGQ RDFFR+  D    SNL+GYAPICLG EDFYT
Sbjct  1    MVRLPYVTALTTLFSYGLLFAFGQLRDFFRRILDARKPSNLKGYAPICLGLEDFYT  56



>ref|XP_009404745.1| PREDICTED: long chain base biosynthesis protein 2a-like [Musa 
acuminata subsp. malaccensis]
Length=489

 Score = 92.4 bits (228),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 41/58 (71%), Positives = 45/58 (78%), Gaps = 2/58 (3%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHS--SNLQGYAPICLGXEDFYT  309
            M+ +PY TALTT FSY LLFAFGQ RDFFRK  DW  S   +L+GYAPICLG EDFYT
Sbjct  1    MVRLPYLTALTTLFSYGLLFAFGQMRDFFRKLIDWSKSKGKDLKGYAPICLGLEDFYT  58



>gb|KFK34178.1| hypothetical protein AALP_AA5G110700 [Arabis alpina]
Length=489

 Score = 92.4 bits (228),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 38/55 (69%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            MI IPY TA++T+FSY LLFAFGQ RD+ R+ FDW  ++NLQGYAPICL  EDFY
Sbjct  1    MITIPYLTAVSTYFSYGLLFAFGQLRDYSRRIFDWWSTNNLQGYAPICLAHEDFY  55



>ref|XP_009403784.1| PREDICTED: long chain base biosynthesis protein 2a [Musa acuminata 
subsp. malaccensis]
Length=489

 Score = 92.4 bits (228),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 41/58 (71%), Positives = 45/58 (78%), Gaps = 2/58 (3%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCH--SSNLQGYAPICLGXEDFYT  309
            M+ +PY TALTT FSY LLFAFGQ RDFFRK  DW    S +L+GYAPICLG EDFYT
Sbjct  1    MVRLPYLTALTTLFSYGLLFAFGQLRDFFRKLIDWSRSKSKDLKGYAPICLGLEDFYT  58



>ref|XP_006404217.1| hypothetical protein EUTSA_v10010322mg [Eutrema salsugineum]
 gb|ESQ45670.1| hypothetical protein EUTSA_v10010322mg [Eutrema salsugineum]
Length=489

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 38/55 (69%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            MI IPY TA++T+FSY LLFAFGQ RD+ R+ FDW  ++NLQGYAPICL  EDFY
Sbjct  1    MITIPYLTAVSTYFSYGLLFAFGQLRDYSRRIFDWWSTNNLQGYAPICLAHEDFY  55



>ref|XP_006662956.1| PREDICTED: long chain base biosynthesis protein 2a-like [Oryza 
brachyantha]
Length=488

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 38/55 (69%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            M+ +PY TALTT FSY LLFAFGQ RDFFR+  DW  + N++GYAPICLG EDFY
Sbjct  1    MVRLPYTTALTTLFSYGLLFAFGQLRDFFRRLIDWFKAKNVKGYAPICLGLEDFY  55



>ref|XP_011073128.1| PREDICTED: long chain base biosynthesis protein 2b isoform X1 
[Sesamum indicum]
Length=520

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            MI IPY TALTT+FSY LLFAFGQ RDFFRK FDW   ++L+GYAPICLG EDFY
Sbjct  1    MITIPYLTALTTYFSYGLLFAFGQLRDFFRKIFDWWSHNSLEGYAPICLGLEDFY  55



>ref|XP_004971156.1| PREDICTED: long chain base biosynthesis protein 2d-like [Setaria 
italica]
Length=489

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 40/56 (71%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFYT  309
            M+ +PY TALTT FSY LLFAFGQ RDFFR+  D    SNL+GYAPICLG EDFYT
Sbjct  1    MVRLPYVTALTTLFSYGLLFAFGQLRDFFRRILDARKPSNLKGYAPICLGLEDFYT  56



>ref|XP_002459025.1| hypothetical protein SORBIDRAFT_03g044700 [Sorghum bicolor]
 gb|EES04145.1| hypothetical protein SORBIDRAFT_03g044700 [Sorghum bicolor]
Length=489

 Score = 91.7 bits (226),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 40/56 (71%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFYT  309
            M+ +PY TALTT FSY LLFAFGQ RDFFR+  D    SNL+GYAPICLG EDFYT
Sbjct  1    MVRLPYVTALTTLFSYGLLFAFGQLRDFFRRILDARKPSNLKGYAPICLGLEDFYT  56



>ref|XP_008656901.1| PREDICTED: long chain base biosynthesis protein 2d [Zea mays]
 gb|ACG26228.1| serine palmitoyltransferase 2 [Zea mays]
 gb|ACL52834.1| unknown [Zea mays]
 gb|AFW84058.1| putative serine palmitoyltransferase [Zea mays]
Length=489

 Score = 91.7 bits (226),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 40/56 (71%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFYT  309
            M+ +PY TALTT FSY LLFAFGQ RDFFR+  D    SNL+GYAPICLG EDFYT
Sbjct  1    MVRLPYVTALTTLFSYGLLFAFGQLRDFFRRILDARKPSNLKGYAPICLGLEDFYT  56



>ref|XP_008791061.1| PREDICTED: long chain base biosynthesis protein 2a-like [Phoenix 
dactylifera]
Length=487

 Score = 91.7 bits (226),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 40/56 (71%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFYT  309
            M+ +PY TALTT FSY LLFAFGQ RD FRK  D   S NL+GYAPICLG EDFYT
Sbjct  1    MVRLPYLTALTTLFSYGLLFAFGQLRDLFRKLIDRSKSKNLKGYAPICLGLEDFYT  56



>ref|XP_010660694.1| PREDICTED: long chain base biosynthesis protein 2a isoform X1 
[Vitis vinifera]
Length=490

 Score = 91.7 bits (226),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 41/56 (73%), Positives = 44/56 (79%), Gaps = 1/56 (2%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNL-QGYAPICLGXEDFY  306
            MI +PY TALTT+FSY LLF FGQ RD FRK  DW  S+NL QGYAPICLG EDFY
Sbjct  1    MIAVPYVTALTTYFSYGLLFVFGQIRDLFRKILDWFRSNNLQQGYAPICLGFEDFY  56



>ref|XP_006645277.1| PREDICTED: long chain base biosynthesis protein 2d-like [Oryza 
brachyantha]
Length=489

 Score = 91.3 bits (225),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 40/56 (71%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFYT  309
            M+ +PY TALTT FSY LLFAFGQ RDF R+  D   SSNL+GYAPICLG EDFYT
Sbjct  1    MVRLPYVTALTTLFSYGLLFAFGQLRDFVRRILDAGKSSNLKGYAPICLGLEDFYT  56



>ref|XP_009421040.1| PREDICTED: long chain base biosynthesis protein 2a-like [Musa 
acuminata subsp. malaccensis]
Length=488

 Score = 91.3 bits (225),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 40/58 (69%), Positives = 45/58 (78%), Gaps = 2/58 (3%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDW--CHSSNLQGYAPICLGXEDFYT  309
            M+ +PY TALTT FSY LLFAFGQ RDFFR+  DW    S +L+GYAPICLG EDFYT
Sbjct  1    MVRLPYLTALTTLFSYGLLFAFGQMRDFFRRLIDWSKSKSKDLKGYAPICLGLEDFYT  58



>ref|XP_010515202.1| PREDICTED: long chain base biosynthesis protein 2b [Camelina 
sativa]
 ref|XP_010426376.1| PREDICTED: long chain base biosynthesis protein 2b [Camelina 
sativa]
Length=489

 Score = 90.9 bits (224),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 38/55 (69%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            MI IPY TA++T+FSY LLFAFGQ RD+ R  FDW  ++NLQGYAPICL  EDFY
Sbjct  1    MITIPYLTAVSTYFSYGLLFAFGQLRDYSRLLFDWWRTNNLQGYAPICLAHEDFY  55



>ref|XP_009419359.1| PREDICTED: long chain base biosynthesis protein 2a-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009419360.1| PREDICTED: long chain base biosynthesis protein 2a-like [Musa 
acuminata subsp. malaccensis]
Length=490

 Score = 90.9 bits (224),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 40/58 (69%), Positives = 45/58 (78%), Gaps = 2/58 (3%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSN--LQGYAPICLGXEDFYT  309
            M+ +PY TALTT FSY LLF FGQ RDFFRK  DW  S++  L+GYAPICLG EDFYT
Sbjct  1    MVRLPYLTALTTLFSYGLLFVFGQLRDFFRKIIDWSKSTSKGLKGYAPICLGLEDFYT  58



>ref|NP_190447.1| serine palmitoyltransferase 1 [Arabidopsis thaliana]
 sp|Q9M304.1|LCB2B_ARATH RecName: Full=Long chain base biosynthesis protein 2b; Short=AtLCB2b; 
AltName: Full=Serine palmitoyltransferase 1; Short=AtSPT1 
[Arabidopsis thaliana]
 emb|CAB87906.1| serine palmitoyltransferase-like protein [Arabidopsis thaliana]
 gb|AAK96680.1| serine palmitoyltransferase-like protein [Arabidopsis thaliana]
 gb|AAL24364.1| serine palmitoyltransferase-like protein [Arabidopsis thaliana]
 dbj|BAB78461.1| serine palmitoyltransferase [Arabidopsis thaliana]
 gb|AAM47981.1| serine palmitoyltransferase-like protein [Arabidopsis thaliana]
 gb|AAP31959.1| At3g48780 [Arabidopsis thaliana]
 gb|AEE78455.1| serine palmitoyltransferase 1 [Arabidopsis thaliana]
Length=489

 Score = 90.9 bits (224),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 38/55 (69%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            MI IPY TA++T+FSY LLFAFGQ RD+ R  FDW  ++NLQGYAPICL  EDFY
Sbjct  1    MITIPYLTAVSTYFSYGLLFAFGQLRDYSRLIFDWWRTNNLQGYAPICLAHEDFY  55



>ref|XP_010503519.1| PREDICTED: long chain base biosynthesis protein 2b-like [Camelina 
sativa]
Length=489

 Score = 90.9 bits (224),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 38/55 (69%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            MI IPY TA++T+FSY LLFAFGQ RD+ R  FDW  ++NLQGYAPICL  EDFY
Sbjct  1    MITIPYLTAVSTYFSYGLLFAFGQLRDYSRLLFDWWRTNNLQGYAPICLAHEDFY  55



>ref|XP_006290987.1| hypothetical protein CARUB_v10017101mg [Capsella rubella]
 gb|EOA23885.1| hypothetical protein CARUB_v10017101mg [Capsella rubella]
Length=489

 Score = 90.9 bits (224),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 38/55 (69%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            MI IPY TA++T+FSY LLFAFGQ RD+ R  FDW  ++NLQGYAPICL  EDFY
Sbjct  1    MITIPYLTAVSTYFSYGLLFAFGQLRDYSRLIFDWWRTNNLQGYAPICLAHEDFY  55



>emb|CDX68498.1| BnaC01g25760D [Brassica napus]
Length=489

 Score = 90.5 bits (223),  Expect = 9e-19, Method: Composition-based stats.
 Identities = 37/55 (67%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            MI IPY TA++T+FSY LLFAFGQ RD+ R+ FDW  ++NL GYAPICL  EDFY
Sbjct  1    MITIPYLTAVSTYFSYGLLFAFGQLRDYSRRIFDWWSTNNLHGYAPICLAHEDFY  55



>ref|XP_009151545.1| PREDICTED: long chain base biosynthesis protein 2b-like [Brassica 
rapa]
Length=489

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 37/55 (67%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            MI IPY TA++T+FSY LLFAFGQ RD+ R+ FDW  ++NL GYAPICL  EDFY
Sbjct  1    MITIPYLTAVSTYFSYGLLFAFGQLRDYSRRIFDWWSTNNLHGYAPICLAHEDFY  55



>emb|CDX83048.1| BnaA01g20480D [Brassica napus]
Length=489

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 37/55 (67%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            MI IPY TA++T+FSY LLFAFGQ RD+ R+ FDW  ++NL GYAPICL  EDFY
Sbjct  1    MITIPYLTAVSTYFSYGLLFAFGQLRDYSRRIFDWWSTNNLHGYAPICLAHEDFY  55



>ref|XP_002321740.1| serine palmitoyltransferase family protein [Populus trichocarpa]
 gb|EEF05867.1| serine palmitoyltransferase family protein [Populus trichocarpa]
Length=489

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            MI+IPY TAL+T+FSY LLF FG FRDFFRK  D  H SNLQGYAPICLG EDFY
Sbjct  1    MIKIPYLTALSTYFSYGLLFVFGHFRDFFRKILDCFHPSNLQGYAPICLGPEDFY  55



>emb|CAP16702.1| putative serine palmitoyltransferase subunit LCB2, partial [Nicotiana 
benthamiana]
Length=356

 Score = 87.4 bits (215),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 37/44 (84%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +1

Query  175  TFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            T+FSY LLFAFGQFRDFFRK FDW  +SNLQGYAPICLG EDFY
Sbjct  1    TYFSYGLLFAFGQFRDFFRKIFDWWKASNLQGYAPICLGLEDFY  44



>ref|XP_003577540.1| PREDICTED: long chain base biosynthesis protein 2a [Brachypodium 
distachyon]
Length=488

 Score = 89.0 bits (219),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFYT  309
            M+ +PY TALTT FSY LLFAFGQ RDFFRK  DW    N++GYAPICLG EDFY 
Sbjct  1    MVRLPYTTALTTLFSYGLLFAFGQLRDFFRKFIDWFKDKNIKGYAPICLGLEDFYV  56



>ref|XP_010519476.1| PREDICTED: long chain base biosynthesis protein 2a [Tarenaya 
hassleriana]
Length=487

 Score = 88.6 bits (218),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            MI IPY TA++T+FSY  LFAFGQ RDFFR+  DW  ++NLQGYAPICLG EDFY
Sbjct  1    MITIPYLTAVSTYFSYGFLFAFGQLRDFFRRLLDWWLTNNLQGYAPICLGHEDFY  55



>ref|XP_006394629.1| hypothetical protein EUTSA_v10004251mg [Eutrema salsugineum]
 gb|ESQ31915.1| hypothetical protein EUTSA_v10004251mg [Eutrema salsugineum]
Length=406

 Score = 87.8 bits (216),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            MI IPY TA++T+FSY LLFAFGQ RDF R+  DW   SNLQGYAPICLG EDFY
Sbjct  1    MITIPYLTAVSTYFSYGLLFAFGQLRDFVRRFIDWWLVSNLQGYAPICLGHEDFY  55



>ref|XP_011002110.1| PREDICTED: long chain base biosynthesis protein 2a-like [Populus 
euphratica]
Length=489

 Score = 88.6 bits (218),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            MI+IPY TAL T+FSY LLF FG FRDFFRK     HSSNLQGYAPICLG EDFY
Sbjct  1    MIKIPYLTALNTYFSYGLLFVFGHFRDFFRKILGCFHSSNLQGYAPICLGPEDFY  55



>ref|XP_006394630.1| hypothetical protein EUTSA_v10004251mg [Eutrema salsugineum]
 gb|ESQ31916.1| hypothetical protein EUTSA_v10004251mg [Eutrema salsugineum]
Length=434

 Score = 87.8 bits (216),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            MI IPY TA++T+FSY LLFAFGQ RDF R+  DW   SNLQGYAPICLG EDFY
Sbjct  1    MITIPYLTAVSTYFSYGLLFAFGQLRDFVRRFIDWWLVSNLQGYAPICLGHEDFY  55



>ref|XP_002875925.1| hypothetical protein ARALYDRAFT_485232 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52184.1| hypothetical protein ARALYDRAFT_485232 [Arabidopsis lyrata subsp. 
lyrata]
Length=489

 Score = 87.8 bits (216),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 37/55 (67%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            MI IPY TA++T+FSY LLFAFGQ RD+ R  F W  ++NLQGYAPICL  EDFY
Sbjct  1    MITIPYLTAVSTYFSYGLLFAFGQLRDYSRLIFGWWRTNNLQGYAPICLAHEDFY  55



>ref|XP_010493489.1| PREDICTED: long chain base biosynthesis protein 2a-like [Camelina 
sativa]
Length=489

 Score = 87.8 bits (216),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            MI IPY TA++T+FSY LLFAFGQ RDFFR+  DW  ++NL GYAPICLG EDFY
Sbjct  1    MITIPYLTAVSTYFSYGLLFAFGQLRDFFRRFIDWWLTTNLHGYAPICLGHEDFY  55



>gb|KFK27657.1| hypothetical protein AALP_AA8G411600 [Arabis alpina]
Length=489

 Score = 87.8 bits (216),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            MI IPY TA++T+FSY LLFAFGQ RDFFR+  DW  ++NL GYAPICLG EDFY
Sbjct  1    MITIPYLTAVSTYFSYGLLFAFGQLRDFFRRFLDWWFATNLHGYAPICLGHEDFY  55



>ref|XP_003564989.1| PREDICTED: long chain base biosynthesis protein 2d [Brachypodium 
distachyon]
Length=489

 Score = 87.8 bits (216),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 40/57 (70%), Positives = 44/57 (77%), Gaps = 1/57 (2%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSS-NLQGYAPICLGXEDFYT  309
            M+ +PY TALTT  SY LLFAFG FRDFFR+  D   SS NL+GYAPICLG EDFYT
Sbjct  1    MVRLPYLTALTTLVSYGLLFAFGHFRDFFRRILDAGKSSDNLKGYAPICLGYEDFYT  57



>ref|XP_009363696.1| PREDICTED: long chain base biosynthesis protein 2a-like [Pyrus 
x bretschneideri]
Length=220

 Score = 84.0 bits (206),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            MI IPY T LT +FSY LLF F Q RDFFRK  +W  + NLQGYAPICLG EDFY
Sbjct  1    MIAIPYLTTLTKYFSYGLLFVFCQVRDFFRKMINWWSAGNLQGYAPICLGLEDFY  55



>ref|XP_009411041.1| PREDICTED: long chain base biosynthesis protein 2a-like [Musa 
acuminata subsp. malaccensis]
Length=483

 Score = 81.3 bits (199),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/56 (63%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFYT  309
            M+ + Y TALTTFF YILL AFG  RD  RK  DW  S +L+GYAPIC   EDFYT
Sbjct  1    MVRLTYLTALTTFFGYILLIAFGVLRDLVRKLLDWFKSDDLKGYAPICPPFEDFYT  56



>gb|EMS46639.1| Serine palmitoyltransferase 2 [Triticum urartu]
Length=487

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 35/55 (64%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            M+  P  TALTT FSY L+FAFG+ RDFF +  D   SSNL+GYAPIC G EDFY
Sbjct  1    MVNPPILTALTTRFSYGLIFAFGRLRDFFCRILDAAKSSNLKGYAPICCGYEDFY  55



>ref|XP_002450804.1| hypothetical protein SORBIDRAFT_05g018870 [Sorghum bicolor]
 gb|EES09792.1| hypothetical protein SORBIDRAFT_05g018870 [Sorghum bicolor]
Length=490

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 33/50 (66%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +1

Query  157  YFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFY  306
            Y TALTT FSY LLFAFGQ RDFFR   D    +N  GYAPIC+G EDF+
Sbjct  8    YTTALTTLFSYGLLFAFGQLRDFFRNLIDCFKPNNAVGYAPICVGLEDFF  57



>ref|XP_006828786.1| hypothetical protein AMTR_s00001p00112910 [Amborella trichopoda]
 gb|ERM96202.1| hypothetical protein AMTR_s00001p00112910 [Amborella trichopoda]
Length=487

 Score = 71.6 bits (174),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 37/56 (66%), Positives = 39/56 (70%), Gaps = 1/56 (2%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFYT  309
            MI IPY TALTT FSY LLF FGQFRD FRK +    SS  + YAPI L  EDFYT
Sbjct  1    MITIPYVTALTTLFSYGLLFVFGQFRDLFRKLWRRI-SSKKELYAPIVLENEDFYT  55



>gb|ABR18369.1| unknown [Picea sitchensis]
Length=493

 Score = 68.6 bits (166),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 39/56 (70%), Gaps = 1/56 (2%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFYT  309
            M+ IPYFTALTT+FSY LLF FG  RDFFR  F     S  +GYAP+C   EDFYT
Sbjct  1    MVTIPYFTALTTYFSYGLLFVFGHMRDFFRS-FCKSDQSTPEGYAPLCRDFEDFYT  55



>ref|XP_011073129.1| PREDICTED: long chain base biosynthesis protein 2b isoform X2 
[Sesamum indicum]
Length=498

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 37/50 (74%), Gaps = 2/50 (4%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQG--YAPIC  285
            MI IPY TALTT+FSY LLFAFGQ RDFFRK FDW   ++L+     PIC
Sbjct  1    MITIPYLTALTTYFSYGLLFAFGQLRDFFRKIFDWWSHNSLEDCFNRPIC  50



>ref|XP_006645276.1| PREDICTED: long chain base biosynthesis protein 2c-like [Oryza 
brachyantha]
Length=492

 Score = 65.9 bits (159),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 31/60 (52%), Positives = 39/60 (65%), Gaps = 5/60 (8%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWC-----HSSNLQGYAPICLGXEDFY  306
            M+++P  TA+TT FSY L+FAFG  RDFFR  F          ++ +GYAPIC G EDFY
Sbjct  1    MVKVPLVTAVTTVFSYGLIFAFGHLRDFFRFVFSAAGDGDGSPASSKGYAPICGGPEDFY  60



>ref|NP_001045278.1| Os01g0928700 [Oryza sativa Japonica Group]
 sp|Q8RYL0.1|LCB2C_ORYSJ RecName: Full=Long chain base biosynthesis protein 2c [Oryza 
sativa Japonica Group]
 dbj|BAB90752.1| putative serine palmitoyltransferase [Oryza sativa Japonica Group]
 dbj|BAF07192.1| Os01g0928700 [Oryza sativa Japonica Group]
 gb|EAY77077.1| hypothetical protein OsI_05037 [Oryza sativa Indica Group]
 gb|EAZ14710.1| hypothetical protein OsJ_04634 [Oryza sativa Japonica Group]
Length=497

 Score = 65.9 bits (159),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 30/63 (48%), Positives = 39/63 (62%), Gaps = 8/63 (13%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHS--------SNLQGYAPICLGXE  297
            M+ +P+ TA+TT FSY ++F FG  RD+FR       S        +NL+GYAPIC G E
Sbjct  1    MVRVPFVTAVTTVFSYGVIFGFGHLRDWFRALLRSLFSGHSPAAAGTNLKGYAPICGGQE  60

Query  298  DFY  306
            DFY
Sbjct  61   DFY  63



>ref|XP_006645275.1| PREDICTED: long chain base biosynthesis protein 2b-like [Oryza 
brachyantha]
Length=498

 Score = 65.9 bits (159),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 31/64 (48%), Positives = 38/64 (59%), Gaps = 9/64 (14%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXF---------DWCHSSNLQGYAPICLGX  294
            M+ +PY TA+TT FS+ L+FAFG  RD FR            D     N +GYAPIC+G 
Sbjct  1    MVRVPYVTAVTTLFSFGLIFAFGHLRDSFRGLLIRFLLAGDDDSPAGGNPKGYAPICVGK  60

Query  295  EDFY  306
            EDFY
Sbjct  61   EDFY  64



>ref|XP_008678154.1| PREDICTED: long chain base biosynthesis protein 2a-like isoform 
X2 [Zea mays]
Length=491

 Score = 65.1 bits (157),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 33/57 (58%), Positives = 36/57 (63%), Gaps = 6/57 (11%)
 Frame = +1

Query  151  IPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSN-----LQGYAPICLGXEDFY  306
            + Y TALTT FSY LLFAFGQ RD FR     C   N      QGYAPIC+G EDF+
Sbjct  5    LAYTTALTTLFSYGLLFAFGQLRDLFRHLLG-CFRPNKDDDVKQGYAPICVGLEDFF  60



>gb|EEE52176.1| hypothetical protein OsJ_34042 [Oryza sativa Japonica Group]
Length=466

 Score = 65.1 bits (157),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQ  267
            M+ +PY TALTT FSY LLFAFGQ RDFFRK  DW  + N++
Sbjct  1    MVRLPYTTALTTLFSYGLLFAFGQLRDFFRKLIDWFKAKNVK  42



>ref|XP_008678152.1| PREDICTED: long chain base biosynthesis protein 2a-like isoform 
X1 [Zea mays]
 ref|XP_008678153.1| PREDICTED: long chain base biosynthesis protein 2a-like isoform 
X1 [Zea mays]
Length=526

 Score = 65.1 bits (157),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 33/57 (58%), Positives = 36/57 (63%), Gaps = 6/57 (11%)
 Frame = +1

Query  151  IPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSN-----LQGYAPICLGXEDFY  306
            + Y TALTT FSY LLFAFGQ RD FR     C   N      QGYAPIC+G EDF+
Sbjct  5    LAYTTALTTLFSYGLLFAFGQLRDLFRHLLG-CFRPNKDDDVKQGYAPICVGLEDFF  60



>ref|XP_009150173.1| PREDICTED: long chain base biosynthesis protein 2a-like isoform 
X1 [Brassica rapa]
Length=485

 Score = 62.8 bits (151),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 27/51 (53%), Positives = 34/51 (67%), Gaps = 1/51 (2%)
 Frame = +1

Query  157  YFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSS-NLQGYAPICLGXEDFY  306
            YFT ++T+ S  L+  FG  RDFFR+      ++ NLQGYAPIC G EDFY
Sbjct  2    YFTTISTYLSCCLIIGFGHLRDFFRRILVLLFTNDNLQGYAPICFGHEDFY  52



>ref|XP_009369635.1| PREDICTED: long chain base biosynthesis protein 2a-like [Pyrus 
x bretschneideri]
Length=184

 Score = 60.1 bits (144),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGY  273
            MI IPY TA TT FS  LLF FGQ RDFFRK  DW  +SNLQ +
Sbjct  1    MIAIPYLTASTTCFSNGLLFVFGQVRDFFRKIIDWWSASNLQDF  44



>gb|AFW60854.1| hypothetical protein ZEAMMB73_652361 [Zea mays]
Length=283

 Score = 60.8 bits (146),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 36/58 (62%), Gaps = 6/58 (10%)
 Frame = +1

Query  148  EIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSN-----LQGYAPICLGXEDFY  306
             + Y TALTT FSY LLFAFGQ RD FR     C   N      QGYAPIC+G EDF+
Sbjct  4    RLAYTTALTTLFSYGLLFAFGQLRDLFRHLL-GCFRPNKDDDVKQGYAPICVGLEDFF  60



>ref|XP_009394362.1| PREDICTED: long chain base biosynthesis protein 2d-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=651

 Score = 62.0 bits (149),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +1

Query  187  YILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFYT  309
            Y++ F FG  RD FR+ FDW  S +L+GYAPIC   EDFYT
Sbjct  16   YVVFFVFGFLRDLFRELFDWSKSDDLRGYAPICPPFEDFYT  56



>ref|XP_001783810.1| predicted protein [Physcomitrella patens]
 gb|EDQ51402.1| predicted protein [Physcomitrella patens]
Length=492

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/54 (50%), Positives = 34/54 (63%), Gaps = 4/54 (7%)
 Frame = +1

Query  148  EIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFYT  309
            E+PY  A+TT+FSY +LF  G  RDF+R        S  +GYAP+C   EDFYT
Sbjct  8    EVPYHVAITTYFSYGILFIIGTLRDFYRNIM----RSGKKGYAPLCRDFEDFYT  57



>gb|EAY77076.1| hypothetical protein OsI_05036 [Oryza sativa Indica Group]
Length=499

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 31/65 (48%), Positives = 38/65 (58%), Gaps = 10/65 (15%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSS----------NLQGYAPICLG  291
            +I++PY TA TT FS+ L+F FG  RD FR       SS          N +GYAPIC+G
Sbjct  2    VIKVPYVTAATTLFSFGLIFGFGHLRDSFRALLRLLFSSAAAADSPAGCNSKGYAPICVG  61

Query  292  XEDFY  306
             EDFY
Sbjct  62   KEDFY  66



>sp|Q8RYL1.1|LCB2B_ORYSJ RecName: Full=Long chain base biosynthesis protein 2b [Oryza 
sativa Japonica Group]
 dbj|BAB90751.1| putative serine palmitoyltransferase [Oryza sativa Japonica Group]
 gb|EAZ14709.1| hypothetical protein OsJ_04633 [Oryza sativa Japonica Group]
 dbj|BAH00934.1| unnamed protein product [Oryza sativa Japonica Group]
Length=499

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 31/65 (48%), Positives = 38/65 (58%), Gaps = 10/65 (15%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSS----------NLQGYAPICLG  291
            +I++PY TA TT FS+ L+F FG  RD FR       SS          N +GYAPIC+G
Sbjct  2    VIKVPYVTAATTLFSFGLIFGFGHLRDSFRALLRLLFSSAAAADSPAGCNSKGYAPICVG  61

Query  292  XEDFY  306
             EDFY
Sbjct  62   KEDFY  66



>emb|CDY37910.1| BnaA06g19070D [Brassica napus]
Length=68

 Score = 55.5 bits (132),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 33/51 (65%), Gaps = 1/51 (2%)
 Frame = +1

Query  157  YFTALTTFFSYILLFAFGQFRDFFRKXFDW-CHSSNLQGYAPICLGXEDFY  306
            YFT ++T+ S  L+  FG  RDFFR+       + NLQGYAPIC G EDFY
Sbjct  2    YFTTISTYLSCCLIIGFGHLRDFFRRILVLPFTNDNLQGYAPICFGHEDFY  52



>gb|EPZ34220.1| Pyridoxal phosphate-dependent transferase domain-containing protein 
1 [Rozella allomycis CSF55]
Length=486

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/57 (44%), Positives = 34/57 (60%), Gaps = 3/57 (5%)
 Frame = +1

Query  148  EIPYFTALTTFFSYILLFAFGQFRDFFRKXF---DWCHSSNLQGYAPICLGXEDFYT  309
            + PYF  +TT+ SY++L  FG  RDFF K F   D+ H  +  G+AP+    E FYT
Sbjct  6    DAPYFVLVTTYLSYLILILFGHVRDFFGKRFRKHDYSHLMDSNGFAPLTSDFESFYT  62



>ref|XP_003298216.1| hypothetical protein PTT_08848 [Pyrenophora teres f. teres 0-1]
 gb|EFQ93693.1| hypothetical protein PTT_08848 [Pyrenophora teres f. teres 0-1]
Length=664

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 27/57 (47%), Positives = 35/57 (61%), Gaps = 3/57 (5%)
 Frame = +1

Query  148  EIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQ---GYAPICLGXEDFYT  309
            E PY+   TT+ SY++L  FG  RDFF K F   H S+LQ   GYAP+    ++FYT
Sbjct  143  EPPYYFLFTTYISYLILIVFGHVRDFFGKRFRKQHYSHLQEKDGYAPLNSDFDNFYT  199



>ref|XP_001936333.1| serine palmitoyltransferase 2 [Pyrenophora tritici-repentis Pt-1C-BFP]
 gb|EDU48920.1| serine palmitoyltransferase 2 [Pyrenophora tritici-repentis Pt-1C-BFP]
Length=664

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 27/57 (47%), Positives = 35/57 (61%), Gaps = 3/57 (5%)
 Frame = +1

Query  148  EIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQ---GYAPICLGXEDFYT  309
            E PY+   TT+ SY++L  FG  RDFF K F   H S+LQ   GYAP+    ++FYT
Sbjct  143  EPPYYFLFTTYISYLILIVFGHVRDFFGKRFRKQHYSHLQEKDGYAPLNSDFDNFYT  199



>ref|XP_011401811.1| Serine palmitoyltransferase 2 [Auxenochlorella protothecoides]
 gb|KFM28766.1| Serine palmitoyltransferase 2 [Auxenochlorella protothecoides]
Length=490

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 28/48 (58%), Positives = 33/48 (69%), Gaps = 3/48 (6%)
 Frame = +1

Query  166  ALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFYT  309
            AL  + S+ LL+ FGQFRDFFRK   W  +S L+GYAPI    EDFYT
Sbjct  13   ALFAYTSFTLLYIFGQFRDFFRKR--WSKAS-LKGYAPIRQDYEDFYT  57



>gb|KIW03829.1| hypothetical protein PV09_05128 [Verruconis gallopava]
Length=684

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 25/55 (45%), Positives = 35/55 (64%), Gaps = 3/55 (5%)
 Frame = +1

Query  154  PYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQ---GYAPICLGXEDFYT  309
            PY+  +TT+ SY++L  FG  RDFF K F   H ++LQ   GYAP+    ++FYT
Sbjct  148  PYYFVITTYISYLILIIFGHVRDFFGKRFRPAHYAHLQAANGYAPLNSDFDNFYT  202



>gb|EMD88052.1| hypothetical protein COCHEDRAFT_1227287 [Bipolaris maydis C5]
 gb|ENI02365.1| hypothetical protein COCC4DRAFT_74503 [Bipolaris maydis ATCC 
48331]
Length=662

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 36/57 (63%), Gaps = 3/57 (5%)
 Frame = +1

Query  148  EIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQ---GYAPICLGXEDFYT  309
            E PY+  LTT+ SY++L  FG  RDFF K F   H S+LQ   GYAP+    ++FYT
Sbjct  142  EPPYYFLLTTYISYLILIVFGHVRDFFGKRFRKQHYSHLQEKDGYAPLNSDFDNFYT  198



>ref|XP_007688714.1| hypothetical protein COCMIDRAFT_5986 [Bipolaris oryzae ATCC 44560]
 gb|EUC44750.1| hypothetical protein COCMIDRAFT_5986 [Bipolaris oryzae ATCC 44560]
Length=663

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 36/57 (63%), Gaps = 3/57 (5%)
 Frame = +1

Query  148  EIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQ---GYAPICLGXEDFYT  309
            E PY+  LTT+ SY++L  FG  RDFF K F   H S+LQ   GYAP+    ++FYT
Sbjct  143  EPPYYFLLTTYISYLILIVFGHVRDFFGKRFRKQHYSHLQEKDGYAPLNSDFDNFYT  199



>ref|XP_007713154.1| hypothetical protein COCCADRAFT_5787 [Bipolaris zeicola 26-R-13]
 gb|EUC32522.1| hypothetical protein COCCADRAFT_5787 [Bipolaris zeicola 26-R-13]
 gb|EUN29459.1| hypothetical protein COCVIDRAFT_24502 [Bipolaris victoriae FI3]
Length=663

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 36/57 (63%), Gaps = 3/57 (5%)
 Frame = +1

Query  148  EIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQ---GYAPICLGXEDFYT  309
            E PY+  LTT+ SY++L  FG  RDFF K F   H S+LQ   GYAP+    ++FYT
Sbjct  143  EPPYYFLLTTYISYLILIVFGHVRDFFGKRFRKQHYSHLQEKDGYAPLNSDFDNFYT  199



>ref|XP_007699462.1| hypothetical protein COCSADRAFT_316156 [Bipolaris sorokiniana 
ND90Pr]
 gb|EMD64929.1| hypothetical protein COCSADRAFT_316156 [Bipolaris sorokiniana 
ND90Pr]
Length=663

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 36/57 (63%), Gaps = 3/57 (5%)
 Frame = +1

Query  148  EIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQ---GYAPICLGXEDFYT  309
            E PY+  LTT+ SY++L  FG  RDFF K F   H S+LQ   GYAP+    ++FYT
Sbjct  143  EPPYYFLLTTYISYLILIVFGHVRDFFGKRFRKQHYSHLQEKDGYAPLNSDFDNFYT  199



>ref|XP_008025168.1| hypothetical protein SETTUDRAFT_73160, partial [Setosphaeria 
turcica Et28A]
 gb|EOA87462.1| hypothetical protein SETTUDRAFT_73160, partial [Setosphaeria 
turcica Et28A]
Length=658

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 36/57 (63%), Gaps = 3/57 (5%)
 Frame = +1

Query  148  EIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQ---GYAPICLGXEDFYT  309
            E PY+  LTT+ SY++L  FG  RDFF K F   H S+LQ   GYAP+    ++FYT
Sbjct  142  EPPYYFLLTTYISYLILIVFGHVRDFFGKRFRKQHYSHLQEKDGYAPLNSDFDNFYT  198



>ref|XP_005848468.1| hypothetical protein CHLNCDRAFT_144864 [Chlorella variabilis]
 gb|EFN56366.1| hypothetical protein CHLNCDRAFT_144864 [Chlorella variabilis]
Length=510

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 26/54 (48%), Positives = 33/54 (61%), Gaps = 2/54 (4%)
 Frame = +1

Query  154  PYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQ--GYAPICLGXEDFYT  309
            P F AL ++ S+++LF FG  RDF+RK      S+  Q  GYAPI    EDFYT
Sbjct  10   PLFVALASYASWLVLFLFGHMRDFYRKKIWGGRSAAKQKEGYAPIRQDYEDFYT  63



>ref|XP_005706634.1| serine palmitoyltransferase [Galdieria sulphuraria]
 gb|EME30114.1| serine palmitoyltransferase [Galdieria sulphuraria]
Length=598

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 25/53 (47%), Positives = 30/53 (57%), Gaps = 0/53 (0%)
 Frame = +1

Query  151  IPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFYT  309
            IPY  ALTT+FSY ++  FG  +DF  K F        QGYA +    EDFYT
Sbjct  12   IPYIVALTTYFSYAMVICFGYLKDFIGKLFRRKKFRVPQGYARLLSDFEDFYT  64



>gb|EWC48527.1| serine palmitoyltransferase 2 [Drechslerella stenobrocha 248]
Length=649

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 24/56 (43%), Positives = 33/56 (59%), Gaps = 3/56 (5%)
 Frame = +1

Query  148  EIPYFTALTTFFSYILLFAFGQFRDFFRKXF---DWCHSSNLQGYAPICLGXEDFY  306
            E PYF  +TT+FSY++L  FG  RDFF K F    + H  +  GYA +    ++FY
Sbjct  125  EPPYFIMITTYFSYLILIIFGHVRDFFGKRFKGHKYSHLKSKNGYAALNSDFDNFY  180



>ref|XP_011127662.1| hypothetical protein AOL_s00215g158 [Arthrobotrys oligospora 
ATCC 24927]
 gb|EGX43422.1| hypothetical protein AOL_s00215g158 [Arthrobotrys oligospora 
ATCC 24927]
Length=648

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 25/56 (45%), Positives = 33/56 (59%), Gaps = 3/56 (5%)
 Frame = +1

Query  148  EIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQ---GYAPICLGXEDFY  306
            E PYF   TT+FSY++L  FG  RDFF K F     +NL+   GYA +    ++FY
Sbjct  124  EPPYFIMFTTYFSYLILIIFGHVRDFFGKRFRSSKYTNLKAQNGYAALNSDFDNFY  179



>gb|KIK44721.1| hypothetical protein CY34DRAFT_10860 [Suillus luteus UH-Slu-Lm8-n1]
Length=670

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 25/57 (44%), Positives = 34/57 (60%), Gaps = 3/57 (5%)
 Frame = +1

Query  148  EIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNL---QGYAPICLGXEDFYT  309
            E PY+  LTT+ SY++L  FG  RDFF K F   + ++L    GYAP+    + FYT
Sbjct  127  EPPYYILLTTYISYLILLCFGHMRDFFGKRFTKSYFTHLMPHDGYAPLNSDFDSFYT  183



>ref|XP_005647033.1| PLP-dependent transferase [Coccomyxa subellipsoidea C-169]
 gb|EIE22489.1| PLP-dependent transferase [Coccomyxa subellipsoidea C-169]
Length=489

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 24/52 (46%), Positives = 30/52 (58%), Gaps = 4/52 (8%)
 Frame = +1

Query  154  PYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQGYAPICLGXEDFYT  309
            P+F AL T  S+ +LF  G  RD FR+ +    S   +GYAPI    EDFYT
Sbjct  9    PFFVALATMASWTILFIMGHIRDLFRRRY----SPERKGYAPIRQDYEDFYT  56



>gb|EWM21787.1| serine palmitoyltransferase [Nannochloropsis gaditana]
Length=648

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 34/58 (59%), Gaps = 3/58 (5%)
 Frame = +1

Query  145  IEIPYFTALTTFFSYILLFAFGQFRDFFRKXFD---WCHSSNLQGYAPICLGXEDFYT  309
            + I +F A+TT+F Y +L  FG  RDFF + F    +  +S   GYAP+    E+FYT
Sbjct  169  VPITWFAAITTYFGYAVLILFGHIRDFFGRLFGMSRYLATSPPPGYAPLLKDWENFYT  226



>gb|KIN04887.1| hypothetical protein OIDMADRAFT_115587 [Oidiodendron maius Zn]
Length=676

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 27/61 (44%), Positives = 35/61 (57%), Gaps = 3/61 (5%)
 Frame = +1

Query  133  PSKMIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQ---GYAPICLGXEDF  303
            P  M E PYF  LTT+ SY++L  FG  RDFF K F   H  +L+   GYA +    ++F
Sbjct  145  PPIMDEPPYFYLLTTYVSYLILIIFGHVRDFFGKRFKPNHYRHLKAANGYAALNSDFDNF  204

Query  304  Y  306
            Y
Sbjct  205  Y  205



>gb|ESA21945.1| hypothetical protein GLOINDRAFT_342892 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX62130.1| serine C-palmitoyltransferase LCB2 [Rhizophagus irregularis DAOM 
197198w]
Length=551

 Score = 50.4 bits (119),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 32/56 (57%), Gaps = 3/56 (5%)
 Frame = +1

Query  148  EIPYFTALTTFFSYILLFAFGQFRDFFRKXF---DWCHSSNLQGYAPICLGXEDFY  306
            E PY+   TT+ SY++L  FG  RDFF K F   ++ H     GYAP+    ++FY
Sbjct  60   EPPYYFLFTTYLSYLVLICFGHLRDFFGKRFLSKNYKHLKEQNGYAPLNSDFDNFY  115



>gb|KIK29494.1| hypothetical protein PISMIDRAFT_672183 [Pisolithus microcarpus 
441]
Length=674

 Score = 50.4 bits (119),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 37/60 (62%), Gaps = 3/60 (5%)
 Frame = +1

Query  139  KMIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNL---QGYAPICLGXEDFYT  309
            K+ E PY+  LTT+FSY+LL  FG  RDFF K F   + ++L    GYAP+    + FYT
Sbjct  130  KIEEPPYYILLTTYFSYLLLIIFGHLRDFFGKRFAKSYFTHLVPYDGYAPLNSDFDSFYT  189



>ref|XP_011107452.1| hypothetical protein H072_1460 [Dactylellina haptotyla CBS 200.50]
 gb|EPS44536.1| hypothetical protein H072_1460 [Dactylellina haptotyla CBS 200.50]
Length=648

 Score = 50.4 bits (119),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 24/56 (43%), Positives = 31/56 (55%), Gaps = 3/56 (5%)
 Frame = +1

Query  148  EIPYFTALTTFFSYILLFAFGQFRDFFRKXF---DWCHSSNLQGYAPICLGXEDFY  306
            E PYF   TT+FSY++L  FG  RDFF K F    + H     GYA +    ++FY
Sbjct  124  EPPYFIMFTTYFSYLILIIFGHVRDFFGKRFKSRKYTHLKAQNGYAALNSDFDNFY  179



>ref|XP_007303817.1| serine palmitoyltransferase 2 [Stereum hirsutum FP-91666 SS1]
 gb|EIM87603.1| serine palmitoyltransferase 2 [Stereum hirsutum FP-91666 SS1]
Length=681

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 32/57 (56%), Gaps = 3/57 (5%)
 Frame = +1

Query  148  EIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNL---QGYAPICLGXEDFYT  309
            E PY+  +TT+FSY++L   G  RDFF K     H  +L    GYAP+    + FYT
Sbjct  135  EPPYYIVITTYFSYLILICLGHMRDFFGKRLYTSHYKHLLPHDGYAPLNSDFDSFYT  191



>ref|XP_007869602.1| PLP-dependent transferase [Gloeophyllum trabeum ATCC 11539]
 gb|EPQ51968.1| PLP-dependent transferase [Gloeophyllum trabeum ATCC 11539]
Length=650

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 25/55 (45%), Positives = 31/55 (56%), Gaps = 3/55 (5%)
 Frame = +1

Query  154  PYFTALTTFFSYILLFAFGQFRDFFRKXF---DWCHSSNLQGYAPICLGXEDFYT  309
            PY+   TT+ SYI+L  FG  RDF RK F   ++ H     GYAPI    + FYT
Sbjct  106  PYYVLFTTYVSYIILILFGHVRDFTRKYFNPGEFKHLIPHDGYAPITSDFDSFYT  160



>gb|KFY75400.1| hypothetical protein V499_04622 [Pseudogymnoascus pannorum VKM 
F-103]
Length=680

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 25/58 (43%), Positives = 34/58 (59%), Gaps = 3/58 (5%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQ---GYAPICLGXEDFY  306
            M E PY+  LTT+ SY++L  FG  RDFF K F   H  +L+   GYA +    ++FY
Sbjct  151  MDEPPYYYLLTTYLSYLILIVFGHVRDFFGKRFRPLHYKHLKSANGYAALNSDFDNFY  208



>ref|XP_003840146.1| similar to serine palmitoyltransferase 2 [Leptosphaeria maculans 
JN3]
 emb|CBX96667.1| similar to serine palmitoyltransferase 2 [Leptosphaeria maculans 
JN3]
Length=677

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 35/57 (61%), Gaps = 3/57 (5%)
 Frame = +1

Query  148  EIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQ---GYAPICLGXEDFYT  309
            E PY+   TT+ SY++L  FG  RDFF K F   H S+LQ   GYAP+    ++FYT
Sbjct  150  EPPYYFLFTTYISYLVLIVFGHVRDFFGKRFRKQHYSHLQEKDGYAPLNSDFDNFYT  206



>gb|KFX90109.1| hypothetical protein V490_06649 [Pseudogymnoascus pannorum VKM 
F-3557]
 gb|KFX99522.1| hypothetical protein O988_03823 [Pseudogymnoascus pannorum VKM 
F-3808]
 gb|KFY48651.1| hypothetical protein V495_01164 [Pseudogymnoascus pannorum VKM 
F-4514 (FW-929)]
 gb|KFY67183.1| hypothetical protein V497_00523 [Pseudogymnoascus pannorum VKM 
F-4516 (FW-969)]
Length=680

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 25/58 (43%), Positives = 34/58 (59%), Gaps = 3/58 (5%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQ---GYAPICLGXEDFY  306
            M E PY+  LTT+ SY++L  FG  RDFF K F   H  +L+   GYA +    ++FY
Sbjct  151  MDEPPYYYLLTTYLSYLILIVFGHVRDFFGKRFRPLHYKHLKSANGYAALNSDFDNFY  208



>gb|KFY25007.1| hypothetical protein V493_04894 [Pseudogymnoascus pannorum VKM 
F-4281 (FW-2241)]
Length=678

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 25/58 (43%), Positives = 34/58 (59%), Gaps = 3/58 (5%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQ---GYAPICLGXEDFY  306
            M E PY+  LTT+ SY++L  FG  RDFF K F   H  +L+   GYA +    ++FY
Sbjct  149  MDEPPYYYLLTTYLSYLILIVFGHVRDFFGKRFRPLHYKHLKSANGYAALNSDFDNFY  206



>gb|KFZ07335.1| hypothetical protein V501_06551 [Pseudogymnoascus pannorum VKM 
F-4519 (FW-2642)]
Length=680

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 25/58 (43%), Positives = 34/58 (59%), Gaps = 3/58 (5%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQ---GYAPICLGXEDFY  306
            M E PY+  LTT+ SY++L  FG  RDFF K F   H  +L+   GYA +    ++FY
Sbjct  151  MDEPPYYYLLTTYLSYLILIVFGHVRDFFGKRFRPLHYKHLKSANGYAALNSDFDNFY  208



>gb|KFY12487.1| hypothetical protein V491_06778 [Pseudogymnoascus pannorum VKM 
F-3775]
Length=681

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 25/58 (43%), Positives = 34/58 (59%), Gaps = 3/58 (5%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQ---GYAPICLGXEDFY  306
            M E PY+  LTT+ SY++L  FG  RDFF K F   H  +L+   GYA +    ++FY
Sbjct  152  MDEPPYYYLLTTYLSYLILIVFGHVRDFFGKRFRPLHYKHLKSANGYAALNSDFDNFY  209



>gb|KFY10100.1| hypothetical protein V492_05191 [Pseudogymnoascus pannorum VKM 
F-4246]
 gb|KFY30103.1| hypothetical protein V494_08264 [Pseudogymnoascus pannorum VKM 
F-4513 (FW-928)]
Length=681

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 25/58 (43%), Positives = 34/58 (59%), Gaps = 3/58 (5%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQ---GYAPICLGXEDFY  306
            M E PY+  LTT+ SY++L  FG  RDFF K F   H  +L+   GYA +    ++FY
Sbjct  152  MDEPPYYYLLTTYLSYLILIVFGHVRDFFGKRFRPLHYKHLKSANGYAALNSDFDNFY  209



>gb|KFY85583.1| hypothetical protein V500_08288 [Pseudogymnoascus pannorum VKM 
F-4518 (FW-2643)]
 gb|KFZ03992.1| hypothetical protein V502_10499 [Pseudogymnoascus pannorum VKM 
F-4520 (FW-2644)]
Length=678

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 25/58 (43%), Positives = 34/58 (59%), Gaps = 3/58 (5%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQ---GYAPICLGXEDFY  306
            M E PY+  LTT+ SY++L  FG  RDFF K F   H  +L+   GYA +    ++FY
Sbjct  149  MDEPPYYYLLTTYLSYLILIVFGHVRDFFGKRFRPLHYKHLKSANGYAALNSDFDNFY  206



>gb|ELR04857.1| serine palmitoyltransferase [Pseudogymnoascus destructans 20631-21]
Length=683

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 25/58 (43%), Positives = 34/58 (59%), Gaps = 3/58 (5%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQ---GYAPICLGXEDFY  306
            M E PY+  LTT+ SY++L  FG  RDFF K F   H  +L+   GYA +    ++FY
Sbjct  154  MDEPPYYYLLTTYLSYLILIVFGHVRDFFGKRFRPLHYKHLKSANGYAALNSDFDNFY  211



>gb|KFY93153.1| hypothetical protein V498_04536 [Pseudogymnoascus pannorum VKM 
F-4517 (FW-2822)]
Length=681

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 25/58 (43%), Positives = 34/58 (59%), Gaps = 3/58 (5%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQ---GYAPICLGXEDFY  306
            M E PY+  LTT+ SY++L  FG  RDFF K F   H  +L+   GYA +    ++FY
Sbjct  152  MDEPPYYYLLTTYLSYLILIVFGHVRDFFGKRFRPLHYKHLKSANGYAALNSDFDNFY  209



>gb|KFY59490.1| hypothetical protein V496_05676 [Pseudogymnoascus pannorum VKM 
F-4515 (FW-2607)]
Length=678

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 25/58 (43%), Positives = 34/58 (59%), Gaps = 3/58 (5%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQ---GYAPICLGXEDFY  306
            M E PY+  LTT+ SY++L  FG  RDFF K F   H  +L+   GYA +    ++FY
Sbjct  149  MDEPPYYYLLTTYLSYLILIVFGHVRDFFGKRFRPLHYKHLKSANGYAALNSDFDNFY  206



>ref|XP_007595827.1| aminotransferase class I and II [Colletotrichum fioriniae PJ7]
 gb|EXF80546.1| aminotransferase class I and II [Colletotrichum fioriniae PJ7]
Length=655

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 28/62 (45%), Positives = 36/62 (58%), Gaps = 4/62 (6%)
 Frame = +1

Query  133  PSKMIEIPYFTALTTFFSYILLFAFGQFRDFFRKXF-DWCHSSNLQ---GYAPICLGXED  300
            P  + E PY+  LTT+ SY+LL  FG  RDFF K F D  H   L+   GYAP+    ++
Sbjct  122  PPIIDEPPYYYILTTYISYLLLILFGHARDFFGKRFGDKKHYQALKPQNGYAPLNEDFDN  181

Query  301  FY  306
            FY
Sbjct  182  FY  183



>ref|XP_461423.2| DEHA2F24926p [Debaryomyces hansenii CBS767]
 emb|CAG89838.2| DEHA2F24926p [Debaryomyces hansenii CBS767]
Length=557

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 25/56 (45%), Positives = 29/56 (52%), Gaps = 3/56 (5%)
 Frame = +1

Query  148  EIPYFTALTTFFSYILLFAFGQFRDFFRKXF---DWCHSSNLQGYAPICLGXEDFY  306
            E PY   +TT+ SY+LL   G  RDFF K F   D+ H     GY P   G E FY
Sbjct  50   EPPYIIYITTYISYLLLILIGHIRDFFGKIFKPRDYAHLVEKDGYGPWYDGFESFY  105



>ref|XP_007797940.1| putative serine palmitoyltransferase 2 protein [Eutypa lata UCREL1]
 gb|EMR62954.1| putative serine palmitoyltransferase 2 protein [Eutypa lata UCREL1]
Length=649

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 25/58 (43%), Positives = 31/58 (53%), Gaps = 4/58 (7%)
 Frame = +1

Query  148  EIPYFTALTTFFSYILLFAFGQFRDFFRKXFD----WCHSSNLQGYAPICLGXEDFYT  309
            E PY+  LTT+ SY+LL A G  RDFF K F     +       GYAP+    + FYT
Sbjct  121  EPPYYYVLTTYISYLLLIALGHIRDFFGKRFSKKPLYQSIKPANGYAPLTDDFDSFYT  178



>gb|EKG16858.1| Aminotransferase class I/classII [Macrophomina phaseolina MS6]
Length=587

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/56 (43%), Positives = 33/56 (59%), Gaps = 3/56 (5%)
 Frame = +1

Query  148  EIPYFTALTTFFSYILLFAFGQFRDFFRKXF---DWCHSSNLQGYAPICLGXEDFY  306
            E PY+  LTT+ SY++L  FG  RDFF K F   ++ H     GYAP+    ++FY
Sbjct  57   EPPYYFLLTTYISYLILIIFGHVRDFFGKRFRQNNYKHLRAQDGYAPLNSDFDNFY  112



>ref|XP_003348860.1| hypothetical protein SMAC_01883 [Sordaria macrospora k-hell]
 emb|CCC08336.1| unnamed protein product [Sordaria macrospora k-hell]
Length=663

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 26/57 (46%), Positives = 34/57 (60%), Gaps = 4/57 (7%)
 Frame = +1

Query  148  EIPYFTALTTFFSYILLFAFGQFRDFFRKXF-DWCHSSNLQ---GYAPICLGXEDFY  306
            E PY+  LTT+ SY++L  FG  RDFF K F D  H   L+   GYAP+    ++FY
Sbjct  136  EPPYYYVLTTYLSYLILIFFGHARDFFGKRFGDQTHYKALRVQNGYAPLNDDFDNFY  192



>gb|KDN61953.1| putative aminotransferase class I and II [Colletotrichum sublineola]
Length=655

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 27/62 (44%), Positives = 36/62 (58%), Gaps = 4/62 (6%)
 Frame = +1

Query  133  PSKMIEIPYFTALTTFFSYILLFAFGQFRDFFRKXF-DWCHSSNLQ---GYAPICLGXED  300
            P  + E PY+  LTT+ SY++L  FG  RDFF K F D  H   L+   GYAP+    ++
Sbjct  122  PPIIDEPPYYYVLTTYISYLILILFGHARDFFGKRFGDKKHYQALKPQNGYAPLNEDFDN  181

Query  301  FY  306
            FY
Sbjct  182  FY  183



>gb|ENH86493.1| serine palmitoyltransferase [Colletotrichum orbiculare MAFF 240422]
Length=655

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 27/62 (44%), Positives = 36/62 (58%), Gaps = 4/62 (6%)
 Frame = +1

Query  133  PSKMIEIPYFTALTTFFSYILLFAFGQFRDFFRKXF-DWCHSSNLQ---GYAPICLGXED  300
            P  + E PY+  LTT+ SY++L  FG  RDFF K F D  H   L+   GYAP+    ++
Sbjct  122  PPIIDEPPYYYVLTTYISYLILILFGHARDFFGKRFGDKKHYQALKPQNGYAPLNEDFDN  181

Query  301  FY  306
            FY
Sbjct  182  FY  183



>ref|XP_007587353.1| putative serine palmitoyltransferase protein [Neofusicoccum parvum 
UCRNP2]
 gb|EOD45194.1| putative serine palmitoyltransferase protein [Neofusicoccum parvum 
UCRNP2]
Length=686

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 24/56 (43%), Positives = 33/56 (59%), Gaps = 3/56 (5%)
 Frame = +1

Query  148  EIPYFTALTTFFSYILLFAFGQFRDFFRKXF---DWCHSSNLQGYAPICLGXEDFY  306
            E PY+  LTT+ SY++L  FG  RDFF K F   ++ H     GYAP+    ++FY
Sbjct  156  EPPYYFLLTTYISYLVLIIFGHVRDFFGKRFKQNNYKHLRAQDGYAPLNSDFDNFY  211



>gb|EFQ25280.1| aminotransferase class I and II [Colletotrichum graminicola M1.001]
Length=655

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 27/62 (44%), Positives = 36/62 (58%), Gaps = 4/62 (6%)
 Frame = +1

Query  133  PSKMIEIPYFTALTTFFSYILLFAFGQFRDFFRKXF-DWCHSSNLQ---GYAPICLGXED  300
            P  + E PY+  LTT+ SY++L  FG  RDFF K F D  H   L+   GYAP+    ++
Sbjct  122  PPIIDEPPYYYVLTTYISYLILILFGHARDFFGKRFGDKKHYQALKPQNGYAPLNEDFDN  181

Query  301  FY  306
            FY
Sbjct  182  FY  183



>ref|XP_009851217.1| serine palmitoyltransferase 2 [Neurospora tetrasperma FGSC 2508]
 gb|EGO58159.1| serine palmitoyltransferase 2 [Neurospora tetrasperma FGSC 2508]
 gb|EGZ71529.1| serine palmitoyltransferase 2 [Neurospora tetrasperma FGSC 2509]
Length=663

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 26/57 (46%), Positives = 34/57 (60%), Gaps = 4/57 (7%)
 Frame = +1

Query  148  EIPYFTALTTFFSYILLFAFGQFRDFFRKXF-DWCHSSNLQ---GYAPICLGXEDFY  306
            E PY+  LTT+ SY++L  FG  RDFF K F D  H   L+   GYAP+    ++FY
Sbjct  136  EPPYYYVLTTYLSYLILIFFGHARDFFGKRFGDQNHYKALRAQNGYAPLNDDFDNFY  192



>ref|XP_007394593.1| hypothetical protein PHACADRAFT_254057 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EKM56758.1| hypothetical protein PHACADRAFT_254057 [Phanerochaete carnosa 
HHB-10118-sp]
Length=673

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 25/55 (45%), Positives = 31/55 (56%), Gaps = 3/55 (5%)
 Frame = +1

Query  154  PYFTALTTFFSYILLFAFGQFRDFFRKXF---DWCHSSNLQGYAPICLGXEDFYT  309
            PY+  LTT+ SYIL+  FG  RDFF K F   D+ H     GYA +    + FYT
Sbjct  125  PYYILLTTYISYILVILFGHLRDFFGKRFKATDYRHLLAHGGYAALNSDFDSFYT  179



>gb|KIO02524.1| hypothetical protein M404DRAFT_1002135 [Pisolithus tinctorius 
Marx 270]
Length=674

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 36/60 (60%), Gaps = 3/60 (5%)
 Frame = +1

Query  139  KMIEIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNL---QGYAPICLGXEDFYT  309
            K+ E PY+   TT+FSY+LL  FG  RDFF K F   + ++L    GYAP+    + FYT
Sbjct  130  KIEEPPYYILFTTYFSYLLLIIFGHLRDFFGKQFAKSYFTHLVPYNGYAPLNSDFDSFYT  189



>emb|CDS13464.1| hypothetical protein LRAMOSA05640 [Absidia idahoensis var. thermophila]
Length=625

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 22/60 (37%), Positives = 33/60 (55%), Gaps = 3/60 (5%)
 Frame = +1

Query  139  KMIEIPYFTALTTFFSYILLFAFGQFRDFFRKXF---DWCHSSNLQGYAPICLGXEDFYT  309
            KM E P +  ++T+ +Y++L   G  RD   K F   ++ H  N QGYAP+    + FYT
Sbjct  147  KMEEAPLYVLVSTYLNYLVLILLGHLRDVIGKVFKRKEYAHLRNNQGYAPLVSDFDSFYT  206



>ref|XP_956766.1| serine palmitoyltransferase 2 [Neurospora crassa OR74A]
 gb|EAA27530.1| serine palmitoyltransferase 2 [Neurospora crassa OR74A]
 gb|KHE87927.1| hypothetical protein GE21DRAFT_4777 [Neurospora crassa]
Length=663

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 26/57 (46%), Positives = 34/57 (60%), Gaps = 4/57 (7%)
 Frame = +1

Query  148  EIPYFTALTTFFSYILLFAFGQFRDFFRKXF-DWCHSSNLQ---GYAPICLGXEDFY  306
            E PY+  LTT+ SY++L  FG  RDFF K F D  H   L+   GYAP+    ++FY
Sbjct  136  EPPYYYVLTTYLSYLILIFFGHARDFFGKRFGDQNHYKALRAQNGYAPLNDDFDNFY  192



>ref|XP_002839631.1| hypothetical protein [Tuber melanosporum Mel28]
 emb|CAZ83822.1| unnamed protein product [Tuber melanosporum]
Length=669

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 24/56 (43%), Positives = 33/56 (59%), Gaps = 3/56 (5%)
 Frame = +1

Query  148  EIPYFTALTTFFSYILLFAFGQFRDFFRKXF---DWCHSSNLQGYAPICLGXEDFY  306
            E PY+  LTT+ SY++L  FG  RDFF K F   ++ H     GYAP+    ++FY
Sbjct  144  EPPYYYLLTTYISYLVLIIFGHVRDFFGKRFKVENYKHLRAQNGYAPLNDDFDNFY  199



>gb|KFX46982.1| Serine palmitoyltransferase 2 [Talaromyces marneffei PM1]
Length=1230

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 33/58 (57%), Gaps = 3/58 (5%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXF---DWCHSSNLQGYAPICLGXEDFY  306
            M E PY+  LTT+ SY++L AFG  RDFF K F   ++ H     GY  +    ++FY
Sbjct  144  MDEPPYYYLLTTYISYLILIAFGHVRDFFGKRFKEENYRHLKPRNGYGALNSDFDNFY  201



>ref|XP_007919029.1| putative serine palmitoyltransferase 2 protein [Togninia minima 
UCRPA7]
 gb|EON96187.1| putative serine palmitoyltransferase 2 protein [Togninia minima 
UCRPA7]
Length=613

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 26/57 (46%), Positives = 34/57 (60%), Gaps = 4/57 (7%)
 Frame = +1

Query  148  EIPYFTALTTFFSYILLFAFGQFRDFFRKXF-DWCHSSNLQ---GYAPICLGXEDFY  306
            E PYF   TT+ SY+LL A G  RDFF K F +  H  +L+   GYAP+    ++FY
Sbjct  85   EPPYFFVFTTYISYLLLIALGHTRDFFGKRFGNQKHYRSLKAQNGYAPLNEDFDNFY  141



>ref|XP_007832647.1| Serine palmitoyltransferase 2 [Pestalotiopsis fici W106-1]
 gb|ETS83999.1| Serine palmitoyltransferase 2 [Pestalotiopsis fici W106-1]
Length=666

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 31/57 (54%), Gaps = 4/57 (7%)
 Frame = +1

Query  148  EIPYFTALTTFFSYILLFAFGQFRDFFRKXFD----WCHSSNLQGYAPICLGXEDFY  306
            E PY+  LTT+ SY+LL A G  RDFF K F     +     + GYAP+    + FY
Sbjct  139  EPPYYFVLTTYISYLLLIALGHVRDFFGKRFSKNPMYKSVKPINGYAPLTDDFDSFY  195



>gb|AAP47107.1| serine palmitoyl transferase subunit [Aspergillus nidulans]
Length=580

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 34/58 (59%), Gaps = 3/58 (5%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXF---DWCHSSNLQGYAPICLGXEDFY  306
            M E PY+  +TT+ SY++L AFG  RDFF K F   ++ H     GYA +    ++FY
Sbjct  51   MDEPPYYYLITTYISYLILIAFGHVRDFFGKRFREENYRHLKPRNGYAALNSDFDNFY  108



>ref|XP_001239438.1| hypothetical protein CIMG_09059 [Coccidioides immitis RS]
 gb|EAS27855.3| serine palmitoyltransferase 2 [Coccidioides immitis RS]
Length=669

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 33/58 (57%), Gaps = 3/58 (5%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXF---DWCHSSNLQGYAPICLGXEDFY  306
            M E PYF  LTT+ SY++L AFG  RDFF K F   D+ H     GY  +    ++FY
Sbjct  140  MDEPPYFYLLTTYISYLILIAFGHVRDFFGKRFKEKDYRHLKPQNGYGALNSDFDNFY  197



>ref|XP_003067044.1| Serine palmitoyltransferase 2 , putative [Coccidioides posadasii 
C735 delta SOWgp]
 gb|EER24899.1| Serine palmitoyltransferase 2 , putative [Coccidioides posadasii 
C735 delta SOWgp]
 gb|EFW19213.1| serine palmitoyltransferase 2 [Coccidioides posadasii str. Silveira]
Length=670

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 33/58 (57%), Gaps = 3/58 (5%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXF---DWCHSSNLQGYAPICLGXEDFY  306
            M E PYF  LTT+ SY++L AFG  RDFF K F   D+ H     GY  +    ++FY
Sbjct  141  MDEPPYFYLLTTYISYLILIAFGHVRDFFGKRFKEKDYRHLKPQNGYGALNSDFDNFY  198



>ref|XP_007769766.1| serine palmitoyltransferase 2 [Coniophora puteana RWD-64-598 
SS2]
 gb|EIW80061.1| serine palmitoyltransferase 2 [Coniophora puteana RWD-64-598 
SS2]
Length=678

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 33/57 (58%), Gaps = 3/57 (5%)
 Frame = +1

Query  148  EIPYFTALTTFFSYILLFAFGQFRDFFRKXFD---WCHSSNLQGYAPICLGXEDFYT  309
            E PY+  +TT+ SY++L  FG  RDFF K F    + H  + +GYA +    + FYT
Sbjct  126  EPPYYILITTYLSYLILICFGHVRDFFGKRFAKKYFTHVMSHKGYAALNSDFDSFYT  182



>ref|XP_658706.1| hypothetical protein AN1102.2 [Aspergillus nidulans FGSC A4]
 gb|EAA66220.1| hypothetical protein AN1102.2 [Aspergillus nidulans FGSC A4]
 tpe|CBF88137.1| TPA: Serine palmitoyl transferase subunit [Source:UniProtKB/TrEMBL;Acc:Q7ZA40] 
[Aspergillus nidulans FGSC A4]
Length=672

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 34/58 (59%), Gaps = 3/58 (5%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXF---DWCHSSNLQGYAPICLGXEDFY  306
            M E PY+  +TT+ SY++L AFG  RDFF K F   ++ H     GYA +    ++FY
Sbjct  143  MDEPPYYYLITTYISYLILIAFGHVRDFFGKRFREENYRHLKPRNGYAALNSDFDNFY  200



>gb|KIK39668.1| hypothetical protein CY34DRAFT_14231 [Suillus luteus UH-Slu-Lm8-n1]
Length=1065

 Score = 48.1 bits (113),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 34/57 (60%), Gaps = 3/57 (5%)
 Frame = +1

Query  148  EIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNL---QGYAPICLGXEDFYT  309
            E PY+  LTT+ SY+++  FG  RDFF K F   H ++L    GYAP+    + FYT
Sbjct  125  EPPYYVLLTTYLSYLMVICFGHMRDFFGKCFAKSHFTHLMPHDGYAPLNSDFDSFYT  181



>ref|XP_007303814.1| serine palmitoyltransferase 2 [Stereum hirsutum FP-91666 SS1]
 gb|EIM87600.1| serine palmitoyltransferase 2 [Stereum hirsutum FP-91666 SS1]
Length=679

 Score = 47.8 bits (112),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 31/57 (54%), Gaps = 3/57 (5%)
 Frame = +1

Query  148  EIPYFTALTTFFSYILLFAFGQFRDFFRKXF---DWCHSSNLQGYAPICLGXEDFYT  309
            E PY+  LTT+  Y++L   G  RDFF K F    + H +   GYAP+    + FYT
Sbjct  135  EPPYYIVLTTYCGYLILICLGHLRDFFGKRFYASYYTHLTPHDGYAPLNSDFDSFYT  191



>gb|EER37408.1| serine palmitoyltransferase [Histoplasma capsulatum H143]
 gb|EGC47985.1| serine palmitoyltransferase [Histoplasma capsulatum H88]
Length=693

 Score = 47.8 bits (112),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 33/58 (57%), Gaps = 3/58 (5%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXF---DWCHSSNLQGYAPICLGXEDFY  306
            M E PY+  LTT+ SY++L AFG  RDFF K F   ++ H     GY  +    ++FY
Sbjct  156  MDEPPYYYLLTTYISYLILIAFGHVRDFFGKRFREENYRHLKPKNGYGALNSDFDNFY  213



>gb|EEH03654.1| serine palmitoyltransferase [Histoplasma capsulatum G186AR]
Length=693

 Score = 47.8 bits (112),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 33/58 (57%), Gaps = 3/58 (5%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXF---DWCHSSNLQGYAPICLGXEDFY  306
            M E PY+  LTT+ SY++L AFG  RDFF K F   ++ H     GY  +    ++FY
Sbjct  156  MDEPPYYYLLTTYISYLILIAFGHVRDFFGKRFREENYRHLKPKNGYGALNSDFDNFY  213



>gb|KEQ73715.1| serine palmitoyl transferase subunit 2 [Aureobasidium pullulans 
var. namibiae CBS 147.97]
Length=674

 Score = 47.8 bits (112),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 33/54 (61%), Gaps = 3/54 (6%)
 Frame = +1

Query  154  PYFTALTTFFSYILLFAFGQFRDFFRKXF---DWCHSSNLQGYAPICLGXEDFY  306
            PY+  LTT+FSY++L  FG  RDFF K F    + H S   GYAP+    ++FY
Sbjct  147  PYYFLLTTYFSYLVLIIFGHVRDFFGKRFKQEQYKHLSARDGYAPLNSDFDNFY  200



>ref|XP_001212205.1| serine palmitoyltransferase 2 [Aspergillus terreus NIH2624]
 gb|EAU36301.1| serine palmitoyltransferase 2 [Aspergillus terreus NIH2624]
Length=893

 Score = 47.8 bits (112),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 31/57 (54%), Gaps = 3/57 (5%)
 Frame = +1

Query  148  EIPYFTALTTFFSYILLFAFGQFRDFFRKXF---DWCHSSNLQGYAPICLGXEDFYT  309
            E PYF ALTT+ ++++L   G F DFF K F    + H     GYA +    E FYT
Sbjct  107  EPPYFIALTTYLNFLVLIFLGHFHDFFAKWFRPQTYRHLKPQNGYASLYSDFESFYT  163



>gb|KEQ94532.1| hypothetical protein AUEXF2481DRAFT_41119 [Aureobasidium subglaciale 
EXF-2481]
Length=672

 Score = 47.4 bits (111),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 33/54 (61%), Gaps = 3/54 (6%)
 Frame = +1

Query  154  PYFTALTTFFSYILLFAFGQFRDFFRKXF---DWCHSSNLQGYAPICLGXEDFY  306
            PY+  LTT+FSY++L  FG  RDFF K F    + H S   GYAP+    ++FY
Sbjct  145  PYYFLLTTYFSYLVLIIFGHVRDFFGKRFKQEQYKHLSARDGYAPLNSDFDNFY  198



>ref|XP_001392526.1| serine palmitoyltransferase 2 [Aspergillus niger CBS 513.88]
 emb|CAK39912.1| unnamed protein product [Aspergillus niger]
Length=676

 Score = 47.4 bits (111),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 33/58 (57%), Gaps = 3/58 (5%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXF---DWCHSSNLQGYAPICLGXEDFY  306
            M E PY+  LTT+ SY++L AFG  RDFF K F   ++ H     GY  +    ++FY
Sbjct  149  MDEPPYYYLLTTYISYLILIAFGHVRDFFGKRFREENYRHLKPQNGYGALNSDFDNFY  206



>ref|XP_001818901.1| serine palmitoyltransferase 2 [Aspergillus oryzae RIB40]
 ref|XP_002380337.1| serine palmitoyltransferase 2, putative [Aspergillus flavus NRRL3357]
 dbj|BAE56899.1| unnamed protein product [Aspergillus oryzae RIB40]
 gb|EED49956.1| serine palmitoyltransferase 2, putative [Aspergillus flavus NRRL3357]
 gb|EIT83438.1| serine palmitoyltransferase [Aspergillus oryzae 3.042]
 gb|KDE77308.1| serine palmitoyltransferase [Aspergillus oryzae 100-8]
Length=673

 Score = 47.4 bits (111),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 33/58 (57%), Gaps = 3/58 (5%)
 Frame = +1

Query  142  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKXF---DWCHSSNLQGYAPICLGXEDFY  306
            M E PY+  LTT+ SY++L AFG  RDFF K F   ++ H     GY  +    ++FY
Sbjct  145  MDEPPYYYLLTTYISYLILIAFGHVRDFFGKRFREENYRHLKPRNGYGALNSDFDNFY  202



>ref|XP_003031688.1| hypothetical protein SCHCODRAFT_82237 [Schizophyllum commune 
H4-8]
 gb|EFI96785.1| hypothetical protein SCHCODRAFT_82237 [Schizophyllum commune 
H4-8]
Length=679

 Score = 47.4 bits (111),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 31/55 (56%), Gaps = 3/55 (5%)
 Frame = +1

Query  154  PYFTALTTFFSYILLFAFGQFRDFFRKXF---DWCHSSNLQGYAPICLGXEDFYT  309
            PYF  +TT+ SY+LL   G  RDFF K F    + H   + GYAP+    + FYT
Sbjct  138  PYFILMTTYISYLLLIVLGHVRDFFGKRFYPKSYEHLVPVNGYAPLTSDFDSFYT  192



>gb|KIM92390.1| hypothetical protein PILCRDRAFT_810446 [Piloderma croceum F 1598]
Length=671

 Score = 47.4 bits (111),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 32/58 (55%), Gaps = 3/58 (5%)
 Frame = +1

Query  145  IEIPYFTALTTFFSYILLFAFGQFRDFFRKXF---DWCHSSNLQGYAPICLGXEDFYT  309
            I+ PY+  L+T+ SY+LL   G  RDFF K F    + H     GYAP+    + FYT
Sbjct  124  IDPPYYILLSTYVSYLLLIVIGHMRDFFGKSFRPSSYKHLMPHDGYAPMNSDFDSFYT  181



>gb|KEQ84476.1| putative serine palmitoyltransferase 2 [Aureobasidium pullulans 
EXF-150]
Length=672

 Score = 47.4 bits (111),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 33/54 (61%), Gaps = 3/54 (6%)
 Frame = +1

Query  154  PYFTALTTFFSYILLFAFGQFRDFFRKXF---DWCHSSNLQGYAPICLGXEDFY  306
            PY+  LTT+FSY++L  FG  RDFF K F    + H S   GYAP+    ++FY
Sbjct  145  PYYFLLTTYFSYLVLIIFGHVRDFFGKRFKQEQYKHLSARDGYAPLNSDFDNFY  198



>gb|EPQ62028.1| hypothetical protein BGT96224_A20663 [Blumeria graminis f. sp. 
tritici 96224]
Length=691

 Score = 47.4 bits (111),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 24/56 (43%), Positives = 33/56 (59%), Gaps = 3/56 (5%)
 Frame = +1

Query  148  EIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQ---GYAPICLGXEDFY  306
            E PY+  LTT+ SY++L  FG  RDFF K F   H  +L+   GYA +    ++FY
Sbjct  164  EPPYYYLLTTYISYLVLIIFGHVRDFFGKRFKAEHYRHLKSANGYAALNSDFDNFY  219



>gb|EHL00610.1| putative Serine palmitoyltransferase 2 [Glarea lozoyensis 74030]
Length=679

 Score = 47.4 bits (111),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 24/56 (43%), Positives = 33/56 (59%), Gaps = 3/56 (5%)
 Frame = +1

Query  148  EIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQ---GYAPICLGXEDFY  306
            E PY+  LTT+ SY++L  FG  RDFF K F   H  +L+   GYA +    ++FY
Sbjct  152  EPPYYYVLTTYISYLILIIFGHVRDFFGKRFRPDHYRHLKAANGYAALNSDFDNFY  207



>ref|XP_007674599.1| hypothetical protein BAUCODRAFT_66436 [Baudoinia compniacensis 
UAMH 10762]
 gb|EMC97986.1| hypothetical protein BAUCODRAFT_66436 [Baudoinia compniacensis 
UAMH 10762]
Length=584

 Score = 47.4 bits (111),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 34/56 (61%), Gaps = 3/56 (5%)
 Frame = +1

Query  148  EIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQ---GYAPICLGXEDFY  306
            E PY+  +TT+ SY++L  FG  RDFF K F   H  +LQ   GYAP+    ++FY
Sbjct  55   EPPYYYLITTYISYLILIIFGHVRDFFGKRFRQDHYRHLQEQDGYAPLNNDFDNFY  110



>ref|XP_008086364.1| PLP-dependent transferase [Glarea lozoyensis ATCC 20868]
 gb|EPE27174.1| PLP-dependent transferase [Glarea lozoyensis ATCC 20868]
Length=679

 Score = 47.4 bits (111),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 24/56 (43%), Positives = 33/56 (59%), Gaps = 3/56 (5%)
 Frame = +1

Query  148  EIPYFTALTTFFSYILLFAFGQFRDFFRKXFDWCHSSNLQ---GYAPICLGXEDFY  306
            E PY+  LTT+ SY++L  FG  RDFF K F   H  +L+   GYA +    ++FY
Sbjct  152  EPPYYYVLTTYISYLILIIFGHVRDFFGKRFRPDHYRHLKAANGYAALNSDFDNFY  207



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 558850726180