BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF051J23

Length=714
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AGH32914.1|  fatty acid desaturase                                   211   4e-88   Camellia chekiangoleosa
gb|AFK31315.1|  fatty acid desaturase                                   211   5e-88   Camellia oleifera [abura-tsubaki]
ref|XP_009592981.1|  PREDICTED: omega-6 fatty acid desaturase, en...    206   6e-88   Nicotiana tomentosiformis
ref|XP_011075145.1|  PREDICTED: omega-6 fatty acid desaturase, en...    210   1e-87   Sesamum indicum [beniseed]
emb|CDP10136.1|  unnamed protein product                                218   2e-87   Coffea canephora [robusta coffee]
ref|XP_009800247.1|  PREDICTED: omega-6 fatty acid desaturase, en...    206   3e-87   Nicotiana sylvestris
gb|ADK47520.1|  microsomal oleic acid desaturase                        213   2e-86   Wrightia tinctoria
ref|XP_006349589.1|  PREDICTED: omega-6 fatty acid desaturase, en...    204   2e-85   Solanum tuberosum [potatoes]
gb|AEI60128.1|  microsomal delta-12 oleate desaturase                   205   1e-84   Vitis labrusca [Concord grape]
ref|XP_004234773.1|  PREDICTED: omega-6 fatty acid desaturase, en...    203   2e-84   Solanum lycopersicum
ref|XP_010520034.1|  PREDICTED: omega-6 fatty acid desaturase, en...    211   2e-84   Tarenaya hassleriana [spider flower]
gb|AGJ01133.1|  fatty acid desaturase 2-1                               205   3e-84   Linum usitatissimum
ref|XP_010520035.1|  PREDICTED: omega-6 fatty acid desaturase, en...    210   4e-84   Tarenaya hassleriana [spider flower]
gb|ACF49507.1|  omega-6 desaturase                                      205   5e-84   Linum usitatissimum
emb|CAN71892.1|  hypothetical protein VITISV_040865                     205   8e-84   Vitis vinifera
ref|XP_002279239.1|  PREDICTED: omega-6 fatty acid desaturase, en...    205   8e-84   Vitis vinifera
ref|XP_006407366.1|  hypothetical protein EUTSA_v10020910mg             204   1e-83   Eutrema salsugineum [saltwater cress]
gb|AAW63041.1|  microsomal delta-12 oleate desaturase                   205   4e-83   Olea europaea
gb|AAL93620.1|  fatty acid desaturase 2                                 204   5e-83   Olea europaea subsp. europaea
emb|CAA63432.1|  D12 oleate desaturase                                  206   6e-83   Solanum commersonii
ref|XP_006354202.1|  PREDICTED: omega-6 fatty acid desaturase, en...    207   8e-83   Solanum tuberosum [potatoes]
gb|AAY87459.1|  omega-6 fatty acid desaturase                           196   8e-83   Hevea brasiliensis [jebe]
ref|XP_008380133.1|  PREDICTED: omega-6 fatty acid desaturase, en...    213   1e-82   
gb|ABS86964.2|  delta-12 fatty acid desaturase                          202   2e-82   Descurainia sophia
ref|XP_008240937.1|  PREDICTED: omega-6 fatty acid desaturase, en...    212   3e-82   Prunus mume [ume]
gb|AEW43690.1|  fatty acid desaturase 2                                 194   3e-82   Jatropha curcas
gb|ABA41034.1|  delta12-fatty acid desaturase                           193   3e-82   Jatropha curcas
gb|ADB93805.1|  delta-12-fatty acid desaturase                          193   4e-82   Jatropha curcas
gb|AHG95978.1|  endoplasmic reticulum 18:1 desaturase                   210   4e-82   Malus baccata [shan jing zi]
ref|XP_009369579.1|  PREDICTED: omega-6 fatty acid desaturase, en...    210   5e-82   Pyrus x bretschneideri [bai li]
gb|AGS12442.1|  omega-6 fatty acid desaturase                           203   6e-82   Crambe hispanica subsp. abyssinica [Abyssinian crambe]
ref|XP_006604385.1|  PREDICTED: omega-6 fatty acid desaturase, en...    201   6e-82   
gb|AIA21661.1|  oleate desaturase                                       202   8e-82   Crambe glabrata
gb|AIA21655.1|  oleate desaturase                                       203   8e-82   Crambe filiformis
gb|AIA21667.1|  oleate desaturase                                       203   9e-82   Crambe kralikii
ref|XP_010277281.1|  PREDICTED: omega-6 fatty acid desaturase, en...    197   9e-82   Nelumbo nucifera [Indian lotus]
gb|AIA21649.1|  oleate desaturase                                       203   1e-81   Crambe hispanica subsp. abyssinica [Abyssinian crambe]
gb|AGS12443.1|  omega-6 fatty acid desaturase                           203   1e-81   Crambe hispanica subsp. abyssinica [Abyssinian crambe]
ref|XP_007204396.1|  hypothetical protein PRUPE_ppa007098mg             211   1e-81   Prunus persica
gb|AIA21657.1|  oleate desaturase                                       202   1e-81   Crambe filiformis
gb|AIA21668.1|  oleate desaturase                                       203   1e-81   Crambe kralikii
gb|AIA21669.1|  oleate desaturase                                       203   1e-81   Crambe kralikii
emb|CDP17521.1|  unnamed protein product                                204   1e-81   Coffea canephora [robusta coffee]
gb|AIA21660.1|  oleate desaturase                                       203   2e-81   Crambe glabrata
ref|XP_011033218.1|  PREDICTED: omega-6 fatty acid desaturase, en...    191   2e-81   Populus euphratica
ref|XP_007028985.1|  Microsomal oleic acid desaturase                   199   2e-81   
gb|AAT72296.2|  microsomal omega-6-desaturase                           208   2e-81   Nicotiana tabacum [American tobacco]
ref|XP_009613562.1|  PREDICTED: omega-6 fatty acid desaturase, en...    208   2e-81   Nicotiana tomentosiformis
ref|XP_009777156.1|  PREDICTED: omega-6 fatty acid desaturase, en...    207   3e-81   Nicotiana sylvestris
gb|KHG25037.1|  Omega-6 fatty acid desaturase, endoplasmic reticu...    200   3e-81   Gossypium arboreum [tree cotton]
ref|XP_002323284.1|  Omega-6 fatty acid desaturase family protein       191   3e-81   
gb|ACU23285.1|  unknown                                                 201   3e-81   Glycine max [soybeans]
ref|XP_010557947.1|  PREDICTED: omega-6 fatty acid desaturase, en...    204   3e-81   Tarenaya hassleriana [spider flower]
ref|XP_008443062.1|  PREDICTED: omega-6 fatty acid desaturase, en...    204   4e-81   
gb|AFK34956.1|  unknown                                                 199   5e-81   Lotus japonicus
ref|XP_007162321.1|  hypothetical protein PHAVU_001G142100g             198   5e-81   Phaseolus vulgaris [French bean]
emb|CDY01103.1|  BnaC05g40970D                                          204   6e-81   
gb|ABZ05022.1|  delta-12 fatty acid desaturase                          199   7e-81   Davidia involucrata
ref|XP_004228665.1|  PREDICTED: omega-6 fatty acid desaturase, en...    199   7e-81   Solanum lycopersicum
ref|XP_011004831.1|  PREDICTED: omega-6 fatty acid desaturase, en...    189   8e-81   Populus euphratica
gb|AGZ02022.1|  microsomal omega-6-desaturase                           196   8e-81   Millettia pinnata [karumtree]
gb|AAL68982.1|AF251843_1  delta-12 oleate desaturase                    201   8e-81   Helianthus annuus
emb|CDY08454.1|  BnaA05g26900D                                          203   8e-81   Brassica napus [oilseed rape]
gb|AGS12444.1|  omega-6 fatty acid desaturase                           204   9e-81   Crambe hispanica subsp. abyssinica [Abyssinian crambe]
ref|XP_002530704.1|  omega-6 desaturase, endoplasmic reticulum          195   1e-80   
gb|AIC34705.1|  omega-6 fatty acid desaturase                           209   1e-80   Rhus chinensis
gb|AIA21650.1|  oleate desaturase                                       203   1e-80   Crambe hispanica subsp. abyssinica [Abyssinian crambe]
gb|AAW63040.1|  microsomal delta-12 oleate desaturase                   202   1e-80   Olea europaea
gb|AAL37484.1|AF331163_1  delta-12 fatty acid desaturase                200   1e-80   Gossypium hirsutum [American cotton]
emb|CDH92856.1|  omega-6 fatty acid desaturase                          199   1e-80   Sesamum radiatum
gb|AFN53642.1|  omega-6 desaturase                                      207   1e-80   Linum usitatissimum
gb|AAF78778.1|  delta-12 oleate desaturase                              203   2e-80   Brassica napus [oilseed rape]
gb|AGN95842.1|  fatty acid delta12-desturase FAD2-2                     199   2e-80   Hiptage benghalensis
ref|XP_009146642.1|  PREDICTED: omega-6 fatty acid desaturase, en...    203   2e-80   Brassica rapa
gb|ACP39502.1|  delta-12 oleate desaturase                              203   2e-80   Brassica napus [oilseed rape]
gb|ACN53524.1|  fatty acid desaturase 2                                 203   2e-80   Brassica juncea [brown mustard]
gb|AFC41106.1|  FAD2-1                                                  203   2e-80   Brassica oleracea
gb|ACP39504.1|  delta-12 oleate desaturase                              203   2e-80   Brassica napus [oilseed rape]
gb|AEQ28964.1|  omega-6 desaturase                                      205   2e-80   Linum grandiflorum
emb|CAD30827.1|  fatty acid desaturase 2                                203   2e-80   Brassica rapa
gb|ACN53522.1|  fatty acid desaturase 2                                 203   2e-80   Brassica juncea [brown mustard]
gb|ADK70952.1|  fatty acid desaturase 2-1                               202   2e-80   Brassica juncea [brown mustard]
gb|ABG76201.1|  delta 12 desaturase                                     203   2e-80   Brassica napus [oilseed rape]
ref|XP_006492862.1|  PREDICTED: omega-6 fatty acid desaturase, en...    201   2e-80   Citrus sinensis [apfelsine]
ref|XP_002309307.2|  hypothetical protein POPTR_0006s20640g             189   2e-80   Populus trichocarpa [western balsam poplar]
gb|KDO70931.1|  hypothetical protein CISIN_1g0167812mg                  200   2e-80   Citrus sinensis [apfelsine]
gb|AFJ53078.1|  fatty acid desaturase 2                                 203   2e-80   Linum usitatissimum
dbj|BAC22091.1|  delta-12 desaturase                                    194   2e-80   Spinacia oleracea
ref|XP_004170289.1|  PREDICTED: omega-6 fatty acid desaturase, en...    206   2e-80   
gb|AGO32050.1|  microsomal oleate desaturase                            202   2e-80   Xanthoceras sorbifolium [yellow-horn]
gb|AAD19742.1|  delta-12 desaturase                                     202   2e-80   Brassica carinata [Abyssinian mustard]
ref|XP_004136572.1|  PREDICTED: omega-6 fatty acid desaturase, en...    205   2e-80   Cucumis sativus [cucumbers]
ref|XP_006429873.1|  hypothetical protein CICLE_v10011949mg             201   2e-80   Citrus clementina [clementine]
gb|ADN10829.1|  fatty acid desaturase                                   204   3e-80   Camelina hispida
gb|AAM61113.1|  omega-6 fatty acid desaturase, endoplasmic reticu...    199   3e-80   Arabidopsis thaliana [mouse-ear cress]
ref|NP_187819.1|  omega-6 fatty acid desaturase                         199   3e-80   Arabidopsis thaliana [mouse-ear cress]
gb|AIA21666.1|  oleate desaturase                                       203   3e-80   Crambe kralikii
gb|ADZ39687.1|  microsomal delta-12 oleate desaturase                   200   3e-80   Olea europaea subsp. europaea
gb|AIA21646.1|  oleate desaturase                                       204   3e-80   Crambe hispanica subsp. abyssinica [Abyssinian crambe]
gb|ABI96919.1|  delta-12 fatty acid desaturase                          194   4e-80   Triadica sebifera [candleberry-tree]
gb|ACP39505.1|  delta-12 oleate desaturase                              203   4e-80   Brassica napus [oilseed rape]
gb|ACF49508.1|  omega-6 desaturase                                      203   4e-80   Linum usitatissimum
gb|ADN10834.1|  fatty acid desaturase                                   204   4e-80   Camelina rumelica
ref|NP_001237865.1|  microsomal oleate desaturase FAD2-4                196   4e-80   Glycine max [soybeans]
ref|XP_004304366.1|  PREDICTED: omega-6 fatty acid desaturase, en...    206   4e-80   Fragaria vesca subsp. vesca
dbj|BAD89862.1|  microsomal omega-6 fatty acid desaturase               196   5e-80   Glycine max [soybeans]
gb|KHN07428.1|  Omega-6 fatty acid desaturase, endoplasmic reticu...    196   5e-80   Glycine soja [wild soybean]
gb|AAC31698.1|  delta-12 fatty acid desaturase                          194   5e-80   Borago officinalis
ref|NP_001238358.1|  omega-6 fatty acid desaturase, endoplasmic r...    204   5e-80   
gb|ABC41578.1|  endoplasmic reticulum 18:1 desaturase                   186   1e-79   Populus tomentosa [Chinese white poplar]
gb|AIA21647.1|  oleate desaturase                                       200   1e-79   Crambe hispanica subsp. abyssinica [Abyssinian crambe]
ref|XP_002884883.1|  hypothetical protein ARALYDRAFT_478568             200   1e-79   
gb|ADU18249.1|  microsomal oleate desaturase                            204   1e-79   Camelina sativa [gold-of-pleasure]
gb|ADN10825.1|  fatty acid desaturase                                   204   1e-79   Camelina sativa [gold-of-pleasure]
gb|AIA21652.1|  oleate desaturase                                       199   1e-79   Crambe filiformis
ref|XP_010257471.1|  PREDICTED: omega-6 fatty acid desaturase, en...    200   1e-79   Nelumbo nucifera [Indian lotus]
gb|AAB80696.1|  omega-6 fatty acid desaturase                           181   1e-79   Petroselinum crispum
ref|XP_009376128.1|  PREDICTED: omega-6 fatty acid desaturase, en...    203   1e-79   Pyrus x bretschneideri [bai li]
ref|XP_010265904.1|  PREDICTED: omega-6 fatty acid desaturase, en...    194   1e-79   Nelumbo nucifera [Indian lotus]
gb|ADN10832.1|  fatty acid desaturase                                   204   1e-79   Camelina microcarpa
gb|ACU21462.1|  unknown                                                 194   1e-79   Glycine max [soybeans]
ref|XP_010464962.1|  PREDICTED: omega-6 fatty acid desaturase, en...    204   1e-79   Camelina sativa [gold-of-pleasure]
gb|AFP21683.1|  FAD2                                                    203   2e-79   Physaria fendleri
gb|AGN95841.1|  fatty acid delta12-desturase FAD2-1                     197   2e-79   Hiptage benghalensis
ref|XP_006297892.1|  hypothetical protein CARUB_v10013933mg             200   2e-79   Capsella rubella
gb|AAS92240.1|  delta-12 oleate desaturase                              202   2e-79   Brassica napus [oilseed rape]
gb|ADJ58018.1|  fatty acid desaturase 2                                 203   2e-79   Brassica nigra
emb|CAA71199.1|  omega-6 desaturase                                     201   2e-79   Gossypium hirsutum [American cotton]
sp|Q39287.1|FAD6E_BRAJU  RecName: Full=Omega-6 fatty acid desatur...    197   2e-79   Brassica juncea [brown mustard]
gb|AIA21648.1|  oleate desaturase                                       199   2e-79   Crambe hispanica subsp. abyssinica [Abyssinian crambe]
ref|XP_010058070.1|  PREDICTED: omega-6 fatty acid desaturase, en...    193   2e-79   
gb|AGZ15438.1|  FAD2                                                    194   2e-79   Eucalyptus camaldulensis
gb|ADN10835.1|  fatty acid desaturase                                   204   3e-79   Camelina rumelica
gb|EYU39930.1|  hypothetical protein MIMGU_mgv1a008167mg                198   3e-79   Erythranthe guttata [common monkey flower]
gb|AGZ02023.1|  microsomal omega-6-desaturase                           185   3e-79   Millettia pinnata [karumtree]
gb|KJB46318.1|  hypothetical protein B456_007G362300                    200   3e-79   Gossypium raimondii
gb|AAQ16653.1|  delta-12 fatty acid desaturase 2                        200   3e-79   Gossypium hirsutum [American cotton]
gb|ABB05230.1|  delta 12 desaturase                                     200   4e-79   Linum usitatissimum
gb|AAT02411.1|  delta-12 oleate desaturase                              201   6e-79   Brassica napus [oilseed rape]
ref|XP_008392076.1|  PREDICTED: omega-6 fatty acid desaturase, en...    206   7e-79   
ref|XP_010058087.1|  PREDICTED: omega-6 fatty acid desaturase, en...    193   9e-79   Eucalyptus grandis [rose gum]
ref|XP_010486902.1|  PREDICTED: omega-6 fatty acid desaturase, en...    201   1e-78   
gb|ACR15954.1|  fatty acid desaturase 2                                 200   1e-78   Lepidium campestre [bastard cress]
ref|XP_003625259.1|  Omega-6 fatty acid desaturase, endoplasmic r...    195   1e-78   
gb|AFQ60942.1|  microsomal oleate desaturase                            202   1e-78   Camelina sativa [gold-of-pleasure]
ref|NP_001291954.1|  omega-6 fatty acid desaturase, endoplasmic r...    201   2e-78   Camelina sativa [gold-of-pleasure]
gb|KHG24863.1|  Omega-6 fatty acid desaturase, endoplasmic reticu...    197   2e-78   Gossypium arboreum [tree cotton]
gb|ADP02395.1|  delta-12 oleate desaturase                              195   3e-78   Gossypium hirsutum [American cotton]
gb|ADM48789.1|  microsomal oleate desaturase                            186   3e-78   Carthamus tinctorius
gb|AAF04094.1|AF188264_1  delta-12 oleate desaturase                    188   4e-78   Vernonia galamensis
gb|AHY24226.1|  delta-12 fatty acid desaturase                          189   5e-78   Paeonia lactiflora [common garden peony]
gb|AFN53713.1|  omega-6 desaturase                                      205   8e-78   Linum usitatissimum
gb|KJB83458.1|  hypothetical protein B456_013G248800                    196   8e-78   Gossypium raimondii
gb|ABR27357.1|  fatty acid desaturase 2                                 196   8e-78   Brassica juncea [brown mustard]
gb|ABF70324.1|  delta-12 desaturase                                     204   1e-77   Orychophragmus violaceus
gb|AFJ53118.1|  fatty acid desaturase 2-2                               205   1e-77   Linum usitatissimum
gb|ADL09404.1|  fatty acid desaturase                                   189   1e-77   Wrightia tinctoria
gb|ABF70311.1|  delta-12 desaturase                                     202   1e-77   Crambe hispanica
gb|ABF70319.1|  delta-12 desaturase                                     204   1e-77   Isatis tinctoria [woad]
emb|CAA76157.1|  delta 12 fatty acid desaturase                         187   2e-77   Crepis palaestina
gb|ABF70309.1|  delta-12 desaturase                                     202   2e-77   Crambe filiformis
gb|ABF70320.1|  delta-12 desaturase                                     206   3e-77   Isatis tinctoria [woad]
ref|XP_010091397.1|  Omega-6 fatty acid desaturase, endoplasmic r...    187   3e-77   Morus notabilis
gb|AAL68983.1|AF251844_1  delta-12 oleate desaturase                    202   3e-77   Helianthus annuus
gb|ABP49577.1|  oleate desaturase                                       189   3e-77   Caragana korshinskii
gb|AEE69021.1|  Fad2                                                    180   4e-77   Vernicia fordii [tung oil tree]
gb|AAN87573.1|  delta 12 oleic acid desaturase FAD2                     180   5e-77   Vernicia fordii [tung oil tree]
gb|AAO37754.1|  delta-12 oleate desaturase                              199   5e-77   Punica granatum [granado]
gb|AAF04093.1|AF188263_1  delta-12 oleate desaturase                    189   5e-77   Vernonia galamensis
emb|CAA65744.1|  omega-6 desaturase                                     191   5e-77   Gossypium hirsutum [American cotton]
gb|AFJ53121.1|  fatty acid desaturase 2-2                               205   6e-77   Linum usitatissimum
gb|ABF70329.1|  delta-12 desaturase                                     202   6e-77   Thlaspi arvense
gb|ABF70313.1|  delta-12 desaturase                                     202   8e-77   Crambe kralikii
gb|ACJ84618.1|  unknown                                                 191   1e-76   Medicago truncatula
ref|XP_002285640.1|  PREDICTED: omega-6 fatty acid desaturase, en...    197   2e-76   Vitis vinifera
ref|XP_010672659.1|  PREDICTED: omega-6 fatty acid desaturase, en...    184   2e-76   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007145683.1|  hypothetical protein PHAVU_007G259500g             198   2e-76   Phaseolus vulgaris [French bean]
gb|ABF70303.1|  delta-12 desaturase                                     204   2e-76   Crambe hispanica subsp. abyssinica [Abyssinian crambe]
emb|CAD24671.1|  delta 12-acyl-lipid-desaturase                         197   2e-76   Punica granatum [granado]
gb|ABF70289.1|  delta-12 desaturase                                     203   2e-76   Brassica juncea var. tumida [zha cai]
gb|AEE69020.1|  Fad2                                                    180   3e-76   Vernicia fordii [tung oil tree]
gb|ABF70290.1|  delta-12 desaturase                                     202   3e-76   Brassica juncea var. tumida [zha cai]
gb|ABF70292.1|  delta-12 desaturase                                     202   3e-76   Brassica napus [oilseed rape]
gb|ABF70293.1|  delta-12 desaturase                                     202   3e-76   Brassica napus [oilseed rape]
ref|XP_004493583.1|  PREDICTED: omega-6 fatty acid desaturase, en...    193   4e-76   Cicer arietinum [garbanzo]
ref|XP_010087393.1|  Omega-6 fatty acid desaturase, endoplasmic r...    191   4e-76   Morus notabilis
gb|ABF70302.1|  delta-12 desaturase                                     197   5e-76   Crambe hispanica subsp. abyssinica [Abyssinian crambe]
gb|ADZ39688.1|  microsomal delta-12 oleate desaturase                   181   6e-76   Olea europaea subsp. europaea
gb|AIN36675.1|  delta 12 desaturase                                     196   6e-76   Cannabis sativa
ref|XP_006365798.1|  PREDICTED: omega-6 fatty acid desaturase, en...    184   7e-76   Solanum tuberosum [potatoes]
gb|ABF70295.1|  delta-12 desaturase                                     202   7e-76   Brassica nigra
gb|ABF70296.1|  delta-12 desaturase                                     202   7e-76   Brassica oleracea
gb|ABF70307.1|  delta-12 desaturase                                     201   1e-75   Erysimum cheiri [wallflower]
gb|ABF70326.1|  delta-12 desaturase                                     200   1e-75   Rorippa indica
gb|EYU46325.1|  hypothetical protein MIMGU_mgv1a008048mg                197   1e-75   Erythranthe guttata [common monkey flower]
gb|ABF70287.1|  delta-12 desaturase                                     199   1e-75   Arabidopsis thaliana [mouse-ear cress]
gb|ABF70300.1|  delta-12 desaturase                                     199   2e-75   Barbarea vulgaris [upland cress]
gb|ABF70327.1|  delta-12 desaturase                                     201   2e-75   Raphanus sativus
gb|EYU39931.1|  hypothetical protein MIMGU_mgv1a008167mg                198   3e-75   Erythranthe guttata [common monkey flower]
gb|ACJ66779.1|  omega-6 desaturase                                      184   3e-75   Portulaca oleracea
gb|ABF70288.1|  delta-12 desaturase                                     200   3e-75   Brassica carinata [Abyssinian mustard]
gb|AFJ19029.1|  fatty acid desaturase BnaA.fad2.a-SW_Hickory mutant     185   3e-75   Brassica napus [oilseed rape]
gb|ABL86147.1|  delta-12 oleic acid desaturase                          177   4e-75   Vernicia montana
gb|AEK67593.1|  omega-6 fatty acid desaturase                           189   4e-75   Citrus medica var. sarcodactylis
gb|ABF70314.1|  delta-12 desaturase                                     202   4e-75   Crambe kralikii
gb|ABF70298.1|  delta-12 desaturase                                     199   5e-75   Brassica rapa var. purpuraria [purple stem mustard]
gb|AFJ53123.1|  fatty acid desaturase 2-2                               205   5e-75   Linum usitatissimum
gb|ABF70305.1|  delta-12 desaturase                                     201   5e-75   Capsella bursa-pastoris
gb|KJB15034.1|  hypothetical protein B456_002G156600                    201   5e-75   Gossypium raimondii
ref|XP_010105456.1|  Omega-6 fatty acid desaturase, endoplasmic r...    183   5e-75   Morus notabilis
gb|ABF70306.1|  delta-12 desaturase                                     200   5e-75   Capsella bursa-pastoris
gb|ABF70328.1|  delta-12 desaturase                                     198   8e-75   Sinapis alba [bai jie]
gb|AIN52150.1|  fatty acid desaturase-2                                 194   9e-75   Camellia oleifera [abura-tsubaki]
gb|ABF70317.1|  delta-12 desaturase                                     201   1e-74   Eruca vesicaria subsp. sativa [arugula]
gb|ACA14461.1|  oleate desaturase                                       196   2e-74   Caragana korshinskii
gb|ABF70316.1|  delta-12 desaturase                                     202   2e-74   
gb|ACA14460.1|  oleate desaturase                                       196   2e-74   Caragana korshinskii
gb|ABF70323.1|  delta-12 desaturase                                     201   3e-74   Lepidium virginicum
gb|ABF70310.1|  delta-12 desaturase                                     199   3e-74   Cardamine hirsuta
gb|AIE48273.1|  omega-6 fatty acid desaturase                           191   3e-74   Rhus chinensis
gb|AFJ53122.1|  fatty acid desaturase 2-2                               205   3e-74   Linum usitatissimum
gb|ABF70315.1|  delta-12 desaturase                                     198   3e-74   Crambe maritima
gb|ABF70325.1|  delta-12 desaturase                                     199   4e-74   Rorippa indica
gb|ACZ06072.1|  microsomal omega-6 fatty acid desaturase                182   7e-74   Arachis hypogaea [goober]
ref|XP_002297660.2|  microsomal omega-6 desaturase family protein       200   1e-73   
gb|AEW43691.1|  fatty acid desaturase 2                                 190   1e-73   Jatropha curcas
gb|ABF70318.1|  delta-12 desaturase                                     198   1e-73   Eruca vesicaria subsp. sativa [arugula]
gb|ACR83861.1|  omega-6 fatty acid desaturase                           184   1e-73   Portulaca oleracea
gb|AAK26633.1|AF343065_1  delta-12 fatty acid desaturase FAD2           179   1e-73   Calendula officinalis [common marigold]
gb|ABF70322.1|  delta-12 desaturase                                     203   1e-73   Physaria fendleri
gb|AFK12604.1|  fad2-3                                                  202   1e-73   Helianthus annuus
gb|AIA21665.1|  oleate desaturase                                       181   2e-73   Crambe kralikii
gb|AIA21654.1|  oleate desaturase                                       202   2e-73   Crambe filiformis
gb|AFK12607.1|  fad2-3                                                  202   2e-73   Helianthus annuus
gb|AFK12603.1|  fad2-3                                                  202   2e-73   Helianthus annuus
ref|XP_006366157.1|  PREDICTED: omega-6 fatty acid desaturase, en...    184   3e-73   Solanum tuberosum [potatoes]
gb|AFK12596.1|  fad2-3                                                  202   4e-73   Helianthus annuus
gb|AIA21658.1|  oleate desaturase                                       202   4e-73   Crambe filiformis
gb|AFK12600.1|  fad2-3                                                  202   4e-73   Helianthus annuus
gb|AIA21659.1|  oleate desaturase                                       201   5e-73   Crambe filiformis
gb|AAL23676.1|  delta-12 fatty acid desaturase                          193   5e-73   Persea americana
gb|AFK12595.1|  fad2-3                                                  202   5e-73   Helianthus petiolaris
ref|XP_002299149.1|  microsomal omega-6 desaturase family protein       190   5e-73   
gb|ABC00770.1|  delta-12 fatty acid desaturase type 02                  196   8e-73   Crepis alpina
ref|XP_008344778.1|  PREDICTED: omega-6 fatty acid desaturase, en...    187   1e-72   
gb|AAV52834.1|  delta-12 fatty acid desaturase                          180   1e-72   Tropaeolum majus
gb|AIA21651.1|  oleate desaturase                                       202   2e-72   Crambe filiformis
ref|XP_011037927.1|  PREDICTED: omega-6 fatty acid desaturase, en...    194   2e-72   Populus euphratica
emb|CAN73788.1|  hypothetical protein VITISV_002517                     184   2e-72   Vitis vinifera
gb|AGC65498.1|  FAD2-1 protein                                          193   2e-72   Carthamus tinctorius
gb|AIB55752.1|  delta-12 fatty acid desaturase                          191   2e-72   Fragaria x ananassa
ref|XP_006492661.1|  PREDICTED: omega-6 fatty acid desaturase, en...    189   2e-72   
gb|ACU51128.1|  oleate desaturase                                       188   2e-72   Arachis hypogaea [goober]
gb|AIA21656.1|  oleate desaturase                                       202   2e-72   Crambe filiformis
gb|AER27516.1|  omega 6 fatty acid desaturase                           187   2e-72   Arachis hypogaea [goober]
gb|KEH41705.1|  microsomal omega-3 fatty acid desaturase                181   3e-72   Medicago truncatula
gb|ADI46403.1|  omega-6 fatty acid desaturase                           187   3e-72   Arachis hypogaea [goober]
gb|AAY67653.1|  oleate desaturase                                       187   3e-72   Arachis hypogaea [goober]
gb|AER27513.1|  omega 6 fatty acid desaturase                           187   3e-72   Arachis hypogaea [goober]
gb|AAF82294.1|  microsomal oleate desaturase                            187   3e-72   Arachis duranensis
gb|AER27514.1|  omega 6 fatty acid desaturase                           187   3e-72   Arachis hypogaea [goober]
ref|XP_006445919.1|  hypothetical protein CICLE_v10015614mg             189   3e-72   Citrus clementina [clementine]
gb|AHV83757.1|  omega-6 fatty acid desaturase                           189   3e-72   Arachis hypogaea [goober]
ref|XP_006492662.1|  PREDICTED: omega-6 fatty acid desaturase, en...    188   3e-72   Citrus sinensis [apfelsine]
gb|AFJ53120.1|  fatty acid desaturase 2-2                               205   3e-72   Linum usitatissimum
gb|AGN95843.1|  fatty acid delta12-desturase FAD2-3                     181   4e-72   Hiptage benghalensis
gb|AGT36605.1|  oleate 12-hydroxylase/desaturase                        191   4e-72   Physaria fendleri
gb|KHN12315.1|  Omega-6 fatty acid desaturase, endoplasmic reticu...    197   4e-72   Glycine soja [wild soybean]
gb|AAK67829.1|  delta-12 fatty acid desaturase                          187   4e-72   Arachis hypogaea [goober]
gb|AAF82293.1|  microsomal oleate desaturase                            187   5e-72   Arachis hypogaea [goober]
gb|AAX14399.1|  oleate desaturase                                       187   5e-72   Arachis monticola
gb|ABF84062.1|  microsomal oleate desaturase FAD2-1B                    189   5e-72   Glycine max [soybeans]
gb|AAS57577.1|  delta12-oleic acid desaturase                           189   5e-72   Euphorbia lagascae
gb|ADX20840.1|  omega 6 fatty acid desaturase                           187   5e-72   Arachis hypogaea [goober]
gb|ADK94440.1|  delta-12 fatty acid desaturase                          190   6e-72   Carthamus tinctorius
gb|AFK12602.1|  fad2-3                                                  201   6e-72   Helianthus annuus
gb|AIA21653.1|  oleate desaturase                                       200   7e-72   Crambe filiformis
ref|XP_004497897.1|  PREDICTED: omega-6 fatty acid desaturase, en...    179   7e-72   Cicer arietinum [garbanzo]
gb|KHN11459.1|  Omega-6 fatty acid desaturase, endoplasmic reticu...    189   7e-72   Glycine soja [wild soybean]
gb|ADX20841.1|  omega 6 fatty acid desaturase                           186   9e-72   
gb|AGT36606.1|  oleate 12-hydroxylase/desaturase                        189   9e-72   
gb|AAB84262.1|  omega-6 desaturase                                      186   1e-71   
gb|ADM83591.1|  omega 6 fatty acid desaturase                           186   1e-71   
ref|XP_010044976.1|  PREDICTED: omega-6 fatty acid desaturase, en...    199   1e-71   
gb|AAL68981.1|AF251842_1  delta-12 oleate desaturase                    190   1e-71   
ref|XP_006605220.1|  PREDICTED: omega-6 fatty acid desaturase, en...    189   1e-71   
ref|XP_003555879.1|  PREDICTED: omega-6 fatty acid desaturase, en...    188   1e-71   
gb|ACF17571.1|  mutant bifunctional oleate 12-hydroxylase:desaturase    189   1e-71   
gb|AAN87574.1|  delta 12 fatty acid conjugase FADX                      180   1e-71   
gb|ADM83594.1|  omega 6 fatty acid desaturase                           185   1e-71   
ref|XP_011037925.1|  PREDICTED: omega-6 fatty acid desaturase, en...    190   2e-71   
gb|ABC00771.1|  delta-12 fatty acid desaturase type 03                  184   2e-71   
gb|KHN37429.1|  Omega-6 fatty acid desaturase, endoplasmic reticu...    189   2e-71   
ref|XP_006605885.1|  PREDICTED: omega-6 fatty acid desaturase, en...    188   2e-71   
gb|AEW67305.1|  delta-12 fatty acid desaturase                          186   2e-71   
gb|ADN86005.1|  oleate desaturase                                       185   2e-71   
gb|AEK06377.1|  microsomal oleate desaturase FAD2-8                     195   2e-71   
ref|NP_001238342.1|  omega-6 fatty acid desaturase, endoplasmic r...    189   2e-71   
gb|AIT96964.1|  FAD2 desaturase                                         176   3e-71   
gb|AAY53559.1|  oleate desaturase                                       187   3e-71   
ref|XP_007014826.1|  Microsomal oleic acid desaturase isoform 1         196   3e-71   
gb|AAC32755.1|  bifunctional oleate 12-hydroxylase:desaturase           189   3e-71   
gb|ACQ42234.1|  bifunctional oleate 12-hydroxylase:desaturase           189   3e-71   
gb|AIT96965.1|  FAD2 desaturase                                         176   3e-71   
ref|XP_004295164.1|  PREDICTED: omega-6 fatty acid desaturase, en...    194   3e-71   
gb|ACU23718.1|  unknown                                                 186   4e-71   
gb|AER27515.1|  omega 6 fatty acid desaturase                           184   4e-71   
ref|XP_006365801.1|  PREDICTED: omega-6 fatty acid desaturase, en...    181   5e-71   
gb|AHV83758.1|  omega-6 fatty acid desaturase                           184   5e-71   
gb|EPS73825.1|  delta-12 oleate desaturase                              192   6e-71   
ref|XP_009375092.1|  PREDICTED: omega-6 fatty acid desaturase, en...    187   6e-71   
gb|ACH43025.1|  omega-6 fatty acid desaturase                           186   7e-71   
gb|ABQ01458.1|  oleate 12-hydroxylase                                   188   8e-71   
gb|AAF82295.1|  microsomal oleate desaturase                            183   8e-71   
gb|ACU51129.1|  oleate desaturase                                       182   8e-71   
gb|ACP39506.1|  delta-12 oleate desaturase                              197   9e-71   
gb|AAX29989.1|  microsomal omega-6-desaturase                           189   9e-71   
gb|AFJ53119.1|  fatty acid desaturase 2-2                               205   1e-70   
ref|XP_011037924.1|  PREDICTED: omega-6 fatty acid desaturase, en...    187   1e-70   
ref|XP_006850001.1|  hypothetical protein AMTR_s00022p00172860          201   1e-70   
emb|CBI30021.3|  unnamed protein product                                158   2e-70   
ref|XP_004497140.1|  PREDICTED: omega-6 fatty acid desaturase, en...    194   2e-70   
gb|AGC65507.1|  FAD2-10 protein                                         189   2e-70   
ref|XP_011037928.1|  PREDICTED: omega-6 fatty acid desaturase, en...    198   2e-70   
emb|CDP11066.1|  unnamed protein product                                187   3e-70   
emb|CDP17522.1|  unnamed protein product                                186   3e-70   
gb|AFS17310.1|  oleyl PC desaturase                                     186   4e-70   
gb|AFC41107.1|  FAD2-2                                                  193   5e-70   
ref|XP_006346654.1|  PREDICTED: omega-6 fatty acid desaturase, en...    175   7e-70   
gb|AFJ19032.1|  fatty acid desaturase BnaC.FAD2.b                       194   1e-69   
ref|XP_006368553.1|  hypothetical protein POPTR_0001s05000g             195   2e-69   
emb|CAI48074.1|  omega-6 fatty acid desaturase                          173   2e-69   
gb|AFK12574.1|  fad2-2                                                  201   2e-69   
gb|AFK12589.1|  fad2-2                                                  201   2e-69   
gb|AFK12577.1|  fad2-2                                                  201   2e-69   
gb|AFK12573.1|  fad2-2                                                  201   2e-69   
gb|AFK12578.1|  fad2-2                                                  201   3e-69   
gb|AFK12580.1|  fad2-2                                                  201   3e-69   
gb|AFK12587.1|  fad2-2                                                  201   3e-69   
gb|AFK12581.1|  fad2-2                                                  201   3e-69   
gb|AAC24586.1|  omega-6 fatty acid desaturase                           211   4e-69   
gb|AFJ53125.1|  fatty acid desaturase 2-2                               205   4e-69   
gb|AFK12575.1|  fad2-2                                                  202   5e-69   
ref|XP_006365804.1|  PREDICTED: omega-6 fatty acid desaturase, en...    172   6e-69   
gb|ABV21586.1|  fatty acid desaturase                                   173   6e-69   
gb|AFJ53126.1|  fatty acid desaturase 2-2                               205   2e-68   
gb|AFJ53124.1|  fatty acid desaturase 2-2                               205   2e-68   
gb|AFJ53127.1|  fatty acid desaturase 2-2                               205   2e-68   
ref|XP_006647793.1|  PREDICTED: omega-6 fatty acid desaturase, en...    189   6e-68   
ref|XP_010943510.1|  PREDICTED: omega-6 fatty acid desaturase, en...    189   7e-68   
gb|AAT44123.1|  microsomal omega-6-desaturase                           185   1e-67   
gb|AAO37752.1|  delta-12 oleate desaturase                              189   2e-67   
gb|ABF70291.1|  delta-12 desaturase                                     184   2e-67   
ref|XP_004953689.1|  PREDICTED: omega-6 fatty acid desaturase, en...    179   4e-67   
ref|XP_009395096.1|  PREDICTED: omega-6 fatty acid desaturase, en...    196   5e-67   
gb|AFK12545.1|  fad2-1                                                  191   6e-67   
ref|NP_001047927.1|  Os02g0716500                                       186   6e-67   
gb|AFK12548.1|  fad2-1                                                  191   6e-67   
ref|XP_009631509.1|  PREDICTED: omega-6 fatty acid desaturase, en...    170   7e-67   
ref|XP_002528127.1|  oleate 12-hydroxylase                              179   7e-67   
gb|AGX28132.1|  omega-6 fatty acid desaturase FAD2-2A                   188   8e-67   
gb|AGN95845.1|  fatty acid delta12-hydroxylase FAH12-1                  177   8e-67   
gb|AFK12546.1|  fad2-1                                                  190   8e-67   
gb|AFK12551.1|  fad2-1                                                  190   1e-66   
gb|AGG38092.1|  omega-6 fatty acid desaturase 2 endoplasmic retic...    196   1e-66   
gb|AGX28133.1|  omega-6 fatty acid desaturase FAD2-2B                   187   1e-66   
gb|AFN53648.1|  omega-6 desaturase                                      178   1e-66   
gb|AFK12543.1|  fad2-1                                                  189   1e-66   
gb|AFK12547.1|  fad2-1                                                  189   2e-66   
gb|AGN95846.1|  fatty acid delta12-hydroxylase FAH12-2                  176   2e-66   
gb|AFK12550.1|  fad2-1                                                  189   2e-66   
gb|AFK12549.1|  fad2-1                                                  189   2e-66   
ref|XP_003570235.1|  PREDICTED: omega-6 fatty acid desaturase, en...    182   2e-66   
gb|AAC49010.1|  oleate 12-hydroxylase                                   177   3e-66   
gb|AFK12544.1|  fad2-1                                                  188   4e-66   
gb|ABK24364.1|  unknown                                                 186   4e-66   
dbj|BAJ86651.1|  predicted protein                                      183   5e-66   
ref|XP_009390650.1|  PREDICTED: omega-6 fatty acid desaturase, en...    195   5e-66   
ref|XP_006346615.1|  PREDICTED: omega-6 fatty acid desaturase, en...    168   5e-66   
gb|AEJ87847.1|  omega-6-desaturase                                      199   6e-66   
gb|AFK12542.1|  fad2-1                                                  189   7e-66   
gb|ACD39348.1|  oleate 12-hydroxylase                                   179   7e-66   
gb|AFN53644.1|  omega-6 desaturase                                      170   9e-66   
gb|AAS72902.1|  trans-delta12 oleic acid desaturase                     181   9e-66   
emb|CAB64256.1|  (8,11)-linoleoyl desaturase                            171   1e-65   
gb|AFK12582.1|  fad2-2                                                  189   1e-65   
gb|AFK12579.1|  fad2-2                                                  189   1e-65   
gb|AFK12576.1|  fad2-2                                                  189   1e-65   
gb|AFX61782.1|  omega-6 fatty acid desaturase endoplasmic reticul...    192   2e-65   
gb|AFK12541.1|  fad2-1                                                  188   3e-65   
gb|AAO37751.1|  fatty acid conjugase                                    170   4e-65   
ref|XP_006365802.1|  PREDICTED: omega-6 fatty acid desaturase, en...    159   7e-65   
gb|AFX61781.1|  omega-6 fatty acid desaturase endoplasmic reticul...    192   1e-64   
ref|XP_010673536.1|  PREDICTED: omega-6 fatty acid desaturase, en...    186   2e-64   
gb|AAO38031.1|  delta12-fatty acid acetylenase                          163   2e-64   
ref|XP_006365800.1|  PREDICTED: omega-6 fatty acid desaturase, en...    151   7e-64   
ref|XP_009383220.1|  PREDICTED: omega-6 fatty acid desaturase, en...    192   2e-63   
ref|XP_008813208.1|  PREDICTED: omega-6 fatty acid desaturase, en...    181   2e-63   
gb|ABC59684.1|  delta-12 fatty acid acetylenase                         167   2e-63   
ref|XP_009420049.1|  PREDICTED: omega-6 fatty acid desaturase, en...    191   2e-63   
gb|AAO38032.1|  delta12-fatty acid acetylenase                          166   2e-63   
gb|AGX28127.1|  omega-6 fatty acid desaturase                           174   5e-63   
gb|AAL61826.1|  putative delta12 acid desaturase                        179   5e-63   
gb|ACN58570.1|  delta-12 fatty acid desaturase                          171   6e-63   
gb|AFN53643.1|  omega-6 desaturase                                      168   1e-62   
emb|CAI48076.2|  omega-6 desaturase                                     159   1e-62   
gb|AGC65506.1|  FAD2-9 protein                                          161   1e-62   
gb|AAG23929.1|AF239833_1  ELI7.8                                        157   1e-62   
gb|EMT22277.1|  Omega-6 fatty acid desaturase, endoplasmic reticu...    182   2e-62   
gb|AAG23924.1|AF239828_1  ELI7.2                                        155   2e-62   
ref|XP_004252384.1|  PREDICTED: omega-6 fatty acid desaturase, en...    155   3e-62   
gb|AAF05916.1|AF182521_1  delta-12 oleic acid desaturase-like pro...    168   5e-62   
ref|XP_006365825.1|  PREDICTED: omega-6 fatty acid desaturase, en...    167   6e-62   
gb|AGX28130.1|  omega-6 fatty acid desaturase FAD2-1A                   177   8e-62   
ref|XP_004252861.2|  PREDICTED: omega-6 fatty acid desaturase, en...    169   9e-62   
ref|XP_010928433.1|  PREDICTED: omega-6 fatty acid desaturase, en...    168   1e-61   
gb|AAG23923.1|AF239827_1  ELI7.1                                        155   1e-61   
ref|XP_010314672.1|  PREDICTED: omega-6 fatty acid desaturase, en...    169   1e-61   
gb|AAQ08982.1|  delta-12 fatty acid desaturase                          204   2e-61   
gb|AGG38093.1|  omega-6 fatty acid desaturase 2 endoplasmic retic...    186   2e-61   
gb|AAK30206.1|AF349965_1  fatty acid desaturase/hydroxylase             156   2e-61   
gb|AFN53645.1|  omega-6 desaturase                                      166   3e-61   
gb|AFW63614.1|  omega-6 fatty acid desaturase, endoplasmic reticu...    172   3e-61   
gb|AGX28131.1|  omega-6 fatty acid desaturase FAD2-1B                   175   3e-61   
gb|AFN53646.1|  omega-6 desaturase                                      164   4e-61   
ref|XP_008677266.1|  PREDICTED: omega-6 fatty acid desaturase, en...    172   4e-61   
gb|AAG23927.1|AF239831_1  ELI7.6                                        156   4e-61   
gb|AAG24521.1|AF239835_1  fatty acid desaturase/hydroxylase-like ...    153   4e-61   
gb|AAG23928.1|AF239832_1  ELI7.7                                        156   7e-61   
ref|XP_008799208.1|  PREDICTED: omega-6 fatty acid desaturase, en...    169   9e-61   
emb|CBI16458.3|  unnamed protein product                                142   1e-60   
gb|AER10477.1|  fatty acid desaturase 2                                 202   1e-60   
ref|XP_010231291.1|  PREDICTED: LOW QUALITY PROTEIN: omega-6 fatt...    166   1e-60   
gb|AIZ94608.1|  fatty acid desaturase 4                                 203   2e-60   
gb|AAG23925.1|AF239829_1  ELI7.4                                        155   3e-60   
gb|AAG23926.1|AF239830_1  ELI7.5                                        156   4e-60   
gb|AGX28128.1|  delta13 fatty acid desaturase SaFADX                    145   6e-60   
gb|AER10476.1|  oleate desaturase                                       202   9e-60   
gb|AAC99622.1|  delta-12 desaturase                                     202   9e-60   
ref|XP_001757907.1|  predicted protein                                  181   1e-59   
gb|AAL61825.1|  putative delta12 oleic acid desaturase-related fa...    180   1e-59   
gb|EMS65425.1|  Omega-6 fatty acid desaturase, endoplasmic reticulum    161   1e-59   
gb|ACS34773.1|  omega-6 fatty acid desaturase                           149   2e-59   
ref|XP_004162092.1|  PREDICTED: omega-6 fatty acid desaturase, en...    167   2e-59   
ref|XP_004142244.1|  PREDICTED: omega-6 fatty acid desaturase, en...    167   2e-59   
gb|AAB80697.1|  fungal elicitor-induced protein                         154   3e-59   
gb|AFW73111.1|  hypothetical protein ZEAMMB73_622852                    159   3e-59   
ref|XP_006365823.1|  PREDICTED: omega-6 fatty acid desaturase, en...    153   3e-59   
gb|AFN53647.1|  omega-6 desaturase                                      163   4e-59   
gb|EMT19391.1|  Omega-6 fatty acid desaturase, endoplasmic reticu...    169   1e-58   
gb|ADP07951.1|  microsomal omega-6 desaturase                           191   3e-58   
ref|XP_006340104.1|  PREDICTED: omega-6 fatty acid desaturase, en...    157   4e-58   
ref|XP_004252862.1|  PREDICTED: omega-6 fatty acid desaturase, en...    154   5e-58   
ref|XP_011080227.1|  PREDICTED: omega-6 fatty acid desaturase, en...    199   6e-58   
ref|XP_010314673.1|  PREDICTED: omega-6 fatty acid desaturase, en...    153   6e-58   
gb|ABC00769.1|  delta-12 fatty acid acetylenase                         163   7e-58   
gb|AAS19533.1|  omega-6 fatty acid desaturase                           199   8e-58   
sp|O81931.2|FAD12_CREAL  RecName: Full=Delta(12) fatty acid dehyd...    163   8e-58   
ref|XP_001756226.1|  predicted protein                                  181   8e-58   
ref|NP_001059467.2|  Os07g0417200                                       166   1e-57   
gb|AAF05915.1|  delta-12 oleic acid desaturase-like protein             157   1e-57   
ref|XP_011080226.1|  PREDICTED: omega-6 fatty acid desaturase, en...    200   2e-57   
ref|XP_008449949.1|  PREDICTED: omega-6 fatty acid desaturase, en...    171   3e-57   
dbj|BAC45173.1|  putative delta 12 oleic acid desaturase                166   3e-57   
gb|EAZ03615.1|  hypothetical protein OsI_25754                          166   3e-57   
gb|AGX28129.1|  delta12-FADS-like FADY                                  148   4e-57   
ref|XP_004237336.1|  PREDICTED: omega-6 fatty acid desaturase, en...    154   7e-57   
emb|CAA76156.1|  delta 12 fatty acid epoxygenase                        161   2e-56   
dbj|BAK04289.1|  predicted protein                                      156   2e-56   
gb|AGX28136.1|  delta13 fatty acid desaturase FADX-2                    147   2e-56   
ref|XP_006346614.1|  PREDICTED: omega-6 fatty acid desaturase, en...    159   3e-56   
gb|AAG23930.1|AF239834_1  ELI7.9                                        152   4e-56   
dbj|BAD89863.1|  microsomal omega-6 fatty acid desaturase               193   5e-56   
ref|NP_001234242.1|  lipid desaturase-like protein                      137   1e-55   
gb|AGC65505.1|  FAD2-8 protein                                          158   2e-55   
gb|AAF03100.1|AF162199_1  oleate 12-hydroxylase                         153   4e-55   
gb|ADM48790.1|  microsomal oleate desaturase                            140   6e-55   
gb|AGC65500.1|  FAD2-3 protein                                          140   6e-55   
ref|XP_009417293.1|  PREDICTED: omega-6 fatty acid desaturase, en...    190   2e-54   
gb|AGX28134.1|  delta13 fatty acid desaturase FADX-1A                   140   3e-54   
ref|XP_008662593.1|  PREDICTED: omega-6 fatty acid desaturase, en...    159   6e-54   
gb|AAO38036.1|  delta12-fatty acid acetylenase                          168   8e-54   
gb|AGC65501.1|  FAD2-4 protein                                          140   8e-54   
gb|AEQ28965.1|  omega-6 desaturase                                      132   2e-53   
ref|XP_007142866.1|  hypothetical protein PHAVU_007G0234001g            186   3e-53   
gb|EMT15024.1|  Omega-6 fatty acid desaturase, endoplasmic reticu...    155   4e-53   
gb|AGX28135.1|  delta13 fatty acid desaturase FADX-1B                   138   4e-53   
gb|AAR23815.1|  delta 12 fatty acid epoxygenase                         159   2e-52   
gb|EAZ03630.1|  hypothetical protein OsI_25766                          146   2e-52   
gb|AAO38035.1|  delta12-fatty acid acetylenase                          166   2e-52   
ref|NP_001059466.1|  Os07g0416900                                       147   2e-52   
ref|XP_007206964.1|  hypothetical protein PRUPE_ppb018818mg             160   3e-52   
gb|AGX28138.1|  delta12-FADS-like FADY-B                                151   4e-52   
gb|AGX28137.1|  delta12-FADS-like FADY-A                                151   6e-52   
gb|AGN95844.1|  fatty acid delta12-desturase FAD2-4                     181   7e-52   
gb|AEK06374.1|  microsomal oleate desaturase FAD2-5                     136   1e-51   
gb|AAK67830.1|AF248740_1  truncated delta-12 fatty acid desaturase      118   2e-51   
gb|KJB83457.1|  hypothetical protein B456_013G248700                    179   3e-51   
ref|XP_008350272.1|  PREDICTED: omega-6 fatty acid desaturase, en...    180   3e-51   
gb|AAO38037.1|  delta12-fatty acid acetylenase                          169   3e-51   



>gb|AGH32914.1| fatty acid desaturase [Camellia chekiangoleosa]
Length=383

 Score =   211 bits (537),  Expect(2) = 4e-88, Method: Compositional matrix adjust.
 Identities = 96/112 (86%), Positives = 105/112 (94%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YWICQGCVLTGVWV+AHECGHHAFSDYQWLDDTVGL+LHSALLVP+FSWKYSHRRHHSN
Sbjct  88   VYWICQGCVLTGVWVVAHECGHHAFSDYQWLDDTVGLVLHSALLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            T SLERDEVFVPK KS +GW++KYLNNPPGR  T++I LTL WPLYLMFNVS
Sbjct  148  TASLERDEVFVPKLKSSIGWYSKYLNNPPGRILTVIITLTLGWPLYLMFNVS  199


 Score =   141 bits (356),  Expect(2) = 4e-88, Method: Compositional matrix adjust.
 Identities = 68/86 (79%), Positives = 76/86 (88%), Gaps = 1/86 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM+VP EGK S +D ++RVPY+KPPFT+GEIKKAIPPHCF+RSVL SFSYVVYDL
Sbjct  1    MGAGGRMSVPPEGKKSDRDVIRRVPYSKPPFTVGEIKKAIPPHCFRRSVLHSFSYVVYDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAW  374
            IIA   YY+ATNY HLLP PLSYLAW
Sbjct  61   IIAFLFYYLATNYIHLLPQPLSYLAW  86



>gb|AFK31315.1| fatty acid desaturase [Camellia oleifera]
Length=383

 Score =   211 bits (536),  Expect(2) = 5e-88, Method: Compositional matrix adjust.
 Identities = 96/112 (86%), Positives = 105/112 (94%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YWICQGCVLTGVWV+AHECGHHAFSDYQWLDDTVGL+LHSALLVP+FSWKYSHRRHHSN
Sbjct  88   VYWICQGCVLTGVWVVAHECGHHAFSDYQWLDDTVGLVLHSALLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            T SLERDEVFVPK KS +GW++KYLNNPPGR  T++I LTL WPLYLMFNVS
Sbjct  148  TASLERDEVFVPKLKSSVGWYSKYLNNPPGRILTVVITLTLGWPLYLMFNVS  199


 Score =   141 bits (356),  Expect(2) = 5e-88, Method: Compositional matrix adjust.
 Identities = 68/86 (79%), Positives = 76/86 (88%), Gaps = 1/86 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM+VP EGK S +D ++RVPY+KPPFT+GEIKKAIPPHCF+RSVL SFSYVVYDL
Sbjct  1    MGAGGRMSVPPEGKKSDRDVIRRVPYSKPPFTVGEIKKAIPPHCFRRSVLHSFSYVVYDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAW  374
            IIA   YY+ATNY HLLP PLSYLAW
Sbjct  61   IIAFLFYYLATNYIHLLPQPLSYLAW  86



>ref|XP_009592981.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Nicotiana tomentosiformis]
 ref|XP_009592982.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Nicotiana tomentosiformis]
Length=384

 Score =   206 bits (525),  Expect(2) = 6e-88, Method: Compositional matrix adjust.
 Identities = 95/112 (85%), Positives = 102/112 (91%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYWICQGC LTGVWVIAHECGHHAFSDYQWLDDTVGL+LHSALLVP+FSWKYSHRRHHSN
Sbjct  88   LYWICQGCNLTGVWVIAHECGHHAFSDYQWLDDTVGLVLHSALLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGS++RDEVFVPK KS + W + YLNNPPGR   LL+QLTL WPLYLMFNVS
Sbjct  148  TGSMDRDEVFVPKVKSSISWFSTYLNNPPGRILILLVQLTLGWPLYLMFNVS  199


 Score =   145 bits (366),  Expect(2) = 6e-88, Method: Compositional matrix adjust.
 Identities = 70/88 (80%), Positives = 78/88 (89%), Gaps = 1/88 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM+VP+EGK SK D LQRVP++KPPFT+GEIKKAIPPHCF+RSVL SFSYVVYDL
Sbjct  1    MGAGGRMSVPSEGKKSKSDVLQRVPHSKPPFTVGEIKKAIPPHCFKRSVLHSFSYVVYDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWPF  380
             IA  LYY ATNYFHLLP+ LSY+AWP 
Sbjct  61   TIAFLLYYAATNYFHLLPYNLSYIAWPL  88



>ref|XP_011075145.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
[Sesamum indicum]
Length=383

 Score =   210 bits (535),  Expect(2) = 1e-87, Method: Compositional matrix adjust.
 Identities = 97/112 (87%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVP+FSWKYSHRRHHSN
Sbjct  88   LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK KS + W AKY+NNPPGR   L++Q TL WPLYL+FNVS
Sbjct  148  TGSLERDEVFVPKVKSGIRWFAKYMNNPPGRVLMLIVQFTLGWPLYLLFNVS  199


 Score =   140 bits (353),  Expect(2) = 1e-87, Method: Compositional matrix adjust.
 Identities = 69/88 (78%), Positives = 75/88 (85%), Gaps = 1/88 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM+VP EGK SK D  QRVP++KPPFTLGE+KKAIPPHCFQRS+ RSFSYV+YDL
Sbjct  1    MGAGGRMSVPPEGKKSKSDAFQRVPHSKPPFTLGELKKAIPPHCFQRSIPRSFSYVIYDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWPF  380
             IAS  YYVATNYFHLLP  LS LAWP 
Sbjct  61   AIASLFYYVATNYFHLLPPSLSCLAWPL  88



>emb|CDP10136.1| unnamed protein product [Coffea canephora]
Length=458

 Score =   218 bits (554),  Expect(2) = 2e-87, Method: Compositional matrix adjust.
 Identities = 101/112 (90%), Positives = 105/112 (94%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVP+FSWKYSHRRHHSN
Sbjct  163  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPYFSWKYSHRRHHSN  222

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK KS+L W AK+LNNPPGR  TL +QLTL WPLYLMFNVS
Sbjct  223  TGSLERDEVFVPKAKSNLKWSAKFLNNPPGRVLTLAVQLTLGWPLYLMFNVS  274


 Score =   132 bits (333),  Expect(2) = 2e-87, Method: Compositional matrix adjust.
 Identities = 64/88 (73%), Positives = 71/88 (81%), Gaps = 1/88 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM V  E K SK D L RVPY+KPPFT+G++KKAIPPHCF+RSV+RSFSYV YDL
Sbjct  76   MGAGGRMNVSTEAKRSKSDVLNRVPYSKPPFTVGDVKKAIPPHCFKRSVIRSFSYVFYDL  135

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWPF  380
             IAS  YYVAT Y  LLP PLS+LAWP 
Sbjct  136  AIASLFYYVATTYIPLLPQPLSFLAWPL  163



>ref|XP_009800247.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Nicotiana sylvestris]
Length=384

 Score =   206 bits (525),  Expect(2) = 3e-87, Method: Compositional matrix adjust.
 Identities = 95/112 (85%), Positives = 102/112 (91%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYWICQGC LTGVWVIAHECGHHAFSDYQWLDDTVGL+LHSALLVP+FSWKYSHRRHHSN
Sbjct  88   LYWICQGCNLTGVWVIAHECGHHAFSDYQWLDDTVGLVLHSALLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGS++RDEVFVPK KS + W + YLNNPPGR   LL+QLTL WPLYLMFNVS
Sbjct  148  TGSMDRDEVFVPKVKSGISWFSTYLNNPPGRILILLVQLTLGWPLYLMFNVS  199


 Score =   143 bits (360),  Expect(2) = 3e-87, Method: Compositional matrix adjust.
 Identities = 68/88 (77%), Positives = 78/88 (89%), Gaps = 1/88 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQDL-QRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM+VP+EGK S+ D+ QRVP++KPPFT+GEIKKAIPPHCF+RSVL SFSYVVYDL
Sbjct  1    MGAGGRMSVPSEGKKSQSDVFQRVPHSKPPFTVGEIKKAIPPHCFKRSVLNSFSYVVYDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWPF  380
             IA  LYY ATNYFHLLP+ LSY+AWP 
Sbjct  61   TIAFLLYYAATNYFHLLPYNLSYIAWPL  88



>gb|ADK47520.1| microsomal oleic acid desaturase [Wrightia tinctoria]
Length=383

 Score =   213 bits (541),  Expect(2) = 2e-86, Method: Compositional matrix adjust.
 Identities = 98/112 (88%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYWICQGC+LTGVWVIAHECGHHAFSDYQWLDDTVGL+LHSALLVP+FSWKYSHRRHHSN
Sbjct  88   LYWICQGCILTGVWVIAHECGHHAFSDYQWLDDTVGLVLHSALLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK KS++ W  KYLNNPPGR  TL+ QLTL WPLYLMFNVS
Sbjct  148  TGSLERDEVFVPKVKSNVRWFGKYLNNPPGRVLTLVFQLTLGWPLYLMFNVS  199


 Score =   134 bits (338),  Expect(2) = 2e-86, Method: Compositional matrix adjust.
 Identities = 64/88 (73%), Positives = 73/88 (83%), Gaps = 1/88 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQDL-QRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM +P EGK +K  +  RVPY+KPPF+LGEIKKAIPPHCFQRSVL SFSYV++DL
Sbjct  1    MGAGGRMNIPHEGKKTKSGVPGRVPYSKPPFSLGEIKKAIPPHCFQRSVLTSFSYVIFDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWPF  380
             IAS  YY+ATNY  LLPHP +YLAWP 
Sbjct  61   AIASLFYYIATNYIPLLPHPFAYLAWPL  88



>ref|XP_006349589.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum-like 
[Solanum tuberosum]
Length=384

 Score =   204 bits (519),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 102/112 (91%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYWICQGC LTGVWVIAHECGHHAFSDYQWLDDTVGL+LHS+LLVP+FSWKYSHRRHHSN
Sbjct  88   LYWICQGCNLTGVWVIAHECGHHAFSDYQWLDDTVGLVLHSSLLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGS++RDEVFVPK KS + W + YLNNPPGR   L++QLTL WPLYLMFNVS
Sbjct  148  TGSMDRDEVFVPKLKSSMKWFSTYLNNPPGRILILVVQLTLGWPLYLMFNVS  199


 Score =   139 bits (351),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 64/88 (73%), Positives = 78/88 (89%), Gaps = 1/88 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM+ P+EG  S+ D LQRVP++KPPFT+G++KKAIPPHCF+RSVL SFS+V+YDL
Sbjct  1    MGAGGRMSTPSEGNKSQSDVLQRVPHSKPPFTVGDVKKAIPPHCFKRSVLHSFSFVLYDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWPF  380
            +IA  LYYVATNYFHLLP+ LSY+AWP 
Sbjct  61   VIAFLLYYVATNYFHLLPYNLSYVAWPL  88



>gb|AEI60128.1| microsomal delta-12 oleate desaturase [Vitis labrusca]
Length=382

 Score =   205 bits (522),  Expect(2) = 1e-84, Method: Compositional matrix adjust.
 Identities = 96/112 (86%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YW  QGC+LTGVWVIAHECGHHAFSDYQWLDDTVGLILHS+LLVP+FSWKYSHRRHHSN
Sbjct  88   IYWAFQGCILTGVWVIAHECGHHAFSDYQWLDDTVGLILHSSLLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLE+DEVFVPK KS LGW++KYLNNP GR  TL IQLTL WPLYLMFNVS
Sbjct  148  TGSLEKDEVFVPKTKSKLGWYSKYLNNPLGRFVTLTIQLTLGWPLYLMFNVS  199


 Score =   135 bits (341),  Expect(2) = 1e-84, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 73/87 (84%), Gaps = 1/87 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQDL-QRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM+ P   K S+ D+ QR P++KP FTL ++KKAIPPHCFQRSVLRSFSYVV DL
Sbjct  1    MGAGGRMSAPPSAKKSEADIVQRAPHSKPQFTLSQLKKAIPPHCFQRSVLRSFSYVVSDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWP  377
              AS LYY+ATNYFHLLPHPLSYLAWP
Sbjct  61   TWASLLYYIATNYFHLLPHPLSYLAWP  87



>ref|XP_004234773.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Solanum lycopersicum]
 ref|XP_010317872.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Solanum lycopersicum]
Length=384

 Score =   203 bits (516),  Expect(2) = 2e-84, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 102/112 (91%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYWICQGC LTGVWVIAHECGHHAFSDYQWLDDTVGL+LHS+LLVP+FSWKYSHRRHHSN
Sbjct  88   LYWICQGCNLTGVWVIAHECGHHAFSDYQWLDDTVGLVLHSSLLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGS++RDEVFVPK+KS + W + YLNN PGR   L++QLTL WPLYLMFNVS
Sbjct  148  TGSMDRDEVFVPKKKSSMKWFSTYLNNSPGRILVLVVQLTLGWPLYLMFNVS  199


 Score =   137 bits (345),  Expect(2) = 2e-84, Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 78/88 (89%), Gaps = 1/88 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM+ P+EG  S+ + LQRVP++KPPFT+G++KKAIPPHCF+RSVL SFS+V+YDL
Sbjct  1    MGAGGRMSTPSEGNKSQSNVLQRVPHSKPPFTVGDVKKAIPPHCFKRSVLHSFSFVLYDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWPF  380
            ++A  LYYVATNYFHLLP+ LSY+AWP 
Sbjct  61   VVAFLLYYVATNYFHLLPYNLSYVAWPL  88



>ref|XP_010520034.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isoform X1 [Tarenaya hassleriana]
Length=437

 Score =   211 bits (536),  Expect(2) = 2e-84, Method: Compositional matrix adjust.
 Identities = 97/112 (87%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW CQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  142  LYWACQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLIFHSLLLVPYFSWKYSHRRHHSN  201

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLE+DEVFVPKQKSD+GW++KYLNNP GR  TL +QL L WPLYLMFNVS
Sbjct  202  TGSLEKDEVFVPKQKSDIGWYSKYLNNPLGRVMTLTVQLVLGWPLYLMFNVS  253


 Score =   129 bits (324),  Expect(2) = 2e-84, Method: Compositional matrix adjust.
 Identities = 62/89 (70%), Positives = 72/89 (81%), Gaps = 1/89 (1%)
 Frame = +3

Query  117  KMGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYD  293
             MGAGGRM VP+  K S+ D L+RVP AKPPF LG++KKAIPPHCF+RS+ RSFSY++ D
Sbjct  54   NMGAGGRMQVPSSSKKSESDALKRVPCAKPPFALGDLKKAIPPHCFKRSIPRSFSYLICD  113

Query  294  LIIASSLYYVATNYFHLLPHPLSYLAWPF  380
            L+IAS  YYVAT YF LLP PLSYLAWP 
Sbjct  114  LVIASCFYYVATAYFSLLPQPLSYLAWPL  142



>gb|AGJ01133.1| fatty acid desaturase 2-1 [Linum usitatissimum]
Length=382

 Score =   205 bits (522),  Expect(2) = 3e-84, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YW CQGCVLTGVWV+AHECGHHAFSDYQWLDD VG +LHS L+VP+FSWK+SHRRHHSN
Sbjct  87   IYWACQGCVLTGVWVLAHECGHHAFSDYQWLDDLVGFVLHSCLMVPYFSWKHSHRRHHSN  146

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPKQKS +GWH+KYLNNPPGR  TL + LTL WPLYL FNVS
Sbjct  147  TGSLERDEVFVPKQKSAIGWHSKYLNNPPGRVLTLAVTLTLGWPLYLAFNVS  198


 Score =   134 bits (336),  Expect(2) = 3e-84, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDLI  299
            MGAGGRMAVP   K   +  +R PY+KPPFTLGEIKKAIPPHCF+RS+ RSFSYV YDL 
Sbjct  1    MGAGGRMAVPPSNKADSETFKRSPYSKPPFTLGEIKKAIPPHCFKRSIPRSFSYVAYDLT  60

Query  300  IASSLYYVATNYFHLLPHPLSYLAWP  377
            IA+  YY+AT Y HLLP+PLSY+AWP
Sbjct  61   IAAIFYYIATTYIHLLPNPLSYVAWP  86



>ref|XP_010520035.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isoform X2 [Tarenaya hassleriana]
 ref|XP_010520036.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isoform X2 [Tarenaya hassleriana]
Length=383

 Score =   210 bits (534),  Expect(2) = 4e-84, Method: Compositional matrix adjust.
 Identities = 97/112 (87%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW CQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  88   LYWACQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLIFHSLLLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLE+DEVFVPKQKSD+GW++KYLNNP GR  TL +QL L WPLYLMFNVS
Sbjct  148  TGSLEKDEVFVPKQKSDIGWYSKYLNNPLGRVMTLTVQLVLGWPLYLMFNVS  199


 Score =   129 bits (323),  Expect(2) = 4e-84, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 74/95 (78%), Gaps = 1/95 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM VP+  K S+ D L+RVP AKPPF LG++KKAIPPHCF+RS+ RSFSY++ DL
Sbjct  1    MGAGGRMQVPSSSKKSESDALKRVPCAKPPFALGDLKKAIPPHCFKRSIPRSFSYLICDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWPFTGSARAV  401
            +IAS  YYVAT YF LLP PLSYLAWP   + +  
Sbjct  61   VIASCFYYVATAYFSLLPQPLSYLAWPLYWACQGC  95



>gb|ACF49507.1| omega-6 desaturase [Linum usitatissimum]
Length=382

 Score =   205 bits (522),  Expect(2) = 5e-84, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YW CQGCVLTGVWV+AHECGHHAFSDYQWLDD VG +LHS L+VP+FSWK+SHRRHHSN
Sbjct  87   IYWACQGCVLTGVWVLAHECGHHAFSDYQWLDDLVGFVLHSCLMVPYFSWKHSHRRHHSN  146

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPKQKS +GWH+KYLNNPPGR  TL + LTL WPLYL FNVS
Sbjct  147  TGSLERDEVFVPKQKSAIGWHSKYLNNPPGRVLTLAVTLTLGWPLYLAFNVS  198


 Score =   133 bits (335),  Expect(2) = 5e-84, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDLI  299
            MGAGGRMAVP   K   +  +R PY+KPPFTLGEIKKA+PPHCF+RS+ RSFSYV YDL 
Sbjct  1    MGAGGRMAVPPSNKADSETFKRSPYSKPPFTLGEIKKAVPPHCFKRSIPRSFSYVAYDLT  60

Query  300  IASSLYYVATNYFHLLPHPLSYLAWP  377
            IA+  YY+AT Y HLLP+PLSY+AWP
Sbjct  61   IAAIFYYIATTYIHLLPNPLSYVAWP  86



>emb|CAN71892.1| hypothetical protein VITISV_040865 [Vitis vinifera]
Length=382

 Score =   205 bits (522),  Expect(2) = 8e-84, Method: Compositional matrix adjust.
 Identities = 96/112 (86%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YW  QGC+LTGVWVIAHECGHHAFSDYQWLDDTVGLILHS+LLVP+FSWKYSHRRHHSN
Sbjct  88   IYWAFQGCILTGVWVIAHECGHHAFSDYQWLDDTVGLILHSSLLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLE+DEVFVPK KS LGW++KYLNNP GR  TL IQLTL WPLYLMFNVS
Sbjct  148  TGSLEKDEVFVPKTKSKLGWYSKYLNNPLGRFVTLTIQLTLGWPLYLMFNVS  199


 Score =   133 bits (334),  Expect(2) = 8e-84, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 72/87 (83%), Gaps = 1/87 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQDL-QRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM+ P   K S+ D+ QR P++KP FTL ++KKAIPPHCFQRSVL SFSYV+ DL
Sbjct  1    MGAGGRMSAPPSAKKSEADIVQRAPHSKPQFTLSQLKKAIPPHCFQRSVLHSFSYVISDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWP  377
              AS LYY+ATNYFHLLPHPLSYLAWP
Sbjct  61   TWASLLYYIATNYFHLLPHPLSYLAWP  87



>ref|XP_002279239.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2 [Vitis vinifera]
Length=382

 Score =   205 bits (522),  Expect(2) = 8e-84, Method: Compositional matrix adjust.
 Identities = 96/112 (86%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YW  QGC+LTGVWVIAHECGHHAFSDYQWLDDTVGLILHS+LLVP+FSWKYSHRRHHSN
Sbjct  88   IYWAFQGCILTGVWVIAHECGHHAFSDYQWLDDTVGLILHSSLLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLE+DEVFVPK KS LGW++KYLNNP GR  TL IQLTL WPLYLMFNVS
Sbjct  148  TGSLEKDEVFVPKTKSKLGWYSKYLNNPLGRFVTLTIQLTLGWPLYLMFNVS  199


 Score =   133 bits (334),  Expect(2) = 8e-84, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 72/87 (83%), Gaps = 1/87 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQDL-QRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM+ P   K S+ D+ QR P++KP FTL ++KKAIPPHCFQRSVL SFSYV+ DL
Sbjct  1    MGAGGRMSAPPSAKKSEADIVQRAPHSKPQFTLSQLKKAIPPHCFQRSVLHSFSYVISDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWP  377
              AS LYY+ATNYFHLLPHPLSYLAWP
Sbjct  61   TWASLLYYIATNYFHLLPHPLSYLAWP  87



>ref|XP_006407366.1| hypothetical protein EUTSA_v10020910mg [Eutrema salsugineum]
 ref|XP_006407367.1| hypothetical protein EUTSA_v10020910mg [Eutrema salsugineum]
 ref|XP_006407368.1| hypothetical protein EUTSA_v10020910mg [Eutrema salsugineum]
 gb|ESQ48819.1| hypothetical protein EUTSA_v10020910mg [Eutrema salsugineum]
 gb|ESQ48820.1| hypothetical protein EUTSA_v10020910mg [Eutrema salsugineum]
 gb|ESQ48821.1| hypothetical protein EUTSA_v10020910mg [Eutrema salsugineum]
Length=383

 Score =   204 bits (518),  Expect(2) = 1e-83, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW+CQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  88   LYWVCQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPKQKS + W+ KYLNNP GR   L++Q TL WPLYL FNVS
Sbjct  148  TGSLERDEVFVPKQKSAIKWYGKYLNNPLGRTVMLIVQFTLGWPLYLAFNVS  199


 Score =   133 bits (335),  Expect(2) = 1e-83, Method: Compositional matrix adjust.
 Identities = 63/88 (72%), Positives = 73/88 (83%), Gaps = 1/88 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM+VP   K S+ D L+RVP   PPFTLGE+KKAIPPHCF+RS+ RSFSY+++D+
Sbjct  1    MGAGGRMSVPTSSKKSETDGLKRVPCETPPFTLGELKKAIPPHCFKRSIPRSFSYLIWDI  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWPF  380
            IIAS  YYVATNYF LLP PLSYLAWP 
Sbjct  61   IIASCFYYVATNYFSLLPQPLSYLAWPL  88



>gb|AAW63041.1| microsomal delta-12 oleate desaturase [Olea europaea]
Length=383

 Score =   205 bits (521),  Expect(2) = 4e-83, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = +2

Query  368  GMALYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRH  547
            G  LYWICQGCVLTGVWV+AHECGHHAFSDYQWLDDTVGLILHS+LLVP+FSWKYSHRRH
Sbjct  85   GWLLYWICQGCVLTGVWVVAHECGHHAFSDYQWLDDTVGLILHSSLLVPYFSWKYSHRRH  144

Query  548  HSNTGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            HSNTGSLERDEVFVP+ KS + W +K LNNPPGR   L+ QLTL WPLYLMFNVS
Sbjct  145  HSNTGSLERDEVFVPRVKSGIRWISKNLNNPPGRVLLLVFQLTLGWPLYLMFNVS  199


 Score =   130 bits (328),  Expect(2) = 4e-83, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 71/86 (83%), Gaps = 1/86 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM++P EGK SK D +QRVP +KP F+LG+IKKAIPPHCFQRSVLRSFSYVVYDL
Sbjct  1    MGAGGRMSIPPEGKKSKSDVIQRVPQSKPQFSLGDIKKAIPPHCFQRSVLRSFSYVVYDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAW  374
             IAS L YVA+ Y   LP+PLSY  W
Sbjct  61   TIASLLCYVASTYIQFLPNPLSYFGW  86



>gb|AAL93620.1| fatty acid desaturase 2 [Olea europaea subsp. europaea]
Length=383

 Score =   204 bits (520),  Expect(2) = 5e-83, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = +2

Query  368  GMALYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRH  547
            G  LYWICQGCVLTGVWV+AHECGHHAFSDYQWLDDTVGLILHS+LLVP+FSWKYSHRRH
Sbjct  85   GWLLYWICQGCVLTGVWVVAHECGHHAFSDYQWLDDTVGLILHSSLLVPYFSWKYSHRRH  144

Query  548  HSNTGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            HSNTGSLERDEVFVP+ KS + W +K LNNPPGR   L+ QLTL WPLYLMFNVS
Sbjct  145  HSNTGSLERDEVFVPRVKSGIRWISKNLNNPPGRVLLLVFQLTLGWPLYLMFNVS  199


 Score =   131 bits (329),  Expect(2) = 5e-83, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 71/86 (83%), Gaps = 1/86 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM+VP EGK SK D +QRVP++KP F+LG+IKKAIPPHCFQRSVLRSFSYVVYDL
Sbjct  1    MGAGGRMSVPPEGKKSKSDVIQRVPHSKPQFSLGDIKKAIPPHCFQRSVLRSFSYVVYDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAW  374
             IAS L YVA+ Y   LP+PL Y  W
Sbjct  61   TIASLLCYVASTYIQFLPNPLCYFGW  86



>emb|CAA63432.1| D12 oleate desaturase [Solanum commersonii]
Length=383

 Score =   206 bits (525),  Expect(2) = 6e-83, Method: Compositional matrix adjust.
 Identities = 95/112 (85%), Positives = 102/112 (91%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YWICQGCV TG+WV AHECGHHAFSDYQW+DDTVGLILHSALLVP+FSWKYSHRRHHSN
Sbjct  88   IYWICQGCVCTGIWVNAHECGHHAFSDYQWVDDTVGLILHSALLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK KS LGW++KYLNNPPGR  +L I LTL WPLYL FNVS
Sbjct  148  TGSLERDEVFVPKPKSQLGWYSKYLNNPPGRVLSLTITLTLGWPLYLAFNVS  199


 Score =   129 bits (323),  Expect(2) = 6e-83, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 72/87 (83%), Gaps = 1/87 (1%)
 Frame = +3

Query  120  MGAGGRMAVP-AEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM+ P  E ++ +  LQ+VP +KPPFT+G+IKKAIPPHCFQRS++RSFSYVVYDL
Sbjct  1    MGAGGRMSAPNGETEVKRNPLQKVPTSKPPFTVGDIKKAIPPHCFQRSLIRSFSYVVYDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWP  377
            I+ S +YYVA  YFHLLP P  Y+AWP
Sbjct  61   ILVSIMYYVANTYFHLLPSPYCYIAWP  87



>ref|XP_006354202.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Solanum tuberosum]
Length=383

 Score =   207 bits (526),  Expect(2) = 8e-83, Method: Compositional matrix adjust.
 Identities = 96/112 (86%), Positives = 102/112 (91%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YWICQGCV TGVWV AHECGHHAFSDYQW+DDTVGLILHSALLVP+FSWKYSHRRHHSN
Sbjct  88   IYWICQGCVCTGVWVNAHECGHHAFSDYQWVDDTVGLILHSALLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK KS LGW++KYLNNPPGR  +L I LTL WPLYL FNVS
Sbjct  148  TGSLERDEVFVPKPKSQLGWYSKYLNNPPGRVLSLTITLTLGWPLYLAFNVS  199


 Score =   128 bits (321),  Expect(2) = 8e-83, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 72/87 (83%), Gaps = 1/87 (1%)
 Frame = +3

Query  120  MGAGGRMAVP-AEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM+ P  E ++ K  LQ+VP +KPPFT+G+IKKAIPPHCF+RS++RSFSYVVYDL
Sbjct  1    MGAGGRMSAPNGETEVKKNPLQKVPTSKPPFTVGDIKKAIPPHCFKRSLIRSFSYVVYDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWP  377
            I+ S +YYVA  YFHLLP P  Y+AWP
Sbjct  61   ILVSIMYYVANTYFHLLPSPYCYIAWP  87



>gb|AAY87459.1| omega-6 fatty acid desaturase [Hevea brasiliensis]
Length=383

 Score =   196 bits (498),  Expect(2) = 8e-83, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YW  QGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHS LLVP+FSWK+SHRRHHSN
Sbjct  88   IYWSLQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSCLLVPYFSWKHSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            T SLERDEVFVPK+KS++ W +KYLNNP GR  TL+I LTL WPLYL FNVS
Sbjct  148  TASLERDEVFVPKKKSNIRWLSKYLNNPLGRVLTLIITLTLGWPLYLAFNVS  199


 Score =   139 bits (349),  Expect(2) = 8e-83, Method: Compositional matrix adjust.
 Identities = 67/94 (71%), Positives = 77/94 (82%), Gaps = 1/94 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM+VP   K  + D L+RVPY+KPPFTLG+IKKAIPPHCF+RSVLRSFSYV+ DL
Sbjct  1    MGAGGRMSVPPSPKQLESDVLKRVPYSKPPFTLGQIKKAIPPHCFERSVLRSFSYVIQDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWPFTGSARA  398
             IAS  YY+ATNYFHLLP PLSY+AWP   S + 
Sbjct  61   TIASIFYYIATNYFHLLPQPLSYVAWPIYWSLQG  94



>ref|XP_008380133.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2 [Malus domestica]
 ref|XP_008380134.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2 [Malus domestica]
Length=382

 Score =   213 bits (541),  Expect(2) = 1e-82, Method: Compositional matrix adjust.
 Identities = 99/112 (88%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            ++W  QGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHS LLVP+FSWKYSHRRHHSN
Sbjct  88   IFWYVQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSCLLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPKQK ++GWHAKYLNNPPGR  TLLIQLTL WPLYL FNVS
Sbjct  148  TGSLERDEVFVPKQKFEIGWHAKYLNNPPGRFLTLLIQLTLGWPLYLAFNVS  199


 Score =   122 bits (305),  Expect(2) = 1e-82, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 68/87 (78%), Gaps = 1/87 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQDL-QRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM  P   K +  D  +RVPY+KPPF+LGE+KKAIPPHCFQRSV+RSFSYV YDL
Sbjct  1    MGAGGRMVAPPVRKNADADTHKRVPYSKPPFSLGEVKKAIPPHCFQRSVIRSFSYVFYDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWP  377
             IAS LYY+A+ Y   L  PLS+LAWP
Sbjct  61   TIASILYYIASTYIQNLSQPLSFLAWP  87



>gb|ABS86964.2| delta-12 fatty acid desaturase [Descurainia sophia]
Length=383

 Score =   202 bits (515),  Expect(2) = 2e-82, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW+CQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  88   LYWVCQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK+KS + W+ KYLNNP GR   L++Q TL WPLYL FNVS
Sbjct  148  TGSLERDEVFVPKKKSAIKWYGKYLNNPVGRIVMLIVQFTLGWPLYLAFNVS  199


 Score =   130 bits (327),  Expect(2) = 2e-82, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 73/88 (83%), Gaps = 1/88 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM VP+  K S+ D L+RVP  KPPF+LG++KKAIPPHCF+RS+ RSFSY++ D+
Sbjct  1    MGAGGRMPVPSSSKKSETDALKRVPCEKPPFSLGDLKKAIPPHCFKRSIPRSFSYLITDI  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWPF  380
            II S  YYVATNYF +LPHPLSYLAWP 
Sbjct  61   IIVSCFYYVATNYFSILPHPLSYLAWPL  88



>ref|XP_008240937.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2 [Prunus mume]
Length=382

 Score =   212 bits (539),  Expect(2) = 3e-82, Method: Compositional matrix adjust.
 Identities = 98/112 (88%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YW  QGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVP+FSWKYSHRRHHSN
Sbjct  88   VYWFVQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGS+ERDEVFVPKQKS +GW++KYLNNPPGR  TL IQLTL WPLYL FNVS
Sbjct  148  TGSIERDEVFVPKQKSAIGWYSKYLNNPPGRFLTLTIQLTLGWPLYLAFNVS  199


 Score =   121 bits (303),  Expect(2) = 3e-82, Method: Compositional matrix adjust.
 Identities = 58/87 (67%), Positives = 70/87 (80%), Gaps = 1/87 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM+ P   K ++ D L+RVP++KPPF+LG+IKKAIPPHCFQRSV+RSFSYV YDL
Sbjct  1    MGAGGRMSAPPPRKNAETDNLKRVPFSKPPFSLGQIKKAIPPHCFQRSVIRSFSYVFYDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWP  377
             IA  LYY+A+NY   L  P S+LAWP
Sbjct  61   TIAFLLYYIASNYIQPLSQPFSFLAWP  87



>gb|AEW43690.1| fatty acid desaturase 2 [Jatropha curcas]
Length=383

 Score =   194 bits (492),  Expect(2) = 3e-82, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YW  QGCVLTG+WVIAHECGHHAFSDYQWLDD VGL+LHS LLVP+FSWK+SHRRHHSN
Sbjct  88   IYWSLQGCVLTGIWVIAHECGHHAFSDYQWLDDIVGLLLHSCLLVPYFSWKHSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK+KS++ W +KYLNN PGR FTL I L L WPLYL FNVS
Sbjct  148  TGSLERDEVFVPKKKSNIRWFSKYLNNLPGRLFTLTITLALGWPLYLAFNVS  199


 Score =   139 bits (350),  Expect(2) = 3e-82, Method: Compositional matrix adjust.
 Identities = 67/94 (71%), Positives = 78/94 (83%), Gaps = 1/94 (1%)
 Frame = +3

Query  120  MGAGGRMAVP-AEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM+VP +  K+  + L+RVPY+KPPFTLG++KKAIPPHCFQRSVLRSFSYVVYDL
Sbjct  1    MGAGGRMSVPPSPKKLEAEVLKRVPYSKPPFTLGQVKKAIPPHCFQRSVLRSFSYVVYDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWPFTGSARA  398
             +A   YYVATNYFHLLP PLSY+AWP   S + 
Sbjct  61   TLAFIFYYVATNYFHLLPQPLSYVAWPIYWSLQG  94



>gb|ABA41034.1| delta12-fatty acid desaturase [Jatropha curcas]
 gb|KDP24621.1| hypothetical protein JCGZ_25537 [Jatropha curcas]
Length=383

 Score =   193 bits (491),  Expect(2) = 3e-82, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YW  QGCVLTG+WVIAHECGHHAFSDYQWLDD VGL+LHS LLVP+FSWK+SHRRHHSN
Sbjct  88   IYWSLQGCVLTGIWVIAHECGHHAFSDYQWLDDIVGLLLHSCLLVPYFSWKHSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK+KS++ W +KYLNN PGR FTL I L L WPLYL FNVS
Sbjct  148  TGSLERDEVFVPKKKSNIRWFSKYLNNLPGRLFTLTITLALGWPLYLAFNVS  199


 Score =   139 bits (350),  Expect(2) = 3e-82, Method: Compositional matrix adjust.
 Identities = 67/94 (71%), Positives = 78/94 (83%), Gaps = 1/94 (1%)
 Frame = +3

Query  120  MGAGGRMAVP-AEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM+VP +  K+  + L+RVPY+KPPFTLG++KKAIPPHCFQRSVLRSFSYVVYDL
Sbjct  1    MGAGGRMSVPPSPKKLEAEVLKRVPYSKPPFTLGQVKKAIPPHCFQRSVLRSFSYVVYDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWPFTGSARA  398
             +A   YYVATNYFHLLP PLSY+AWP   S + 
Sbjct  61   TLAFIFYYVATNYFHLLPQPLSYVAWPIYWSLQG  94



>gb|ADB93805.1| delta-12-fatty acid desaturase [Jatropha curcas]
Length=383

 Score =   193 bits (491),  Expect(2) = 4e-82, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YW  QGCVLTG+WVIAHECGHHAFSDYQWLDD VGL+LHS LLVP+FSWK+SHRRHHSN
Sbjct  88   IYWSLQGCVLTGIWVIAHECGHHAFSDYQWLDDIVGLLLHSCLLVPYFSWKHSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK+KS++ W +KYLNN PGR FTL I L L WPLYL FNVS
Sbjct  148  TGSLERDEVFVPKKKSNIRWFSKYLNNLPGRLFTLTITLALGWPLYLAFNVS  199


 Score =   139 bits (350),  Expect(2) = 4e-82, Method: Compositional matrix adjust.
 Identities = 67/94 (71%), Positives = 78/94 (83%), Gaps = 1/94 (1%)
 Frame = +3

Query  120  MGAGGRMAVP-AEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM+VP +  K+  + L+RVPY+KPPFTLG++KKAIPPHCFQRSVLRSFSYVVYDL
Sbjct  1    MGAGGRMSVPPSPKKLEAEVLKRVPYSKPPFTLGQVKKAIPPHCFQRSVLRSFSYVVYDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWPFTGSARA  398
             +A   YYVATNYFHLLP PLSY+AWP   S + 
Sbjct  61   TLAFIFYYVATNYFHLLPQPLSYVAWPIYWSLQG  94



>gb|AHG95978.1| endoplasmic reticulum 18:1 desaturase [Malus baccata]
Length=382

 Score =   210 bits (535),  Expect(2) = 4e-82, Method: Compositional matrix adjust.
 Identities = 98/112 (88%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            ++W  QGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHS LLVP+FSWKYSHRRHHSN
Sbjct  88   IFWYVQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSCLLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            T SLERDEVFVPKQK ++GWHAKYLNNPPGR  TLLIQLTL WPLYL FNVS
Sbjct  148  TASLERDEVFVPKQKFEIGWHAKYLNNPPGRFLTLLIQLTLGWPLYLAFNVS  199


 Score =   122 bits (305),  Expect(2) = 4e-82, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 68/87 (78%), Gaps = 1/87 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQDL-QRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM  P   K +  D  +RVPY+KPPF+LGE+KKAIPPHCFQRSV+RSFSYV YDL
Sbjct  1    MGAGGRMVAPPVRKNADADTHKRVPYSKPPFSLGEVKKAIPPHCFQRSVIRSFSYVFYDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWP  377
             IAS LYY+A+ Y   L  PLS+LAWP
Sbjct  61   TIASILYYIASTYIQNLSQPLSFLAWP  87



>ref|XP_009369579.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2 [Pyrus x bretschneideri]
 ref|XP_009369586.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2 [Pyrus x bretschneideri]
Length=382

 Score =   210 bits (535),  Expect(2) = 5e-82, Method: Compositional matrix adjust.
 Identities = 98/112 (88%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            ++W  QGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHS LLVP+FSWKYSHRRHHSN
Sbjct  88   IFWYVQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSCLLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPKQK ++GW+AKYLNNPPGR  TLLIQLTL WPLYL FNVS
Sbjct  148  TGSLERDEVFVPKQKFEIGWYAKYLNNPPGRFLTLLIQLTLGWPLYLAFNVS  199


 Score =   122 bits (305),  Expect(2) = 5e-82, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 68/87 (78%), Gaps = 1/87 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQDL-QRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM  P   K +  D  +RVPY+KPPF+LGE+KKAIPPHCFQRSV+RSFSYV YDL
Sbjct  1    MGAGGRMVAPPVRKNADADTHKRVPYSKPPFSLGEVKKAIPPHCFQRSVIRSFSYVFYDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWP  377
             IAS LYY+A+ Y   L  PLS+LAWP
Sbjct  61   TIASILYYIASTYIQNLSQPLSFLAWP  87



>gb|AGS12442.1| omega-6 fatty acid desaturase [Crambe hispanica subsp. abyssinica]
Length=383

 Score =   203 bits (516),  Expect(2) = 6e-82, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW CQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  88   LYWACQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK+KSD+ W+ KYLNNP GR   L +Q TL WPLYL FNVS
Sbjct  148  TGSLERDEVFVPKKKSDIKWYGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVS  199


 Score =   129 bits (324),  Expect(2) = 6e-82, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 74/95 (78%), Gaps = 1/95 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM V    K S+ D L+RVP   PPFT+GE+KKAIPPHCF+RS+ RSFSY+++D+
Sbjct  1    MGAGGRMQVSPSPKKSETDTLKRVPCETPPFTVGELKKAIPPHCFKRSIPRSFSYLIWDI  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWPFTGSARAV  401
            IIAS  YY+ATNYF LLPHPLSYLAWP   + +  
Sbjct  61   IIASCFYYIATNYFSLLPHPLSYLAWPLYWACQGC  95



>ref|XP_006604385.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Glycine max]
 gb|KHN26385.1| Omega-6 fatty acid desaturase, endoplasmic reticulum isozyme 
2 [Glycine soja]
Length=383

 Score =   201 bits (511),  Expect(2) = 6e-82, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YW  QGC+LTGVWVIAHECGHHAFSDYQ LDD VGLILHSALLVP+FSWKYSHRRHHSN
Sbjct  88   IYWAVQGCILTGVWVIAHECGHHAFSDYQLLDDIVGLILHSALLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPKQKS + W++KYLNNPPGR  TL + LTL WPLYL FNVS
Sbjct  148  TGSLERDEVFVPKQKSSIMWYSKYLNNPPGRVLTLAVTLTLGWPLYLAFNVS  199


 Score =   130 bits (328),  Expect(2) = 6e-82, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 73/87 (84%), Gaps = 1/87 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGR AVP   + S+ D L+RVP+ KP F+L +IKKAIPPHCFQRSVLRSFSYVVYDL
Sbjct  1    MGAGGRTAVPPANRKSEADPLKRVPFEKPQFSLSQIKKAIPPHCFQRSVLRSFSYVVYDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWP  377
             IA  LYYVAT+YFHLLP PLS++AWP
Sbjct  61   TIAFCLYYVATHYFHLLPGPLSFVAWP  87



>gb|AIA21661.1| oleate desaturase [Crambe glabrata]
 gb|AIA21662.1| oleate desaturase [Crambe glabrata]
 gb|AIA21663.1| oleate desaturase [Crambe glabrata]
 gb|AIA21664.1| oleate desaturase [Crambe glabrata]
Length=383

 Score =   202 bits (515),  Expect(2) = 8e-82, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW CQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  88   LYWACQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK+KSD+ W+ KYLNNP GR   L +Q TL WPLYL FNVS
Sbjct  148  TGSLERDEVFVPKKKSDIKWYGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVS  199


 Score =   129 bits (323),  Expect(2) = 8e-82, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 72/88 (82%), Gaps = 1/88 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM V    K S+ D L+RVP   PPFT+GE+KKAIPPHCF+RS+ RSFSY+++D+
Sbjct  1    MGAGGRMQVSPSPKKSETDTLKRVPCETPPFTVGELKKAIPPHCFKRSIPRSFSYLIWDI  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWPF  380
            IIAS  YYVATNYF LLPHPLSY+AWP 
Sbjct  61   IIASCFYYVATNYFSLLPHPLSYIAWPL  88



>gb|AIA21655.1| oleate desaturase [Crambe filiformis]
Length=384

 Score =   203 bits (516),  Expect(2) = 8e-82, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW CQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  88   LYWACQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK+KSD+ W+ KYLNNP GR   L +Q TL WPLYL FNVS
Sbjct  148  TGSLERDEVFVPKKKSDIKWYGKYLNNPLGRTLMLTVQFTLGWPLYLAFNVS  199


 Score =   128 bits (322),  Expect(2) = 8e-82, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 74/95 (78%), Gaps = 1/95 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM V    K S+ D ++RVP   PPFT+GE+KKAIPPHCF+RS+ RSFSY+++D+
Sbjct  1    MGAGGRMQVSPSPKKSETDTIKRVPCETPPFTVGELKKAIPPHCFKRSIPRSFSYLIWDI  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWPFTGSARAV  401
            IIAS  YY+ATNYF LLPHPLSYLAWP   + +  
Sbjct  61   IIASCFYYIATNYFSLLPHPLSYLAWPLYWACQGC  95



>gb|AIA21667.1| oleate desaturase [Crambe kralikii]
Length=384

 Score =   203 bits (516),  Expect(2) = 9e-82, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW CQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  88   LYWACQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK+KSD+ W+ KYLNNP GR   L +Q TL WPLYL FNVS
Sbjct  148  TGSLERDEVFVPKKKSDIKWYGKYLNNPLGRTLMLTVQFTLGWPLYLAFNVS  199


 Score =   128 bits (322),  Expect(2) = 9e-82, Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 72/88 (82%), Gaps = 1/88 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM V    K S+ D L+RVP   PPFTLGE+KKAIPPHCF+RS+ RSFSY+++D+
Sbjct  1    MGAGGRMQVSPSPKKSETDTLKRVPCETPPFTLGELKKAIPPHCFKRSIPRSFSYLIWDI  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWPF  380
            IIAS  YYVAT+YF LLPHPLSYLAWP 
Sbjct  61   IIASCFYYVATSYFSLLPHPLSYLAWPL  88



>ref|XP_010277281.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Nelumbo nucifera]
 ref|XP_010277282.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Nelumbo nucifera]
Length=382

 Score =   197 bits (502),  Expect(2) = 9e-82, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YW  QGCVLTGVWVIAHECGHHAFSDYQWLDD VGLILHS+LLVP+FSWKYSHRRHHSN
Sbjct  87   IYWALQGCVLTGVWVIAHECGHHAFSDYQWLDDIVGLILHSSLLVPYFSWKYSHRRHHSN  146

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK KS++ W++KYLNNP GR  +L I LTL WPLYL FNVS
Sbjct  147  TGSLERDEVFVPKPKSNIPWYSKYLNNPLGRVLSLAITLTLGWPLYLAFNVS  198


 Score =   134 bits (336),  Expect(2) = 9e-82, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDLI  299
            MG GGRM+VP   K     L RVP++KPPF L EIKKAIPPHCFQRSVLRSFSY VYDL 
Sbjct  1    MGGGGRMSVPTPRKEKHDALNRVPHSKPPFMLSEIKKAIPPHCFQRSVLRSFSYAVYDLA  60

Query  300  IASSLYYVATNYFHLLPHPLSYLAWP  377
            +A + YY+AT+YFHLLPHPLSY AWP
Sbjct  61   LAFAFYYIATSYFHLLPHPLSYFAWP  86



>gb|AIA21649.1| oleate desaturase [Crambe hispanica subsp. abyssinica]
Length=383

 Score =   203 bits (516),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW CQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  88   LYWACQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK+KSD+ W+ KYLNNP GR   L +Q TL WPLYL FNVS
Sbjct  148  TGSLERDEVFVPKKKSDIKWYGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVS  199


 Score =   128 bits (322),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 72/88 (82%), Gaps = 1/88 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM V    K S+ D ++RVP   PPFT+GE+KKAIPPHCF+RS+ RSFSY+++D+
Sbjct  1    MGAGGRMQVSPSPKKSETDTIKRVPCETPPFTVGELKKAIPPHCFKRSIPRSFSYLIWDI  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWPF  380
            IIAS  YY+ATNYF LLPHPLSYLAWP 
Sbjct  61   IIASCFYYIATNYFSLLPHPLSYLAWPL  88



>gb|AGS12443.1| omega-6 fatty acid desaturase [Crambe hispanica subsp. abyssinica]
Length=383

 Score =   203 bits (516),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW CQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  88   LYWACQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK+KSD+ W+ KYLNNP GR   L +Q TL WPLYL FNVS
Sbjct  148  TGSLERDEVFVPKKKSDIKWYGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVS  199


 Score =   128 bits (322),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 72/88 (82%), Gaps = 1/88 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM V    K S+ D ++RVP   PPFT+GE+KKAIPPHCF+RS+ RSFSY+++D+
Sbjct  1    MGAGGRMQVSPSPKKSETDTIKRVPCETPPFTVGELKKAIPPHCFKRSIPRSFSYLIWDI  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWPF  380
            IIAS  YY+ATNYF LLPHPLSYLAWP 
Sbjct  61   IIASCFYYIATNYFSLLPHPLSYLAWPL  88



>ref|XP_007204396.1| hypothetical protein PRUPE_ppa007098mg [Prunus persica]
 gb|EMJ05595.1| hypothetical protein PRUPE_ppa007098mg [Prunus persica]
 gb|AGM53489.1| omega-6 fatty acid desaturase [Prunus persica]
Length=382

 Score =   211 bits (537),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 98/112 (88%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YW  QGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVP+FSWKYSHRRHHSN
Sbjct  88   VYWYVQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGS+ERDEVFVPKQKS +GW++KYLNNPPGR  TL IQLTL WPLYL FNVS
Sbjct  148  TGSIERDEVFVPKQKSAIGWYSKYLNNPPGRFLTLTIQLTLGWPLYLAFNVS  199


 Score =   120 bits (300),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 58/87 (67%), Positives = 68/87 (78%), Gaps = 1/87 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQDL-QRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM+ P   K ++ D  +RVPY+KPPF+LG+IKKAIPPHCFQRSV+RSFSYV YDL
Sbjct  1    MGAGGRMSAPPTRKNAETDNPKRVPYSKPPFSLGQIKKAIPPHCFQRSVIRSFSYVFYDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWP  377
             IA  LYY+A NY   L  P S+LAWP
Sbjct  61   TIAFLLYYIACNYIQPLSQPFSFLAWP  87



>gb|AIA21657.1| oleate desaturase [Crambe filiformis]
Length=383

 Score =   202 bits (515),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW CQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  88   LYWACQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK+KSD+ W+ KYLNNP GR   L +Q TL WPLYL FNVS
Sbjct  148  TGSLERDEVFVPKKKSDIKWYGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVS  199


 Score =   128 bits (321),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 72/88 (82%), Gaps = 1/88 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM V    K S+ D ++RVP   PPFT+GE+KKAIPPHCF+RS+ RSFSY+++D+
Sbjct  1    MGAGGRMQVSPSPKKSETDTIKRVPCETPPFTVGELKKAIPPHCFKRSIPRSFSYLIWDI  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWPF  380
            IIAS  YY+ATNYF LLPHPLSYLAWP 
Sbjct  61   IIASCFYYIATNYFSLLPHPLSYLAWPL  88



>gb|AIA21668.1| oleate desaturase [Crambe kralikii]
Length=383

 Score =   203 bits (516),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW CQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  88   LYWACQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK+KSD+ W+ KYLNNP GR   L +Q TL WPLYL FNVS
Sbjct  148  TGSLERDEVFVPKKKSDIKWYGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVS  199


 Score =   128 bits (321),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 74/95 (78%), Gaps = 1/95 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM V    K S+ D L+RVP   PPFTLGE+KKAIPPHCF+RS+ RSFSY+++D+
Sbjct  1    MGAGGRMQVSPSPKKSETDTLERVPCETPPFTLGELKKAIPPHCFKRSIPRSFSYLIWDI  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWPFTGSARAV  401
            IIAS  YYVAT+YF LLPHPLSY+AWP   + +  
Sbjct  61   IIASCFYYVATSYFSLLPHPLSYIAWPLYWACQGC  95



>gb|AIA21669.1| oleate desaturase [Crambe kralikii]
Length=383

 Score =   203 bits (516),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW CQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  88   LYWACQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK+KSD+ W+ KYLNNP GR   L +Q TL WPLYL FNVS
Sbjct  148  TGSLERDEVFVPKKKSDIKWYGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVS  199


 Score =   127 bits (320),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 74/95 (78%), Gaps = 1/95 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM V    K S+ D L+RVP   PPFTLGE+KKAIPPHCF+RS+ RSFSY+++D+
Sbjct  1    MGAGGRMQVSPSPKKSETDTLKRVPCETPPFTLGELKKAIPPHCFKRSIPRSFSYLIWDI  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWPFTGSARAV  401
            IIAS  YYVAT+YF LLPHPLSY+AWP   + +  
Sbjct  61   IIASCFYYVATSYFSLLPHPLSYMAWPLYWACQGC  95



>emb|CDP17521.1| unnamed protein product [Coffea canephora]
Length=381

 Score =   204 bits (518),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YWI QGCV TGVWVIAHECGHHAFSDYQW+DDTVGLILHSALLVP+FSWKYSHRRHHSN
Sbjct  88   VYWIFQGCVCTGVWVIAHECGHHAFSDYQWVDDTVGLILHSALLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK KS + W++KYLNNPPGR  TL I LTL WPLYL FN S
Sbjct  148  TGSLERDEVFVPKPKSKMAWYSKYLNNPPGRVITLTITLTLGWPLYLAFNAS  199


 Score =   127 bits (318),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 71/87 (82%), Gaps = 1/87 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM+        K++ L+RVPY+KPPFT+G+IKKAIPPHCF+RS+LRSFSYVVYDL
Sbjct  1    MGAGGRMSSATTKTEDKKNPLKRVPYSKPPFTVGDIKKAIPPHCFKRSLLRSFSYVVYDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWP  377
             + S  YY+AT YFHLLP P +YLAWP
Sbjct  61   TLVSLFYYIATTYFHLLPSPYNYLAWP  87



>gb|AIA21660.1| oleate desaturase [Crambe glabrata]
Length=383

 Score =   203 bits (516),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW CQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  88   LYWACQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK+KSD+ W+ KYLNNP GR   L +Q TL WPLYL FNVS
Sbjct  148  TGSLERDEVFVPKKKSDIKWYGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVS  199


 Score =   127 bits (320),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 72/88 (82%), Gaps = 1/88 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM V    K S+ D L+RVP   PPFT+GE++KAIPPHCF+RS+ RSFSY+++D+
Sbjct  1    MGAGGRMQVSPSPKKSETDTLKRVPCETPPFTVGELRKAIPPHCFKRSIPRSFSYLIWDI  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWPF  380
            IIAS  YYVATNYF LLPHPLSY+AWP 
Sbjct  61   IIASCFYYVATNYFSLLPHPLSYIAWPL  88



>ref|XP_011033218.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2 [Populus euphratica]
Length=454

 Score =   191 bits (486),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YW  QGCVLTGVWV+AHECGHHAFSDYQ LDD VGLILHS LLVP+FSWK+SHRRHHSN
Sbjct  157  IYWAVQGCVLTGVWVLAHECGHHAFSDYQLLDDIVGLILHSCLLVPYFSWKHSHRRHHSN  216

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPKQKS + W +KYLNNPPGR  T+ I LTL WPLYL  NVS
Sbjct  217  TGSLERDEVFVPKQKSSISWFSKYLNNPPGRFLTIAITLTLGWPLYLACNVS  268


 Score =   139 bits (349),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDLI  299
            MGAGGRM+  + GK+    L+R P +KPPFTLG++KKAIPPHCF+RS+LRSFSYVVYDLI
Sbjct  71   MGAGGRMSPYSPGKVESHVLKRAPDSKPPFTLGQVKKAIPPHCFRRSLLRSFSYVVYDLI  130

Query  300  IASSLYYVATNYFHLLPHPLSYLAWP  377
            IAS  YYVATNYFHLLPHPLSY+AWP
Sbjct  131  IASLFYYVATNYFHLLPHPLSYVAWP  156



>ref|XP_007028985.1| Microsomal oleic acid desaturase [Theobroma cacao]
 gb|EOY09487.1| Microsomal oleic acid desaturase [Theobroma cacao]
Length=383

 Score =   199 bits (506),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YW  QG VLTGVWVIAHECGHHAFSDYQWLDDTVG +LHS+LLVP+FSWKYSHRRHHSN
Sbjct  88   IYWAVQGSVLTGVWVIAHECGHHAFSDYQWLDDTVGFVLHSSLLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSL+RDEVFVPKQK+ + W AKYLNNPPGR  TL IQLT+ WPLYL FNVS
Sbjct  148  TGSLDRDEVFVPKQKAAIRWWAKYLNNPPGRFLTLTIQLTIGWPLYLAFNVS  199


 Score =   131 bits (329),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 73/87 (84%), Gaps = 1/87 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSK-QDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM+VP   K S+ Q L+RVP +KPPFTL ++KKAI PHCFQRSVLRSFSY+VYD 
Sbjct  1    MGAGGRMSVPPTPKKSEFQSLKRVPCSKPPFTLSQVKKAIAPHCFQRSVLRSFSYLVYDF  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWP  377
            I+ S  YYVAT+YFH LPHPLSY+AWP
Sbjct  61   ILVSLFYYVATDYFHQLPHPLSYVAWP  87



>gb|AAT72296.2| microsomal omega-6-desaturase [Nicotiana tabacum]
Length=383

 Score =   208 bits (529),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YWICQGCV TG+WVIAHECGHHAFSDYQW+DDTVGLILHSAL+VP+FSWKYSHRRHHSN
Sbjct  88   IYWICQGCVCTGIWVIAHECGHHAFSDYQWVDDTVGLILHSALMVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK KS LGW++KYLNNPPGR  +L + LTL WPLYL FNVS
Sbjct  148  TGSLERDEVFVPKPKSQLGWYSKYLNNPPGRVMSLTVTLTLGWPLYLAFNVS  199


 Score =   121 bits (304),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 69/87 (79%), Gaps = 1/87 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGG M+V       K++ L++VP +KPPFT+G+IKKAIPPHCFQRS++RSFSYVVYDL
Sbjct  1    MGAGGNMSVVTGKTGEKKNPLEKVPTSKPPFTVGDIKKAIPPHCFQRSLVRSFSYVVYDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWP  377
            I+ S  YY+A  YFHLLP P  YLAWP
Sbjct  61   ILVSVFYYIAITYFHLLPSPYCYLAWP  87



>ref|XP_009613562.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Nicotiana tomentosiformis]
Length=383

 Score =   208 bits (529),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YWICQGCV TG+WVIAHECGHHAFSDYQW+DDTVGLILHSAL+VP+FSWKYSHRRHHSN
Sbjct  88   IYWICQGCVCTGIWVIAHECGHHAFSDYQWVDDTVGLILHSALMVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK KS LGW++KYLNNPPGR  +L + LTL WPLYL FNVS
Sbjct  148  TGSLERDEVFVPKPKSQLGWYSKYLNNPPGRVMSLTVTLTLGWPLYLAFNVS  199


 Score =   121 bits (304),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 69/87 (79%), Gaps = 1/87 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGG M+V       K++ L++VP +KPPFT+G+IKKAIPPHCFQRS++RSFSYVVYDL
Sbjct  1    MGAGGNMSVVTGKTGEKKNPLEKVPTSKPPFTVGDIKKAIPPHCFQRSLVRSFSYVVYDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWP  377
            I+ S  YY+A  YFHLLP P  YLAWP
Sbjct  61   ILVSVFYYIAITYFHLLPSPYCYLAWP  87



>ref|XP_009777156.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Nicotiana sylvestris]
Length=383

 Score =   207 bits (526),  Expect(2) = 3e-81, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 102/112 (91%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YWICQGCV TG+WVIAHECGHHAFSDYQW+DD VGLILHSAL+VP+FSWKYSHRRHHSN
Sbjct  88   IYWICQGCVCTGIWVIAHECGHHAFSDYQWVDDAVGLILHSALMVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK KS LGW++KYLNNPPGR  +L I LTL WPLYL FNVS
Sbjct  148  TGSLERDEVFVPKPKSQLGWYSKYLNNPPGRVISLTITLTLGWPLYLAFNVS  199


 Score =   122 bits (307),  Expect(2) = 3e-81, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 70/87 (80%), Gaps = 1/87 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGG M+V       K++ L++VP +KPPFT+G+IKKAIPPHCFQRS++RSFSYVVYDL
Sbjct  1    MGAGGNMSVVTGKTGEKKNPLEKVPTSKPPFTVGDIKKAIPPHCFQRSLVRSFSYVVYDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWP  377
            ++ S  YY+AT YFHLLP P  YLAWP
Sbjct  61   LLVSVFYYIATTYFHLLPSPYCYLAWP  87



>gb|KHG25037.1| Omega-6 fatty acid desaturase, endoplasmic reticulum isozyme 
2 [Gossypium arboreum]
Length=392

 Score =   200 bits (508),  Expect(2) = 3e-81, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YW  QG VLTGVWVIAHECGHHAFSDYQW+DDTVGLILHS+LLVP+FSWKYSHRRHHSN
Sbjct  96   IYWTLQGSVLTGVWVIAHECGHHAFSDYQWIDDTVGLILHSSLLVPYFSWKYSHRRHHSN  155

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK++S + W AKYLNNPPGR  T+ IQLTL WPLYL FNV+
Sbjct  156  TGSLERDEVFVPKKRSSIRWWAKYLNNPPGRFVTVTIQLTLGWPLYLAFNVA  207


 Score =   129 bits (325),  Expect(2) = 3e-81, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 72/89 (81%), Gaps = 1/89 (1%)
 Frame = +3

Query  114  GKMGAGGRMAVP-AEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVY  290
            G MGAGGRM+VP ++ K     ++RVP +KPPFTL EIKKAIPPHCFQRS++RSFSY+VY
Sbjct  7    GTMGAGGRMSVPPSQRKQESGSMKRVPISKPPFTLSEIKKAIPPHCFQRSLIRSFSYLVY  66

Query  291  DLIIASSLYYVATNYFHLLPHPLSYLAWP  377
            D I+ S  YYVAT YFH LP PLS++AWP
Sbjct  67   DFILVSIFYYVATTYFHNLPQPLSFVAWP  95



>ref|XP_002323284.1| Omega-6 fatty acid desaturase family protein [Populus trichocarpa]
 gb|EEF05045.1| Omega-6 fatty acid desaturase family protein [Populus trichocarpa]
Length=385

 Score =   191 bits (485),  Expect(2) = 3e-81, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YW  QGCVLTGVWV+AHECGHHAFSDYQ LDD VGLILHS LLVP+FSWK+SHRRHHSN
Sbjct  88   IYWAVQGCVLTGVWVLAHECGHHAFSDYQLLDDIVGLILHSCLLVPYFSWKHSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPKQKS + W +KYLNNPPGR  T+ I LTL WPLYL  NVS
Sbjct  148  TGSLERDEVFVPKQKSSISWFSKYLNNPPGRFLTITITLTLGWPLYLACNVS  199


 Score =   138 bits (348),  Expect(2) = 3e-81, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 76/87 (87%), Gaps = 1/87 (1%)
 Frame = +3

Query  120  MGAGGRMAVP-AEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM+ P + GK+    L+R P +KPPFTLG++KKAIPPHCF+RSVLRSFSYVVYDL
Sbjct  1    MGAGGRMSPPYSPGKVESHVLKRAPDSKPPFTLGQLKKAIPPHCFRRSVLRSFSYVVYDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWP  377
            IIAS  YYVATNYFHLLPHPLSY+AWP
Sbjct  61   IIASLFYYVATNYFHLLPHPLSYVAWP  87



>gb|ACU23285.1| unknown [Glycine max]
Length=383

 Score =   201 bits (511),  Expect(2) = 3e-81, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YW  QGC+LTGVWVIAHECGHHAFSDYQ LDD VGLILHSALLVP+FSWKYSHRRHHSN
Sbjct  88   IYWAVQGCILTGVWVIAHECGHHAFSDYQLLDDIVGLILHSALLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPKQKS + W++KYLNNPPGR  TL + LTL WPLYL FNVS
Sbjct  148  TGSLERDEVFVPKQKSSIMWYSKYLNNPPGRVLTLAVTLTLGWPLYLAFNVS  199


 Score =   128 bits (322),  Expect(2) = 3e-81, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 72/87 (83%), Gaps = 1/87 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGR AVP   + S+ D L+RVP+ KP F+L +IKKAIPPHCFQRSVLR FSYVVYDL
Sbjct  1    MGAGGRTAVPPANRKSEADPLKRVPFEKPQFSLSQIKKAIPPHCFQRSVLRPFSYVVYDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWP  377
             IA  LYYVAT+YFHLLP PLS++AWP
Sbjct  61   TIAFCLYYVATHYFHLLPGPLSFVAWP  87



>ref|XP_010557947.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum-like 
[Tarenaya hassleriana]
Length=383

 Score =   204 bits (518),  Expect(2) = 3e-81, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW CQGCV+TGVWVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  88   LYWACQGCVMTGVWVIAHECGHHAFSDYQWLDDTVGLIFHSLLLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSL++DEVFVPKQKS + W++KYLNNP GR  TL IQL L WPLYLMFNVS
Sbjct  148  TGSLDKDEVFVPKQKSAIRWYSKYLNNPLGRVMTLTIQLVLGWPLYLMFNVS  199


 Score =   125 bits (315),  Expect(2) = 3e-81, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 73/95 (77%), Gaps = 1/95 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM VP   K S+ + L+RVP AKPPF+LG++KKAIPPHCF+RS+ RSFSY++ DL
Sbjct  1    MGAGGRMQVPPSSKKSESNALKRVPCAKPPFSLGDLKKAIPPHCFKRSIPRSFSYLITDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWPFTGSARAV  401
            II    YY+ATNYF LLP PLSYLAWP   + +  
Sbjct  61   IIIYCFYYIATNYFSLLPQPLSYLAWPLYWACQGC  95



>ref|XP_008443062.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2 [Cucumis melo]
Length=492

 Score =   204 bits (519),  Expect(2) = 4e-81, Method: Compositional matrix adjust.
 Identities = 95/113 (84%), Positives = 100/113 (88%), Gaps = 0/113 (0%)
 Frame = +2

Query  374  ALYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHS  553
            ALYW  QGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHS L+VP+FSWKYSHRRHHS
Sbjct  197  ALYWAAQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSFLMVPYFSWKYSHRRHHS  256

Query  554  NTGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            NTGSLERDEVFVPKQKS + W++ YLNNP GR  TL IQL L WPLYL FNVS
Sbjct  257  NTGSLERDEVFVPKQKSAMKWYSTYLNNPVGRVLTLTIQLVLGWPLYLAFNVS  309


 Score =   125 bits (313),  Expect(2) = 4e-81, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 71/95 (75%), Gaps = 1/95 (1%)
 Frame = +3

Query  117  KMGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYD  293
            KMGAGGRM+ P+  K S  D L+RVP  KPPFTLGE+KKAIPPHCFQRSVLRSFSYVVYD
Sbjct  110  KMGAGGRMSSPSSLKKSDSDHLKRVPSTKPPFTLGELKKAIPPHCFQRSVLRSFSYVVYD  169

Query  294  LIIASSLYYVATNYFHLLPHPLSYLAWPFTGSARA  398
            L +AS  YYVAT YF  LP  L Y AW    +A+ 
Sbjct  170  LTLASIFYYVATTYFQSLPSLLFYPAWALYWAAQG  204



>gb|AFK34956.1| unknown [Lotus japonicus]
Length=384

 Score =   199 bits (507),  Expect(2) = 5e-81, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = +2

Query  380  YWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSNT  559
            YW  QGC+LTGVWVIAHECGHHAFSDYQWLDDTVGLILHS+LLVP+ SWKYSHRRHHSNT
Sbjct  89   YWAIQGCILTGVWVIAHECGHHAFSDYQWLDDTVGLILHSSLLVPYLSWKYSHRRHHSNT  148

Query  560  GSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            GSL+RDEVFVPKQKS +GW++KYLNNP GR  T+ I LTL WPLYL FNVS
Sbjct  149  GSLDRDEVFVPKQKSSIGWYSKYLNNPLGRFLTITITLTLGWPLYLTFNVS  199


 Score =   129 bits (324),  Expect(2) = 5e-81, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 74/87 (85%), Gaps = 1/87 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGR +VP   + S+ D ++RVP+ KPPF+L ++KKAIPPHCF+RS+LRSFSYVVYDL
Sbjct  1    MGAGGRTSVPQPNRKSETDAVKRVPFEKPPFSLSQVKKAIPPHCFKRSILRSFSYVVYDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWP  377
             IA  LYYVAT+YFHLLP PL++LAWP
Sbjct  61   TIAFFLYYVATHYFHLLPRPLAFLAWP  87



>ref|XP_007162321.1| hypothetical protein PHAVU_001G142100g [Phaseolus vulgaris]
 gb|ADO17551.1| omega-6 fatty acid desaturase [Phaseolus vulgaris]
 gb|AGV54471.1| omega-6 fatty acid desaturase [Phaseolus vulgaris]
 gb|ESW34315.1| hypothetical protein PHAVU_001G142100g [Phaseolus vulgaris]
Length=383

 Score =   198 bits (503),  Expect(2) = 5e-81, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YW  QGC+LTGVWVIAHECGHHAFSDYQ LDD VGL+LHSALLVP+FSWKYSHRRHHSN
Sbjct  88   IYWAVQGCILTGVWVIAHECGHHAFSDYQLLDDIVGLVLHSALLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPKQKS + W++KYLNNP GR  TL+I LTL WPLYL FNVS
Sbjct  148  TGSLERDEVFVPKQKSGMKWYSKYLNNPLGRVLTLVITLTLGWPLYLAFNVS  199


 Score =   130 bits (328),  Expect(2) = 5e-81, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 72/87 (83%), Gaps = 1/87 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGR  VP   + S+ D L+RVP+ KPPF+L +IKKAIPPHCFQRSVLRSFSYV+YDL
Sbjct  1    MGAGGRTFVPPANRKSEADPLKRVPFEKPPFSLSQIKKAIPPHCFQRSVLRSFSYVIYDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWP  377
             IA  LYYVAT+YFH LP PLS+LAWP
Sbjct  61   TIAFCLYYVATHYFHTLPRPLSFLAWP  87



>emb|CDY01103.1| BnaC05g40970D [Brassica napus]
Length=458

 Score =   204 bits (518),  Expect(2) = 6e-81, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW CQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  162  LYWACQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  221

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK+KSD+ W+ KYLNNP GR   L +Q TL WPLYL FNVS
Sbjct  222  TGSLERDEVFVPKKKSDIKWYGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVS  273


 Score =   124 bits (312),  Expect(2) = 6e-81, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 70/89 (79%), Gaps = 1/89 (1%)
 Frame = +3

Query  117  KMGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYD  293
             MGAGGRM V    K S+ D ++RVP   PPFT+GE+KKAIPPHCF+RS+ RSFSY+++D
Sbjct  74   NMGAGGRMQVSPPSKKSETDTIKRVPCETPPFTVGELKKAIPPHCFKRSIPRSFSYLIWD  133

Query  294  LIIASSLYYVATNYFHLLPHPLSYLAWPF  380
            +IIAS  YYVAT YF LLPHPLSY AWP 
Sbjct  134  IIIASCFYYVATTYFPLLPHPLSYFAWPL  162



>gb|ABZ05022.1| delta-12 fatty acid desaturase [Davidia involucrata]
Length=382

 Score =   199 bits (507),  Expect(2) = 7e-81, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YW  QGCVLTGVWVIAHECGHHAFSDYQW+DDTVGLILHS+LLVP+FSWKYSHRRHHSN
Sbjct  87   VYWTLQGCVLTGVWVIAHECGHHAFSDYQWVDDTVGLILHSSLLVPYFSWKYSHRRHHSN  146

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK KS + W+++YLNNP GR  TL+I LTL WPLYL FNVS
Sbjct  147  TGSLERDEVFVPKPKSQIAWYSQYLNNPIGRILTLVITLTLGWPLYLAFNVS  198


 Score =   129 bits (323),  Expect(2) = 7e-81, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDLI  299
            MGAGGRM+VP      K  LQRVP++KPPFTLG++KKAIPPHCFQRS+ RSFSYVVYDL 
Sbjct  1    MGAGGRMSVPTTKSEQKNPLQRVPHSKPPFTLGDVKKAIPPHCFQRSLFRSFSYVVYDLS  60

Query  300  IASSLYYVATNYFHLLPHPLSYLAWP  377
            +AS  YY+AT YFHLLP     +AWP
Sbjct  61   LASLFYYIATTYFHLLPQHFRCIAWP  86



>ref|XP_004228665.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Solanum lycopersicum]
 ref|XP_004228667.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Solanum lycopersicum]
Length=383

 Score =   199 bits (507),  Expect(2) = 7e-81, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YWICQGCV TG+WV AHECGHHAFSDYQ +DDTVGLILHSALLVP+FSWKYSHRRHHSN
Sbjct  88   IYWICQGCVCTGIWVNAHECGHHAFSDYQLVDDTVGLILHSALLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK KS LGW++KYLNNP GR  TL + LTL WPLYL FNVS
Sbjct  148  TGSLERDEVFVPKSKSQLGWYSKYLNNPLGRVITLTVTLTLGWPLYLAFNVS  199


 Score =   129 bits (323),  Expect(2) = 7e-81, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 72/87 (83%), Gaps = 1/87 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM+ P  G   K++ LQ+VP +KPPFT+G+IKKAIPPHCFQRS++RSFSYVVYDL
Sbjct  1    MGAGGRMSAPNGGTEVKKNPLQKVPTSKPPFTVGDIKKAIPPHCFQRSLIRSFSYVVYDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWP  377
            I+ S +YYVA  YFHL+P P  Y+AWP
Sbjct  61   ILVSIMYYVANTYFHLIPSPYCYIAWP  87



>ref|XP_011004831.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Populus euphratica]
Length=387

 Score =   189 bits (479),  Expect(2) = 8e-81, Method: Compositional matrix adjust.
 Identities = 88/112 (79%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YW  QGCVLTGVWVIAHECGHHAFSDYQ LDD VGL+LHS LLVP+FSWK+SHRRHHSN
Sbjct  88   IYWAVQGCVLTGVWVIAHECGHHAFSDYQLLDDIVGLVLHSCLLVPYFSWKHSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSL+RDEVFVPK+KS + W++KYLNNP GR  T+ I LTL WPLYL FNVS
Sbjct  148  TGSLDRDEVFVPKKKSGIRWYSKYLNNPLGRFLTITITLTLGWPLYLAFNVS  199


 Score =   139 bits (351),  Expect(2) = 8e-81, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 75/87 (86%), Gaps = 1/87 (1%)
 Frame = +3

Query  120  MGAGGRMAVP-AEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM+VP +  K+    L+R P +KPPFTLG+IKKAIPPHCFQRSVLRSFSYV +DL
Sbjct  1    MGAGGRMSVPPSSAKVESDVLKRAPDSKPPFTLGQIKKAIPPHCFQRSVLRSFSYVAHDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWP  377
            IIAS  YYVATNYFHLLPHPLSY+AWP
Sbjct  61   IIASLFYYVATNYFHLLPHPLSYVAWP  87



>gb|AGZ02022.1| microsomal omega-6-desaturase [Millettia pinnata]
Length=385

 Score =   196 bits (499),  Expect(2) = 8e-81, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YW+ QGC+LTGVWVIAHECGHHAFSDYQW+DD VGLILHSALLVP+FSWK SHRRHHSN
Sbjct  88   IYWVLQGCILTGVWVIAHECGHHAFSDYQWVDDVVGLILHSALLVPYFSWKISHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK KS L W +KYLNNP GR  +L++ LTL WPLYL FNVS
Sbjct  148  TGSLERDEVFVPKPKSKLSWFSKYLNNPLGRVVSLVVTLTLGWPLYLAFNVS  199


 Score =   132 bits (331),  Expect(2) = 8e-81, Method: Compositional matrix adjust.
 Identities = 61/87 (70%), Positives = 74/87 (85%), Gaps = 1/87 (1%)
 Frame = +3

Query  120  MGAGGRMAVPA-EGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM+VP  + +   + L+RVPY KPPFT+G+IKKAIPPHCFQRS+LRSFSYVVYDL
Sbjct  1    MGAGGRMSVPEIKAEEKAKPLKRVPYLKPPFTVGQIKKAIPPHCFQRSLLRSFSYVVYDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWP  377
            ++A   YY+AT+YFHLLP P SY+AWP
Sbjct  61   VLAFIFYYIATSYFHLLPQPFSYIAWP  87



>gb|AAL68982.1|AF251843_1 delta-12 oleate desaturase [Helianthus annuus]
 gb|AAX19392.1| delta-12 oleate desaturase [Helianthus annuus]
 gb|AAX19393.1| delta-12 oleate desaturase [Helianthus annuus]
 gb|AAX19394.1| delta-12 oleate desaturase [Helianthus annuus]
 gb|AAX19395.1| delta-12 oleate desaturase [Helianthus annuus]
 gb|AAX19396.1| delta-12 oleate desaturase [Helianthus annuus]
Length=383

 Score =   201 bits (511),  Expect(2) = 8e-81, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGL+LHSALLVP+FSWKYSHRRHHSN
Sbjct  89   VYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLVLHSALLVPYFSWKYSHRRHHSN  148

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGS+E DEVFVPK KS +   A+ LNNPPGR  TLL+ LT+ WPLYLMFNVS
Sbjct  149  TGSIEHDEVFVPKLKSGVRSTARLLNNPPGRILTLLVTLTMGWPLYLMFNVS  200


 Score =   127 bits (318),  Expect(2) = 8e-81, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 70/88 (80%), Gaps = 2/88 (2%)
 Frame = +3

Query  120  MGAGGRMAVPAEG--KMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYD  293
            MGAGGRM+ P  G  K +   LQRVPY KPPFT+G++KKAIPPHCF RSV+RSFSYVVYD
Sbjct  1    MGAGGRMSNPVNGEKKPNPDPLQRVPYQKPPFTVGDVKKAIPPHCFNRSVIRSFSYVVYD  60

Query  294  LIIASSLYYVATNYFHLLPHPLSYLAWP  377
            L IAS  YY+A NY  LLP PL+Y+AWP
Sbjct  61   LTIASIFYYLANNYIALLPSPLAYVAWP  88



>emb|CDY08454.1| BnaA05g26900D [Brassica napus]
Length=457

 Score =   203 bits (517),  Expect(2) = 8e-81, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW CQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  161  LYWACQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  220

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK+KSD+ W+ KYLNNP GR   L +Q TL WPLYL FNVS
Sbjct  221  TGSLERDEVFVPKKKSDIKWYGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVS  272


 Score =   124 bits (312),  Expect(2) = 8e-81, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 70/89 (79%), Gaps = 1/89 (1%)
 Frame = +3

Query  117  KMGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYD  293
             MGAGGRM V    K S+ D ++RVP   PPFT+GE+KKAIPPHCF+RS+ RSFSY+++D
Sbjct  73   NMGAGGRMQVSPPSKKSETDNIKRVPCETPPFTVGELKKAIPPHCFKRSIPRSFSYLIWD  132

Query  294  LIIASSLYYVATNYFHLLPHPLSYLAWPF  380
            +IIAS  YYVAT YF LLPHPLSY AWP 
Sbjct  133  IIIASCFYYVATTYFPLLPHPLSYFAWPL  161



>gb|AGS12444.1| omega-6 fatty acid desaturase [Crambe hispanica subsp. abyssinica]
 gb|AIA21645.1| oleate desaturase [Crambe hispanica subsp. abyssinica]
Length=383

 Score =   204 bits (518),  Expect(2) = 9e-81, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW+CQGCVLTG+WVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  88   LYWVCQGCVLTGIWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK+KSD+ W+ KYLNNP GR   L +Q TL WPLYL FNVS
Sbjct  148  TGSLERDEVFVPKKKSDIKWYGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVS  199


 Score =   124 bits (311),  Expect(2) = 9e-81, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 71/88 (81%), Gaps = 1/88 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM V    K S+ D L+RVP   PPFT+GE+KKAIPPHCF+RS+ RSFSY+++D+
Sbjct  1    MGAGGRMQVSPSPKKSETDTLKRVPCETPPFTVGELKKAIPPHCFKRSIPRSFSYLIWDI  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWPF  380
            IIAS  YY+AT+YF LLPH LSYLAWP 
Sbjct  61   IIASCFYYIATSYFSLLPHSLSYLAWPL  88



>ref|XP_002530704.1| omega-6 desaturase, endoplasmic reticulum [Ricinus communis]
 gb|ABK59093.1| oleate desaturase [Ricinus communis]
 gb|EEF31658.1| omega-6 desaturase, endoplasmic reticulum [Ricinus communis]
Length=383

 Score =   195 bits (495),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YW  QGCVLTGVWVIAHECGHHAFSDYQ LDD VGLILHS LLVP+FSWK+SHRRHHSN
Sbjct  88   IYWALQGCVLTGVWVIAHECGHHAFSDYQLLDDVVGLILHSCLLVPYFSWKHSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK+KS + W++KYLNNPPGR  T+ + LTL WPLYL FNVS
Sbjct  148  TGSLERDEVFVPKKKSSIRWYSKYLNNPPGRIMTIAVTLTLGWPLYLAFNVS  199


 Score =   132 bits (333),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 72/87 (83%), Gaps = 1/87 (1%)
 Frame = +3

Query  120  MGAGGRMAVPA-EGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM+VP    K+   DL+R P +KPPFTLG+IKKAIPPHCF+RS+ RSFSYVVYDL
Sbjct  1    MGAGGRMSVPPPSKKVESDDLKRAPSSKPPFTLGQIKKAIPPHCFKRSIPRSFSYVVYDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWP  377
             IA   YYVATNYFHLLP PLSY+AWP
Sbjct  61   TIAFLFYYVATNYFHLLPEPLSYVAWP  87



>gb|AIC34705.1| omega-6 fatty acid desaturase [Rhus chinensis]
 gb|AIC34706.1| omega-6 fatty acid desaturase [Rhus chinensis]
Length=383

 Score =   209 bits (531),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 97/112 (87%), Positives = 102/112 (91%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YW+ QGCVLTGVWVIAHECGHHAFSDYQW+DDTVGLILHSALLVP+FSWKYSHRRHHSN
Sbjct  88   VYWVFQGCVLTGVWVIAHECGHHAFSDYQWVDDTVGLILHSALLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK KS   W AKY NNPPGRA TLL+QLTL WPLYL FNVS
Sbjct  148  TGSLERDEVFVPKTKSKTPWFAKYFNNPPGRALTLLVQLTLGWPLYLTFNVS  199


 Score =   119 bits (297),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 71/88 (81%), Gaps = 3/88 (3%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD--LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYD  293
            MGAGGRM V   GK   ++  ++R PY KPPFTL +IKKAI PHCFQRS++RSFSYVVYD
Sbjct  1    MGAGGRMTV-GNGKHEGKESPVRRAPYTKPPFTLSQIKKAISPHCFQRSLVRSFSYVVYD  59

Query  294  LIIASSLYYVATNYFHLLPHPLSYLAWP  377
            LI+ S  YY+A++YF LLP+PL+YLAWP
Sbjct  60   LILVSLFYYIASSYFPLLPYPLAYLAWP  87



>gb|AIA21650.1| oleate desaturase [Crambe hispanica subsp. abyssinica]
Length=383

 Score =   203 bits (516),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW CQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  88   LYWACQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK+KSD+ W+ KYLNNP GR   L +Q TL WPLYL FNVS
Sbjct  148  TGSLERDEVFVPKKKSDIKWYGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVS  199


 Score =   124 bits (312),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 71/88 (81%), Gaps = 1/88 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM V    K S+ D L+RVP   PPFT+GE+KKAIPPHCF+RS+ RSFSY+++D+
Sbjct  1    MGAGGRMQVSPSPKKSETDTLKRVPCETPPFTVGELKKAIPPHCFKRSIPRSFSYLIWDI  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWPF  380
            IIAS  YY+AT+YF LLPH LSYLAWP 
Sbjct  61   IIASCFYYIATSYFSLLPHSLSYLAWPL  88



>gb|AAW63040.1| microsomal delta-12 oleate desaturase [Olea europaea]
Length=381

 Score =   202 bits (514),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 95/115 (83%), Positives = 100/115 (87%), Gaps = 0/115 (0%)
 Frame = +2

Query  368  GMALYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRH  547
            G ++YWI QGCV TGVWVIAHECGHHAFSDYQW+DDTVGLILHS LLVP+FSWKYSHRRH
Sbjct  85   GWSVYWILQGCVCTGVWVIAHECGHHAFSDYQWVDDTVGLILHSTLLVPYFSWKYSHRRH  144

Query  548  HSNTGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            HSNTGSLERDEVFVPK KS L W  KYLNNPPGR  TL+I LTL WPLYL  NVS
Sbjct  145  HSNTGSLERDEVFVPKPKSKLSWFTKYLNNPPGRVMTLVITLTLGWPLYLALNVS  199


 Score =   125 bits (314),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 70/86 (81%), Gaps = 1/86 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGR++VPA     K++ L+RVPY KPPFT+G+IKK IPPHCF+RS+LRSFSYVVYDL
Sbjct  1    MGAGGRLSVPATKAEEKKNPLKRVPYLKPPFTVGDIKKTIPPHCFKRSLLRSFSYVVYDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAW  374
             +    YY+AT+YFHLLP P SYL W
Sbjct  61   FLVFLFYYIATSYFHLLPSPFSYLGW  86



>gb|AAL37484.1|AF331163_1 delta-12 fatty acid desaturase [Gossypium hirsutum]
Length=384

 Score =   200 bits (509),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YW  QG VLTGVWVIAHECGHHAFSDYQW+DDTVGLILHS+LLVP+FSWKYSHRRHHSN
Sbjct  88   IYWTLQGSVLTGVWVIAHECGHHAFSDYQWIDDTVGLILHSSLLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK++S + W AKYLNNPPGR  T+ IQLTL WPLYL FNV+
Sbjct  148  TGSLERDEVFVPKKRSSIRWWAKYLNNPPGRFVTVTIQLTLGWPLYLAFNVA  199


 Score =   127 bits (319),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 71/87 (82%), Gaps = 1/87 (1%)
 Frame = +3

Query  120  MGAGGRMAVP-AEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM+VP ++ K     ++RVP +KPPFTL EIKKAIPPHCFQRS++RSFSY+VYD 
Sbjct  1    MGAGGRMSVPPSQRKQESGSMKRVPISKPPFTLSEIKKAIPPHCFQRSLIRSFSYLVYDF  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWP  377
            I+ S  YYVAT YFH LP PLS++AWP
Sbjct  61   ILVSIFYYVATTYFHNLPQPLSFVAWP  87



>emb|CDH92856.1| omega-6 fatty acid desaturase, partial [Sesamum radiatum]
Length=311

 Score =   199 bits (505),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YW  QGCV TG+WVIAHECGHHAFSDYQWLDDTVGLILHSALLVP+FSWKYSHRRHHSN
Sbjct  88   IYWAFQGCVCTGIWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK KS + W++KYLNNP GR  TL++ LTL WPLYL+FNVS
Sbjct  148  TGSLERDEVFVPKPKSRVSWYSKYLNNPLGRVITLVVTLTLGWPLYLLFNVS  199


 Score =   129 bits (323),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 70/87 (80%), Gaps = 1/87 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM+ P      K++ L RVPY KPPFTLG+IKKAIPPHCF+RSV RSFSYVVYDL
Sbjct  1    MGAGGRMSDPTTKDEQKKNPLHRVPYTKPPFTLGDIKKAIPPHCFERSVSRSFSYVVYDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWP  377
            +I   LYY+AT+Y HLLP P SYLAWP
Sbjct  61   VIVFLLYYIATSYIHLLPSPYSYLAWP  87



>gb|AFN53642.1| omega-6 desaturase [Linum usitatissimum]
Length=508

 Score =   207 bits (527),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YW CQGCVLTGVWV+AHECGHHAFSDYQWLDD VG +LHS L+VP+FSWK+SHRRHHSN
Sbjct  81   IYWACQGCVLTGVWVLAHECGHHAFSDYQWLDDLVGFVLHSCLMVPYFSWKHSHRRHHSN  140

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPKQKS +GWH+KYLNNPPGR  TL + LTL WPLYL FNVS
Sbjct  141  TGSLERDEVFVPKQKSAIGWHSKYLNNPPGRVLTLAVTLTLGWPLYLAFNVS  192


 Score =   120 bits (300),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = +3

Query  138  MAVPAEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDLIIASSLY  317
            MAVP   K   +  +R PY+KPPFTLGEIKKA+PPHCF+RS+ RSFSYV YDL IA+  Y
Sbjct  1    MAVPPSNKADSETFKRSPYSKPPFTLGEIKKAVPPHCFKRSIPRSFSYVAYDLTIAAIFY  60

Query  318  YVATNYFHLLPHPLSYLAWP  377
            Y+AT Y HLLP+PLSY+AWP
Sbjct  61   YIATTYIHLLPNPLSYVAWP  80



>gb|AAF78778.1| delta-12 oleate desaturase [Brassica napus]
Length=384

 Score =   203 bits (516),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW CQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  88   LYWACQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK+KSD+ W+ KYLNNP GR   L +Q TL WPLYL FNVS
Sbjct  148  TGSLERDEVFVPKKKSDIKWYGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVS  199


 Score =   124 bits (311),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 70/88 (80%), Gaps = 1/88 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM V    K S+ D ++RVP   PPFT+GE+KKAIPPHCF+RS+ RSFSY+++D+
Sbjct  1    MGAGGRMQVSPPSKKSETDTIKRVPCETPPFTVGELKKAIPPHCFKRSIPRSFSYLIWDI  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWPF  380
            IIAS  YYVAT YF LLPHPLSY AWP 
Sbjct  61   IIASCFYYVATTYFPLLPHPLSYFAWPL  88



>gb|AGN95842.1| fatty acid delta12-desturase FAD2-2 [Hiptage benghalensis]
Length=383

 Score =   199 bits (505),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +Y   QGC+LTGVWV+AHECGHHAFSDYQWLDDTVGL+LHS LLVP+FSWK+SHRRHHSN
Sbjct  88   IYGAVQGCILTGVWVVAHECGHHAFSDYQWLDDTVGLVLHSCLLVPYFSWKHSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPKQKS LGW+AKYL+NP GR  TL+I LTL WPLYL FNVS
Sbjct  148  TGSLERDEVFVPKQKSSLGWYAKYLDNPVGRLVTLIITLTLGWPLYLAFNVS  199


 Score =   129 bits (323),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 74/94 (79%), Gaps = 1/94 (1%)
 Frame = +3

Query  120  MGAGGRMAVP-AEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM+VP +  K+    L+RVP++KPPF+LGEIKKAIPPHCF+RSVLRSFSYVVYDL
Sbjct  1    MGAGGRMSVPPSPRKLESDALKRVPHSKPPFSLGEIKKAIPPHCFRRSVLRSFSYVVYDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWPFTGSARA  398
             IA  LYYVAT Y HLLP PLS  AW   G+ + 
Sbjct  61   TIAFLLYYVATEYIHLLPQPLSTAAWLIYGAVQG  94



>ref|XP_009146642.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
[Brassica rapa]
 gb|AFC41105.1| FAD2-1 [Brassica rapa]
Length=384

 Score =   203 bits (516),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW CQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  88   LYWACQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK+KSD+ W+ KYLNNP GR   L +Q TL WPLYL FNVS
Sbjct  148  TGSLERDEVFVPKKKSDIKWYGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVS  199


 Score =   124 bits (311),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 70/88 (80%), Gaps = 1/88 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM V    K S+ D ++RVP   PPFT+GE+KKAIPPHCF+RS+ RSFSY+++D+
Sbjct  1    MGAGGRMQVSPPSKKSETDNIKRVPCETPPFTVGELKKAIPPHCFKRSIPRSFSYLIWDI  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWPF  380
            IIAS  YYVAT YF LLPHPLSY AWP 
Sbjct  61   IIASCFYYVATTYFPLLPHPLSYFAWPL  88



>gb|ACP39502.1| delta-12 oleate desaturase [Brassica napus]
 gb|ACR47974.1| fatty acid desaturase [Brassica napus]
 gb|AFJ19031.1| fatty acid desaturase BnaC.FAD2.a [Brassica napus]
 gb|AGV77099.1| delta-12 oleate desaturase [Brassica napus]
Length=384

 Score =   203 bits (516),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW CQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  88   LYWACQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK+KSD+ W+ KYLNNP GR   L +Q TL WPLYL FNVS
Sbjct  148  TGSLERDEVFVPKKKSDIKWYGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVS  199


 Score =   124 bits (311),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 70/88 (80%), Gaps = 1/88 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM V    K S+ D ++RVP   PPFT+GE+KKAIPPHCF+RS+ RSFSY+++D+
Sbjct  1    MGAGGRMQVSPPSKKSETDTIKRVPCETPPFTVGELKKAIPPHCFKRSIPRSFSYLIWDI  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWPF  380
            IIAS  YYVAT YF LLPHPLSY AWP 
Sbjct  61   IIASCFYYVATTYFPLLPHPLSYFAWPL  88



>gb|ACN53524.1| fatty acid desaturase 2 [Brassica juncea]
Length=384

 Score =   203 bits (516),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW CQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  88   LYWACQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK+KSD+ W+ KYLNNP GR   L +Q TL WPLYL FNVS
Sbjct  148  TGSLERDEVFVPKKKSDIKWYGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVS  199


 Score =   124 bits (311),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 72/95 (76%), Gaps = 1/95 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM V    K S+ D ++RVP   PPFT+GE+KKAIPPHCF+RS+ RSFSY+++D+
Sbjct  1    MGAGGRMQVSPPSKKSETDTIKRVPCETPPFTVGELKKAIPPHCFKRSIPRSFSYLIWDI  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWPFTGSARAV  401
            IIAS  YYVAT YF LLPHPLSY AWP   + +  
Sbjct  61   IIASCFYYVATTYFPLLPHPLSYFAWPLYWACQGC  95



>gb|AFC41106.1| FAD2-1 [Brassica oleracea]
Length=384

 Score =   203 bits (516),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW CQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  88   LYWACQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK+KSD+ W+ KYLNNP GR   L +Q TL WPLYL FNVS
Sbjct  148  TGSLERDEVFVPKKKSDIKWYGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVS  199


 Score =   124 bits (311),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 72/95 (76%), Gaps = 1/95 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM V    K S+ D ++RVP   PPFT+GE+KKAIPPHCF+RS+ RSFSY+++D+
Sbjct  1    MGAGGRMQVSPPSKKSETDTIKRVPCETPPFTVGELKKAIPPHCFKRSIPRSFSYLIWDI  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWPFTGSARAV  401
            IIAS  YYVAT YF LLPHPLSY AWP   + +  
Sbjct  61   IIASCFYYVATTYFPLLPHPLSYFAWPLYWACQGC  95



>gb|ACP39504.1| delta-12 oleate desaturase [Brassica napus]
Length=384

 Score =   203 bits (516),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW CQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  88   LYWACQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK+KSD+ W+ KYLNNP GR   L +Q TL WPLYL FNVS
Sbjct  148  TGSLERDEVFVPKKKSDIKWYGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVS  199


 Score =   124 bits (311),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 72/95 (76%), Gaps = 1/95 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM V    K S+ D ++RVP   PPFT+GE+KKAIPPHCF+RS+ RSFSY+++D+
Sbjct  1    MGAGGRMQVSPPSKKSETDNIKRVPCETPPFTVGELKKAIPPHCFKRSIPRSFSYLIWDI  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWPFTGSARAV  401
            IIAS  YYVAT YF LLPHPLSY AWP   + +  
Sbjct  61   IIASCFYYVATTYFPLLPHPLSYFAWPLYWACQGC  95



>gb|AEQ28964.1| omega-6 desaturase [Linum grandiflorum]
Length=385

 Score =   205 bits (522),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YW CQGC+LTGVWV+AHECGHHAFSDYQWLDDTVG +LHS+LLVP+FSWK+SHRRHHSN
Sbjct  90   VYWACQGCILTGVWVLAHECGHHAFSDYQWLDDTVGFVLHSSLLVPYFSWKHSHRRHHSN  149

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSL+RDEVFVPKQK+++GW++KYLNNPPGR  TL + LTL WPLYL FNVS
Sbjct  150  TGSLDRDEVFVPKQKAEIGWYSKYLNNPPGRVITLAVTLTLGWPLYLAFNVS  201


 Score =   122 bits (305),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 70/89 (79%), Gaps = 3/89 (3%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSK---QDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVY  290
            MGAGGRM VP +   ++   + L+R PY+KPPFTLGEIKKAIPPHCF+RS+ RSF+YV  
Sbjct  1    MGAGGRMTVPPKSNNNEPKSKPLKRSPYSKPPFTLGEIKKAIPPHCFKRSIPRSFAYVAV  60

Query  291  DLIIASSLYYVATNYFHLLPHPLSYLAWP  377
            DL IA+  YY+AT Y HLLP PL+YLAWP
Sbjct  61   DLTIAAIFYYIATTYIHLLPSPLNYLAWP  89



>emb|CAD30827.1| fatty acid desaturase 2 [Brassica rapa]
 emb|CAG26981.1| fatty acid desaturase 2 [Brassica rapa]
 gb|ACP39503.1| delta-12 oleate desaturase [Brassica napus]
 gb|AEA76336.1| microsomal oleic acid desaturase [Brassica rapa subsp. pekinensis]
 gb|AFJ19030.1| fatty acid desaturase BnaA.FAD2.a [Brassica napus]
Length=384

 Score =   203 bits (516),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW CQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  88   LYWACQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK+KSD+ W+ KYLNNP GR   L +Q TL WPLYL FNVS
Sbjct  148  TGSLERDEVFVPKKKSDIKWYGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVS  199


 Score =   124 bits (311),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 72/95 (76%), Gaps = 1/95 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM V    K S+ D ++RVP   PPFT+GE+KKAIPPHCF+RS+ RSFSY+++D+
Sbjct  1    MGAGGRMQVSPPSKKSETDNIKRVPCETPPFTVGELKKAIPPHCFKRSIPRSFSYLIWDI  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWPFTGSARAV  401
            IIAS  YYVAT YF LLPHPLSY AWP   + +  
Sbjct  61   IIASCFYYVATTYFPLLPHPLSYFAWPLYWACQGC  95



>gb|ACN53522.1| fatty acid desaturase 2 [Brassica juncea]
 gb|ACN53523.1| fatty acid desaturase 2 [Brassica juncea]
Length=384

 Score =   203 bits (516),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW CQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  88   LYWACQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK+KSD+ W+ KYLNNP GR   L +Q TL WPLYL FNVS
Sbjct  148  TGSLERDEVFVPKKKSDIKWYGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVS  199


 Score =   124 bits (311),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 70/88 (80%), Gaps = 1/88 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM V    K S+ D ++RVP   PPFT+GE+KKAIPPHCF+RS+ RSFSY+++D+
Sbjct  1    MGAGGRMQVSPPSKKSETDTIKRVPCETPPFTVGELKKAIPPHCFKRSIPRSFSYLIWDI  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWPF  380
            IIAS  YYVAT YF LLPHPLSY AWP 
Sbjct  61   IIASCFYYVATTYFPLLPHPLSYFAWPL  88



>gb|ADK70952.1| fatty acid desaturase 2-1 [Brassica juncea]
 gb|ADK70953.1| fatty acid desaturase 2-1 [Brassica juncea]
Length=368

 Score =   202 bits (515),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW CQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  88   LYWACQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK+KSD+ W+ KYLNNP GR   L +Q TL WPLYL FNVS
Sbjct  148  TGSLERDEVFVPKKKSDIKWYGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVS  199


 Score =   124 bits (311),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 72/95 (76%), Gaps = 1/95 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM V    K S+ D ++RVP   PPFT+GE+KKAIPPHCF+RS+ RSFSY+++D+
Sbjct  1    MGAGGRMQVSPPSKKSETDTIKRVPCETPPFTVGELKKAIPPHCFKRSIPRSFSYLIWDI  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWPFTGSARAV  401
            IIAS  YYVAT YF LLPHPLSY AWP   + +  
Sbjct  61   IIASCFYYVATTYFPLLPHPLSYFAWPLYWACQGC  95



>gb|ABG76201.1| delta 12 desaturase [Brassica napus]
Length=384

 Score =   203 bits (516),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW CQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  88   LYWACQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK+KSD+ W+ KYLNNP GR   L +Q TL WPLYL FNVS
Sbjct  148  TGSLERDEVFVPKKKSDIKWYGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVS  199


 Score =   124 bits (311),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 70/88 (80%), Gaps = 1/88 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM V    K S+ D ++RVP   PPFT+GE+KKAIPPHCF+RS+ RSFSY+++D+
Sbjct  1    MGAGGRMQVSPPSKKSETDTIKRVPCETPPFTVGELKKAIPPHCFKRSIPRSFSYLIWDI  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWPF  380
            IIAS  YYVAT YF LLPHPLSY AWP 
Sbjct  61   IIASCFYYVATTYFPLLPHPLSYFAWPL  88



>ref|XP_006492862.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like isoform X1 [Citrus sinensis]
 ref|XP_006492863.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like isoform X2 [Citrus sinensis]
 gb|KDO70932.1| hypothetical protein CISIN_1g0167812mg [Citrus sinensis]
Length=383

 Score =   201 bits (510),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YW  QGC+LTGVWV+AHECGHHAFSDYQWLDDTVGLILHS LLVP+FSWKYSHRRHHSN
Sbjct  88   VYWALQGCILTGVWVVAHECGHHAFSDYQWLDDTVGLILHSCLLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSL+RDEVFVPKQK+ +GW+AKYLNNP GR  TL + LTL WPLYL FNVS
Sbjct  148  TGSLDRDEVFVPKQKTAIGWYAKYLNNPLGRVITLTVTLTLGWPLYLAFNVS  199


 Score =   126 bits (316),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 61/87 (70%), Positives = 70/87 (80%), Gaps = 1/87 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAE-GKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRMAVP+   K+    L+RVP +KPPFTL ++KKAIPPHCF+RSVLRSFSYVV+DL
Sbjct  1    MGAGGRMAVPSTPMKVDSDPLKRVPCSKPPFTLSQVKKAIPPHCFERSVLRSFSYVVHDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWP  377
             IA   YY+A  Y H LPHPLSYLAWP
Sbjct  61   TIAFVFYYIADTYIHQLPHPLSYLAWP  87



>ref|XP_002309307.2| hypothetical protein POPTR_0006s20640g [Populus trichocarpa]
 gb|EEE92830.2| hypothetical protein POPTR_0006s20640g [Populus trichocarpa]
Length=462

 Score =   189 bits (479),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 88/112 (79%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YW  QGCVLTGVWVIAHECGHHAFSDYQ LDD VGL+LHS LLVP+FSWK+SHRRHHSN
Sbjct  162  IYWAVQGCVLTGVWVIAHECGHHAFSDYQLLDDIVGLVLHSCLLVPYFSWKHSHRRHHSN  221

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSL+RDEVFVPK+KS + W++KYLNNP GR  T+ I LTL WPLYL FNVS
Sbjct  222  TGSLDRDEVFVPKKKSGIRWYSKYLNNPLGRFLTITITLTLGWPLYLAFNVS  273


 Score =   138 bits (347),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 74/88 (84%), Gaps = 1/88 (1%)
 Frame = +3

Query  120  MGAGGRMAVP-AEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM+VP +  K+     +R P +KPPFTLG+IKKAIPPHCFQRSVLRSFSYV +DL
Sbjct  75   MGAGGRMSVPPSSAKVESDVFKRAPDSKPPFTLGQIKKAIPPHCFQRSVLRSFSYVAHDL  134

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWPF  380
            IIAS  YYVATNYFHLLPHPLSY+AWP 
Sbjct  135  IIASIFYYVATNYFHLLPHPLSYVAWPI  162



>gb|KDO70931.1| hypothetical protein CISIN_1g0167812mg [Citrus sinensis]
Length=338

 Score =   200 bits (509),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YW  QGC+LTGVWV+AHECGHHAFSDYQWLDDTVGLILHS LLVP+FSWKYSHRRHHSN
Sbjct  88   VYWALQGCILTGVWVVAHECGHHAFSDYQWLDDTVGLILHSCLLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSL+RDEVFVPKQK+ +GW+AKYLNNP GR  TL + LTL WPLYL FNVS
Sbjct  148  TGSLDRDEVFVPKQKTAIGWYAKYLNNPLGRVITLTVTLTLGWPLYLAFNVS  199


 Score =   126 bits (317),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 61/87 (70%), Positives = 70/87 (80%), Gaps = 1/87 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAE-GKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRMAVP+   K+    L+RVP +KPPFTL ++KKAIPPHCF+RSVLRSFSYVV+DL
Sbjct  1    MGAGGRMAVPSTPMKVDSDPLKRVPCSKPPFTLSQVKKAIPPHCFERSVLRSFSYVVHDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWP  377
             IA   YY+A  Y H LPHPLSYLAWP
Sbjct  61   TIAFVFYYIADTYIHQLPHPLSYLAWP  87



>gb|AFJ53078.1| fatty acid desaturase 2 [Linum usitatissimum]
 gb|AFJ53079.1| fatty acid desaturase 2 [Linum usitatissimum]
 gb|AFJ53080.1| fatty acid desaturase 2 [Linum usitatissimum]
 gb|AFJ53081.1| fatty acid desaturase 2 [Linum usitatissimum]
 gb|AFJ53082.1| fatty acid desaturase 2 [Linum usitatissimum]
 gb|AFJ53083.1| fatty acid desaturase 2 [Linum usitatissimum]
 gb|AFJ53084.1| fatty acid desaturase 2 [Linum usitatissimum]
 gb|AFJ53085.1| fatty acid desaturase 2 [Linum usitatissimum]
 gb|AFJ53086.1| fatty acid desaturase 2 [Linum usitatissimum]
 gb|AFJ53087.1| fatty acid desaturase 2 [Linum usitatissimum]
Length=378

 Score =   203 bits (516),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 89/112 (79%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YW CQGC+LTGVWV+AHECGHHAFSDYQWLDD VG +LHS+LLVP+FSWK+SHRRHHSN
Sbjct  83   VYWACQGCILTGVWVLAHECGHHAFSDYQWLDDMVGFVLHSSLLVPYFSWKHSHRRHHSN  142

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSL+RDEVFVPKQK+++GW++KYLNNPPGR  TL + LTL WPLYL FNVS
Sbjct  143  TGSLDRDEVFVPKQKAEIGWYSKYLNNPPGRVITLAVTLTLGWPLYLAFNVS  194


 Score =   124 bits (310),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 70/86 (81%), Gaps = 4/86 (5%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDLI  299
            MGAGGRM VP     S + ++R PY+KPPFTLGE+KKAIPPHCF+RS+ RSF+YV YDL 
Sbjct  1    MGAGGRMPVPP----SSKPMKRSPYSKPPFTLGELKKAIPPHCFKRSIPRSFAYVAYDLT  56

Query  300  IASSLYYVATNYFHLLPHPLSYLAWP  377
            IA+  YY+AT YFHLLP PL+YLAWP
Sbjct  57   IAAIFYYIATTYFHLLPSPLNYLAWP  82



>dbj|BAC22091.1| delta-12 desaturase [Spinacia oleracea]
Length=382

 Score =   194 bits (494),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +Y   QGCVLTGVWVIAHECGHHAFSDYQWLDDTVGL+LHS LLVP+FSWKYSHRRHHSN
Sbjct  87   VYGFVQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLVLHSFLLVPYFSWKYSHRRHHSN  146

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGS+E+DEVFVP++K ++ W +KYL+NPPGR  TL++ LTL WPLYL+FNVS
Sbjct  147  TGSMEKDEVFVPQRKENMSWFSKYLSNPPGRILTLVVTLTLGWPLYLLFNVS  198


 Score =   132 bits (332),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 64/89 (72%), Positives = 68/89 (76%), Gaps = 0/89 (0%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDLI  299
            MGAGGR   P+  K     L RVPY KPPFTLG+IKKAIPPHCF+RSVLRSFSYVVYD  
Sbjct  1    MGAGGRSIPPSARKEKSDALNRVPYEKPPFTLGQIKKAIPPHCFKRSVLRSFSYVVYDFT  60

Query  300  IASSLYYVATNYFHLLPHPLSYLAWPFTG  386
            IA  LYYVATNY HLLP P +YLAWP  G
Sbjct  61   IAFLLYYVATNYIHLLPKPFNYLAWPVYG  89



>ref|XP_004170289.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum-like, 
partial [Cucumis sativus]
Length=242

 Score =   206 bits (524),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 95/113 (84%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = +2

Query  374  ALYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHS  553
            ALYW  QGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHS L+VP+FSWKYSHRRHHS
Sbjct  87   ALYWAAQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSFLMVPYFSWKYSHRRHHS  146

Query  554  NTGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            NTGSLERDEVFVPKQKSD+ W++ Y+NNP GR  TL IQL L WPLYL FNVS
Sbjct  147  NTGSLERDEVFVPKQKSDMKWYSTYINNPVGRVLTLTIQLVLGWPLYLAFNVS  199


 Score =   120 bits (302),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 70/94 (74%), Gaps = 1/94 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM+ P+  K +  D L+RVP  KPPFTLGE+KKAIPPHCFQRSVLRSFSYVVYDL
Sbjct  1    MGAGGRMSSPSSLKKTDSDHLKRVPSTKPPFTLGELKKAIPPHCFQRSVLRSFSYVVYDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWPFTGSARA  398
             +AS  YY+AT YF  LP  L Y AW    +A+ 
Sbjct  61   TLASIFYYIATTYFQNLPSLLFYPAWALYWAAQG  94



>gb|AGO32050.1| microsomal oleate desaturase [Xanthoceras sorbifolium]
Length=383

 Score =   202 bits (515),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YWI QGC LTGVWVIAHECGHHAFSD+QW+DDTVGL+LHSALLVP+FSWKYSHRRHHSN
Sbjct  88   IYWILQGCNLTGVWVIAHECGHHAFSDHQWVDDTVGLVLHSALLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK K+++ W +KYLNNPPGRA TL+I LTL WPLYL FNVS
Sbjct  148  TGSLERDEVFVPKTKAEIPWFSKYLNNPPGRAVTLVITLTLGWPLYLAFNVS  199


 Score =   124 bits (311),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 69/87 (79%), Gaps = 1/87 (1%)
 Frame = +3

Query  120  MGAGGRM-AVPAEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM A  +E       +QRVP+ KPPFTL +IKKAIPPHCFQRS++RSFSYVVYDL
Sbjct  1    MGAGGRMSASSSENGEKGSSIQRVPHTKPPFTLSQIKKAIPPHCFQRSLVRSFSYVVYDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWP  377
             +A  LYY+ATNYFH LP P +YLAWP
Sbjct  61   CLAFLLYYIATNYFHPLPSPYAYLAWP  87



>gb|AAD19742.1| delta-12 desaturase [Brassica carinata]
Length=384

 Score =   202 bits (515),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW CQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  88   LYWACQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK+KSD+ W+ KYLNNP GR   L +Q TL WPLYL FNVS
Sbjct  148  TGSLERDEVFVPKKKSDIKWYGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVS  199


 Score =   124 bits (310),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 73/95 (77%), Gaps = 1/95 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM V    K S+ D ++RVP   PPFT+GE+KKAIPPHCF+RS+ RSFSY+++D+
Sbjct  1    MGAGGRMQVSPSPKKSETDTIKRVPCETPPFTVGELKKAIPPHCFKRSIPRSFSYLIWDI  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWPFTGSARAV  401
            I+AS  YYVAT YF LLPHPLSY+AWP   + +  
Sbjct  61   IVASCFYYVATTYFPLLPHPLSYIAWPLYWACQGC  95



>ref|XP_004136572.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Cucumis sativus]
 gb|KGN59307.1| hypothetical protein Csa_3G808360 [Cucumis sativus]
Length=382

 Score =   205 bits (522),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 95/113 (84%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = +2

Query  374  ALYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHS  553
            ALYW  QGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHS L+VP+FSWKYSHRRHHS
Sbjct  87   ALYWAAQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSFLMVPYFSWKYSHRRHHS  146

Query  554  NTGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            NTGSLERDEVFVPKQKSD+ W++ Y+NNP GR  TL IQL L WPLYL FNVS
Sbjct  147  NTGSLERDEVFVPKQKSDMKWYSTYINNPVGRVLTLTIQLVLGWPLYLAFNVS  199


 Score =   121 bits (303),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 70/94 (74%), Gaps = 1/94 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM+ P+  K +  D L+RVP  KPPFTLGE+KKAIPPHCFQRSVLRSFSYVVYDL
Sbjct  1    MGAGGRMSSPSSLKKTDSDHLKRVPSTKPPFTLGELKKAIPPHCFQRSVLRSFSYVVYDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWPFTGSARA  398
             +AS  YY+AT YF  LP  L Y AW    +A+ 
Sbjct  61   TLASIFYYIATTYFQNLPSLLFYPAWALYWAAQG  94



>ref|XP_006429873.1| hypothetical protein CICLE_v10011949mg [Citrus clementina]
 gb|ESR43113.1| hypothetical protein CICLE_v10011949mg [Citrus clementina]
Length=383

 Score =   201 bits (510),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YW  QGC+LTGVWV+AHECGHHAFSDYQWLDDTVGLILHS LLVP+FSWKYSHRRHHSN
Sbjct  88   VYWALQGCILTGVWVVAHECGHHAFSDYQWLDDTVGLILHSCLLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSL+RDEVFVPKQK+ +GW+AKYLNNP GR  TL + LTL WPLYL FNVS
Sbjct  148  TGSLDRDEVFVPKQKTAIGWYAKYLNNPLGRVITLTVTLTLGWPLYLAFNVS  199


 Score =   126 bits (316),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 61/87 (70%), Positives = 70/87 (80%), Gaps = 1/87 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAE-GKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRMAVP+   K+    L+RVP +KPPFTL ++KKAIPPHCF+RSVLRSFSYVV+DL
Sbjct  1    MGAGGRMAVPSTPMKVDSDPLKRVPCSKPPFTLSQVKKAIPPHCFERSVLRSFSYVVHDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWP  377
             IA   YY+A  Y H LPHPLSYLAWP
Sbjct  61   TIAFIFYYIADTYIHQLPHPLSYLAWP  87



>gb|ADN10829.1| fatty acid desaturase [Camelina hispida]
Length=384

 Score =   204 bits (519),  Expect(2) = 3e-80, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW CQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  89   LYWACQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  148

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPKQKS + W+ KYLNNPPGR   L +Q  L WPLYL FNVS
Sbjct  149  TGSLERDEVFVPKQKSAIKWYGKYLNNPPGRIMMLTVQFVLGWPLYLAFNVS  200


 Score =   122 bits (307),  Expect(2) = 3e-80, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 72/96 (75%), Gaps = 2/96 (2%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD--LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYD  293
            MGAGGRM VP+      +   ++RVP  KPPFT+GE+KKAIPPHCF+RS+ RSFSY++ D
Sbjct  1    MGAGGRMPVPSSSSKKSETNAIKRVPCEKPPFTVGELKKAIPPHCFKRSIPRSFSYLITD  60

Query  294  LIIASSLYYVATNYFHLLPHPLSYLAWPFTGSARAV  401
            +IIAS  YYVATNYF LLP PLSYLAWP   + +  
Sbjct  61   IIIASCFYYVATNYFSLLPQPLSYLAWPLYWACQGC  96



>gb|AAM61113.1| omega-6 fatty acid desaturase, endoplasmic reticulum (FAD2) [Arabidopsis 
thaliana]
Length=383

 Score =   199 bits (507),  Expect(2) = 3e-80, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW CQGCVLTG+WVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  88   LYWACQGCVLTGIWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPKQKS + W+ KYLNNP GR   L +Q  L WPLYL FNVS
Sbjct  148  TGSLERDEVFVPKQKSAIKWYGKYLNNPLGRIMMLTVQFVLGWPLYLAFNVS  199


 Score =   127 bits (318),  Expect(2) = 3e-80, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 73/95 (77%), Gaps = 1/95 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQDL-QRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM VP   K S+ D  +RVP  KPPF++G++KKAIPPHCF+RS+ RSFSY++ D+
Sbjct  1    MGAGGRMPVPTSSKKSETDTTKRVPCEKPPFSVGDLKKAIPPHCFKRSIPRSFSYLISDI  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWPFTGSARAV  401
            IIAS  YYVATNYF LLP PLSYLAWP   + +  
Sbjct  61   IIASCFYYVATNYFSLLPQPLSYLAWPLYWACQGC  95



>ref|NP_187819.1| omega-6 fatty acid desaturase [Arabidopsis thaliana]
 ref|NP_001078140.1| omega-6 fatty acid desaturase [Arabidopsis thaliana]
 sp|P46313.1|FAD6E_ARATH RecName: Full=Omega-6 fatty acid desaturase, endoplasmic reticulum; 
AltName: Full=Delta(12) desaturase [Arabidopsis thaliana]
 gb|AAG51042.1|AC069473_4 omega-6 fatty acid desaturase, endoplasmic reticulum (FAD2); 
20389-21540 [Arabidopsis thaliana]
 gb|AAA32782.1| delta-12 desaturase [Arabidopsis thaliana]
 dbj|BAB01960.1| omega-6 fatty acid desaturase, endoplasmic reticulum (delta-12 
desaturase) [Arabidopsis thaliana]
 gb|AAK62627.1| AT3g12120/T21B14_107 [Arabidopsis thaliana]
 gb|AAM98321.1| At3g12120/T21B14_107 [Arabidopsis thaliana]
 gb|AEE75152.1| omega-6 fatty acid desaturase [Arabidopsis thaliana]
 gb|AEE75153.1| omega-6 fatty acid desaturase [Arabidopsis thaliana]
Length=383

 Score =   199 bits (507),  Expect(2) = 3e-80, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW CQGCVLTG+WVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  88   LYWACQGCVLTGIWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPKQKS + W+ KYLNNP GR   L +Q  L WPLYL FNVS
Sbjct  148  TGSLERDEVFVPKQKSAIKWYGKYLNNPLGRIMMLTVQFVLGWPLYLAFNVS  199


 Score =   127 bits (318),  Expect(2) = 3e-80, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 71/88 (81%), Gaps = 1/88 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQDL-QRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM VP   K S+ D  +RVP  KPPF++G++KKAIPPHCF+RS+ RSFSY++ D+
Sbjct  1    MGAGGRMPVPTSSKKSETDTTKRVPCEKPPFSVGDLKKAIPPHCFKRSIPRSFSYLISDI  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWPF  380
            IIAS  YYVATNYF LLP PLSYLAWP 
Sbjct  61   IIASCFYYVATNYFSLLPQPLSYLAWPL  88



>gb|AIA21666.1| oleate desaturase [Crambe kralikii]
Length=384

 Score =   203 bits (516),  Expect(2) = 3e-80, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW CQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  88   LYWACQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK+KSD+ W+ KYLNNP GR   L +Q TL WPLYL FNVS
Sbjct  148  TGSLERDEVFVPKKKSDIKWYGKYLNNPLGRTLMLTVQFTLGWPLYLAFNVS  199


 Score =   123 bits (308),  Expect(2) = 3e-80, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 71/88 (81%), Gaps = 1/88 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM V    K S+ D L+RVP   PPFT+GE+KKAIPPHCF+RS+ RSFSY+++D+
Sbjct  1    MGAGGRMQVSPSPKKSETDTLKRVPCETPPFTVGELKKAIPPHCFKRSIPRSFSYLIWDI  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWPF  380
            II+SS YY++T YF LLPHPLSY AWP 
Sbjct  61   IISSSFYYLSTTYFPLLPHPLSYFAWPL  88



>gb|ADZ39687.1| microsomal delta-12 oleate desaturase [Olea europaea subsp. europaea]
Length=381

 Score =   200 bits (509),  Expect(2) = 3e-80, Method: Compositional matrix adjust.
 Identities = 94/115 (82%), Positives = 100/115 (87%), Gaps = 0/115 (0%)
 Frame = +2

Query  368  GMALYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRH  547
            G ++YWI QGCV TGVWVIAHECGHHAFSDYQW+DDTVGLILHS LLVP+FSWKYSHRRH
Sbjct  85   GWSVYWILQGCVCTGVWVIAHECGHHAFSDYQWVDDTVGLILHSTLLVPYFSWKYSHRRH  144

Query  548  HSNTGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
             SNTGSLERDEVFVPK +S L W  KYLNNPPGR  TL+I LTL WPLYL FNVS
Sbjct  145  PSNTGSLERDEVFVPKPRSKLSWFTKYLNNPPGRVMTLVITLTLGWPLYLAFNVS  199


 Score =   125 bits (315),  Expect(2) = 3e-80, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 71/86 (83%), Gaps = 1/86 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGR++VPA     K++ L+RVPY+KPPFT+G+IKK IPPHCF+RS+LRSFSYVVYDL
Sbjct  1    MGAGGRLSVPATKAEEKKNPLKRVPYSKPPFTVGDIKKIIPPHCFKRSLLRSFSYVVYDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAW  374
             +    YY+AT+YFHLLP P SYL W
Sbjct  61   FLVFLFYYIATSYFHLLPSPFSYLGW  86



>gb|AIA21646.1| oleate desaturase [Crambe hispanica subsp. abyssinica]
Length=383

 Score =   204 bits (518),  Expect(2) = 3e-80, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW+CQGCVLTG+WVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  88   LYWVCQGCVLTGIWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK+KSD+ W+ KYLNNP GR   L +Q TL WPLYL FNVS
Sbjct  148  TGSLERDEVFVPKKKSDIKWYGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVS  199


 Score =   122 bits (306),  Expect(2) = 3e-80, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 69/88 (78%), Gaps = 1/88 (1%)
 Frame = +3

Query  120  MGAGGRMAV-PAEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM V P+        L+RVP   PPFTLG++KKAIPPHCF+RS+ RSFSY+++D+
Sbjct  1    MGAGGRMQVSPSPQNSETNTLKRVPSETPPFTLGDLKKAIPPHCFKRSIPRSFSYLIWDI  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWPF  380
            IIAS  YY+ATN+F LLPH LSYLAWP 
Sbjct  61   IIASCFYYIATNHFSLLPHSLSYLAWPL  88



>gb|ABI96919.1| delta-12 fatty acid desaturase [Triadica sebifera]
Length=381

 Score =   194 bits (494),  Expect(2) = 4e-80, Method: Compositional matrix adjust.
 Identities = 89/112 (79%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YW  QGCVLTGVWVIAHECGHHAFSDY+ LDD VGLILHS+LLVP+FSWK+SHRRHHSN
Sbjct  88   IYWAVQGCVLTGVWVIAHECGHHAFSDYRLLDDIVGLILHSSLLVPYFSWKHSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSL++DEVFVPK+KS + W++KYLNNPPGR  TL+I LTL WPLYL FNVS
Sbjct  148  TGSLDKDEVFVPKKKSSIPWYSKYLNNPPGRFLTLVITLTLGWPLYLAFNVS  199


 Score =   131 bits (330),  Expect(2) = 4e-80, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 75/87 (86%), Gaps = 1/87 (1%)
 Frame = +3

Query  120  MGAGGRMAVP-AEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM+VP +  K+  + L+RVP +KPPFTLG+IKKAIPPHCF+RS LRSFSYVV+DL
Sbjct  1    MGAGGRMSVPPSPKKLESEVLKRVPVSKPPFTLGQIKKAIPPHCFKRSALRSFSYVVHDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWP  377
            II+  LYY+ATNYF LLP PLSY+AWP
Sbjct  61   IISFILYYIATNYFQLLPRPLSYVAWP  87



>gb|ACP39505.1| delta-12 oleate desaturase [Brassica napus]
Length=384

 Score =   203 bits (517),  Expect(2) = 4e-80, Method: Compositional matrix adjust.
 Identities = 94/113 (83%), Positives = 100/113 (88%), Gaps = 0/113 (0%)
 Frame = +2

Query  374  ALYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHS  553
            +LYW CQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHS
Sbjct  87   SLYWACQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHS  146

Query  554  NTGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            NTGSLERDEVFVPK+KSD+ W+ KYLNNP GR   L +Q TL WPLYL FNVS
Sbjct  147  NTGSLERDEVFVPKKKSDIKWYGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVS  199


 Score =   122 bits (307),  Expect(2) = 4e-80, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 69/86 (80%), Gaps = 1/86 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM V    K S+ D ++RVP   PPFT+GE+KKAIPPHCF+RS+ RSFSY+++D+
Sbjct  1    MGAGGRMQVSPPSKKSETDNIKRVPCETPPFTVGELKKAIPPHCFKRSIPRSFSYLIWDI  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAW  374
            IIAS  YYVAT YF LLPHPLSY AW
Sbjct  61   IIASCFYYVATTYFPLLPHPLSYFAW  86



>gb|ACF49508.1| omega-6 desaturase [Linum usitatissimum]
Length=378

 Score =   203 bits (516),  Expect(2) = 4e-80, Method: Compositional matrix adjust.
 Identities = 89/112 (79%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YW CQGC+LTGVWV+AHECGHHAFSDYQWLDD VG +LHS+LLVP+FSWK+SHRRHHSN
Sbjct  83   VYWACQGCILTGVWVLAHECGHHAFSDYQWLDDMVGFVLHSSLLVPYFSWKHSHRRHHSN  142

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSL+RDEVFVPKQK+++GW++KYLNNPPGR  TL + LTL WPLYL FNVS
Sbjct  143  TGSLDRDEVFVPKQKAEIGWYSKYLNNPPGRVITLAVTLTLGWPLYLAFNVS  194


 Score =   123 bits (308),  Expect(2) = 4e-80, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 70/86 (81%), Gaps = 4/86 (5%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDLI  299
            MGAGGRM+VP   +     ++R PY+KPPFTLGE+KKAIPPHCF+RS+ RSF+YV YDL 
Sbjct  1    MGAGGRMSVPPPSR----PMKRSPYSKPPFTLGELKKAIPPHCFKRSIPRSFAYVAYDLT  56

Query  300  IASSLYYVATNYFHLLPHPLSYLAWP  377
            IA+  YY+AT YFHLLP PL+YLAWP
Sbjct  57   IAAIFYYIATTYFHLLPSPLNYLAWP  82



>gb|ADN10834.1| fatty acid desaturase [Camelina rumelica]
Length=384

 Score =   204 bits (518),  Expect(2) = 4e-80, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW CQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  89   LYWACQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  148

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPKQKS + W+ KYLNNPPGR   L +Q  L WPLYL FNVS
Sbjct  149  TGSLERDEVFVPKQKSAIKWYGKYLNNPPGRIMMLTVQFVLGWPLYLAFNVS  200


 Score =   122 bits (305),  Expect(2) = 4e-80, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 72/96 (75%), Gaps = 2/96 (2%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD--LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYD  293
            MGAGGRM VP+      +   ++RVP  KPPFT+GE+KKAIPPHCF+RS+ RSFSY++ D
Sbjct  1    MGAGGRMPVPSSSSKKSETDAIKRVPCEKPPFTVGELKKAIPPHCFKRSIPRSFSYLITD  60

Query  294  LIIASSLYYVATNYFHLLPHPLSYLAWPFTGSARAV  401
            +I+AS  YYVATNYF LLP PLSYLAWP   + +  
Sbjct  61   IIVASCFYYVATNYFSLLPQPLSYLAWPLYWACQGC  96



>ref|NP_001237865.1| microsomal oleate desaturase FAD2-4 [Glycine max]
 gb|ABF84063.1| microsomal oleate desaturase FAD2-3 [Glycine max]
Length=383

 Score =   196 bits (497),  Expect(2) = 4e-80, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YW  QGC+LTGVWVIAHECGHHAFSDYQ LDD VGL+LHS LLVP+FSWKYSHRRHHSN
Sbjct  88   IYWAVQGCILTGVWVIAHECGHHAFSDYQLLDDIVGLVLHSGLLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPKQKS + W++KYLNNPPGR  TL + LTL WPLYL  NVS
Sbjct  148  TGSLERDEVFVPKQKSCIKWYSKYLNNPPGRVLTLAVTLTLGWPLYLALNVS  199


 Score =   130 bits (326),  Expect(2) = 4e-80, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 71/87 (82%), Gaps = 1/87 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGR  VP   + S+ D L+RVP+ KPPF+L +IKK IPPHCFQRSV RSFSYVVYDL
Sbjct  1    MGAGGRTDVPPANRKSEVDPLKRVPFEKPPFSLSQIKKVIPPHCFQRSVFRSFSYVVYDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWP  377
             IA  LYYVAT+YFHLLP PLS+LAWP
Sbjct  61   TIAFCLYYVATHYFHLLPSPLSFLAWP  87



>ref|XP_004304366.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Fragaria vesca subsp. vesca]
Length=382

 Score =   206 bits (523),  Expect(2) = 4e-80, Method: Compositional matrix adjust.
 Identities = 97/112 (87%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YW  QGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHS LLVP+FSWKYSHRRHHSN
Sbjct  88   IYWALQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSFLLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPKQKS +GW +KYLNNPPGR  TL I LTL WPLYL FNVS
Sbjct  148  TGSLERDEVFVPKQKSAMGWWSKYLNNPPGRVLTLAITLTLGWPLYLAFNVS  199


 Score =   120 bits (300),  Expect(2) = 4e-80, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 70/87 (80%), Gaps = 1/87 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM+ P   K ++ D ++RVP+ KPPFTLG++KKAIPPHCFQRSV+ SFSY+VYD 
Sbjct  1    MGAGGRMSAPPTRKSAETDNIKRVPHLKPPFTLGQVKKAIPPHCFQRSVIHSFSYIVYDF  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWP  377
             IAS  YY+A+NY + L  PLS+LAWP
Sbjct  61   AIASIFYYIASNYINNLSAPLSFLAWP  87



>dbj|BAD89862.1| microsomal omega-6 fatty acid desaturase [Glycine max]
Length=383

 Score =   196 bits (497),  Expect(2) = 5e-80, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YW  QGC+LTGVWVIAHECGHHAFSDYQ LDD VGL+LHS LLVP+FSWKYSHRRHHSN
Sbjct  88   IYWAVQGCILTGVWVIAHECGHHAFSDYQLLDDIVGLVLHSGLLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPKQKS + W++KYLNNPPGR  TL + LTL WPLYL  NVS
Sbjct  148  TGSLERDEVFVPKQKSCIKWYSKYLNNPPGRVLTLAVTLTLGWPLYLALNVS  199


 Score =   130 bits (326),  Expect(2) = 5e-80, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 71/87 (82%), Gaps = 1/87 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGR  VP   + S+ D L+RVP+ KPPF+L +IKK IPPHCFQRSV RSFSYVVYDL
Sbjct  1    MGAGGRTDVPPANRKSEVDPLKRVPFEKPPFSLSQIKKVIPPHCFQRSVFRSFSYVVYDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWP  377
             IA  LYYVAT+YFHLLP PLS+LAWP
Sbjct  61   TIAFCLYYVATHYFHLLPSPLSFLAWP  87



>gb|KHN07428.1| Omega-6 fatty acid desaturase, endoplasmic reticulum isozyme 
2 [Glycine soja]
Length=383

 Score =   196 bits (497),  Expect(2) = 5e-80, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YW  QGC+LTGVWVIAHECGHHAFSDYQ LDD VGL+LHS LLVP+FSWKYSHRRHHSN
Sbjct  88   IYWAVQGCILTGVWVIAHECGHHAFSDYQLLDDIVGLVLHSGLLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPKQKS + W++KYLNNPPGR  TL + LTL WPLYL  NVS
Sbjct  148  TGSLERDEVFVPKQKSCIKWYSKYLNNPPGRVLTLAVTLTLGWPLYLALNVS  199


 Score =   130 bits (326),  Expect(2) = 5e-80, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 71/87 (82%), Gaps = 1/87 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGR  VP   + S+ D L+RVP+ KPPF+L +IKK IPPHCFQRSV RSFSYVVYDL
Sbjct  1    MGAGGRTDVPPANRKSEVDPLKRVPFEKPPFSLSQIKKVIPPHCFQRSVFRSFSYVVYDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWP  377
             IA  LYYVAT+YFHLLP PLS+LAWP
Sbjct  61   TIAFCLYYVATHYFHLLPSPLSFLAWP  87



>gb|AAC31698.1| delta-12 fatty acid desaturase [Borago officinalis]
Length=383

 Score =   194 bits (493),  Expect(2) = 5e-80, Method: Compositional matrix adjust.
 Identities = 95/112 (85%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW CQG VLTGVWVIAHECGHHAFSDYQWLDDTVGL+LHSALLVP+FSWKYSHRRHHSN
Sbjct  88   LYWFCQGSVLTGVWVIAHECGHHAFSDYQWLDDTVGLLLHSALLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK++S + W ++YLNNPPGR   LL+QLTL WPLYLMFNVS
Sbjct  148  TGSLERDEVFVPKKRSGISWSSEYLNNPPGRVLVLLVQLTLGWPLYLMFNVS  199


 Score =   131 bits (330),  Expect(2) = 5e-80, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 71/88 (81%), Gaps = 1/88 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQDL-QRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MG GGRM VP +GK SK D+ QRVP  KPPFT+G++KK IPPHCFQRSVL SFSYVVYDL
Sbjct  1    MGGGGRMPVPTKGKKSKSDVFQRVPSEKPPFTVGDLKKVIPPHCFQRSVLHSFSYVVYDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWPF  380
            +IA+  +Y A+ Y HL PHPLSY+AWP 
Sbjct  61   VIAALFFYTASRYIHLQPHPLSYVAWPL  88



>ref|NP_001238358.1| omega-6 fatty acid desaturase, endoplasmic reticulum isozyme 
2 [Glycine max]
 sp|P48631.1|FD6E2_SOYBN RecName: Full=Omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2 [Glycine max]
 gb|AAB00860.1| microsomal omega-6 desaturase [Glycine max]
Length=383

 Score =   204 bits (520),  Expect(2) = 5e-80, Method: Compositional matrix adjust.
 Identities = 95/115 (83%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = +2

Query  368  GMALYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRH  547
            GMA+YW  QGC+LTGVWVIAHECGHHAFSDYQ LDD VGLILHSALLVP+FSWKYSHRRH
Sbjct  85   GMAIYWAVQGCILTGVWVIAHECGHHAFSDYQLLDDIVGLILHSALLVPYFSWKYSHRRH  144

Query  548  HSNTGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            HSNTGSLERDEVFVPKQKS + W++KYLNNPPGR  TL + LTL WPLYL  NVS
Sbjct  145  HSNTGSLERDEVFVPKQKSCIKWYSKYLNNPPGRVLTLAVTLTLGWPLYLALNVS  199


 Score =   121 bits (303),  Expect(2) = 5e-80, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 68/83 (82%), Gaps = 1/83 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGR  VP   + S+ D L+RVP+ KP F+L +IKKAIPPHCFQRSVLRSFSYVVYDL
Sbjct  1    MGAGGRTDVPPANRKSEVDPLKRVPFEKPQFSLSQIKKAIPPHCFQRSVLRSFSYVVYDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSY  365
             IA  LYYVAT+YFHLLP PLS+
Sbjct  61   TIAFCLYYVATHYFHLLPGPLSF  83



>gb|ABC41578.1| endoplasmic reticulum 18:1 desaturase [Populus tomentosa]
Length=388

 Score =   186 bits (473),  Expect(2) = 1e-79, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YW  QGCVLTGVWVIAHECGHHAFSDYQ LDD VGL+LHS LLVP+FSWK+SHRRHHSN
Sbjct  88   IYWAVQGCVLTGVWVIAHECGHHAFSDYQLLDDIVGLVLHSCLLVPYFSWKHSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSL+RDEVFVPK+KS + W++KYLNNP GR  T+ I LTL WPLYL  NVS
Sbjct  148  TGSLDRDEVFVPKKKSAIRWYSKYLNNPVGRFLTITITLTLGWPLYLAVNVS  199


 Score =   138 bits (347),  Expect(2) = 1e-79, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 74/87 (85%), Gaps = 1/87 (1%)
 Frame = +3

Query  120  MGAGGRMAVP-AEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM+ P +  K+    L+R P +KPPFTLG+IKKAIPPHCFQRSVLRSFSYV +DL
Sbjct  1    MGAGGRMSAPPSSAKVESDVLKRAPDSKPPFTLGQIKKAIPPHCFQRSVLRSFSYVAHDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWP  377
            IIAS  YYVATNYFHLLPHPLSY+AWP
Sbjct  61   IIASIFYYVATNYFHLLPHPLSYVAWP  87



>gb|AIA21647.1| oleate desaturase [Crambe hispanica subsp. abyssinica]
Length=384

 Score =   200 bits (509),  Expect(2) = 1e-79, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW+CQGCVLTG+WVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHS+
Sbjct  88   LYWVCQGCVLTGIWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSS  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGS ERDEVFVPK+KSD+ W+ KYLNNP GR   L +Q TL WPLYL FNVS
Sbjct  148  TGSPERDEVFVPKKKSDIKWYGKYLNNPLGRTLMLTVQFTLGWPLYLAFNVS  199


 Score =   124 bits (311),  Expect(2) = 1e-79, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 71/88 (81%), Gaps = 1/88 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM V    K S+ D L+RVP   PPFT+GE+KKAIPPHCF+RS+ RSFSY+++D+
Sbjct  1    MGAGGRMQVSPSPKKSETDTLKRVPCETPPFTVGELKKAIPPHCFKRSIPRSFSYLIWDI  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWPF  380
            IIAS  YY+AT+YF LLPH LSYLAWP 
Sbjct  61   IIASCFYYIATSYFSLLPHSLSYLAWPL  88



>ref|XP_002884883.1| hypothetical protein ARALYDRAFT_478568 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61142.1| hypothetical protein ARALYDRAFT_478568 [Arabidopsis lyrata subsp. 
lyrata]
 gb|ADN10828.1| fatty acid desaturase [Arabidopsis lyrata]
Length=383

 Score =   200 bits (508),  Expect(2) = 1e-79, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW CQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  88   LYWACQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPKQKS + W+ KYLNNP GR   L +Q  L WPLYL FNVS
Sbjct  148  TGSLERDEVFVPKQKSAIKWYGKYLNNPLGRIMMLTVQFVLGWPLYLAFNVS  199


 Score =   124 bits (312),  Expect(2) = 1e-79, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 73/95 (77%), Gaps = 1/95 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM VP   K S+ D ++RVP  KPPF++G++KKAIP HCF+RS+ RSFSY++ D+
Sbjct  1    MGAGGRMPVPTSSKKSETDTIKRVPCEKPPFSVGDLKKAIPQHCFKRSIPRSFSYLIGDI  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWPFTGSARAV  401
            IIAS  YYVATNYF LLP PLSYLAWP   + +  
Sbjct  61   IIASCFYYVATNYFSLLPQPLSYLAWPLYWACQGC  95



>gb|ADU18249.1| microsomal oleate desaturase [Camelina sativa]
Length=384

 Score =   204 bits (519),  Expect(2) = 1e-79, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW CQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  89   LYWACQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  148

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPKQKS + W+ KYLNNPPGR   L +Q  L WPLYL FNVS
Sbjct  149  TGSLERDEVFVPKQKSAIKWYGKYLNNPPGRIMMLTVQFVLGWPLYLAFNVS  200


 Score =   120 bits (301),  Expect(2) = 1e-79, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 71/96 (74%), Gaps = 2/96 (2%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD--LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYD  293
            MGAGGRM VP+      +   ++RVP  KPPFTLGE+KKAIPP CF+RS+ RSFSY++ D
Sbjct  1    MGAGGRMPVPSSSSKKSETDAIKRVPCEKPPFTLGELKKAIPPQCFKRSIPRSFSYLITD  60

Query  294  LIIASSLYYVATNYFHLLPHPLSYLAWPFTGSARAV  401
            +I+AS  YYVATNYF LLP PLSYLAWP   + +  
Sbjct  61   IIVASCFYYVATNYFSLLPQPLSYLAWPLYWACQGC  96



>gb|ADN10825.1| fatty acid desaturase [Camelina sativa]
Length=384

 Score =   204 bits (519),  Expect(2) = 1e-79, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW CQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  89   LYWACQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  148

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPKQKS + W+ KYLNNPPGR   L +Q  L WPLYL FNVS
Sbjct  149  TGSLERDEVFVPKQKSAIKWYGKYLNNPPGRIMMLTVQFVLGWPLYLAFNVS  200


 Score =   120 bits (301),  Expect(2) = 1e-79, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 71/96 (74%), Gaps = 2/96 (2%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD--LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYD  293
            MGAGGRM VP+      +   ++RVP  KPPFTLGE+KKAIPP CF+RS+ RSFSY++ D
Sbjct  1    MGAGGRMPVPSSSSKKSETDAIKRVPCEKPPFTLGELKKAIPPQCFKRSIPRSFSYLITD  60

Query  294  LIIASSLYYVATNYFHLLPHPLSYLAWPFTGSARAV  401
            +I+AS  YYVATNYF LLP PLSYLAWP   + +  
Sbjct  61   IIVASCFYYVATNYFSLLPQPLSYLAWPLYWACQGC  96



>gb|AIA21652.1| oleate desaturase [Crambe filiformis]
Length=383

 Score =   199 bits (506),  Expect(2) = 1e-79, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW CQGCVLTG+WVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRR HSN
Sbjct  88   LYWACQGCVLTGLWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRRHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK+KSD+ W+ KYLNNP GR   L +Q TL WPLYL FNVS
Sbjct  148  TGSLERDEVFVPKKKSDIKWYGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVS  199


 Score =   125 bits (314),  Expect(2) = 1e-79, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 72/88 (82%), Gaps = 1/88 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM V    K S+ D ++RVP   PPFT+GE+KKAIPPHCF+RS+ RSFSY+++D+
Sbjct  1    MGAGGRMQVSPSPKKSETDTIKRVPCETPPFTVGELKKAIPPHCFKRSIPRSFSYLIWDI  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWPF  380
            +IAS  YY+AT+YF LLPHPLSYLAWP 
Sbjct  61   VIASCFYYIATSYFSLLPHPLSYLAWPL  88



>ref|XP_010257471.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2 [Nelumbo nucifera]
Length=382

 Score =   200 bits (509),  Expect(2) = 1e-79, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YW  QGCVLTGVWV+AHECGHHAFSDYQWLDDTVGLILHS LLVP+FSWKYSHRRHHSN
Sbjct  87   IYWALQGCVLTGVWVLAHECGHHAFSDYQWLDDTVGLILHSFLLVPYFSWKYSHRRHHSN  146

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSL+RDEVFVPK KS + W +KYLNNPPGR  TL I LTL WPLYL FNVS
Sbjct  147  TGSLDRDEVFVPKPKSKISWFSKYLNNPPGRVLTLAITLTLGWPLYLTFNVS  198


 Score =   124 bits (310),  Expect(2) = 1e-79, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDLI  299
            MGAGGR++VPA  K     L R P++ PPFTL +IKKAIP HCFQRSV+RSFSYV YDL+
Sbjct  1    MGAGGRISVPATKKQEHDVLHRAPHSTPPFTLSQIKKAIPSHCFQRSVVRSFSYVAYDLV  60

Query  300  IASSLYYVATNYFHLLPHPLSYLAWP  377
            +A +  Y+AT YFHLLPHP  Y+ WP
Sbjct  61   LALAFNYIATTYFHLLPHPFPYIVWP  86



>gb|AAB80696.1| omega-6 fatty acid desaturase [Petroselinum crispum]
Length=382

 Score =   181 bits (458),  Expect(2) = 1e-79, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            ++   QGC LTG+WVIAHECGHHAFSDYQWLDDTVGLILHS+LLVP+FSWKYSHRRHHSN
Sbjct  87   IHGFVQGCFLTGIWVIAHECGHHAFSDYQWLDDTVGLILHSSLLVPYFSWKYSHRRHHSN  146

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK KS+L   AKY NNPPGR  TLL+ LTL WPLYL+FNVS
Sbjct  147  TGSLERDEVFVPKPKSELQSVAKYTNNPPGRVLTLLVTLTLGWPLYLLFNVS  198


 Score =   144 bits (362),  Expect(2) = 1e-79, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 78/89 (88%), Gaps = 0/89 (0%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDLI  299
            MGAGGRM +  +GK S++ LQRVP +KPPFT+G+IKKAIPPHCF+RSV+RSFSYVVYDL+
Sbjct  1    MGAGGRMPINPQGKNSEEVLQRVPVSKPPFTVGDIKKAIPPHCFKRSVIRSFSYVVYDLV  60

Query  300  IASSLYYVATNYFHLLPHPLSYLAWPFTG  386
            IAS LY+VATNY  LLPHPLSY+AWP  G
Sbjct  61   IASILYFVATNYIQLLPHPLSYIAWPIHG  89



>ref|XP_009376128.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Pyrus x bretschneideri]
Length=382

 Score =   203 bits (516),  Expect(2) = 1e-79, Method: Compositional matrix adjust.
 Identities = 96/112 (86%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +Y+  QGCV TGVWVIAHECGHHAFSDYQWLDDTVGLILHS LLVP+FSWKYSHRRHHSN
Sbjct  88   IYFYVQGCVCTGVWVIAHECGHHAFSDYQWLDDTVGLILHSCLLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPKQKS +GW AKYLNNPPGR  TL +QLTL WPLYL FNVS
Sbjct  148  TGSLERDEVFVPKQKSAIGWWAKYLNNPPGRFLTLAVQLTLGWPLYLAFNVS  199


 Score =   121 bits (303),  Expect(2) = 1e-79, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 68/87 (78%), Gaps = 1/87 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGG M  P   K+++ D ++RVPY KPPF+LGE+KKAIPPHCFQRSV+RSFSYV YDL
Sbjct  1    MGAGGNMTAPRARKIAEADTVKRVPYTKPPFSLGEVKKAIPPHCFQRSVIRSFSYVFYDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWP  377
             I S LYY+A+ Y   L  PLS+LAWP
Sbjct  61   AIVSILYYIASTYIQNLSQPLSFLAWP  87



>ref|XP_010265904.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Nelumbo nucifera]
Length=382

 Score =   194 bits (493),  Expect(2) = 1e-79, Method: Compositional matrix adjust.
 Identities = 95/112 (85%), Positives = 102/112 (91%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YW+ QGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVP+FSWKYSHRRHHSN
Sbjct  87   IYWVIQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPYFSWKYSHRRHHSN  146

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK KS + W ++YLNNPPGR  TL I LTL WPLYL+FNVS
Sbjct  147  TGSLERDEVFVPKPKSKIPWFSRYLNNPPGRVLTLTITLTLGWPLYLLFNVS  198


 Score =   130 bits (326),  Expect(2) = 1e-79, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDLI  299
            MGAGGRM VP   K     L+R P++ PPFTL +IKKAIPPHCFQRSVLRSFSYVVYDL 
Sbjct  1    MGAGGRMVVPTTKKQEHDALRRAPHSAPPFTLSQIKKAIPPHCFQRSVLRSFSYVVYDLA  60

Query  300  IASSLYYVATNYFHLLPHPLSYLAWP  377
            +  + YY+A  YFHLLPH LSYLAWP
Sbjct  61   MVFAFYYIAITYFHLLPHSLSYLAWP  86



>gb|ADN10832.1| fatty acid desaturase [Camelina microcarpa]
Length=385

 Score =   204 bits (519),  Expect(2) = 1e-79, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW CQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  90   LYWACQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  149

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPKQKS + W+ KYLNNPPGR   L +Q  L WPLYL FNVS
Sbjct  150  TGSLERDEVFVPKQKSAIKWYGKYLNNPPGRIMMLTVQFVLGWPLYLAFNVS  201


 Score =   120 bits (300),  Expect(2) = 1e-79, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 72/97 (74%), Gaps = 3/97 (3%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD---LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVY  290
            MGAGGRM VP+     K +   ++RVP  KPPFTLGE+KKAIPP CF+RS+ RSFSY++ 
Sbjct  1    MGAGGRMPVPSSSSSKKSETDAMKRVPCEKPPFTLGELKKAIPPQCFKRSIPRSFSYLIT  60

Query  291  DLIIASSLYYVATNYFHLLPHPLSYLAWPFTGSARAV  401
            D+I+AS  YYVATNYF LLP PLSYLAWP   + +  
Sbjct  61   DIIVASCFYYVATNYFSLLPQPLSYLAWPLYWACQGC  97



>gb|ACU21462.1| unknown [Glycine max]
Length=260

 Score =   194 bits (494),  Expect(2) = 1e-79, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YW  QGC+LTGVWVIAHECGHHAFSDYQ LDD VGL+LHS LLVP+FSWKYSHRRHHSN
Sbjct  88   IYWAVQGCILTGVWVIAHECGHHAFSDYQLLDDIVGLVLHSGLLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPKQKS + W++KYLNNPPGR  TL + LTL WPLYL  NVS
Sbjct  148  TGSLERDEVFVPKQKSCIKWYSKYLNNPPGRVLTLAVTLTLGWPLYLALNVS  199


 Score =   129 bits (324),  Expect(2) = 1e-79, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 71/87 (82%), Gaps = 1/87 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGR  VP   + S+ D L+RVP+ KPPF+L +IKK IPPHCFQRSV RSFSYVVYDL
Sbjct  1    MGAGGRTDVPPANRKSEVDPLKRVPFEKPPFSLSQIKKVIPPHCFQRSVFRSFSYVVYDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWP  377
             IA  LYYVAT+YFHLLP PLS+LAWP
Sbjct  61   TIAFCLYYVATHYFHLLPSPLSFLAWP  87



>ref|XP_010464962.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum-like 
[Camelina sativa]
 gb|ADN10830.1| fatty acid desaturase [Camelina laxa]
Length=385

 Score =   204 bits (519),  Expect(2) = 1e-79, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW CQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  90   LYWACQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  149

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPKQKS + W+ KYLNNPPGR   L +Q  L WPLYL FNVS
Sbjct  150  TGSLERDEVFVPKQKSAIKWYGKYLNNPPGRIMMLTVQFVLGWPLYLAFNVS  201


 Score =   120 bits (300),  Expect(2) = 1e-79, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 72/97 (74%), Gaps = 3/97 (3%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD---LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVY  290
            MGAGGRM VP+     K +   ++RVP  KPPFTLGE+KKAIPP CF+RS+ RSFSY++ 
Sbjct  1    MGAGGRMPVPSSSSSKKSETDAIKRVPCEKPPFTLGELKKAIPPQCFKRSIPRSFSYLIT  60

Query  291  DLIIASSLYYVATNYFHLLPHPLSYLAWPFTGSARAV  401
            D+I+AS  YYVATNYF LLP PLSYLAWP   + +  
Sbjct  61   DIIVASCFYYVATNYFSLLPQPLSYLAWPLYWACQGC  97



>gb|AFP21683.1| FAD2 [Physaria fendleri]
 gb|AGT36609.1| oleate 12-desaturase [Physaria fendleri]
Length=382

 Score =   203 bits (516),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW CQGCVLTGVWVIAHECGHHAFS+YQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  87   LYWACQGCVLTGVWVIAHECGHHAFSNYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  146

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPKQKS + W+ KYLNNPPGR   L +Q  L WPLYL FNVS
Sbjct  147  TGSLERDEVFVPKQKSAIKWYGKYLNNPPGRIMMLTVQFVLGWPLYLAFNVS  198


 Score =   121 bits (303),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 69/87 (79%), Gaps = 0/87 (0%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDLI  299
            MGAGGRM+VP+  K     ++RVP  KPPFT+GE+KKAIP HCF+RS+ RSFSY++ D+I
Sbjct  1    MGAGGRMSVPSSKKSETAPVKRVPCEKPPFTVGELKKAIPSHCFERSIPRSFSYLITDII  60

Query  300  IASSLYYVATNYFHLLPHPLSYLAWPF  380
            IAS  YY+ATN+F LLP  LSY+AWP 
Sbjct  61   IASCFYYIATNFFPLLPQSLSYVAWPL  87



>gb|AGN95841.1| fatty acid delta12-desturase FAD2-1 [Hiptage benghalensis]
Length=383

 Score =   197 bits (502),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +Y   QGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHS LLVP+FSWK+SHRRHHSN
Sbjct  88   IYGAVQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSCLLVPYFSWKHSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPKQKS L W+AKYL+NP GR  TL+I LTL WPLYL FNVS
Sbjct  148  TGSLERDEVFVPKQKSGLSWYAKYLDNPVGRLMTLIITLTLGWPLYLAFNVS  199


 Score =   126 bits (316),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 73/94 (78%), Gaps = 1/94 (1%)
 Frame = +3

Query  120  MGAGGRMAVP-AEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM+VP +  K+    L+RVP++KPPFTLGEIKKAIPPHCF+RSVL SFSYVVYDL
Sbjct  1    MGAGGRMSVPPSPRKLESNVLKRVPHSKPPFTLGEIKKAIPPHCFRRSVLCSFSYVVYDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWPFTGSARA  398
             IA  LYYVAT Y HLLP PLS  AW   G+ + 
Sbjct  61   TIAFLLYYVATKYIHLLPQPLSTAAWLIYGAVQG  94



>ref|XP_006297892.1| hypothetical protein CARUB_v10013933mg [Capsella rubella]
 gb|ADN10827.1| fatty acid desaturase [Capsella rubella]
 gb|EOA30790.1| hypothetical protein CARUB_v10013933mg [Capsella rubella]
Length=383

 Score =   200 bits (508),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW CQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  88   LYWACQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPKQKS + W+ KYLNNP GR   L +Q  L WPLYL FNVS
Sbjct  148  TGSLERDEVFVPKQKSAIKWYGKYLNNPFGRIMMLTVQFVLGWPLYLAFNVS  199


 Score =   124 bits (310),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 73/95 (77%), Gaps = 1/95 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM VP+  K S+ + ++RVP  KPPFT+G++KKAIPP CF+RS+ RSFSY++ D+
Sbjct  1    MGAGGRMPVPSSSKKSETNAIKRVPCEKPPFTVGDLKKAIPPQCFKRSIPRSFSYLITDI  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWPFTGSARAV  401
            IIAS  YYVATNYF LLP PLSY AWP   + +  
Sbjct  61   IIASCFYYVATNYFSLLPQPLSYFAWPLYWACQGC  95



>gb|AAS92240.1| delta-12 oleate desaturase [Brassica napus]
Length=384

 Score =   202 bits (515),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW CQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  88   LYWACQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK+KSD+ W+ KYLNNP GR   L +Q TL WPLYL FNVS
Sbjct  148  TGSLERDEVFVPKKKSDIKWYGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVS  199


 Score =   121 bits (303),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 71/95 (75%), Gaps = 1/95 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM V    K S+ D ++ VP   PPFT+GE+KKAIPPHCF+RS+ RSFSY+++D+
Sbjct  1    MGAGGRMQVSPPSKKSETDNIKCVPCETPPFTVGELKKAIPPHCFKRSIPRSFSYLIWDI  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWPFTGSARAV  401
            IIAS  YYVAT YF LLPHPLSY AWP   + +  
Sbjct  61   IIASCFYYVATTYFPLLPHPLSYFAWPLYWACQGC  95



>gb|ADJ58018.1| fatty acid desaturase 2 [Brassica nigra]
Length=383

 Score =   203 bits (516),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW CQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  88   LYWACQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK+KSD+ W+ KYLNNP GR   L +Q TL WPLYL FNVS
Sbjct  148  TGSLERDEVFVPKKKSDIKWYGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVS  199


 Score =   120 bits (302),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 70/88 (80%), Gaps = 1/88 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGR+ V    K S+ D L+RVP   PPFT+GE+KKAIPPHCF+RS+ RSFSY+++D+
Sbjct  1    MGAGGRIEVSPSPKKSETDTLKRVPCETPPFTVGELKKAIPPHCFKRSIPRSFSYLIWDI  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWPF  380
            I+AS  YYVAT YF LLP PLSY+AWP 
Sbjct  61   IVASCFYYVATTYFPLLPQPLSYIAWPL  88



>emb|CAA71199.1| omega-6 desaturase [Gossypium hirsutum]
Length=383

 Score =   201 bits (510),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW  QGC+LTGVWVIAHECGHHAFSDYQWLDDTVGLILHS+LLVP+FSWKYSHRRHHSN
Sbjct  88   LYWAMQGCILTGVWVIAHECGHHAFSDYQWLDDTVGLILHSSLLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK+KS L W AK+ NNPPGR  ++ IQLTL WPLYL FNV+
Sbjct  148  TGSLERDEVFVPKKKSGLRWWAKHFNNPPGRFLSITIQLTLGWPLYLAFNVA  199


 Score =   123 bits (308),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 70/88 (80%), Gaps = 1/88 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSK-QDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM+VP   K  +   L+RVPY+KPPFTL EIKKAIPPHCFQRSVLRSFSY++YD 
Sbjct  1    MGAGGRMSVPTSPKKPEFNSLKRVPYSKPPFTLSEIKKAIPPHCFQRSVLRSFSYLLYDF  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWPF  380
            I+AS  Y+VATNYF  LP  LS +AWP 
Sbjct  61   ILASLFYHVATNYFPNLPQALSNVAWPL  88



>sp|Q39287.1|FAD6E_BRAJU RecName: Full=Omega-6 fatty acid desaturase, endoplasmic reticulum; 
AltName: Full=Delta(12) desaturase [Brassica juncea]
 emb|CAA62578.1| oleate desaturase [Brassica juncea]
Length=384

 Score =   197 bits (500),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW CQG VLTGVWVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  88   LYWACQGVVLTGVWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK+KSD+ W+ KYLNNP GR   L +Q TL WPLY  FNVS
Sbjct  148  TGSLERDEVFVPKKKSDIKWYGKYLNNPLGRTVMLTVQFTLGWPLYWAFNVS  199


 Score =   126 bits (317),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 74/95 (78%), Gaps = 1/95 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM V    K S+ D L+RVP   PPFT+GE+KKAIPPHCF+RS+ RSFSY+++D+
Sbjct  1    MGAGGRMQVSPSPKKSETDTLKRVPCETPPFTVGELKKAIPPHCFKRSIPRSFSYLIWDI  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWPFTGSARAV  401
            I+AS  YYVAT YF LLPHPLSY+AWP   + + V
Sbjct  61   IVASCFYYVATTYFPLLPHPLSYVAWPLYWACQGV  95



>gb|AIA21648.1| oleate desaturase [Crambe hispanica subsp. abyssinica]
Length=384

 Score =   199 bits (506),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW+CQGCVLTG+WVIAHECGHHAFSDYQWL DTVGLI H  LLVP+FSWKYSHRRHHSN
Sbjct  88   LYWVCQGCVLTGIWVIAHECGHHAFSDYQWLGDTVGLIFHFFLLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK+KSD+ W+ KYLNNP GR   L +Q TL WPLYL FNVS
Sbjct  148  TGSLERDEVFVPKKKSDIKWYGKYLNNPLGRTLMLTVQFTLGWPLYLAFNVS  199


 Score =   124 bits (311),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 71/88 (81%), Gaps = 1/88 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM V    K S+ D L+RVP   PPFT+GE+KKAIPPHCF+RS+ RSFSY+++D+
Sbjct  1    MGAGGRMQVSPSPKKSETDTLKRVPCETPPFTVGELKKAIPPHCFKRSIPRSFSYLIWDI  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWPF  380
            IIAS  YY+AT+YF LLPH LSYLAWP 
Sbjct  61   IIASCFYYIATSYFSLLPHSLSYLAWPL  88



>ref|XP_010058070.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2 isoform X1 [Eucalyptus grandis]
 ref|XP_010058078.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2 isoform X1 [Eucalyptus grandis]
Length=413

 Score =   193 bits (490),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 89/112 (79%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +Y   QGCVLTGVWV+AHECGHHAFSDYQWLDD VGL+LHS LLVP+FSWKYSHRRHHSN
Sbjct  118  IYGFVQGCVLTGVWVVAHECGHHAFSDYQWLDDLVGLVLHSCLLVPYFSWKYSHRRHHSN  177

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPKQK+ + W + YLNNP GR  TL + LTL WPLYLMFNVS
Sbjct  178  TGSLERDEVFVPKQKNQMPWFSNYLNNPLGRVITLTVTLTLGWPLYLMFNVS  229


 Score =   130 bits (327),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 72/92 (78%), Gaps = 1/92 (1%)
 Frame = +3

Query  114  GKMGAGGRMAV-PAEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVY  290
            G MGAGG M+V PA  K   +   RVP +KPPFTL ++KKAIPPHCFQRSVLRSFSYVVY
Sbjct  29   GTMGAGGNMSVRPAVKKSESKLDNRVPSSKPPFTLSQLKKAIPPHCFQRSVLRSFSYVVY  88

Query  291  DLIIASSLYYVATNYFHLLPHPLSYLAWPFTG  386
            DL IA  LYY+AT +FHLLP PLSYLAWP  G
Sbjct  89   DLTIAYVLYYIATTFFHLLPSPLSYLAWPIYG  120



>gb|AGZ15438.1| FAD2 [Eucalyptus camaldulensis]
Length=389

 Score =   194 bits (494),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +Y   QGCVLTGVWV+AHECGHHAFSDYQWLDD VGL+LHS LLVP+FSWKYSHRRHHSN
Sbjct  88   IYGFVQGCVLTGVWVVAHECGHHAFSDYQWLDDLVGLVLHSCLLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPKQK+ + W +KYLNNP GR  TL + LTL WPLYLMFNVS
Sbjct  148  TGSLERDEVFVPKQKNQMPWFSKYLNNPLGRVITLTVTLTLGWPLYLMFNVS  199


 Score =   128 bits (322),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 71/90 (79%), Gaps = 1/90 (1%)
 Frame = +3

Query  120  MGAGGRMAV-PAEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGG M+V PA  K   +   RVP +KPPFTL ++KKAIPPHCFQRSVLRSFSYVVYDL
Sbjct  1    MGAGGNMSVRPAVKKSESKPDNRVPSSKPPFTLSQLKKAIPPHCFQRSVLRSFSYVVYDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWPFTG  386
             IA  LYY+AT +FHLLP PLSYLAWP  G
Sbjct  61   TIAYVLYYIATTFFHLLPSPLSYLAWPIYG  90



>gb|ADN10835.1| fatty acid desaturase [Camelina rumelica]
Length=384

 Score =   204 bits (518),  Expect(2) = 3e-79, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW CQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  89   LYWACQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  148

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPKQKS + W+ KYLNNPPGR   L +Q  L WPLYL FNVS
Sbjct  149  TGSLERDEVFVPKQKSAIKWYGKYLNNPPGRIMMLTVQFVLGWPLYLAFNVS  200


 Score =   119 bits (298),  Expect(2) = 3e-79, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 71/96 (74%), Gaps = 2/96 (2%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD--LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYD  293
            MGAGGRM VP+      +   ++RVP  KPPFTLGE+KKAIPP CF+RS+ RSFSY++ D
Sbjct  1    MGAGGRMPVPSSSSKKSETDAMKRVPCEKPPFTLGELKKAIPPQCFKRSIPRSFSYLITD  60

Query  294  LIIASSLYYVATNYFHLLPHPLSYLAWPFTGSARAV  401
            +I+AS  YYVATN+F LLP PLSYLAWP   + +  
Sbjct  61   IIVASCFYYVATNFFSLLPQPLSYLAWPLYWACQGC  96



>gb|EYU39930.1| hypothetical protein MIMGU_mgv1a008167mg [Erythranthe guttata]
Length=383

 Score =   198 bits (503),  Expect(2) = 3e-79, Method: Compositional matrix adjust.
 Identities = 94/113 (83%), Positives = 100/113 (88%), Gaps = 0/113 (0%)
 Frame = +2

Query  374  ALYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHS  553
             LY I QGCVLTGVWVIAHECGHHAFSD+QWLDDTVGL+LHSALLVP+FSWKYSHRRHHS
Sbjct  87   TLYTIVQGCVLTGVWVIAHECGHHAFSDHQWLDDTVGLVLHSALLVPYFSWKYSHRRHHS  146

Query  554  NTGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            NTGSLERDEVFVPKQK+ L   AKYLNNPPGR   L +Q TL WPLYL+FNVS
Sbjct  147  NTGSLERDEVFVPKQKTGLSPWAKYLNNPPGRILMLTVQFTLGWPLYLLFNVS  199


 Score =   125 bits (314),  Expect(2) = 3e-79, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 70/86 (81%), Gaps = 1/86 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSK-QDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM+VP EGK SK +  QRVP++KPPFT+G +KKAIPPHCF+RS+ RSFSYV  DL
Sbjct  1    MGAGGRMSVPTEGKKSKPEPHQRVPHSKPPFTVGTLKKAIPPHCFKRSIPRSFSYVFLDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAW  374
             IAS  YY+ATNY   LPHPL YLAW
Sbjct  61   AIASFFYYIATNYIPALPHPLPYLAW  86



>gb|AGZ02023.1| microsomal omega-6-desaturase [Millettia pinnata]
Length=383

 Score =   185 bits (469),  Expect(2) = 3e-79, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YW  QGCVLTG+WVIAHECGHHAFSDYQ LDD VGLILHS LLVP+FSWKYSHRRHHSN
Sbjct  88   IYWALQGCVLTGIWVIAHECGHHAFSDYQLLDDIVGLILHSCLLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPKQKS + W++KYLNNPPGR FTL + LTL WPLYL FNVS
Sbjct  148  TGSLERDEVFVPKQKSCIRWYSKYLNNPPGRLFTLTVTLTLGWPLYLAFNVS  199


 Score =   137 bits (346),  Expect(2) = 3e-79, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 74/87 (85%), Gaps = 1/87 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGR  VP   K S+ D L+RVPY+KPPF+LG++KKAIPPHCFQRSVLRSFSYVVYDL
Sbjct  1    MGAGGRTDVPPANKKSEVDPLKRVPYSKPPFSLGQVKKAIPPHCFQRSVLRSFSYVVYDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWP  377
             IA   YYVATNYFHLLP PLSY+AWP
Sbjct  61   TIAFLFYYVATNYFHLLPQPLSYVAWP  87



>gb|KJB46318.1| hypothetical protein B456_007G362300 [Gossypium raimondii]
 gb|KJB46319.1| hypothetical protein B456_007G362300 [Gossypium raimondii]
 gb|KJB46320.1| hypothetical protein B456_007G362300 [Gossypium raimondii]
 gb|KJB46321.1| hypothetical protein B456_007G362300 [Gossypium raimondii]
Length=384

 Score =   200 bits (509),  Expect(2) = 3e-79, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YW  QG VLTGVWVIAHECGHHAFSDYQW+DDTVGLILHS+LLVP+FSWKYSHRRHHSN
Sbjct  88   IYWALQGSVLTGVWVIAHECGHHAFSDYQWIDDTVGLILHSSLLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK++S + W AKYLNNPPGR  T+ IQLTL WPLYL FNV+
Sbjct  148  TGSLERDEVFVPKKRSSIRWWAKYLNNPPGRFVTITIQLTLGWPLYLAFNVA  199


 Score =   122 bits (306),  Expect(2) = 3e-79, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 69/87 (79%), Gaps = 1/87 (1%)
 Frame = +3

Query  120  MGAGGRMAVP-AEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM+VP ++ K     ++R P +KPPFTL EIKKAIPPHCFQRS++RSFSY+VYD 
Sbjct  1    MGAGGRMSVPPSQRKQESGSMKRAPISKPPFTLSEIKKAIPPHCFQRSLIRSFSYLVYDF  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWP  377
            I+ S  YYVAT YF  LP PLS++AWP
Sbjct  61   ILVSIFYYVATTYFRNLPQPLSFVAWP  87



>gb|AAQ16653.1| delta-12 fatty acid desaturase 2 [Gossypium hirsutum]
 gb|AAQ16654.1| delta-12 fatty acid desaturase 2 [Gossypium hirsutum]
Length=384

 Score =   200 bits (509),  Expect(2) = 3e-79, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YW  QG VLTGVWVIAHECGHHAFSDYQW+DDTVGLILHS+LLVP+FSWKYSHRRHHSN
Sbjct  88   IYWALQGSVLTGVWVIAHECGHHAFSDYQWIDDTVGLILHSSLLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK++S + W AKYLNNPPGR  T+ IQLTL WPLYL FNV+
Sbjct  148  TGSLERDEVFVPKKRSSIRWWAKYLNNPPGRFVTITIQLTLGWPLYLAFNVA  199


 Score =   122 bits (306),  Expect(2) = 3e-79, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 69/87 (79%), Gaps = 1/87 (1%)
 Frame = +3

Query  120  MGAGGRMAVP-AEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM+VP ++ K     ++R P +KPPFTL EIKKAIPPHCFQRS++RSFSY+VYD 
Sbjct  1    MGAGGRMSVPPSQRKQESGSMKRAPISKPPFTLSEIKKAIPPHCFQRSLIRSFSYLVYDF  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWP  377
            I+ S  YYVAT YF  LP PLS++AWP
Sbjct  61   ILVSIFYYVATTYFRNLPQPLSFVAWP  87



>gb|ABB05230.1| delta 12 desaturase [Linum usitatissimum]
Length=378

 Score =   200 bits (509),  Expect(2) = 4e-79, Method: Compositional matrix adjust.
 Identities = 88/112 (79%), Positives = 102/112 (91%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YW CQGC+LTGVWV+AHECGHHAFSDYQWLDD  G +LHS+LLVP+FSWK+SHRRHHSN
Sbjct  83   VYWACQGCILTGVWVLAHECGHHAFSDYQWLDDMDGFVLHSSLLVPYFSWKHSHRRHHSN  142

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSL+RDEVFVPKQK+++GW++KYLNNPPGR  TL + LTL WPLYL FNVS
Sbjct  143  TGSLDRDEVFVPKQKAEIGWYSKYLNNPPGRVITLAVTLTLGWPLYLAFNVS  194


 Score =   122 bits (306),  Expect(2) = 4e-79, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 70/86 (81%), Gaps = 4/86 (5%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDLI  299
            MGAGGRM VP     S + ++R PY+KPPFTLGE+KKAIPPHCF+RS+ RSF+YV +DL 
Sbjct  1    MGAGGRMPVPP----SSKPMKRSPYSKPPFTLGELKKAIPPHCFKRSIPRSFAYVAHDLT  56

Query  300  IASSLYYVATNYFHLLPHPLSYLAWP  377
            IA+  YY+AT YFHLLP PL+YLAWP
Sbjct  57   IAAIFYYIATTYFHLLPSPLNYLAWP  82



>gb|AAT02411.1| delta-12 oleate desaturase [Brassica napus]
Length=384

 Score =   201 bits (510),  Expect(2) = 6e-79, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW CQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLI HS  LVP+FSWKYSHRRHHSN
Sbjct  88   LYWACQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLIFHSFPLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK+KSD+ W+ KYLNNP GR   L +Q TL WPLYL FNVS
Sbjct  148  TGSLERDEVFVPKKKSDIKWYGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVS  199


 Score =   121 bits (304),  Expect(2) = 6e-79, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 67/88 (76%), Gaps = 1/88 (1%)
 Frame = +3

Query  120  MGAGGRMAV-PAEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM V P         L+RVP   PPFT+GE+KKAIPPHCF+RS+ RSFSY+++D+
Sbjct  1    MGAGGRMQVSPPSSSPGTNTLKRVPCETPPFTVGELKKAIPPHCFKRSIPRSFSYLIWDI  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWPF  380
            IIAS  YYVAT YF LLPHPLSY AWP 
Sbjct  61   IIASCFYYVATTYFPLLPHPLSYFAWPL  88



>ref|XP_008392076.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Malus domestica]
Length=382

 Score =   206 bits (523),  Expect(2) = 7e-79, Method: Compositional matrix adjust.
 Identities = 97/112 (87%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YW  QGCV TGVWVIAHECGHHAFSDYQWLDDTVGLILHS LLVP+FSWKYSHRRHHSN
Sbjct  88   IYWYVQGCVCTGVWVIAHECGHHAFSDYQWLDDTVGLILHSCLLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPKQKS +GW AKYLNNPPGR  TL +QLTL WPLYL FNVS
Sbjct  148  TGSLERDEVFVPKQKSAIGWWAKYLNNPPGRFLTLAVQLTLGWPLYLAFNVS  199


 Score =   115 bits (289),  Expect(2) = 7e-79, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 65/87 (75%), Gaps = 1/87 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGG M      K+++ D ++RVPY KPPF+LGE+KKAIPPHCFQRSV+RSFSYV YDL
Sbjct  1    MGAGGNMTALRVRKIAEADTVKRVPYTKPPFSLGEVKKAIPPHCFQRSVIRSFSYVFYDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWP  377
             I S LYY A  Y   L  PLS+LAWP
Sbjct  61   AIVSILYYJAXTYIQNLSQPLSFLAWP  87



>ref|XP_010058087.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2 isoform X2 [Eucalyptus grandis]
 gb|KCW90306.1| hypothetical protein EUGRSUZ_A02449 [Eucalyptus grandis]
Length=383

 Score =   193 bits (490),  Expect(2) = 9e-79, Method: Compositional matrix adjust.
 Identities = 89/112 (79%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +Y   QGCVLTGVWV+AHECGHHAFSDYQWLDD VGL+LHS LLVP+FSWKYSHRRHHSN
Sbjct  88   IYGFVQGCVLTGVWVVAHECGHHAFSDYQWLDDLVGLVLHSCLLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPKQK+ + W + YLNNP GR  TL + LTL WPLYLMFNVS
Sbjct  148  TGSLERDEVFVPKQKNQMPWFSNYLNNPLGRVITLTVTLTLGWPLYLMFNVS  199


 Score =   128 bits (322),  Expect(2) = 9e-79, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 71/90 (79%), Gaps = 1/90 (1%)
 Frame = +3

Query  120  MGAGGRMAV-PAEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGG M+V PA  K   +   RVP +KPPFTL ++KKAIPPHCFQRSVLRSFSYVVYDL
Sbjct  1    MGAGGNMSVRPAVKKSESKLDNRVPSSKPPFTLSQLKKAIPPHCFQRSVLRSFSYVVYDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWPFTG  386
             IA  LYY+AT +FHLLP PLSYLAWP  G
Sbjct  61   TIAYVLYYIATTFFHLLPSPLSYLAWPIYG  90



>ref|XP_010486902.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum-like 
[Camelina sativa]
 gb|ADN10826.1| fatty acid desaturase [Camelina sativa]
 gb|ADN10833.1| fatty acid desaturase [Camelina microcarpa]
 gb|ADU18247.1| microsomal oleate desaturase [Camelina sativa]
 gb|AFQ60940.1| microsomal oleate desaturase [Camelina sativa]
Length=384

 Score =   201 bits (510),  Expect(2) = 1e-78, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW CQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  89   LYWACQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  148

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPKQKS + W+ KYLNNP GR   L +Q  L WPLYL FNVS
Sbjct  149  TGSLERDEVFVPKQKSAIKWYGKYLNNPAGRIMMLTVQFVLGWPLYLAFNVS  200


 Score =   120 bits (301),  Expect(2) = 1e-78, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 71/96 (74%), Gaps = 2/96 (2%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD--LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYD  293
            MGAGGRM VP+      +   ++RVP  KPPFTLGE+KKAIPP CF+RS+ RSFSY++ D
Sbjct  1    MGAGGRMPVPSSSSKKSETDAIKRVPCEKPPFTLGELKKAIPPQCFKRSIPRSFSYLITD  60

Query  294  LIIASSLYYVATNYFHLLPHPLSYLAWPFTGSARAV  401
            +I+AS  YYVATNYF LLP PLSYLAWP   + +  
Sbjct  61   IIVASCFYYVATNYFSLLPQPLSYLAWPLYWACQGC  96



>gb|ACR15954.1| fatty acid desaturase 2 [Lepidium campestre]
Length=383

 Score =   200 bits (508),  Expect(2) = 1e-78, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW CQGCVLTG+WVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  88   LYWACQGCVLTGIWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPKQ+S + W+ KYLNNP GR   L IQ  L WPLYL FNVS
Sbjct  148  TGSLERDEVFVPKQRSAIKWYGKYLNNPLGRVVMLTIQFVLGWPLYLAFNVS  199


 Score =   121 bits (303),  Expect(2) = 1e-78, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 72/95 (76%), Gaps = 1/95 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM VP   K ++ + L+RVP  KPPFTLG++KKAIPP CF+RS+ RSFSY++ D+
Sbjct  1    MGAGGRMPVPPSSKKTETEALKRVPCEKPPFTLGDLKKAIPPQCFKRSIPRSFSYLISDI  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWPFTGSARAV  401
            IIAS  YYVATNYF LLP  +SYLAWP   + +  
Sbjct  61   IIASCFYYVATNYFSLLPQSISYLAWPLYWACQGC  95



>ref|XP_003625259.1| Omega-6 fatty acid desaturase, endoplasmic reticulum [Medicago 
truncatula]
 gb|AES81477.1| microsomal omega-3 fatty acid desaturase [Medicago truncatula]
Length=434

 Score =   195 bits (496),  Expect(2) = 1e-78, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 99/112 (88%), Gaps = 1/112 (1%)
 Frame = +2

Query  380  YWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSNT  559
            YW  QGC+LTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVP+FSWKYSHRRHHSNT
Sbjct  139  YWAIQGCILTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPYFSWKYSHRRHHSNT  198

Query  560  GSLERDEVFVPKQKSDLGWHAKYL-NNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            GSLERDEVFVPKQKS + W++KYL NNP GR  T+ I LTL WPLYL  NVS
Sbjct  199  GSLERDEVFVPKQKSSIYWYSKYLSNNPLGRVLTITITLTLGWPLYLALNVS  250


 Score =   125 bits (314),  Expect(2) = 1e-78, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 72/88 (82%), Gaps = 1/88 (1%)
 Frame = +3

Query  117  KMGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYD  293
            KMGAGGR +VP   + S+ D ++RVP+ KPPF+L +IKKAIPPHCF+RSV+ SFSYVVYD
Sbjct  50   KMGAGGRTSVPPSARKSENDTVKRVPFEKPPFSLSQIKKAIPPHCFKRSVIHSFSYVVYD  109

Query  294  LIIASSLYYVATNYFHLLPHPLSYLAWP  377
            L IA  LYYVAT+YF  LP PLS+LAWP
Sbjct  110  LTIAFFLYYVATHYFQHLPRPLSFLAWP  137



>gb|AFQ60942.1| microsomal oleate desaturase [Camelina sativa]
Length=384

 Score =   202 bits (515),  Expect(2) = 1e-78, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW CQGC LTGVWVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  89   LYWACQGCALTGVWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  148

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPKQKS + W+ KYLNNPPGR   L +Q  L WPLYL FNVS
Sbjct  149  TGSLERDEVFVPKQKSAIKWYGKYLNNPPGRIMMLTVQFVLGWPLYLAFNVS  200


 Score =   118 bits (295),  Expect(2) = 1e-78, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 70/96 (73%), Gaps = 2/96 (2%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD--LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYD  293
            MGAGGRM VP+      +   ++RVP  KPPFTLGE+KKAIPP CF+ S+ RSFSY++ D
Sbjct  1    MGAGGRMPVPSSSSKKSETDAIKRVPCEKPPFTLGELKKAIPPQCFKHSIPRSFSYLITD  60

Query  294  LIIASSLYYVATNYFHLLPHPLSYLAWPFTGSARAV  401
            +I+AS  YYVATNYF LLP PLSYLAWP   + +  
Sbjct  61   IIVASCFYYVATNYFSLLPQPLSYLAWPLYWACQGC  96



>ref|NP_001291954.1| omega-6 fatty acid desaturase, endoplasmic reticulum [Camelina 
sativa]
 ref|XP_010498539.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
[Camelina sativa]
 gb|ADN10824.1| fatty acid desaturase [Camelina sativa]
 gb|ADN10831.1| fatty acid desaturase [Camelina microcarpa]
 gb|ADU18248.1| microsomal oleate desaturase [Camelina sativa]
 gb|AFQ60941.1| microsomal oleate desaturase [Camelina sativa]
Length=384

 Score =   201 bits (510),  Expect(2) = 2e-78, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW CQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  89   LYWACQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  148

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPKQKS + W+ KYLNNP GR   L +Q  L WPLYL FNVS
Sbjct  149  TGSLERDEVFVPKQKSAIKWYGKYLNNPAGRIMMLTVQFVLGWPLYLAFNVS  200


 Score =   120 bits (300),  Expect(2) = 2e-78, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 71/96 (74%), Gaps = 2/96 (2%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD--LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYD  293
            MGAGGRM VP+      +   ++RVP  KPPFTLG++KKAIPP CF+RS+ RSFSY++ D
Sbjct  1    MGAGGRMPVPSSSSKKSETDAIKRVPCEKPPFTLGDLKKAIPPQCFKRSIPRSFSYLITD  60

Query  294  LIIASSLYYVATNYFHLLPHPLSYLAWPFTGSARAV  401
            +IIAS  YYVATNYF LLP PLSYLAWP   + +  
Sbjct  61   IIIASCFYYVATNYFSLLPQPLSYLAWPLYWACQGC  96



>gb|KHG24863.1| Omega-6 fatty acid desaturase, endoplasmic reticulum isozyme 
1 [Gossypium arboreum]
Length=385

 Score =   197 bits (502),  Expect(2) = 2e-78, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YW+ QGC+LTGVWVIAHECGHHAFSDYQW+DDTVGLILHSALLVP+FSWK SHRRHHSN
Sbjct  87   VYWVLQGCILTGVWVIAHECGHHAFSDYQWVDDTVGLILHSALLVPYFSWKISHRRHHSN  146

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGS+ERDEVFVPK KS L   AKYLNNPPGR  +L++ LTL WP+YL FNVS
Sbjct  147  TGSMERDEVFVPKPKSKLSCFAKYLNNPPGRVLSLVVTLTLGWPMYLAFNVS  198


 Score =   122 bits (307),  Expect(2) = 2e-78, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDLI  299
            MGAGGRM V  + +  +  + RVP  KPPFTLG+IK+AIPPHCF+RS+LRSFSYVV+DL 
Sbjct  1    MGAGGRMLVDGKKEEKRGSVNRVPIEKPPFTLGQIKQAIPPHCFRRSLLRSFSYVVHDLC  60

Query  300  IASSLYYVATNYFHLLPHPLSYLAWP  377
            +AS  YY+AT+YFH LP P S +AWP
Sbjct  61   LASLFYYIATSYFHFLPQPFSNIAWP  86



>gb|ADP02395.1| delta-12 oleate desaturase [Gossypium hirsutum]
Length=385

 Score =   195 bits (496),  Expect(2) = 3e-78, Method: Compositional matrix adjust.
 Identities = 89/112 (79%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YW+ QGC+LTGVWVIAHECGHHAFSDYQW+DDTVGLILHSALLVP+FSW  SHRRHHSN
Sbjct  87   VYWVLQGCILTGVWVIAHECGHHAFSDYQWVDDTVGLILHSALLVPYFSWTISHRRHHSN  146

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGS+ERDEVFVPK KS L   AKYLNNPPGR  +L++ LTL WP+YL FNVS
Sbjct  147  TGSMERDEVFVPKPKSKLSCFAKYLNNPPGRVLSLVVTLTLGWPMYLAFNVS  198


 Score =   124 bits (312),  Expect(2) = 3e-78, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDLI  299
            MGAGGRM V    + ++  + RVP  KPPFTLG+IK+AIPPHCF+RS+LRSFSYVV+DL 
Sbjct  1    MGAGGRMPVDGIKEENRGSVNRVPIEKPPFTLGQIKQAIPPHCFRRSLLRSFSYVVHDLC  60

Query  300  IASSLYYVATNYFHLLPHPLSYLAWP  377
            +AS  YY+AT+YFH LP P SY+AWP
Sbjct  61   LASLFYYIATSYFHFLPQPFSYIAWP  86



>gb|ADM48789.1| microsomal oleate desaturase [Carthamus tinctorius]
 gb|AGC65499.1| FAD2-2 protein [Carthamus tinctorius]
Length=383

 Score =   186 bits (472),  Expect(2) = 3e-78, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YW  QGCV+TGVWVIAHECGHHAFSDYQWLDDTVGLILHS LLVP+FSWKYSHRRHHSN
Sbjct  89   IYWAVQGCVMTGVWVIAHECGHHAFSDYQWLDDTVGLILHSVLLVPYFSWKYSHRRHHSN  148

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGS+E DEVFVPK KS +   AKYLNNPPGR  TLL+ LTL WPLYLMFNVS
Sbjct  149  TGSIEHDEVFVPKLKSGVRSTAKYLNNPPGRILTLLVTLTLGWPLYLMFNVS  200


 Score =   134 bits (336),  Expect(2) = 3e-78, Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 74/88 (84%), Gaps = 2/88 (2%)
 Frame = +3

Query  120  MGAGGRMAVPAEG--KMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYD  293
            MGAGGRM+ P+EG  K   + +QRVPY KPPFT+G++KKAIPPHCF RSV+RSFSYVVYD
Sbjct  1    MGAGGRMSNPSEGEKKTELEGIQRVPYQKPPFTVGDVKKAIPPHCFNRSVIRSFSYVVYD  60

Query  294  LIIASSLYYVATNYFHLLPHPLSYLAWP  377
            L IAS LYY+AT +  LLPHPL+Y+AWP
Sbjct  61   LTIASILYYIATTFIPLLPHPLAYVAWP  88



>gb|AAF04094.1|AF188264_1 delta-12 oleate desaturase [Vernonia galamensis]
Length=383

 Score =   188 bits (478),  Expect(2) = 4e-78, Method: Compositional matrix adjust.
 Identities = 95/112 (85%), Positives = 102/112 (91%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YWI QGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVP+FSWKYSHRRHHSN
Sbjct  89   VYWIFQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPYFSWKYSHRRHHSN  148

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGS+E DEVFVPK KS++   A+YLNNPPGR  TLL+ LTL WPLYLMFNVS
Sbjct  149  TGSIEHDEVFVPKLKSNVRSTARYLNNPPGRILTLLVTLTLGWPLYLMFNVS  200


 Score =   130 bits (327),  Expect(2) = 4e-78, Method: Compositional matrix adjust.
 Identities = 63/88 (72%), Positives = 71/88 (81%), Gaps = 2/88 (2%)
 Frame = +3

Query  120  MGAGGRMAVP--AEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYD  293
            MGAGGRM+ P   E K   + LQRVPY KPPFT+G+IKKAIPPHCF RSV+RSFSYVVYD
Sbjct  1    MGAGGRMSNPPKDEKKAEHEALQRVPYQKPPFTVGDIKKAIPPHCFNRSVIRSFSYVVYD  60

Query  294  LIIASSLYYVATNYFHLLPHPLSYLAWP  377
            L I+   YY+ATNY  LLPHPLSY+AWP
Sbjct  61   LTISFIFYYLATNYIPLLPHPLSYVAWP  88



>gb|AHY24226.1| delta-12 fatty acid desaturase [Paeonia lactiflora]
Length=383

 Score =   189 bits (479),  Expect(2) = 5e-78, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 102/112 (91%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YW  QGC LTGVWVIAHECGHHAFSDYQW+DDTVGLILHS+LLVP+FSWK+SHRRHHSN
Sbjct  88   IYWALQGCNLTGVWVIAHECGHHAFSDYQWVDDTVGLILHSSLLVPYFSWKHSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK KS +GW++KYLNNPPGR  TL+I LTL WPLYL FNVS
Sbjct  148  TGSLERDEVFVPKPKSQVGWYSKYLNNPPGRLLTLVITLTLGWPLYLAFNVS  199


 Score =   130 bits (326),  Expect(2) = 5e-78, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 73/87 (84%), Gaps = 1/87 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRMAVP    + ++  L+RVP +KPPFTLGE+KKA+PPHCF+RS++ SFSYVVYDL
Sbjct  1    MGAGGRMAVPTSNSVEEEKPLKRVPCSKPPFTLGEVKKAVPPHCFERSLIHSFSYVVYDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWP  377
             IA  LYY++T+YFHLLPHP  Y+AWP
Sbjct  61   CIAFLLYYISTSYFHLLPHPFPYVAWP  87



>gb|AFN53713.1| omega-6 desaturase [Linum usitatissimum]
Length=769

 Score =   205 bits (522),  Expect(2) = 8e-78, Method: Compositional matrix adjust.
 Identities = 89/112 (79%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YW CQGC+LTGVWV+AHECGHHAFSDYQWLDD VG +LHS+LLVP+FSWK+SHRRHHSN
Sbjct  77   VYWACQGCILTGVWVLAHECGHHAFSDYQWLDDMVGFVLHSSLLVPYFSWKHSHRRHHSN  136

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSL+RDEVFVPKQK+++GW++KYLNNPPGR  TL + LTL WPLYL FNVS
Sbjct  137  TGSLDRDEVFVPKQKAEIGWYSKYLNNPPGRVITLAVTLTLGWPLYLAFNVS  188


 Score =   112 bits (281),  Expect(2) = 8e-78, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 65/80 (81%), Gaps = 4/80 (5%)
 Frame = +3

Query  138  MAVPAEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDLIIASSLY  317
            M+VP     S + ++R PY+KPPFTLGE+KKAIPPHCF+RS+ RSF+YV YDL IA+  Y
Sbjct  1    MSVPP----SSKPMKRSPYSKPPFTLGELKKAIPPHCFKRSIPRSFAYVAYDLTIAAIFY  56

Query  318  YVATNYFHLLPHPLSYLAWP  377
            Y+AT YFHLLP PL+YLAWP
Sbjct  57   YIATTYFHLLPSPLNYLAWP  76



>gb|KJB83458.1| hypothetical protein B456_013G248800 [Gossypium raimondii]
 gb|KJB83459.1| hypothetical protein B456_013G248800 [Gossypium raimondii]
Length=383

 Score =   196 bits (498),  Expect(2) = 8e-78, Method: Compositional matrix adjust.
 Identities = 89/112 (79%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YW+ QGC+LTGVWVIAHECGHHAFSDYQW+DDTVGLILHSALLVP+FSWK SHRRHHSN
Sbjct  87   VYWVLQGCILTGVWVIAHECGHHAFSDYQWVDDTVGLILHSALLVPYFSWKISHRRHHSN  146

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGS+ERDEVFVPK KS L   AKY NNPPGR  +L++ LTL WP+YL FNVS
Sbjct  147  TGSMERDEVFVPKPKSKLSCFAKYFNNPPGRVLSLVVTLTLGWPMYLAFNVS  198


 Score =   122 bits (305),  Expect(2) = 8e-78, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDLI  299
            MGAGGRM +    + ++  + RVP  KPPFTLG+IK+AIPPHCF+RS+LRSFSYVV+DL 
Sbjct  1    MGAGGRMPIDGIKEENRGSVNRVPIEKPPFTLGQIKQAIPPHCFRRSLLRSFSYVVHDLC  60

Query  300  IASSLYYVATNYFHLLPHPLSYLAWP  377
            +AS  YY+A +YFH LP P SY+AWP
Sbjct  61   LASLFYYIAASYFHFLPQPFSYIAWP  86



>gb|ABR27357.1| fatty acid desaturase 2 [Brassica juncea]
Length=384

 Score =   196 bits (499),  Expect(2) = 8e-78, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW CQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  88   LYWACQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERD VFVPK+KSD+ W+ KYLNNP GR   L +Q TL WPL L FNVS
Sbjct  148  TGSLERDGVFVPKKKSDIKWYGKYLNNPLGRTVMLTVQFTLGWPLCLAFNVS  199


 Score =   122 bits (305),  Expect(2) = 8e-78, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 71/95 (75%), Gaps = 1/95 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            M AGGRM V    K S+ D ++RVP   PPFT+GE+KKAIPPHCF+RS+ RSFSY+++D+
Sbjct  1    MSAGGRMQVSPPSKKSETDTIKRVPCETPPFTVGELKKAIPPHCFKRSIPRSFSYLIWDI  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWPFTGSARAV  401
            IIAS  YYVAT YF LLPHPLSY AWP   + +  
Sbjct  61   IIASCFYYVATTYFPLLPHPLSYFAWPLYWACQGC  95



>gb|ABF70324.1| delta-12 desaturase, partial [Orychophragmus violaceus]
Length=260

 Score =   204 bits (519),  Expect(2) = 1e-77, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW+CQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  81   LYWVCQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  140

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK+KSD+ W+ KYLNNP GR   L +Q TL WPLYL FNVS
Sbjct  141  TGSLERDEVFVPKKKSDIKWYGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVS  192


 Score =   113 bits (283),  Expect(2) = 1e-77, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +3

Query  147  PAEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDLIIASSLYYVA  326
            P+  K     L+RVP   PPFTLG++KKAIPPHCF+RS+ RSFSY+++D+IIAS  YYVA
Sbjct  4    PSSKKSETDALKRVPCETPPFTLGDLKKAIPPHCFKRSIPRSFSYLIWDIIIASCFYYVA  63

Query  327  TNYFHLLPHPLSYLAWPF  380
            TNYF LLP+PLSYLAWP 
Sbjct  64   TNYFSLLPNPLSYLAWPL  81



>gb|AFJ53118.1| fatty acid desaturase 2-2, partial [Linum usitatissimum]
Length=339

 Score =   205 bits (522),  Expect(2) = 1e-77, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YW CQGCVLTGVWV+AHECGHHAFSDYQWLDD VG +LHS L+VP+FSWK+SHRRHHSN
Sbjct  77   IYWACQGCVLTGVWVLAHECGHHAFSDYQWLDDLVGFVLHSCLMVPYFSWKHSHRRHHSN  136

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPKQKS +GWH+KYLNNPPGR  TL + LTL WPLYL FNVS
Sbjct  137  TGSLERDEVFVPKQKSAIGWHSKYLNNPPGRVLTLAVTLTLGWPLYLAFNVS  188


 Score =   112 bits (280),  Expect(2) = 1e-77, Method: Compositional matrix adjust.
 Identities = 50/75 (67%), Positives = 60/75 (80%), Gaps = 0/75 (0%)
 Frame = +3

Query  153  EGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDLIIASSLYYVATN  332
              K   +  +R PY+KPPFTLGEIKKA+PPHCF+RS+ RSFSYV YDL IA+  YY+AT 
Sbjct  2    SNKADSETFKRSPYSKPPFTLGEIKKAVPPHCFKRSIPRSFSYVAYDLTIAAIFYYIATT  61

Query  333  YFHLLPHPLSYLAWP  377
            Y HLLP+PLSY+AWP
Sbjct  62   YIHLLPNPLSYVAWP  76



>gb|ADL09404.1| fatty acid desaturase [Wrightia tinctoria]
Length=381

 Score =   189 bits (479),  Expect(2) = 1e-77, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YWI QGCV TGVWVIAHECGHHAFSDYQW+DDTVGLILHSALLVP+FSWKYSHRRHHSN
Sbjct  88   IYWIFQGCVCTGVWVIAHECGHHAFSDYQWVDDTVGLILHSALLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK KS + W +K+LNNPPGR  TLL+ LTL WPLYL FNVS
Sbjct  148  TGSLERDEVFVPKPKSKMPWFSKFLNNPPGRVLTLLVTLTLGWPLYLAFNVS  199


 Score =   128 bits (322),  Expect(2) = 1e-77, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 69/87 (79%), Gaps = 1/87 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQDL-QRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM+VP      K    QRVPY KPPFTL +IKKAIPPHCFQRS+LRSFSY+VYDL
Sbjct  1    MGAGGRMSVPTTISGQKNSSPQRVPYQKPPFTLSDIKKAIPPHCFQRSLLRSFSYLVYDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWP  377
            ++ S  YY+ATNYFHLLP P  YLAWP
Sbjct  61   LLISFFYYIATNYFHLLPSPYCYLAWP  87



>gb|ABF70311.1| delta-12 desaturase, partial [Crambe hispanica]
 gb|ABF70312.1| delta-12 desaturase, partial [Crambe hispanica]
Length=260

 Score =   202 bits (515),  Expect(2) = 1e-77, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW CQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  81   LYWACQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  140

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK+KSD+ W+ KYLNNP GR   L +Q TL WPLYL FNVS
Sbjct  141  TGSLERDEVFVPKKKSDIKWYGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVS  192


 Score =   115 bits (287),  Expect(2) = 1e-77, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = +3

Query  147  PAEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDLIIASSLYYVA  326
            P+  K     L+RVP   PPFT+GE+KKAIPPHCF+RS+ RSFSY+++D+IIAS  YY+A
Sbjct  4    PSPKKSETDTLKRVPCETPPFTVGELKKAIPPHCFKRSIPRSFSYLIWDIIIASCFYYIA  63

Query  327  TNYFHLLPHPLSYLAWPFTGSARAV  401
            TNYF LLPHPLSYLAWP   + +  
Sbjct  64   TNYFSLLPHPLSYLAWPLYWACQGC  88



>gb|ABF70319.1| delta-12 desaturase, partial [Isatis tinctoria]
Length=260

 Score =   204 bits (519),  Expect(2) = 1e-77, Method: Compositional matrix adjust.
 Identities = 95/112 (85%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW CQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  81   LYWACQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  140

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPKQKSD+ W+ KYLNNP GR   L +Q TL WPLYL FNVS
Sbjct  141  TGSLERDEVFVPKQKSDIKWYGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVS  192


 Score =   113 bits (282),  Expect(2) = 1e-77, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = +3

Query  147  PAEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDLIIASSLYYVA  326
            P+  K     L+RVP   PPFTLGE+KKAIPPHCF+RS+ RSFSY+++D+IIAS  Y+VA
Sbjct  4    PSTKKSETDALKRVPCETPPFTLGELKKAIPPHCFKRSIPRSFSYLIWDIIIASCFYFVA  63

Query  327  TNYFHLLPHPLSYLAWPFTGSARAV  401
            TNYF LLP PLSYLAWP   + +  
Sbjct  64   TNYFSLLPQPLSYLAWPLYWACQGC  88



>emb|CAA76157.1| delta 12 fatty acid desaturase [Crepis palaestina]
Length=379

 Score =   187 bits (474),  Expect(2) = 2e-77, Method: Compositional matrix adjust.
 Identities = 95/112 (85%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YW  QGCVLTGVWVIAHECGHHAFSD+QWLDDTVGLILHS LLVP+FSWKYSHRRHHSN
Sbjct  84   IYWALQGCVLTGVWVIAHECGHHAFSDHQWLDDTVGLILHSFLLVPYFSWKYSHRRHHSN  143

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGS+E DEVFVPK KSDL   AKYLNNPPGR  TLL+ LTL WPLYLMFNVS
Sbjct  144  TGSIEHDEVFVPKLKSDLRSTAKYLNNPPGRILTLLVTLTLGWPLYLMFNVS  195


 Score =   130 bits (327),  Expect(2) = 2e-77, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 68/86 (79%), Gaps = 3/86 (3%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDLI  299
            MGAGGRM  P+  K + +   RVPY KPPFT+GE+KKAIPPHCF RSV+RSFSYVVYDL 
Sbjct  1    MGAGGRMQDPSNDKTTTE---RVPYQKPPFTVGELKKAIPPHCFNRSVIRSFSYVVYDLT  57

Query  300  IASSLYYVATNYFHLLPHPLSYLAWP  377
            IAS  YY+ATNY H LP PL+Y AWP
Sbjct  58   IASIFYYIATNYIHTLPQPLTYFAWP  83



>gb|ABF70309.1| delta-12 desaturase, partial [Crambe filiformis]
Length=261

 Score =   202 bits (515),  Expect(2) = 2e-77, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW CQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  81   LYWACQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  140

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK+KSD+ W+ KYLNNP GR   L +Q TL WPLYL FNVS
Sbjct  141  TGSLERDEVFVPKKKSDIKWYGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVS  192


 Score =   114 bits (285),  Expect(2) = 2e-77, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = +3

Query  147  PAEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDLIIASSLYYVA  326
            P+  K     ++RVP   PPFT+GE+KKAIPPHCF+RS+ RSFSY+++D+IIAS  YY+A
Sbjct  4    PSPKKSETDTIKRVPCETPPFTVGELKKAIPPHCFKRSIPRSFSYLIWDIIIASCFYYIA  63

Query  327  TNYFHLLPHPLSYLAWPFTGSARAV  401
            TNYF LLPHPLSYLAWP   + +  
Sbjct  64   TNYFSLLPHPLSYLAWPLYWACQGC  88



>gb|ABF70320.1| delta-12 desaturase, partial [Isatis tinctoria]
 gb|ABF70321.1| delta-12 desaturase, partial [Isatis tinctoria]
Length=260

 Score =   206 bits (523),  Expect(2) = 3e-77, Method: Compositional matrix adjust.
 Identities = 95/112 (85%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW+CQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  81   LYWVCQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  140

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPKQKSD+ W+ KYLNNP GR   L +Q TL WPLYL FNVS
Sbjct  141  TGSLERDEVFVPKQKSDIKWYGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVS  192


 Score =   110 bits (276),  Expect(2) = 3e-77, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = +3

Query  147  PAEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDLIIASSLYYVA  326
            P+  K     L+RVP   PPFTLGE+KKAIPPHCF+RS+ RSFSY+++D+IIAS  Y+VA
Sbjct  4    PSSKKSETDALKRVPCETPPFTLGELKKAIPPHCFKRSIPRSFSYLIWDIIIASCFYFVA  63

Query  327  TNYFHLLPHPLSYLAWPF  380
            T YF LLP PLSYLAWP 
Sbjct  64   TTYFSLLPQPLSYLAWPL  81



>ref|XP_010091397.1| Omega-6 fatty acid desaturase, endoplasmic reticulum isozyme 
2 [Morus notabilis]
 gb|EXB44402.1| Omega-6 fatty acid desaturase, endoplasmic reticulum isozyme 
2 [Morus notabilis]
Length=381

 Score =   187 bits (475),  Expect(2) = 3e-77, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +Y   QGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHS+LLVP+FSWKYSHRRHHSN
Sbjct  88   IYGFIQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSSLLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPKQKS + W++KYLNNP GR  TL I LTL WPLYL+FNVS
Sbjct  148  TGSLERDEVFVPKQKSSIRWYSKYLNNPLGRFLTLTITLTLGWPLYLLFNVS  199


 Score =   129 bits (324),  Expect(2) = 3e-77, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 72/90 (80%), Gaps = 1/90 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM+VP   K S+ D L+RVPY+KPPFTL +IKKAIPPHCF+RSV+ SFSYVVYDL
Sbjct  1    MGAGGRMSVPPAAKNSEIDSLKRVPYSKPPFTLSQIKKAIPPHCFKRSVIHSFSYVVYDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWPFTG  386
             IA + YY+ TNY   LPHPL YLAWP  G
Sbjct  61   TIAFTFYYIVTNYIPQLPHPLPYLAWPIYG  90



>gb|AAL68983.1|AF251844_1 delta-12 oleate desaturase [Helianthus annuus]
 gb|AAX19365.1| delta-12 oleate desaturase [Helianthus annuus]
 gb|AAX19366.1| delta-12 oleate desaturase [Helianthus annuus]
 gb|AAX19367.1| delta-12 oleate desaturase [Helianthus annuus]
 gb|AAX19368.1| delta-12 oleate desaturase [Helianthus annuus]
 gb|AAX19369.1| delta-12 oleate desaturase [Helianthus annuus]
 gb|AAX19370.1| delta-12 oleate desaturase [Helianthus annuus]
 gb|AAX19371.1| delta-12 oleate desaturase [Helianthus annuus]
 gb|AAX19372.1| delta-12 oleate desaturase [Helianthus annuus]
 gb|AAX19373.1| delta-12 oleate desaturase [Helianthus annuus]
 gb|AAX19374.1| delta-12 oleate desaturase [Helianthus annuus]
 gb|AAX19375.1| delta-12 oleate desaturase [Helianthus annuus]
Length=382

 Score =   202 bits (514),  Expect(2) = 3e-77, Method: Compositional matrix adjust.
 Identities = 95/112 (85%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YWI QGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVP+FSWKYSHRRHHSN
Sbjct  88   VYWIFQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGS+E DEVFVPK KS +   AKYLNNPPGR  TLL+ LT+ WPLYLMFNVS
Sbjct  148  TGSIEHDEVFVPKLKSSVRSTAKYLNNPPGRILTLLVTLTMGWPLYLMFNVS  199


 Score =   114 bits (284),  Expect(2) = 3e-77, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 68/87 (78%), Gaps = 1/87 (1%)
 Frame = +3

Query  120  MGAGGRMAVP-AEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM+ P  + K   + L+R  + KPPFT+G+IKK IPPHCF+RSV+RSFSYVVYDL
Sbjct  1    MGAGGRMSSPNGKEKDGPKPLERALHEKPPFTVGDIKKVIPPHCFKRSVIRSFSYVVYDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWP  377
             IAS  YY+A NY  LLP+ L+Y+AWP
Sbjct  61   TIASIFYYLANNYIPLLPNSLAYVAWP  87



>gb|ABP49577.1| oleate desaturase [Caragana korshinskii]
Length=383

 Score =   189 bits (480),  Expect(2) = 3e-77, Method: Compositional matrix adjust.
 Identities = 87/111 (78%), Positives = 97/111 (87%), Gaps = 0/111 (0%)
 Frame = +2

Query  380  YWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSNT  559
            YW  QGC+LTGVWVIAHECGHHAFSDYQWLDDTVGL+LHSALLV +FSWKYSHRRHHSNT
Sbjct  89   YWAIQGCILTGVWVIAHECGHHAFSDYQWLDDTVGLVLHSALLVLYFSWKYSHRRHHSNT  148

Query  560  GSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            GSL+RDEVFVPK+K+ + W++KYLNNP GR   + I LTL WPLYL  NVS
Sbjct  149  GSLDRDEVFVPKKKTGIQWYSKYLNNPLGRVVAITITLTLGWPLYLALNVS  199


 Score =   127 bits (318),  Expect(2) = 3e-77, Method: Compositional matrix adjust.
 Identities = 58/87 (67%), Positives = 73/87 (84%), Gaps = 1/87 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGR +VP   + S+ D ++RVP+ KPPF+L ++KKAIPPHCF+RS++RSFSYVVYDL
Sbjct  1    MGAGGRTSVPPTNRKSETDTVKRVPFEKPPFSLSQLKKAIPPHCFKRSIIRSFSYVVYDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWP  377
             IA  LYY+AT+YFH LP PLS+LAWP
Sbjct  61   TIAFCLYYIATHYFHNLPRPLSFLAWP  87



>gb|AEE69021.1| Fad2 [Vernicia fordii]
Length=383

 Score =   180 bits (457),  Expect(2) = 4e-77, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YW  QGCVLTGVWVIAHECGHHAFSDYQ LDD VGL+LHS LLVP+FSWK+SHRRHHSN
Sbjct  88   IYWALQGCVLTGVWVIAHECGHHAFSDYQLLDDIVGLVLHSCLLVPYFSWKHSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            T SLERDEVFVPK+KS + W +KYLNNPPGR FTL I LTL WPLYL FNVS
Sbjct  148  TASLERDEVFVPKKKSSIRWFSKYLNNPPGRLFTLTITLTLGWPLYLAFNVS  199


 Score =   135 bits (340),  Expect(2) = 4e-77, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 75/87 (86%), Gaps = 1/87 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAE-GKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM+VP    K+  + L+RVP++KPPFTLG++KKAIPPHCFQRSVLRSFSYVVYDL
Sbjct  1    MGAGGRMSVPPPPKKLESEVLKRVPHSKPPFTLGQLKKAIPPHCFQRSVLRSFSYVVYDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWP  377
             +A   YY+ATNYFHLLP PLSY+AWP
Sbjct  61   TVAFIFYYIATNYFHLLPQPLSYVAWP  87



>gb|AAN87573.1| delta 12 oleic acid desaturase FAD2 [Vernicia fordii]
Length=383

 Score =   180 bits (457),  Expect(2) = 5e-77, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YW  QGCVLTGVWVIAHECGHHAFSDYQ LDD VGL+LHS LLVP+FSWK+SHRRHHSN
Sbjct  88   IYWALQGCVLTGVWVIAHECGHHAFSDYQLLDDIVGLVLHSCLLVPYFSWKHSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            T SLERDEVFVPK+KS + W +KYLNNPPGR FTL I LTL WPLYL FNVS
Sbjct  148  TASLERDEVFVPKKKSSIRWFSKYLNNPPGRLFTLTITLTLGWPLYLAFNVS  199


 Score =   135 bits (340),  Expect(2) = 5e-77, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 75/87 (86%), Gaps = 1/87 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAE-GKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM+VP    K+  + L+RVP++KPPFTLG++KKAIPPHCFQRSVLRSFSYVVYDL
Sbjct  1    MGAGGRMSVPPPPKKLESEVLKRVPHSKPPFTLGQLKKAIPPHCFQRSVLRSFSYVVYDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWP  377
             +A   YY+ATNYFHLLP PLSY+AWP
Sbjct  61   TVAFIFYYIATNYFHLLPQPLSYVAWP  87



>gb|AAO37754.1| delta-12 oleate desaturase [Punica granatum]
Length=387

 Score =   199 bits (506),  Expect(2) = 5e-77, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YW  QGCVLTGVWVIAHECGHHAFSDYQW+DD VGL+LHSALLVP+FSWKYSHRRHHSN
Sbjct  92   VYWALQGCVLTGVWVIAHECGHHAFSDYQWVDDCVGLVLHSALLVPYFSWKYSHRRHHSN  151

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK KS + W +KYLNNPPGR  TL++ LTL WPLYL  NVS
Sbjct  152  TGSLERDEVFVPKPKSKMPWFSKYLNNPPGRVMTLIVTLTLGWPLYLALNVS  203


 Score =   116 bits (291),  Expect(2) = 5e-77, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 69/91 (76%), Gaps = 5/91 (5%)
 Frame = +3

Query  120  MGAGGRMAVP----AEG-KMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYV  284
            MGAGGRM VP     EG + S++ +QRVP AKPPFTL EIKKAIPPHCF+RS+L+SFSYV
Sbjct  1    MGAGGRMTVPNKWEGEGDEKSQKPVQRVPSAKPPFTLSEIKKAIPPHCFKRSLLKSFSYV  60

Query  285  VYDLIIASSLYYVATNYFHLLPHPLSYLAWP  377
            +YDL + +  YYVAT Y   LP PL Y AWP
Sbjct  61   LYDLTLVAIFYYVATTYIDALPGPLRYAAWP  91



>gb|AAF04093.1|AF188263_1 delta-12 oleate desaturase [Vernonia galamensis]
Length=383

 Score =   189 bits (479),  Expect(2) = 5e-77, Method: Compositional matrix adjust.
 Identities = 95/112 (85%), Positives = 102/112 (91%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YWI QGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVP+FSWKYSHRRHHSN
Sbjct  89   VYWIFQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPYFSWKYSHRRHHSN  148

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGS+E DEVFVPK KS++   A+YLNNPPGR  TLL+ LTL WPLYLMFNVS
Sbjct  149  TGSIEHDEVFVPKLKSNVRSTARYLNNPPGRILTLLVTLTLGWPLYLMFNVS  200


 Score =   127 bits (318),  Expect(2) = 5e-77, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 70/88 (80%), Gaps = 2/88 (2%)
 Frame = +3

Query  120  MGAGGRMAVP--AEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYD  293
            MGAGGRM+ P   E K   + LQRVPY KPPFT+G+IKKAIPPHC  RSV++SFSYVVYD
Sbjct  1    MGAGGRMSNPPKDEKKAEHEALQRVPYQKPPFTVGDIKKAIPPHCLNRSVIKSFSYVVYD  60

Query  294  LIIASSLYYVATNYFHLLPHPLSYLAWP  377
            L I+   YY+ATNY  LLPHPLSY+AWP
Sbjct  61   LTISFIFYYLATNYIPLLPHPLSYVAWP  88



>emb|CAA65744.1| omega-6 desaturase [Gossypium hirsutum]
Length=385

 Score =   191 bits (486),  Expect(2) = 5e-77, Method: Compositional matrix adjust.
 Identities = 88/112 (79%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YW+ QGC+LTGVWVIAHE GHHAF DYQW+DDTVGLILHSALLVP+FSWK SHRRHHSN
Sbjct  87   VYWVLQGCILTGVWVIAHEWGHHAFRDYQWVDDTVGLILHSALLVPYFSWKISHRRHHSN  146

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGS+ERDEVFVPK KS L   AKYLNNPPGR  +L++ LTL WP+YL FNVS
Sbjct  147  TGSMERDEVFVPKPKSKLSCFAKYLNNPPGRVLSLVVTLTLGWPMYLAFNVS  198


 Score =   124 bits (311),  Expect(2) = 5e-77, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDLI  299
            MGAGGRM +    + ++  + RVP  KPPFTLG+IK+AIPPHCF+RS+LRSFSYVV+DL 
Sbjct  1    MGAGGRMPIDGIKEENRGSVNRVPIEKPPFTLGQIKQAIPPHCFRRSLLRSFSYVVHDLC  60

Query  300  IASSLYYVATNYFHLLPHPLSYLAWP  377
            +AS  YY+AT+YFH LP P SY+AWP
Sbjct  61   LASFFYYIATSYFHFLPQPFSYIAWP  86



>gb|AFJ53121.1| fatty acid desaturase 2-2, partial [Linum usitatissimum]
Length=332

 Score =   205 bits (522),  Expect(2) = 6e-77, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YW CQGCVLTGVWV+AHECGHHAFSDYQWLDD VG +LHS L+VP+FSWK+SHRRHHSN
Sbjct  73   IYWACQGCVLTGVWVLAHECGHHAFSDYQWLDDLVGFVLHSCLMVPYFSWKHSHRRHHSN  132

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPKQKS +GWH+KYLNNPPGR  TL + LTL WPLYL FNVS
Sbjct  133  TGSLERDEVFVPKQKSAIGWHSKYLNNPPGRVLTLAVTLTLGWPLYLAFNVS  184


 Score =   110 bits (274),  Expect(2) = 6e-77, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = +3

Query  165  SKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDLIIASSLYYVATNYFHL  344
              +  +R PY+KPPFTLGEIKKA+PPHCF+RS+ RSFSYV YDL IA+  YY+AT Y HL
Sbjct  2    DSETFKRSPYSKPPFTLGEIKKAVPPHCFKRSIPRSFSYVAYDLTIAAIFYYIATTYIHL  61

Query  345  LPHPLSYLAWP  377
            LP+PLSY+AWP
Sbjct  62   LPNPLSYVAWP  72



>gb|ABF70329.1| delta-12 desaturase, partial [Thlaspi arvense]
Length=260

 Score =   202 bits (513),  Expect(2) = 6e-77, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW+CQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  81   LYWVCQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  140

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLE+DEVFVPKQKS + W+ KYLNNP GR   L +Q TL WPLYL FNVS
Sbjct  141  TGSLEKDEVFVPKQKSAIKWYGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVS  192


 Score =   113 bits (283),  Expect(2) = 6e-77, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 63/81 (78%), Gaps = 1/81 (1%)
 Frame = +3

Query  141  AVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDLIIASSLY  317
             VP   K S+ D L+RVP  KPPFTLGE+KKAIP HCF RS+ RSFSY+++D+IIAS  Y
Sbjct  1    TVPTSSKKSETDALKRVPCEKPPFTLGELKKAIPQHCFNRSIPRSFSYLIWDIIIASCFY  60

Query  318  YVATNYFHLLPHPLSYLAWPF  380
            YVAT YF LLP PLSYLAWP 
Sbjct  61   YVATTYFSLLPQPLSYLAWPL  81



>gb|ABF70313.1| delta-12 desaturase, partial [Crambe kralikii]
Length=260

 Score =   202 bits (515),  Expect(2) = 8e-77, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW CQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  81   LYWACQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  140

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK+KSD+ W+ KYLNNP GR   L +Q TL WPLYL FNVS
Sbjct  141  TGSLERDEVFVPKKKSDIKWYGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVS  192


 Score =   112 bits (280),  Expect(2) = 8e-77, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = +3

Query  147  PAEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDLIIASSLYYVA  326
            P+  K     L+RVP   PPF LGE+KKAIPPHCF+RS+ RSFSY+++D+IIAS  YYVA
Sbjct  4    PSPKKSETDTLKRVPCETPPFALGELKKAIPPHCFKRSIPRSFSYLIWDIIIASCFYYVA  63

Query  327  TNYFHLLPHPLSYLAWPFTGSARAV  401
            T+YF LLPHPLSYLAWP   + +  
Sbjct  64   TSYFSLLPHPLSYLAWPLYWACQGC  88



>gb|ACJ84618.1| unknown [Medicago truncatula]
 gb|AFK49601.1| unknown [Medicago truncatula]
Length=411

 Score =   191 bits (485),  Expect(2) = 1e-76, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 98/112 (88%), Gaps = 1/112 (1%)
 Frame = +2

Query  380  YWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSNT  559
            Y   QGC+LTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVP+FSWKYSHRRHHSNT
Sbjct  110  YRAIQGCILTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPYFSWKYSHRRHHSNT  169

Query  560  GSLERDEVFVPKQKSDLGWHAKYL-NNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            GSLERDEVFVPKQKS + W++KYL NNP GR  T+ I LTL WPLYL  NVS
Sbjct  170  GSLERDEVFVPKQKSSIYWYSKYLSNNPLGRVLTITITLTLGWPLYLALNVS  221


 Score =   123 bits (308),  Expect(2) = 1e-76, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 71/88 (81%), Gaps = 1/88 (1%)
 Frame = +3

Query  117  KMGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYD  293
            KMGAGGR +VP   + S+ D ++RVP+ KPPF+L +IKKAIPPHCF+RSV+ SFSYVVYD
Sbjct  21   KMGAGGRTSVPPSARKSENDTVKRVPFEKPPFSLSQIKKAIPPHCFKRSVIHSFSYVVYD  80

Query  294  LIIASSLYYVATNYFHLLPHPLSYLAWP  377
            L IA  LYYVAT+Y   LP PLS+LAWP
Sbjct  81   LTIAFFLYYVATHYLQHLPRPLSFLAWP  108



>ref|XP_002285640.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2 [Vitis vinifera]
 emb|CAN79670.1| hypothetical protein VITISV_018075 [Vitis vinifera]
 gb|AEI60129.1| microsomal delta-12 oleate desaturase [Vitis labrusca]
Length=376

 Score =   197 bits (502),  Expect(2) = 2e-76, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW  QGC LTGVWVIAHECGHHAFSDYQWLDDTVGLILHS+LLVP+FSWK SHRRHHSN
Sbjct  81   LYWTLQGCTLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSSLLVPYFSWKISHRRHHSN  140

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK KS + W +KYLNNP GRA TL+I LTL WPLYL FNVS
Sbjct  141  TGSLERDEVFVPKPKSRIPWFSKYLNNPLGRALTLVITLTLGWPLYLAFNVS  192


 Score =   116 bits (290),  Expect(2) = 2e-76, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 67/87 (77%), Gaps = 6/87 (7%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDLI  299
            MGAGGR++VP         +QRVP+ KPPFTLG+IKKAIPPHCFQRS+ RSFSYV YDL 
Sbjct  1    MGAGGRLSVP------NSPVQRVPHTKPPFTLGQIKKAIPPHCFQRSIPRSFSYVAYDLS  54

Query  300  IASSLYYVATNYFHLLPHPLSYLAWPF  380
            +A   YY+AT+YF LLP  L+YLAWP 
Sbjct  55   LAFLFYYIATSYFSLLPSWLTYLAWPL  81



>ref|XP_010672659.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Beta vulgaris subsp. vulgaris]
 ref|XP_010672660.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Beta vulgaris subsp. vulgaris]
Length=382

 Score =   184 bits (466),  Expect(2) = 2e-76, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +Y   QGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHS LLVP+FSWKYSHRRHHSN
Sbjct  87   VYGFVQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSFLLVPYFSWKYSHRRHHSN  146

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGS+E+DEVFVPK K DL W +KY+NNP GR  TL + LTL WPLYL+FNVS
Sbjct  147  TGSIEKDEVFVPKTKKDLAWFSKYMNNPLGRLLTLSVTLTLGWPLYLLFNVS  198


 Score =   130 bits (327),  Expect(2) = 2e-76, Method: Compositional matrix adjust.
 Identities = 63/89 (71%), Positives = 70/89 (79%), Gaps = 0/89 (0%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDLI  299
            MGAGGR   P+  K     L+RVPY KPPFTLG++KKAIPPHCFQRSVLRSFSYVVYD I
Sbjct  1    MGAGGRSMPPSTRKEKPDALKRVPYEKPPFTLGQLKKAIPPHCFQRSVLRSFSYVVYDFI  60

Query  300  IASSLYYVATNYFHLLPHPLSYLAWPFTG  386
            IA  LY+VATNY +LLP P +YLAWP  G
Sbjct  61   IAFLLYFVATNYINLLPKPFNYLAWPVYG  89



>ref|XP_007145683.1| hypothetical protein PHAVU_007G259500g [Phaseolus vulgaris]
 gb|ESW17677.1| hypothetical protein PHAVU_007G259500g [Phaseolus vulgaris]
Length=383

 Score =   198 bits (503),  Expect(2) = 2e-76, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYWI QG VLTGVWVIAHECGHHAFSDYQWLDD+VGL+LHS LLVP+FSWKYSHRRHHSN
Sbjct  89   LYWIIQGSVLTGVWVIAHECGHHAFSDYQWLDDSVGLVLHSFLLVPYFSWKYSHRRHHSN  148

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK K+ + W++KYLNNP GR  TL I LTL WPLYL FNVS
Sbjct  149  TGSLERDEVFVPKTKASIRWYSKYLNNPVGRVLTLFITLTLGWPLYLAFNVS  200


 Score =   115 bits (289),  Expect(2) = 2e-76, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 68/89 (76%), Gaps = 2/89 (2%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQDL--QRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYD  293
            MG GGR + P +    + ++  +RVP+AKPPF+L ++KKAIPPHCFQRSV+RSFSYV YD
Sbjct  1    MGGGGRSSAPKQRNSGEDEVSKKRVPHAKPPFSLSQVKKAIPPHCFQRSVIRSFSYVFYD  60

Query  294  LIIASSLYYVATNYFHLLPHPLSYLAWPF  380
            L IASSL+Y+A NYF  LP+ LS  AWP 
Sbjct  61   LAIASSLFYLALNYFSTLPNNLSLFAWPL  89



>gb|ABF70303.1| delta-12 desaturase, partial [Crambe hispanica subsp. abyssinica]
Length=260

 Score =   204 bits (518),  Expect(2) = 2e-76, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW+CQGCVLTG+WVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  81   LYWVCQGCVLTGIWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  140

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK+KSD+ W+ KYLNNP GR   L +Q TL WPLYL FNVS
Sbjct  141  TGSLERDEVFVPKKKSDIKWYGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVS  192


 Score =   110 bits (274),  Expect(2) = 2e-76, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +3

Query  147  PAEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDLIIASSLYYVA  326
            P+  K     L+RVP   PPFT+GE+KKAIPPHCF+RS+ RSFSY+++D+IIAS  YY+A
Sbjct  4    PSPKKSETDTLKRVPCETPPFTVGELKKAIPPHCFKRSIPRSFSYLIWDIIIASCFYYIA  63

Query  327  TNYFHLLPHPLSYLAWPF  380
            T+YF LLPH LSYLAWP 
Sbjct  64   TSYFSLLPHSLSYLAWPL  81



>emb|CAD24671.1| delta 12-acyl-lipid-desaturase [Punica granatum]
Length=387

 Score =   197 bits (500),  Expect(2) = 2e-76, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YW  QGCVLTGVWVIAHECGHHAFSDYQW+DD VGL+LHSALLVP+FSWKYSHRRHHSN
Sbjct  92   VYWALQGCVLTGVWVIAHECGHHAFSDYQWVDDCVGLVLHSALLVPYFSWKYSHRRHHSN  151

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGS ERDEVFVPK KS + W +KYLNNPPGR  TL++ LTL WPLYL  NVS
Sbjct  152  TGSXERDEVFVPKPKSKMPWFSKYLNNPPGRVMTLIVTLTLGWPLYLALNVS  203


 Score =   116 bits (291),  Expect(2) = 2e-76, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 69/91 (76%), Gaps = 5/91 (5%)
 Frame = +3

Query  120  MGAGGRMAVP----AEG-KMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYV  284
            MGAGGRM VP     EG + S++ +QRVP AKPPFTL EIKKAIPPHCF+RS+L+SFSYV
Sbjct  1    MGAGGRMTVPNKWEGEGDEKSQKPVQRVPSAKPPFTLSEIKKAIPPHCFKRSLLKSFSYV  60

Query  285  VYDLIIASSLYYVATNYFHLLPHPLSYLAWP  377
            +YDL + +  YYVAT Y   LP PL Y AWP
Sbjct  61   LYDLTLVAIFYYVATTYIDALPGPLRYAAWP  91



>gb|ABF70289.1| delta-12 desaturase, partial [Brassica juncea var. tumida]
Length=261

 Score =   203 bits (516),  Expect(2) = 2e-76, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW CQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  81   LYWACQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  140

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK+KSD+ W+ KYLNNP GR   L +Q TL WPLYL FNVS
Sbjct  141  TGSLERDEVFVPKKKSDIKWYGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVS  192


 Score =   110 bits (275),  Expect(2) = 2e-76, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = +3

Query  147  PAEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDLIIASSLYYVA  326
            P+  K     L+RVP   PPFT+GE+KKAIPPHCF+RS+ RSFSY+++D+I+AS  YYVA
Sbjct  4    PSPKKSETDTLKRVPCETPPFTVGELKKAIPPHCFKRSIPRSFSYLIWDIIVASCFYYVA  63

Query  327  TNYFHLLPHPLSYLAWPFTGSARAV  401
            T YF LLPHPLSY+AWP   + +  
Sbjct  64   TTYFPLLPHPLSYIAWPLYWACQGC  88



>gb|AEE69020.1| Fad2 [Vernicia fordii]
Length=383

 Score =   180 bits (457),  Expect(2) = 3e-76, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YW  QGCVLTGVWVIAHECGHHAFSDYQ LDD VGL+LHS LLVP+FSWK+SHRRHHSN
Sbjct  88   IYWALQGCVLTGVWVIAHECGHHAFSDYQLLDDIVGLVLHSCLLVPYFSWKHSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            T SLERDEVFVPK+KS + W +KYLNNPPGR FTL I LTL WPLYL FNVS
Sbjct  148  TASLERDEVFVPKKKSSIRWFSKYLNNPPGRLFTLTITLTLGWPLYLAFNVS  199


 Score =   132 bits (333),  Expect(2) = 3e-76, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 74/87 (85%), Gaps = 1/87 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAE-GKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM+VP    K+  + L+RVP++KPPFTLG++KKAIPPHCFQRSVLRSFSYVVYDL
Sbjct  1    MGAGGRMSVPPPPKKLESEVLKRVPHSKPPFTLGQLKKAIPPHCFQRSVLRSFSYVVYDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWP  377
             +A   YY+ATNYFHLL  PLSY+AWP
Sbjct  61   TVAFIFYYIATNYFHLLTQPLSYVAWP  87



>gb|ABF70290.1| delta-12 desaturase, partial [Brassica juncea var. tumida]
Length=260

 Score =   202 bits (515),  Expect(2) = 3e-76, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW CQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  80   LYWACQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  139

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK+KSD+ W+ KYLNNP GR   L +Q TL WPLYL FNVS
Sbjct  140  TGSLERDEVFVPKKKSDIKWYGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVS  191


 Score =   110 bits (275),  Expect(2) = 3e-76, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = +3

Query  147  PAEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDLIIASSLYYVA  326
            P+  K     L+RVP   PPFT+GE+KKAIPPHCF+RS+ RSFSY+++D+I+AS  YYVA
Sbjct  3    PSPKKSETDTLKRVPCETPPFTVGELKKAIPPHCFKRSIPRSFSYLIWDIIVASCFYYVA  62

Query  327  TNYFHLLPHPLSYLAWPFTGSARAV  401
            T YF LLPHPLSY+AWP   + +  
Sbjct  63   TTYFPLLPHPLSYIAWPLYWACQGC  87



>gb|ABF70292.1| delta-12 desaturase, partial [Brassica napus]
Length=261

 Score =   202 bits (514),  Expect(2) = 3e-76, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW CQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  81   LYWACQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  140

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK+KSD+ W+ KYLNNP GR   L +Q TL WPLYL FNVS
Sbjct  141  TGSLERDEVFVPKKKSDIKWYGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVS  192


 Score =   110 bits (275),  Expect(2) = 3e-76, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 63/85 (74%), Gaps = 0/85 (0%)
 Frame = +3

Query  147  PAEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDLIIASSLYYVA  326
            P   K    +++RVP   PPFT+GE+KKAIPPHCF+RS+ RSFSY+++D+IIAS  YYVA
Sbjct  4    PPSKKSETDNIKRVPCETPPFTVGELKKAIPPHCFKRSIPRSFSYLIWDIIIASCFYYVA  63

Query  327  TNYFHLLPHPLSYLAWPFTGSARAV  401
            T YF LLPHPLSY AWP   + +  
Sbjct  64   TTYFPLLPHPLSYFAWPLYWACQGC  88



>gb|ABF70293.1| delta-12 desaturase, partial [Brassica napus]
 gb|ABF70294.1| delta-12 desaturase, partial [Brassica napus]
 gb|ABF70299.1| delta-12 desaturase, partial [Brassica rapa var. purpuraria]
Length=261

 Score =   202 bits (514),  Expect(2) = 3e-76, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW CQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  81   LYWACQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  140

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK+KSD+ W+ KYLNNP GR   L +Q TL WPLYL FNVS
Sbjct  141  TGSLERDEVFVPKKKSDIKWYGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVS  192


 Score =   110 bits (275),  Expect(2) = 3e-76, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 63/85 (74%), Gaps = 0/85 (0%)
 Frame = +3

Query  147  PAEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDLIIASSLYYVA  326
            P   K    +++RVP   PPFT+GE+KKAIPPHCF+RS+ RSFSY+++D+IIAS  YYVA
Sbjct  4    PPSKKSETDNIKRVPCETPPFTVGELKKAIPPHCFKRSIPRSFSYLIWDIIIASCFYYVA  63

Query  327  TNYFHLLPHPLSYLAWPFTGSARAV  401
            T YF LLPHPLSY AWP   + +  
Sbjct  64   TTYFPLLPHPLSYFAWPLYWACQGC  88



>ref|XP_004493583.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Cicer arietinum]
Length=384

 Score =   193 bits (491),  Expect(2) = 4e-76, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 98/112 (88%), Gaps = 1/112 (1%)
 Frame = +2

Query  380  YWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSNT  559
            YW  QGC+LTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVP+FSWKYSHRRHHSNT
Sbjct  89   YWAIQGCILTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPYFSWKYSHRRHHSNT  148

Query  560  GSLERDEVFVPKQKSDLGWHAKYL-NNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            GSLERDEVFVPKQKS   W++KYL NNP GR  T+ I LTL WPLYL  NVS
Sbjct  149  GSLERDEVFVPKQKSGTYWYSKYLSNNPLGRVLTITITLTLGWPLYLALNVS  200


 Score =   119 bits (297),  Expect(2) = 4e-76, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 70/87 (80%), Gaps = 1/87 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGR +VP + + S+ D ++RVP  KPPF+L ++KKAIPPHCF+RSV+ SFSYVVYDL
Sbjct  1    MGAGGRTSVPPQNRKSENDTVKRVPSEKPPFSLSQLKKAIPPHCFKRSVIHSFSYVVYDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWP  377
             IA  LYYVAT+Y   LP PLS+LAWP
Sbjct  61   TIAFFLYYVATHYIQHLPRPLSFLAWP  87



>ref|XP_010087393.1| Omega-6 fatty acid desaturase, endoplasmic reticulum isozyme 
2 [Morus notabilis]
 gb|EXB29003.1| Omega-6 fatty acid desaturase, endoplasmic reticulum isozyme 
2 [Morus notabilis]
Length=384

 Score =   191 bits (484),  Expect(2) = 4e-76, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 102/112 (91%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYWI QGCV TG+WVIAHECGHHAFSD+QW+DDTVGLILHSALLVP+FSWKYSHRRHHSN
Sbjct  89   LYWIVQGCVCTGIWVIAHECGHHAFSDHQWVDDTVGLILHSALLVPYFSWKYSHRRHHSN  148

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK KS + W++KYLNNPPGR  +LL+ LTL WPLYL FNVS
Sbjct  149  TGSLERDEVFVPKPKSKISWYSKYLNNPPGRLLSLLVTLTLGWPLYLAFNVS  200


 Score =   122 bits (305),  Expect(2) = 4e-76, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 70/89 (79%), Gaps = 2/89 (2%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMS--KQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYD  293
            MGAGGRM V +  K+   K  ++RVP+  PPFTL +IKKAIPPHCF+RS++RSFSYV +D
Sbjct  1    MGAGGRMPVLSSNKLEGHKSQVERVPHTTPPFTLSQIKKAIPPHCFKRSLVRSFSYVGHD  60

Query  294  LIIASSLYYVATNYFHLLPHPLSYLAWPF  380
            L  A+  YY+AT+YFHLLPHPL YLAWP 
Sbjct  61   LFFAALFYYIATSYFHLLPHPLPYLAWPL  89



>gb|ABF70302.1| delta-12 desaturase, partial [Crambe hispanica subsp. abyssinica]
Length=260

 Score =   197 bits (501),  Expect(2) = 5e-76, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW CQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  81   LYWACQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  140

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK+KS   W+ KY+NNP GR   L +Q TL WPLYL FNVS
Sbjct  141  TGSLERDEVFVPKKKSGNKWYGKYVNNPLGRTVVLTVQFTLGWPLYLAFNVS  192


 Score =   115 bits (287),  Expect(2) = 5e-76, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = +3

Query  147  PAEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDLIIASSLYYVA  326
            P+  K     L+RVP   PPFT+GE+KKAIPPHCF+RS+ RSFSY+++D+IIAS  YY+A
Sbjct  4    PSPKKSETDTLKRVPCETPPFTVGELKKAIPPHCFKRSIPRSFSYLIWDIIIASCFYYIA  63

Query  327  TNYFHLLPHPLSYLAWPFTGSARAV  401
            TNYF LLPHPLSYLAWP   + +  
Sbjct  64   TNYFSLLPHPLSYLAWPLYWACQGC  88



>gb|ADZ39688.1| microsomal delta-12 oleate desaturase [Olea europaea subsp. europaea]
Length=383

 Score =   181 bits (459),  Expect(2) = 6e-76, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 95/115 (83%), Gaps = 0/115 (0%)
 Frame = +2

Query  368  GMALYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRH  547
            G  LYWICQGCVLTGVWV+AHECGHHAF D   L +TVGLILHS+LLVP FS  YSHRRH
Sbjct  85   GWLLYWICQGCVLTGVWVVAHECGHHAFXDNHGLHNTVGLILHSSLLVPNFSGNYSHRRH  144

Query  548  HSNTGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            HSNTGSLERDEVFVP+ KS + W +K LNNPPGR   L+ QLTL WPLYLMFNVS
Sbjct  145  HSNTGSLERDEVFVPRVKSGIRWISKNLNNPPGRVLLLVFQLTLGWPLYLMFNVS  199


 Score =   130 bits (328),  Expect(2) = 6e-76, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 71/86 (83%), Gaps = 1/86 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MG GGRM++P EGK SK D +QRVP++KP F+LG+IKKAIPPHCFQRSVLRSFSYVVYDL
Sbjct  1    MGGGGRMSIPPEGKKSKSDVIQRVPHSKPQFSLGDIKKAIPPHCFQRSVLRSFSYVVYDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAW  374
             IAS L YVA+ Y   LP+PLSY  W
Sbjct  61   TIASLLCYVASTYIQFLPNPLSYFGW  86



>gb|AIN36675.1| delta 12 desaturase [Cannabis sativa]
Length=387

 Score =   196 bits (499),  Expect(2) = 6e-76, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YWI QGC+LTGVWVIAHECGHHAFSD+QW+DDTVGLILHSALLVP+FSWKYSHRRHHSN
Sbjct  91   IYWIFQGCILTGVWVIAHECGHHAFSDHQWVDDTVGLILHSALLVPYFSWKYSHRRHHSN  150

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGS++RDEVFVPK KS +   AKYLNNPPGR  +L + LTL WPLYL FNVS
Sbjct  151  TGSIDRDEVFVPKPKSQVSPFAKYLNNPPGRVLSLFVTLTLGWPLYLAFNVS  202


 Score =   115 bits (288),  Expect(2) = 6e-76, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 70/90 (78%), Gaps = 4/90 (4%)
 Frame = +3

Query  120  MGAGGRM-AVPAEGKMSKQD---LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVV  287
            MGAGGRM    +E   SK +   ++RVP+ KPPFTL EIKKAIPPHCF+RS++RSF+ V 
Sbjct  1    MGAGGRMPEAKSELNGSKNNNRLIERVPHTKPPFTLSEIKKAIPPHCFKRSLIRSFACVF  60

Query  288  YDLIIASSLYYVATNYFHLLPHPLSYLAWP  377
            +DL  AS  YYVAT+YFHL+P P+SY+AWP
Sbjct  61   HDLFFASLFYYVATSYFHLIPKPISYIAWP  90



>ref|XP_006365798.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum-like 
[Solanum tuberosum]
 ref|XP_006365799.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum-like 
[Solanum tuberosum]
Length=383

 Score =   184 bits (467),  Expect(2) = 7e-76, Method: Compositional matrix adjust.
 Identities = 81/111 (73%), Positives = 92/111 (83%), Gaps = 0/111 (0%)
 Frame = +2

Query  380  YWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSNT  559
            YWI QGCV TG+WVI HECGHH FSDYQW+DDTVGLI HSALL P+F+WK+SHRRHH+NT
Sbjct  89   YWIAQGCVSTGIWVIGHECGHHGFSDYQWVDDTVGLIFHSALLTPYFAWKHSHRRHHANT  148

Query  560  GSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            GSLE DEV++P+ KS L W+ KYLNNP GR F L   LT  WPLYLMFN+S
Sbjct  149  GSLENDEVYIPRFKSKLRWYYKYLNNPLGRVFVLAFTLTFAWPLYLMFNIS  199


 Score =   127 bits (320),  Expect(2) = 7e-76, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 70/87 (80%), Gaps = 1/87 (1%)
 Frame = +3

Query  120  MGAGGRMAVPA-EGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGG M+ P  + +  K  LQRVP +KPPFTLG++KKAIPPHCFQRS++RSFSY++ DL
Sbjct  1    MGAGGNMSTPTTKNEQKKNHLQRVPSSKPPFTLGDVKKAIPPHCFQRSLIRSFSYLIQDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWP  377
            I+ S  YY+A  YFHLLP PL+YLAWP
Sbjct  61   ILVSIFYYIANTYFHLLPSPLTYLAWP  87



>gb|ABF70295.1| delta-12 desaturase, partial [Brassica nigra]
Length=261

 Score =   202 bits (514),  Expect(2) = 7e-76, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW CQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  81   LYWACQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  140

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK+KSD+ W+ KYLNNP GR   L +Q TL WPLYL FNVS
Sbjct  141  TGSLERDEVFVPKKKSDIKWYGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVS  192


 Score =   109 bits (272),  Expect(2) = 7e-76, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 62/85 (73%), Gaps = 0/85 (0%)
 Frame = +3

Query  147  PAEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDLIIASSLYYVA  326
            P   K     ++RVP   PPFT+GE+KKAIPPHCF+RS+ RSFSY+++D+IIAS  YYVA
Sbjct  4    PPSKKSETDTIKRVPCETPPFTVGELKKAIPPHCFKRSIPRSFSYLIWDIIIASCFYYVA  63

Query  327  TNYFHLLPHPLSYLAWPFTGSARAV  401
            T YF LLPHPLSY AWP   + +  
Sbjct  64   TTYFPLLPHPLSYFAWPLYWACQGC  88



>gb|ABF70296.1| delta-12 desaturase, partial [Brassica oleracea]
 gb|ABF70297.1| delta-12 desaturase, partial [Brassica oleracea]
Length=261

 Score =   202 bits (515),  Expect(2) = 7e-76, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW CQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  81   LYWACQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  140

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK+KSD+ W+ KYLNNP GR   L +Q TL WPLYL FNVS
Sbjct  141  TGSLERDEVFVPKKKSDIKWYGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVS  192


 Score =   109 bits (272),  Expect(2) = 7e-76, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 62/85 (73%), Gaps = 0/85 (0%)
 Frame = +3

Query  147  PAEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDLIIASSLYYVA  326
            P   K     ++RVP   PPFT+GE+KKAIPPHCF+RS+ RSFSY+++D+IIAS  YYVA
Sbjct  4    PPSKKSETDTIKRVPCETPPFTVGELKKAIPPHCFKRSIPRSFSYLIWDIIIASCFYYVA  63

Query  327  TNYFHLLPHPLSYLAWPFTGSARAV  401
            T YF LLPHPLSY AWP   + +  
Sbjct  64   TTYFPLLPHPLSYFAWPLYWACQGC  88



>gb|ABF70307.1| delta-12 desaturase, partial [Erysimum cheiri]
 gb|ABF70308.1| delta-12 desaturase, partial [Erysimum cheiri]
Length=260

 Score =   201 bits (511),  Expect(2) = 1e-75, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW CQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  81   LYWACQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  140

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPKQKS + W+ KYLNNP GR   L +Q T+ WPLYL FNVS
Sbjct  141  TGSLERDEVFVPKQKSAIKWYGKYLNNPLGRIMMLTVQFTIGWPLYLAFNVS  192


 Score =   110 bits (274),  Expect(2) = 1e-75, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 66/87 (76%), Gaps = 1/87 (1%)
 Frame = +3

Query  144  VPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDLIIASSLYY  320
            VP+  K S+ D L+RVP  KPPFT+G++KKAIP HCF+RS+ RSFSY++ D+IIAS  YY
Sbjct  2    VPSSSKKSETDVLKRVPCEKPPFTVGDLKKAIPAHCFKRSIPRSFSYLITDIIIASCFYY  61

Query  321  VATNYFHLLPHPLSYLAWPFTGSARAV  401
            VATNY  LLP PLSYLAWP   + +  
Sbjct  62   VATNYISLLPQPLSYLAWPLYWACQGC  88



>gb|ABF70326.1| delta-12 desaturase, partial [Rorippa indica]
Length=260

 Score =   200 bits (509),  Expect(2) = 1e-75, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW+CQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  81   LYWVCQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  140

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPKQKS + W+ KYLNNP GR   L +Q TL WPLYL  NVS
Sbjct  141  TGSLERDEVFVPKQKSAIKWYGKYLNNPLGRTVMLTVQFTLGWPLYLACNVS  192


 Score =   110 bits (276),  Expect(2) = 1e-75, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 63/77 (82%), Gaps = 0/77 (0%)
 Frame = +3

Query  147  PAEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDLIIASSLYYVA  326
            P+  K   + L+RVP  +PPFT+G++KKAIPPHCF+RS+ RSFSY++ D+IIAS  +YVA
Sbjct  4    PSSKKSETEALKRVPSERPPFTVGDLKKAIPPHCFKRSIPRSFSYLITDIIIASCFFYVA  63

Query  327  TNYFHLLPHPLSYLAWP  377
            TNYF LLP PLSYLAWP
Sbjct  64   TNYFSLLPQPLSYLAWP  80



>gb|EYU46325.1| hypothetical protein MIMGU_mgv1a008048mg [Erythranthe guttata]
Length=386

 Score =   197 bits (500),  Expect(2) = 1e-75, Method: Compositional matrix adjust.
 Identities = 90/113 (80%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = +2

Query  374  ALYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHS  553
            A YW  QGCV TGVWV+AHECGHHAFSD+QW+DD VGL+LHSALLVP+FSWKYSHRRHHS
Sbjct  90   AAYWTLQGCVCTGVWVVAHECGHHAFSDHQWVDDAVGLVLHSALLVPYFSWKYSHRRHHS  149

Query  554  NTGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            NTGSLERDEVFVPKQK  + W++KYLNNPPGR  TL + LTL WPLYL FNVS
Sbjct  150  NTGSLERDEVFVPKQKFQIPWYSKYLNNPPGRFMTLFVTLTLGWPLYLAFNVS  202


 Score =   114 bits (285),  Expect(2) = 1e-75, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 65/89 (73%), Gaps = 4/89 (4%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD----LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVV  287
            MGAGGRM+ P             LQRVP+AKPPFTLGEIKKAIPPHCF RS+LRSFSYVV
Sbjct  1    MGAGGRMSSPTTKGGGGGKTATPLQRVPHAKPPFTLGEIKKAIPPHCFNRSLLRSFSYVV  60

Query  288  YDLIIASSLYYVATNYFHLLPHPLSYLAW  374
            YDL IA+ LYY+AT+Y  LLP     LAW
Sbjct  61   YDLTIAAVLYYIATSYIPLLPSTYRLLAW  89



>gb|ABF70287.1| delta-12 desaturase, partial [Arabidopsis thaliana]
Length=260

 Score =   199 bits (507),  Expect(2) = 1e-75, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW CQGCVLTG+WVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  81   LYWACQGCVLTGIWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  140

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPKQKS + W+ KYLNNP GR   L +Q  L WPLYL FNVS
Sbjct  141  TGSLERDEVFVPKQKSAIKWYGKYLNNPLGRIMMLTVQFVLGWPLYLAFNVS  192


 Score =   111 bits (277),  Expect(2) = 1e-75, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 66/87 (76%), Gaps = 1/87 (1%)
 Frame = +3

Query  144  VPAEGKMSKQDL-QRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDLIIASSLYY  320
            VP   K S+ D  +RVP  KPPF++G++KKAIPPHCF+RS+ RSFSY++ D+IIAS  YY
Sbjct  2    VPTSSKKSETDTTKRVPCEKPPFSVGDLKKAIPPHCFKRSIPRSFSYLISDIIIASCFYY  61

Query  321  VATNYFHLLPHPLSYLAWPFTGSARAV  401
            VATNYF LLP PLSYLAWP   + +  
Sbjct  62   VATNYFSLLPQPLSYLAWPLYWACQGC  88



>gb|ABF70300.1| delta-12 desaturase, partial [Barbarea vulgaris]
 gb|ABF70301.1| delta-12 desaturase, partial [Barbarea vulgaris]
 gb|ABF70304.1| delta-12 desaturase, partial [Crambe hispanica subsp. abyssinica]
Length=260

 Score =   199 bits (507),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW CQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  81   LYWACQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  140

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPKQKS + W+ KYLNNP GR   L IQ TL WPLYL  NVS
Sbjct  141  TGSLERDEVFVPKQKSAIKWYGKYLNNPLGRTVMLTIQFTLGWPLYLACNVS  192


 Score =   111 bits (277),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 66/79 (84%), Gaps = 1/79 (1%)
 Frame = +3

Query  144  VPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDLIIASSLYY  320
            VPA  K S+ + L+RVP  +PPFT+G++KKAIPPHCF+RS+ RSFSY++ D+IIAS  YY
Sbjct  2    VPASSKKSETEALKRVPSERPPFTVGDLKKAIPPHCFKRSIPRSFSYLITDIIIASCFYY  61

Query  321  VATNYFHLLPHPLSYLAWP  377
            +ATN+F LLP PLSYLAWP
Sbjct  62   LATNFFSLLPQPLSYLAWP  80



>gb|ABF70327.1| delta-12 desaturase, partial [Raphanus sativus]
Length=261

 Score =   201 bits (510),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW CQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  81   LYWACQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  140

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK+KSD+ W+ KYLNNP GR   L +Q  L WPLYL FNVS
Sbjct  141  TGSLERDEVFVPKKKSDIKWYGKYLNNPLGRTVMLTVQFALGWPLYLAFNVS  192


 Score =   109 bits (272),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 63/85 (74%), Gaps = 0/85 (0%)
 Frame = +3

Query  147  PAEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDLIIASSLYYVA  326
            P+  K     L+RVP   PPFT+G++KKAIPPHCF+RS+ RSFSY+++D+IIAS  YYVA
Sbjct  4    PSPKKSETDTLKRVPCETPPFTVGQLKKAIPPHCFKRSIPRSFSYLIWDIIIASCFYYVA  63

Query  327  TNYFHLLPHPLSYLAWPFTGSARAV  401
            T YF LLPHPLSY AWP   + +  
Sbjct  64   TTYFPLLPHPLSYFAWPLYWACQGC  88



>gb|EYU39931.1| hypothetical protein MIMGU_mgv1a008167mg [Erythranthe guttata]
Length=377

 Score =   198 bits (503),  Expect(2) = 3e-75, Method: Compositional matrix adjust.
 Identities = 94/113 (83%), Positives = 100/113 (88%), Gaps = 0/113 (0%)
 Frame = +2

Query  374  ALYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHS  553
             LY I QGCVLTGVWVIAHECGHHAFSD+QWLDDTVGL+LHSALLVP+FSWKYSHRRHHS
Sbjct  81   TLYTIVQGCVLTGVWVIAHECGHHAFSDHQWLDDTVGLVLHSALLVPYFSWKYSHRRHHS  140

Query  554  NTGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            NTGSLERDEVFVPKQK+ L   AKYLNNPPGR   L +Q TL WPLYL+FNVS
Sbjct  141  NTGSLERDEVFVPKQKTGLSPWAKYLNNPPGRILMLTVQFTLGWPLYLLFNVS  193


 Score =   111 bits (278),  Expect(2) = 3e-75, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 64/80 (80%), Gaps = 1/80 (1%)
 Frame = +3

Query  138  MAVPAEGKMSK-QDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDLIIASSL  314
            M+VP EGK SK +  QRVP++KPPFT+G +KKAIPPHCF+RS+ RSFSYV  DL IAS  
Sbjct  1    MSVPTEGKKSKPEPHQRVPHSKPPFTVGTLKKAIPPHCFKRSIPRSFSYVFLDLAIASFF  60

Query  315  YYVATNYFHLLPHPLSYLAW  374
            YY+ATNY   LPHPL YLAW
Sbjct  61   YYIATNYIPALPHPLPYLAW  80



>gb|ACJ66779.1| omega-6 desaturase [Portulaca oleracea]
Length=383

 Score =   184 bits (468),  Expect(2) = 3e-75, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +Y   QGC+LTGVWVIAHECGHHAFSDYQWLDDTVGLILHS LLVP+FSWKYSHRRHHSN
Sbjct  87   IYGYIQGCILTGVWVIAHECGHHAFSDYQWLDDTVGLILHSCLLVPYFSWKYSHRRHHSN  146

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGS++RDEVFVPK+K  + W +KYLNNPPGR  TLL+ LTL WPLYL+FNVS
Sbjct  147  TGSMDRDEVFVPKKKDGMKWFSKYLNNPPGRVLTLLVTLTLGWPLYLLFNVS  198


 Score =   125 bits (314),  Expect(2) = 3e-75, Method: Compositional matrix adjust.
 Identities = 63/89 (71%), Positives = 69/89 (78%), Gaps = 0/89 (0%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDLI  299
            MGAGGR   P+  K   + L R PYAKPPFTL +IKKAIPPHCFQRSVLRSFSYVVYDL 
Sbjct  1    MGAGGRSIPPSVRKEKPEALGRSPYAKPPFTLSQIKKAIPPHCFQRSVLRSFSYVVYDLT  60

Query  300  IASSLYYVATNYFHLLPHPLSYLAWPFTG  386
            IA+ LYY+AT Y  LLP PL+YLAWP  G
Sbjct  61   IAAILYYLATTYIPLLPKPLNYLAWPIYG  89



>gb|ABF70288.1| delta-12 desaturase, partial [Brassica carinata]
Length=261

 Score =   200 bits (508),  Expect(2) = 3e-75, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW CQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKY HRRHHSN
Sbjct  81   LYWACQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYCHRRHHSN  140

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK+KSD+ W+ KYLNNP GR   L +Q TL WPLYL FNVS
Sbjct  141  TGSLERDEVFVPKKKSDIKWYGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVS  192


 Score =   109 bits (272),  Expect(2) = 3e-75, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 62/85 (73%), Gaps = 0/85 (0%)
 Frame = +3

Query  147  PAEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDLIIASSLYYVA  326
            P   K     ++RVP   PPFT+GE+KKAIPPHCF+RS+ RSFSY+++D+IIAS  YYVA
Sbjct  4    PPSKKSETDTIKRVPCETPPFTVGELKKAIPPHCFKRSIPRSFSYLIWDIIIASCFYYVA  63

Query  327  TNYFHLLPHPLSYLAWPFTGSARAV  401
            T YF LLPHPLSY AWP   + +  
Sbjct  64   TTYFPLLPHPLSYFAWPLYWACQGC  88



>gb|AFJ19029.1| fatty acid desaturase BnaA.fad2.a-SW_Hickory mutant [Brassica 
napus]
Length=222

 Score =   185 bits (469),  Expect(2) = 3e-75, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW CQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  88   LYWACQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTL  679
            TGSLERDEVFVPK+KSD+ W+ KYLNNP GR   L +Q TL
Sbjct  148  TGSLERDEVFVPKKKSDIKWYGKYLNNPLGRTVMLTVQFTL  188


 Score =   124 bits (312),  Expect(2) = 3e-75, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 70/88 (80%), Gaps = 1/88 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM V    K S+ D ++RVP   PPFT+GE+KKAIPPHCF+RS+ RSFSY+++D+
Sbjct  1    MGAGGRMQVSPPSKKSETDNIKRVPCETPPFTVGELKKAIPPHCFKRSIPRSFSYLIWDI  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWPF  380
            IIAS  YYVAT YF LLPHPLSY AWP 
Sbjct  61   IIASCFYYVATTYFPLLPHPLSYFAWPL  88



>gb|ABL86147.1| delta-12 oleic acid desaturase [Vernicia montana]
Length=383

 Score =   177 bits (450),  Expect(2) = 4e-75, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YW  QGCVLTGVWVIAHECGHHAFS YQ LDD VGL+LHS LLVP+FSWK+SHRRHHSN
Sbjct  88   IYWALQGCVLTGVWVIAHECGHHAFSGYQLLDDIVGLVLHSCLLVPYFSWKHSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            T SLERDEVFVPK+KS + W +KYLNNPPGR FTL I LTL WPLYL FNVS
Sbjct  148  TASLERDEVFVPKKKSSIRWFSKYLNNPPGRLFTLTITLTLGWPLYLAFNVS  199


 Score =   131 bits (330),  Expect(2) = 4e-75, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 74/87 (85%), Gaps = 1/87 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAE-GKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM+VP    K+  + L+RVP++KPPFTLG++KKAIPPHCFQRSVLRSFSYVVYDL
Sbjct  1    MGAGGRMSVPPPPKKLESEVLKRVPHSKPPFTLGQLKKAIPPHCFQRSVLRSFSYVVYDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWP  377
             +A   YY+ATNYF LLP PLSY+AWP
Sbjct  61   TMAFIFYYIATNYFRLLPQPLSYVAWP  87



>gb|AEK67593.1| omega-6 fatty acid desaturase [Citrus medica var. sarcodactylis]
Length=383

 Score =   189 bits (479),  Expect(2) = 4e-75, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 102/112 (91%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YWI QGCVLTGVWVIAHECGHHAFSDYQW+DDTVGLILHSALLVP+FSWKYSHRRHHSN
Sbjct  88   IYWIFQGCVLTGVWVIAHECGHHAFSDYQWVDDTVGLILHSALLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            T SLERDEVFVPK KS++ +++KY NNPPGRA TLL+ LTL WPLYL  NVS
Sbjct  148  TASLERDEVFVPKAKSEVPFYSKYFNNPPGRALTLLVTLTLGWPLYLALNVS  199


 Score =   120 bits (301),  Expect(2) = 4e-75, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 68/87 (78%), Gaps = 1/87 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQDL-QRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM+VP   +  K+ L Q  P+ KPPF L +IKKAIPPHCF+RS++RSFSYVVYDL
Sbjct  1    MGAGGRMSVPPLQREKKESLIQPAPHTKPPFNLSQIKKAIPPHCFKRSLIRSFSYVVYDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWP  377
              +   YY+ATNYFHLLP P +YLAWP
Sbjct  61   SFSFLFYYIATNYFHLLPSPFAYLAWP  87



>gb|ABF70314.1| delta-12 desaturase, partial [Crambe kralikii]
Length=261

 Score =   202 bits (515),  Expect(2) = 4e-75, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW CQGCVLTG+WVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  81   LYWACQGCVLTGIWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  140

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK+KSD+ W+ KYLNNP GR   L +Q TL WPLYL FNVS
Sbjct  141  TGSLERDEVFVPKKKSDIKWYGKYLNNPLGRTLMLTVQFTLGWPLYLAFNVS  192


 Score =   106 bits (264),  Expect(2) = 4e-75, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 63/85 (74%), Gaps = 0/85 (0%)
 Frame = +3

Query  147  PAEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDLIIASSLYYVA  326
            P+        L+RVP   PPFTLG++KKAIPPHCF+RS+ RSFSY++YD+II+SS YY++
Sbjct  4    PSPKNSETNTLKRVPSETPPFTLGDLKKAIPPHCFKRSIPRSFSYLLYDIIISSSFYYLS  63

Query  327  TNYFHLLPHPLSYLAWPFTGSARAV  401
            T YF LLPHPLSY +WP   + +  
Sbjct  64   TTYFPLLPHPLSYFSWPLYWACQGC  88



>gb|ABF70298.1| delta-12 desaturase, partial [Brassica rapa var. purpuraria]
Length=261

 Score =   199 bits (505),  Expect(2) = 5e-75, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW CQGCVLTGV VIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  81   LYWACQGCVLTGVRVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  140

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK+KSD+ W+ KYLNNP GR   L +Q TL WPLYL FNVS
Sbjct  141  TGSLERDEVFVPKKKSDIKWYGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVS  192


 Score =   110 bits (275),  Expect(2) = 5e-75, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 63/85 (74%), Gaps = 0/85 (0%)
 Frame = +3

Query  147  PAEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDLIIASSLYYVA  326
            P   K    +++RVP   PPFT+GE+KKAIPPHCF+RS+ RSFSY+++D+IIAS  YYVA
Sbjct  4    PPSKKSETDNIKRVPCETPPFTVGELKKAIPPHCFKRSIPRSFSYLIWDIIIASCFYYVA  63

Query  327  TNYFHLLPHPLSYLAWPFTGSARAV  401
            T YF LLPHPLSY AWP   + +  
Sbjct  64   TTYFPLLPHPLSYFAWPLYWACQGC  88



>gb|AFJ53123.1| fatty acid desaturase 2-2, partial [Linum usitatissimum]
Length=317

 Score =   205 bits (521),  Expect(2) = 5e-75, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YW CQGCVLTGVWV+AHECGHHAFSDYQWLDD VG +LHS L+VP+FSWK+SHRRHHSN
Sbjct  63   IYWACQGCVLTGVWVLAHECGHHAFSDYQWLDDLVGFVLHSCLMVPYFSWKHSHRRHHSN  122

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPKQKS +GWH+KYLNNPPGR  TL + LTL WPLYL FNVS
Sbjct  123  TGSLERDEVFVPKQKSAIGWHSKYLNNPPGRVLTLAVTLTLGWPLYLAFNVS  174


 Score =   103 bits (258),  Expect(2) = 5e-75, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +3

Query  192  YAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDLIIASSLYYVATNYFHLLPHPLSYLA  371
            Y+KPPFTLGEIKKA+PPHCF+RS+ RSFSYV YDL IA+  YY+AT Y HLLP+PLSY+A
Sbjct  1    YSKPPFTLGEIKKAVPPHCFKRSIPRSFSYVAYDLTIAAIFYYIATTYIHLLPNPLSYVA  60

Query  372  WP  377
            WP
Sbjct  61   WP  62



>gb|ABF70305.1| delta-12 desaturase, partial [Capsella bursa-pastoris]
Length=260

 Score =   201 bits (510),  Expect(2) = 5e-75, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW CQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  81   LYWACQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  140

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPKQKS + W+ KYLNNP GR   L +Q  L WPLYL FNVS
Sbjct  141  TGSLERDEVFVPKQKSAIKWYGKYLNNPFGRIMMLTVQFVLGWPLYLAFNVS  192


 Score =   108 bits (269),  Expect(2) = 5e-75, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 64/79 (81%), Gaps = 1/79 (1%)
 Frame = +3

Query  144  VPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDLIIASSLYY  320
            VP+  K S+ + ++RVP  KPPFT+G++KKAIPP CF+RS+ RSFSY++ D+IIAS  YY
Sbjct  2    VPSSSKKSETNAIKRVPCEKPPFTVGDLKKAIPPQCFKRSIPRSFSYLITDIIIASCFYY  61

Query  321  VATNYFHLLPHPLSYLAWP  377
            VATNYF LLP PLSY AWP
Sbjct  62   VATNYFSLLPQPLSYFAWP  80



>gb|KJB15034.1| hypothetical protein B456_002G156600 [Gossypium raimondii]
Length=377

 Score =   201 bits (510),  Expect(2) = 5e-75, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW  QGC+LTGVWVIAHECGHHAFSDYQWLDDTVGLILHS+LLVP+FSWKYSHRRHHSN
Sbjct  82   LYWAMQGCILTGVWVIAHECGHHAFSDYQWLDDTVGLILHSSLLVPYFSWKYSHRRHHSN  141

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK+KS L W AK+ NNPPGR  ++ IQLTL WPLYL FNV+
Sbjct  142  TGSLERDEVFVPKKKSGLRWWAKHFNNPPGRFLSITIQLTLGWPLYLAFNVA  193


 Score =   108 bits (269),  Expect(2) = 5e-75, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 64/82 (78%), Gaps = 1/82 (1%)
 Frame = +3

Query  138  MAVPAEGKMSK-QDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDLIIASSL  314
            M+VP   K  +   L+RVPY+KPPFTL EIKKAIPPHCFQRSVLRSFSY++YD I+AS  
Sbjct  1    MSVPTSPKKPEFNSLKRVPYSKPPFTLSEIKKAIPPHCFQRSVLRSFSYLLYDFILASLF  60

Query  315  YYVATNYFHLLPHPLSYLAWPF  380
            Y+VATNYF  LP  LS +AWP 
Sbjct  61   YHVATNYFPNLPQLLSNVAWPL  82



>ref|XP_010105456.1| Omega-6 fatty acid desaturase, endoplasmic reticulum isozyme 
2 [Morus notabilis]
 gb|EXC04784.1| Omega-6 fatty acid desaturase, endoplasmic reticulum isozyme 
2 [Morus notabilis]
Length=381

 Score =   183 bits (465),  Expect(2) = 5e-75, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +Y   QGCVLTGVWVIA ECGHHAFSDYQWLDDTVGLILHS+LLVP+FSWKYSHRRHHSN
Sbjct  88   IYGFIQGCVLTGVWVIALECGHHAFSDYQWLDDTVGLILHSSLLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPKQKS + W++KYLNNP GR  TL I LTL WPLYL+FNVS
Sbjct  148  TGSLERDEVFVPKQKSSIRWYSKYLNNPLGRFLTLTITLTLGWPLYLLFNVS  199


 Score =   125 bits (314),  Expect(2) = 5e-75, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 70/90 (78%), Gaps = 1/90 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM+VP   K S+ D L+RVPY+KPPFTL +IKKAIPPHCF+RSV+ SF YVVYDL
Sbjct  1    MGAGGRMSVPLAAKNSEIDSLKRVPYSKPPFTLSQIKKAIPPHCFKRSVVHSFFYVVYDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWPFTG  386
             IA   YY+ TNY   LPHPL YLAWP  G
Sbjct  61   TIAFIFYYIVTNYIPQLPHPLPYLAWPIYG  90



>gb|ABF70306.1| delta-12 desaturase, partial [Capsella bursa-pastoris]
Length=260

 Score =   200 bits (509),  Expect(2) = 5e-75, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW CQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  81   LYWACQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  140

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPKQKS + W+ KYLNNP GR   L +Q  L WPLYL FNVS
Sbjct  141  TGSLERDEVFVPKQKSAIKWYGKYLNNPFGRIMMLTVQFVLGWPLYLAFNVS  192


 Score =   108 bits (270),  Expect(2) = 5e-75, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 66/87 (76%), Gaps = 1/87 (1%)
 Frame = +3

Query  144  VPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDLIIASSLYY  320
            VP+  K S+ + ++RVP  KPPFT+G++KKAIPP CF+RS+ RSFSY++ D+IIAS  YY
Sbjct  2    VPSSSKKSETNAIKRVPCEKPPFTVGDLKKAIPPQCFKRSIPRSFSYLITDIIIASCFYY  61

Query  321  VATNYFHLLPHPLSYLAWPFTGSARAV  401
            VATNYF LLP PLSY AWP   + +  
Sbjct  62   VATNYFSLLPQPLSYFAWPLYWACQGC  88



>gb|ABF70328.1| delta-12 desaturase, partial [Sinapis alba]
Length=262

 Score =   198 bits (504),  Expect(2) = 8e-75, Method: Compositional matrix adjust.
 Identities = 94/113 (83%), Positives = 100/113 (88%), Gaps = 1/113 (1%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW+CQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  81   LYWVCQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLISHSFLLVPYFSWKYSHRRHHSN  140

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPP-GRAFTLLIQLTLXWPLYLMFNVS  712
            T SLERDEVFVPK+KSD+ W+AKYLNN P GR   L +Q TL WPLYL FNVS
Sbjct  141  TASLERDEVFVPKKKSDIKWYAKYLNNNPLGRTVMLTVQFTLGWPLYLAFNVS  193


 Score =   109 bits (273),  Expect(2) = 8e-75, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 62/79 (78%), Gaps = 0/79 (0%)
 Frame = +3

Query  144  VPAEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDLIIASSLYYV  323
            +P+        L+RVP   PPFTLG++KKAIPPHCF+RS+ RSFSY+++D+IIAS LYY+
Sbjct  3    IPSPKNSETNTLKRVPCETPPFTLGDLKKAIPPHCFKRSIPRSFSYLLWDIIIASCLYYL  62

Query  324  ATNYFHLLPHPLSYLAWPF  380
            +T YF LLPHPLSY AWP 
Sbjct  63   STTYFSLLPHPLSYFAWPL  81



>gb|AIN52150.1| fatty acid desaturase-2 [Camellia oleifera]
Length=382

 Score =   194 bits (493),  Expect(2) = 9e-75, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YW  QGCVLTGVWVIAHECGHHAFSDYQW+DDTVGLILHS LLVP+FSWKYSHRRHHSN
Sbjct  87   IYWALQGCVLTGVWVIAHECGHHAFSDYQWVDDTVGLILHSTLLVPYFSWKYSHRRHHSN  146

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            T SLE DEVFVPK KS L W++KYLNNP GR  TL+I LTL WP YL FNVS
Sbjct  147  TSSLEHDEVFVPKPKSKLAWYSKYLNNPVGRVVTLVITLTLGWPSYLAFNVS  198


 Score =   114 bits (285),  Expect(2) = 9e-75, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 62/86 (72%), Gaps = 0/86 (0%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDLI  299
            MGAGG+M VPA     +    R P++KPPFTLGEIKKAIPPHCF+RS+LRSFSY+VYD  
Sbjct  1    MGAGGQMPVPATKHEQQITPHRAPHSKPPFTLGEIKKAIPPHCFERSLLRSFSYIVYDFS  60

Query  300  IASSLYYVATNYFHLLPHPLSYLAWP  377
            +    YYV T+Y HLLP    YL WP
Sbjct  61   LIFLFYYVTTSYIHLLPQHFRYLVWP  86



>gb|ABF70317.1| delta-12 desaturase, partial [Eruca vesicaria subsp. sativa]
Length=260

 Score =   201 bits (512),  Expect(2) = 1e-74, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW+CQGCVLTG+WVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  81   LYWVCQGCVLTGIWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  140

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK+KSD+ W  KYLNNP GR   L +Q TL WPLYL FNVS
Sbjct  141  TGSLERDEVFVPKKKSDIKWWGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVS  192


 Score =   106 bits (265),  Expect(2) = 1e-74, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = +3

Query  147  PAEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDLIIASSLYYVA  326
            P+  K      +RVP  +PPFT+GE+KKAIPPHCF+RS+ RSFSY+++D+I+AS  YY+A
Sbjct  4    PSPKKSETDTFKRVPCERPPFTVGELKKAIPPHCFKRSIPRSFSYLIWDIIVASCFYYIA  63

Query  327  TNYFHLLPHPLSYLAWPF  380
            T YF LLP+ LSYLAWP 
Sbjct  64   TTYFSLLPNNLSYLAWPL  81



>gb|ACA14461.1| oleate desaturase [Caragana korshinskii]
Length=283

 Score =   196 bits (499),  Expect(2) = 2e-74, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YWI QGC+LTGVWVIAHECGHHAFS YQWLDD VGL+LH++LLVP+FSWK SHRRHHSN
Sbjct  85   IYWILQGCILTGVWVIAHECGHHAFSKYQWLDDLVGLVLHTSLLVPYFSWKISHRRHHSN  144

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSL+RDEVFVPK KS +GW++KYLNNP GR  TLLI LTL WPLYL FNVS
Sbjct  145  TGSLDRDEVFVPKPKSSVGWYSKYLNNPIGRGVTLLITLTLGWPLYLAFNVS  196


 Score =   110 bits (275),  Expect(2) = 2e-74, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 66/86 (77%), Gaps = 2/86 (2%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDLI  299
            MGAG  +    E K+ K  L RVP+ KPPFT+G++KKAIPPHCF+RS+L SFSYVVYDL 
Sbjct  1    MGAGSHVTY-HEPKLLKP-LSRVPHTKPPFTVGQLKKAIPPHCFERSILSSFSYVVYDLS  58

Query  300  IASSLYYVATNYFHLLPHPLSYLAWP  377
            IA  LYY+AT YFHLLPH  +++ WP
Sbjct  59   IALFLYYIATTYFHLLPHTFAFIVWP  84



>gb|ABF70316.1| delta-12 desaturase, partial [Crambe maritima]
Length=260

 Score =   202 bits (515),  Expect(2) = 2e-74, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW+C+GCVLTG+WVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  81   LYWVCEGCVLTGIWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  140

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK+KSD+ W+ KYLNNP GR   L +Q TL WPLYL FNVS
Sbjct  141  TGSLERDEVFVPKKKSDIKWYGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVS  192


 Score =   104 bits (259),  Expect(2) = 2e-74, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 59/77 (77%), Gaps = 0/77 (0%)
 Frame = +3

Query  147  PAEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDLIIASSLYYVA  326
            P+  K     L+RVP   PPFT+GE+KKAIPPHCF+RS  RSFSY++ D+ IAS  YY+A
Sbjct  4    PSPKKSETDTLKRVPCETPPFTVGELKKAIPPHCFKRSSPRSFSYLICDIFIASCFYYIA  63

Query  327  TNYFHLLPHPLSYLAWP  377
            T+YF  LPHPLSYLAWP
Sbjct  64   TSYFSPLPHPLSYLAWP  80



>gb|ACA14460.1| oleate desaturase [Caragana korshinskii]
Length=380

 Score =   196 bits (499),  Expect(2) = 2e-74, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YWI QGC+LTGVWVIAHECGHHAFS YQWLDD VGL+LH++LLVP+FSWK SHRRHHSN
Sbjct  85   IYWILQGCILTGVWVIAHECGHHAFSKYQWLDDLVGLVLHTSLLVPYFSWKISHRRHHSN  144

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSL+RDEVFVPK KS +GW++KYLNNP GR  TLLI LTL WPLYL FNVS
Sbjct  145  TGSLDRDEVFVPKPKSSVGWYSKYLNNPIGRGVTLLITLTLGWPLYLAFNVS  196


 Score =   110 bits (275),  Expect(2) = 2e-74, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 66/86 (77%), Gaps = 2/86 (2%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDLI  299
            MGAG  +    E K+ K  L RVP+ KPPFT+G++KKAIPPHCF+RS+L SFSYVVYDL 
Sbjct  1    MGAGSHVTY-HEPKLLKP-LSRVPHTKPPFTVGQLKKAIPPHCFERSILSSFSYVVYDLS  58

Query  300  IASSLYYVATNYFHLLPHPLSYLAWP  377
            IA  LYY+AT YFHLLPH  +++ WP
Sbjct  59   IALFLYYIATTYFHLLPHTFAFIVWP  84



>gb|ABF70323.1| delta-12 desaturase, partial [Lepidium virginicum]
Length=260

 Score =   201 bits (512),  Expect(2) = 3e-74, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW CQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  81   LYWACQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  140

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPKQKS + W+ KYLNNP GR   L IQ  L WPLYL FNVS
Sbjct  141  TGSLERDEVFVPKQKSAIKWYGKYLNNPLGRVVMLTIQFVLGWPLYLAFNVS  192


 Score =   105 bits (261),  Expect(2) = 3e-74, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 64/87 (74%), Gaps = 1/87 (1%)
 Frame = +3

Query  144  VPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDLIIASSLYY  320
            VP+  K ++ + L+RVP  KPPFTLG++KKAIPP CF+RS+ RSFSY+V D+IIAS  YY
Sbjct  2    VPSSSKKTETEALKRVPCEKPPFTLGDLKKAIPPQCFKRSIPRSFSYLVSDIIIASCFYY  61

Query  321  VATNYFHLLPHPLSYLAWPFTGSARAV  401
            VA NYF LLP  LSYL WP   + +  
Sbjct  62   VAANYFSLLPQSLSYLVWPLYWACQGC  88



>gb|ABF70310.1| delta-12 desaturase, partial [Cardamine hirsuta]
Length=260

 Score =   199 bits (506),  Expect(2) = 3e-74, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW+CQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  81   LYWVCQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  140

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            T SLERDEVFVPKQKS + W+ KYLNNP GR   L IQ TL WPLYL  NVS
Sbjct  141  TASLERDEVFVPKQKSAIKWYGKYLNNPLGRTVMLTIQFTLGWPLYLACNVS  192


 Score =   107 bits (267),  Expect(2) = 3e-74, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 61/77 (79%), Gaps = 0/77 (0%)
 Frame = +3

Query  147  PAEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDLIIASSLYYVA  326
            P+  K   + L+RVP   PPF++G++KKAIPPHCF+RS+ RSFSY++ D+IIAS  +YVA
Sbjct  4    PSSKKSETEALKRVPCETPPFSVGDLKKAIPPHCFKRSIPRSFSYLITDIIIASCFFYVA  63

Query  327  TNYFHLLPHPLSYLAWP  377
            TNYF LLP PLSY AWP
Sbjct  64   TNYFSLLPQPLSYFAWP  80



>gb|AIE48273.1| omega-6 fatty acid desaturase [Rhus chinensis]
 gb|AIE48274.1| omega-6 fatty acid desaturase [Rhus chinensis]
Length=383

 Score =   191 bits (485),  Expect(2) = 3e-74, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YW  QGC+LTGVWV+AHECGHHAFSDYQWLDDTVGLILHS LLVP+FSWKYSHRRHHSN
Sbjct  87   VYWALQGCILTGVWVVAHECGHHAFSDYQWLDDTVGLILHSGLLVPYFSWKYSHRRHHSN  146

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSL+RDEVFVPKQK+ + W++KYLNNPPGR  TL I LTL WPLYL FNVS
Sbjct  147  TGSLDRDEVFVPKQKTGIRWYSKYLNNPPGRILTLTITLTLGWPLYLAFNVS  198


 Score =   115 bits (288),  Expect(2) = 3e-74, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDLI  299
            MGAGGR    A  ++    L+RVP +KPPFTL ++KKAIPPHCFQRSV+RSFSY VYDL 
Sbjct  1    MGAGGRAVQSAPKRVETDPLKRVPVSKPPFTLSQVKKAIPPHCFQRSVIRSFSYAVYDLT  60

Query  300  IASSLYYVATNYFHLLPHPLSYLAWP  377
            IA+ LYY AT+Y  +LP  LSYLAWP
Sbjct  61   IAAFLYYAATSYIPMLPPALSYLAWP  86



>gb|AFJ53122.1| fatty acid desaturase 2-2, partial [Linum usitatissimum]
Length=314

 Score =   205 bits (521),  Expect(2) = 3e-74, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YW CQGCVLTGVWV+AHECGHHAFSDYQWLDD VG +LHS L+VP+FSWK+SHRRHHSN
Sbjct  61   IYWACQGCVLTGVWVLAHECGHHAFSDYQWLDDLVGFVLHSCLMVPYFSWKHSHRRHHSN  120

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPKQKS +GWH+KYLNNPPGR  TL + LTL WPLYL FNVS
Sbjct  121  TGSLERDEVFVPKQKSAIGWHSKYLNNPPGRVLTLAVTLTLGWPLYLAFNVS  172


 Score =   101 bits (252),  Expect(2) = 3e-74, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +3

Query  198  KPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDLIIASSLYYVATNYFHLLPHPLSYLAWP  377
            KPPFTLGEIKKA+PPHCF+RS+ RSFSYV YDL IA+  YY+AT Y HLLP+PLSY+AWP
Sbjct  1    KPPFTLGEIKKAVPPHCFKRSIPRSFSYVAYDLTIAAIFYYIATTYIHLLPNPLSYVAWP  60



>gb|ABF70315.1| delta-12 desaturase, partial [Crambe maritima]
Length=260

 Score =   198 bits (504),  Expect(2) = 3e-74, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW+CQGCVLTG+WVIAHECGHHAF DYQWLDDTVGLI HS + VP+FSWKYSHRRHHSN
Sbjct  81   LYWVCQGCVLTGIWVIAHECGHHAFRDYQWLDDTVGLIFHSCIWVPYFSWKYSHRRHHSN  140

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK+KSD+ W+ KYLNNP GR   L +Q TL WPLYL FNVS
Sbjct  141  TGSLERDEVFVPKKKSDIKWYGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVS  192


 Score =   107 bits (268),  Expect(2) = 3e-74, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = +3

Query  147  PAEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDLIIASSLYYVA  326
            P+  K     L+RVP   PPFT+GE+KKAIPPHCF+RS+ RSFSY++ D+IIAS  YY+A
Sbjct  4    PSPKKSETDTLKRVPCETPPFTVGELKKAIPPHCFKRSIPRSFSYLICDIIIASCFYYIA  63

Query  327  TNYFHLLPHPLSYLAWPF  380
            T+YF  LPHPLSYLAWP 
Sbjct  64   TSYFSPLPHPLSYLAWPL  81



>gb|ABF70325.1| delta-12 desaturase, partial [Rorippa indica]
Length=260

 Score =   199 bits (507),  Expect(2) = 4e-74, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW+CQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  81   LYWVCQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  140

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPKQKS + W+ KYLNNP GR   L +Q TL WPLYL  NVS
Sbjct  141  TGSLERDEVFVPKQKSAIKWYGKYLNNPLGRTVMLTVQFTLGWPLYLACNVS  192


 Score =   106 bits (265),  Expect(2) = 4e-74, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +3

Query  177  LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDLIIASSLYYVATNYFHLLPHP  356
            L+RVP  +PPFT+G++KKAIPPHCF+RS+ RSFSY++ D+IIAS  +YVATNYF LLP P
Sbjct  14   LKRVPSERPPFTVGDLKKAIPPHCFKRSIPRSFSYLITDIIIASCFFYVATNYFSLLPQP  73

Query  357  LSYLAWP  377
            LSYLAWP
Sbjct  74   LSYLAWP  80



>gb|ACZ06072.1| microsomal omega-6 fatty acid desaturase [Arachis hypogaea]
Length=383

 Score =   182 bits (463),  Expect(2) = 7e-74, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LY   QGC+LTGVWVIAHECGHHAFSDYQWLDDTVGL+LHS LLVP+FSWKYSHRRHHSN
Sbjct  88   LYGAVQGCILTGVWVIAHECGHHAFSDYQWLDDTVGLVLHSGLLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSL+RDEVFVPK+KS + W +KYLNNP GR  TL I LTL WPLYL FNVS
Sbjct  148  TGSLDRDEVFVPKKKSSIAWWSKYLNNPLGRVLTLTITLTLGWPLYLAFNVS  199


 Score =   122 bits (306),  Expect(2) = 7e-74, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 70/94 (74%), Gaps = 1/94 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQDL-QRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGR +VP   +  + D  +RVP+ KPPF+L ++KKAIPPHCFQRSV+RSFSYVVYDL
Sbjct  1    MGAGGRTSVPPSNRTVEADYAKRVPHEKPPFSLSQVKKAIPPHCFQRSVIRSFSYVVYDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWPFTGSARA  398
             IA  LYY ATNYFH L  PL YLAW   G+ + 
Sbjct  61   TIAFCLYYAATNYFHKLSSPLFYLAWLLYGAVQG  94



>ref|XP_002297660.2| microsomal omega-6 desaturase family protein [Populus trichocarpa]
 gb|EEE82465.2| microsomal omega-6 desaturase family protein [Populus trichocarpa]
Length=382

 Score =   200 bits (509),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 102/112 (91%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YWI QG +LTGVWVI+HECGHHAFSDY+WLDDTVGLILHSALLVP+FSWKYSHRRHHSN
Sbjct  87   MYWILQGSILTGVWVISHECGHHAFSDYRWLDDTVGLILHSALLVPYFSWKYSHRRHHSN  146

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK KS + W++KYLNNPPGRA +L++ L L WPLYL FNVS
Sbjct  147  TGSLERDEVFVPKPKSRIAWYSKYLNNPPGRALSLVVTLLLGWPLYLAFNVS  198


 Score =   104 bits (259),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 62/86 (72%), Gaps = 0/86 (0%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDLI  299
            M A G  A   +    +  ++R+P+ KPPFTLG+IKKAIPPHCF+RS+LRSFSYVVYDL 
Sbjct  1    MAANGVFASSGKHGGKESRIKRMPHGKPPFTLGKIKKAIPPHCFERSLLRSFSYVVYDLC  60

Query  300  IASSLYYVATNYFHLLPHPLSYLAWP  377
            I+  L Y+A  Y  LLP PLS +AWP
Sbjct  61   ISFLLCYIAITYIDLLPSPLSCVAWP  86



>gb|AEW43691.1| fatty acid desaturase 2 [Jatropha curcas]
 gb|KDP44415.1| hypothetical protein JCGZ_19430 [Jatropha curcas]
Length=387

 Score =   190 bits (482),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YW  QGC LTGVWVIAHECGHHAFSDYQW+DDTVGLILHS+LLVP+FSWK SHRRHHSN
Sbjct  92   IYWTLQGCTLTGVWVIAHECGHHAFSDYQWVDDTVGLILHSSLLVPYFSWKISHRRHHSN  151

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGS+ERDEVFVPK KS + W+++YLNNP GRA  L   LT+ WPLYL FNVS
Sbjct  152  TGSIERDEVFVPKFKSRIPWYSQYLNNPLGRALALAATLTVGWPLYLAFNVS  203


 Score =   114 bits (285),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 71/91 (78%), Gaps = 5/91 (5%)
 Frame = +3

Query  120  MGAGG-RMAVPAEGKMSKQD----LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYV  284
            MGAGG + AV    K  + +    L+RVP+ KPPFTLG+IK+AIP HCF+RS+LRSFSY+
Sbjct  1    MGAGGQKTAVLVSSKFKEMETNRRLKRVPHTKPPFTLGQIKQAIPSHCFKRSLLRSFSYL  60

Query  285  VYDLIIASSLYYVATNYFHLLPHPLSYLAWP  377
            VYDL ++S  YY+A +YFHLLP P+SY+AWP
Sbjct  61   VYDLSLSSLFYYIAASYFHLLPSPISYIAWP  91



>gb|ABF70318.1| delta-12 desaturase, partial [Eruca vesicaria subsp. sativa]
Length=260

 Score =   198 bits (503),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW+CQ CVLTG+WVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  81   LYWVCQCCVLTGIWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  140

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK+KSD+ W  KYLNNP GR   L +Q TL WPLYL FNVS
Sbjct  141  TGSLERDEVFVPKKKSDIKWWGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVS  192


 Score =   106 bits (265),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = +3

Query  147  PAEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDLIIASSLYYVA  326
            P+  K      +RVP  +PPFT+GE+KKAIPPHCF+RS+ RSFSY+++D+I+AS  YY+A
Sbjct  4    PSPKKSETDTFRRVPCERPPFTVGELKKAIPPHCFKRSIPRSFSYLIWDIIVASCFYYIA  63

Query  327  TNYFHLLPHPLSYLAWPF  380
            T YF LLP+ LSYLAWP 
Sbjct  64   TTYFSLLPNNLSYLAWPL  81



>gb|ACR83861.1| omega-6 fatty acid desaturase [Portulaca oleracea]
Length=382

 Score =   184 bits (467),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 91/113 (81%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = +2

Query  374  ALYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHS  553
            A+Y   QGCVLTG+WVIAHECGHHAFSD+QWLDDTVGL+LHS LLVP+FSWKYSHRRHHS
Sbjct  86   AVYGFVQGCVLTGLWVIAHECGHHAFSDHQWLDDTVGLVLHSFLLVPYFSWKYSHRRHHS  145

Query  554  NTGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            NTGS+E+DEVFVPK+KS L W +KYLNNPPGR  TL I LTL WPLYL+FNVS
Sbjct  146  NTGSMEKDEVFVPKRKSGLQWFSKYLNNPPGRVLTLTITLTLGWPLYLLFNVS  198


 Score =   120 bits (300),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 66/89 (74%), Gaps = 0/89 (0%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDLI  299
            MGAGGR   P+  K     L R PYAKPPFTL ++KKAIPPHCF+RSVLRSFSYVVYD I
Sbjct  1    MGAGGRSIAPSVTKDKANALGRSPYAKPPFTLSQLKKAIPPHCFKRSVLRSFSYVVYDFI  60

Query  300  IASSLYYVATNYFHLLPHPLSYLAWPFTG  386
            +AS +YY+AT Y  LLP PLSY +W   G
Sbjct  61   LASIIYYLATTYIDLLPKPLSYFSWAVYG  89



>gb|AAK26633.1|AF343065_1 delta-12 fatty acid desaturase FAD2 [Calendula officinalis]
Length=383

 Score =   179 bits (454),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YW  QGCVLTGVWVIAHECGHHAFSD+QWLDDTVGL+LHS LLVP+FSWKYSHRRHHSN
Sbjct  89   VYWAVQGCVLTGVWVIAHECGHHAFSDHQWLDDTVGLVLHSFLLVPYFSWKYSHRRHHSN  148

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGS+E DEVFVPK KS +   A+YLNNPPGR  TLL+ LTL WPLYL FNVS
Sbjct  149  TGSIEHDEVFVPKLKSGVRSTARYLNNPPGRILTLLVTLTLGWPLYLTFNVS  200


 Score =   125 bits (313),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 68/88 (77%), Gaps = 2/88 (2%)
 Frame = +3

Query  120  MGAGGRMAVPAEG--KMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYD  293
            MGAGGRM  P  G  K   + +QRVP+ KPPFT+G+IKKAIPPHCF RSV+RSFSYV YD
Sbjct  1    MGAGGRMQDPTNGGNKTEPEPIQRVPHEKPPFTVGDIKKAIPPHCFNRSVIRSFSYVFYD  60

Query  294  LIIASSLYYVATNYFHLLPHPLSYLAWP  377
            L IAS LYY+A NY   LP PL+Y+AWP
Sbjct  61   LTIASILYYIANNYISTLPSPLAYVAWP  88



>gb|ABF70322.1| delta-12 desaturase, partial [Physaria fendleri]
Length=259

 Score =   203 bits (516),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW CQGCVLTGVWVIAHECGHHAFS+YQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  80   LYWACQGCVLTGVWVIAHECGHHAFSNYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  139

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPKQKS + W+ KYLNNPPGR   L +Q  L WPLYL FNVS
Sbjct  140  TGSLERDEVFVPKQKSAIKWYGKYLNNPPGRIMMLTVQFVLGWPLYLAFNVS  191


 Score =   100 bits (250),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 62/87 (71%), Gaps = 0/87 (0%)
 Frame = +3

Query  141  AVPAEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDLIIASSLYY  320
            +VP+  K     ++RVP  KPPFT+GE+KKAIP HCF+RS+ RSFSY++ D+IIAS  YY
Sbjct  1    SVPSSKKSETAPVKRVPCEKPPFTVGELKKAIPSHCFERSIPRSFSYLITDIIIASCFYY  60

Query  321  VATNYFHLLPHPLSYLAWPFTGSARAV  401
            +AT  F LLP  LSY+AWP   + +  
Sbjct  61   IATTCFPLLPQSLSYVAWPLYWACQGC  87



>gb|AFK12604.1| fad2-3, partial [Helianthus annuus]
Length=348

 Score =   202 bits (514),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 95/112 (85%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YWI QGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVP+FSWKYSHRRHHSN
Sbjct  74   VYWIFQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPYFSWKYSHRRHHSN  133

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGS+E DEVFVPK KS +   AKYLNNPPGR  TLL+ LT+ WPLYLMFNVS
Sbjct  134  TGSIEHDEVFVPKLKSSVRSTAKYLNNPPGRILTLLVTLTMGWPLYLMFNVS  185


 Score =   101 bits (252),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +3

Query  177  LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDLIIASSLYYVATNYFHLLPHP  356
            L+R  + KPPFT+G+IKK IPPHCF+RSV+RSFSYVVYDL IAS  YY+A NY  LLP+ 
Sbjct  7    LERALHEKPPFTVGDIKKVIPPHCFKRSVIRSFSYVVYDLTIASIFYYLANNYIXLLPNS  66

Query  357  LSYLAWP  377
            L+Y+AWP
Sbjct  67   LAYVAWP  73



>gb|AIA21665.1| oleate desaturase [Crambe kralikii]
Length=378

 Score =   181 bits (460),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 93/112 (83%), Gaps = 6/112 (5%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW CQGCVLTG+WVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  88   LYWACQGCVLTGLWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLER EVFVPK+KSD+ W+      P GR   L +Q TL WPLYL FNVS
Sbjct  148  TGSLERGEVFVPKKKSDIKWY------PLGRTVMLTVQFTLGWPLYLAFNVS  193


 Score =   122 bits (306),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 70/88 (80%), Gaps = 1/88 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM V    K S+ D L+RVP   PPFTLGE+KKAIPPHCF+RS+ RSFSY+++D+
Sbjct  1    MGAGGRMQVSPSPKKSETDTLKRVPCGTPPFTLGELKKAIPPHCFKRSIPRSFSYLIWDI  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWPF  380
            II+S  YY++T YF LLPHPLSY AWP 
Sbjct  61   IISSFFYYLSTTYFPLLPHPLSYFAWPL  88



>gb|AIA21654.1| oleate desaturase [Crambe filiformis]
Length=384

 Score =   202 bits (514),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW CQGCVLTG+WVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  88   LYWACQGCVLTGLWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK+KSD+ W+ KYLNNP GR   L +Q TL WPLYL FNVS
Sbjct  148  TGSLERDEVFVPKKKSDIKWYGKYLNNPLGRTLMLTVQFTLGWPLYLAFNVS  199


 Score =   101 bits (251),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 71/88 (81%), Gaps = 1/88 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM V    K S+ + L+RVP   PPFTLG++KKAIPPHCF+RS+ RSFSY+++D+
Sbjct  1    MGAGGRMQVSPSPKTSETNTLKRVPCETPPFTLGDLKKAIPPHCFKRSIPRSFSYLLHDI  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWPF  380
            II+SS YY++T YF LLPHPL YLAWP 
Sbjct  61   IISSSFYYLSTTYFPLLPHPLPYLAWPL  88



>gb|AFK12607.1| fad2-3, partial [Helianthus annuus]
Length=348

 Score =   202 bits (514),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 95/112 (85%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YWI QGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVP+FSWKYSHRRHHSN
Sbjct  74   VYWIFQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPYFSWKYSHRRHHSN  133

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGS+E DEVFVPK KS +   AKYLNNPPGR  TLL+ LT+ WPLYLMFNVS
Sbjct  134  TGSIEHDEVFVPKLKSSVRSTAKYLNNPPGRILTLLVTLTMGWPLYLMFNVS  185


 Score =   101 bits (251),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +3

Query  177  LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDLIIASSLYYVATNYFHLLPHP  356
            L+R  + KPPFT+G+IKK IPPHCF+RSV+RSFSYVVYDL IAS  YY+A NY  LLP+ 
Sbjct  7    LERALHEKPPFTVGDIKKVIPPHCFKRSVIRSFSYVVYDLTIASIFYYLANNYILLLPNS  66

Query  357  LSYLAWP  377
            L+Y+AWP
Sbjct  67   LAYVAWP  73



>gb|AFK12603.1| fad2-3, partial [Helianthus annuus]
Length=348

 Score =   202 bits (514),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 95/112 (85%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YWI QGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVP+FSWKYSHRRHHSN
Sbjct  74   VYWIFQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPYFSWKYSHRRHHSN  133

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGS+E DEVFVPK KS +   AKYLNNPPGR  TLL+ LT+ WPLYLMFNVS
Sbjct  134  TGSIEHDEVFVPKLKSSVRSTAKYLNNPPGRILTLLVTLTMGWPLYLMFNVS  185


 Score =   101 bits (251),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = +3

Query  159  KMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDLIIASSLYYVATNYF  338
            K   + L+R  + KPPFT+G+IKK IPPHCF+RSV+RSFSYVVYDL IAS  YY+A NY 
Sbjct  1    KDGXKPLERALHEKPPFTVGDIKKVIPPHCFKRSVIRSFSYVVYDLTIASIFYYLANNYI  60

Query  339  HLLPHPLSYLAWP  377
             LLP+ L+Y+AWP
Sbjct  61   PLLPNSLAYVAWP  73



>ref|XP_006366157.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Solanum tuberosum]
Length=380

 Score =   184 bits (467),  Expect(2) = 3e-73, Method: Compositional matrix adjust.
 Identities = 81/111 (73%), Positives = 93/111 (84%), Gaps = 0/111 (0%)
 Frame = +2

Query  380  YWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSNT  559
            YWI QGCV TG+WVI HECGHH FSDYQW+DDTVGLILHSALL P+F+WK+SHRRHH+NT
Sbjct  89   YWIAQGCVCTGIWVIGHECGHHGFSDYQWVDDTVGLILHSALLTPYFAWKHSHRRHHANT  148

Query  560  GSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            GSLE DEV++P+ KS L W+ KYLNNP GR F L   LT  WPLYL+FN+S
Sbjct  149  GSLENDEVYIPRLKSKLRWYYKYLNNPLGRVFVLAFTLTFAWPLYLIFNIS  199


 Score =   119 bits (297),  Expect(2) = 3e-73, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 68/86 (79%), Gaps = 1/86 (1%)
 Frame = +3

Query  120  MGAGGRM-AVPAEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MG GG M A+  + +  K  L+RVP +KPPFTLG++KKAIPPHCF+RS++RSFSY++ DL
Sbjct  1    MGGGGNMSAMTTKNEQKKNPLERVPSSKPPFTLGDVKKAIPPHCFERSLIRSFSYLIQDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAW  374
            I+ S  YY+AT Y HLLP PL+YLAW
Sbjct  61   ILVSIFYYIATTYIHLLPSPLTYLAW  86



>gb|AFK12596.1| fad2-3, partial [Helianthus annuus]
 gb|AFK12597.1| fad2-3, partial [Helianthus annuus]
 gb|AFK12598.1| fad2-3, partial [Helianthus annuus]
 gb|AFK12599.1| fad2-3, partial [Helianthus annuus]
 gb|AFK12601.1| fad2-3, partial [Helianthus annuus]
 gb|AFK12605.1| fad2-3, partial [Helianthus annuus]
 gb|AFK12606.1| fad2-3, partial [Helianthus annuus]
 gb|AFK12608.1| fad2-3, partial [Helianthus annuus]
 gb|AFK12609.1| fad2-3, partial [Helianthus annuus]
 gb|AFK12610.1| fad2-3, partial [Helianthus annuus]
 gb|AFK12611.1| fad2-3, partial [Helianthus annuus]
 gb|AFK12612.1| fad2-3, partial [Helianthus annuus]
Length=348

 Score =   202 bits (514),  Expect(2) = 4e-73, Method: Compositional matrix adjust.
 Identities = 95/112 (85%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YWI QGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVP+FSWKYSHRRHHSN
Sbjct  74   VYWIFQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPYFSWKYSHRRHHSN  133

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGS+E DEVFVPK KS +   AKYLNNPPGR  TLL+ LT+ WPLYLMFNVS
Sbjct  134  TGSIEHDEVFVPKLKSSVRSTAKYLNNPPGRILTLLVTLTMGWPLYLMFNVS  185


 Score =   100 bits (250),  Expect(2) = 4e-73, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +3

Query  177  LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDLIIASSLYYVATNYFHLLPHP  356
            L+R  + KPPFT+G+IKK IPPHCF+RSV+RSFSYVVYDL IAS  YY+A NY  LLP+ 
Sbjct  7    LERALHEKPPFTVGDIKKVIPPHCFKRSVIRSFSYVVYDLTIASIFYYLANNYIPLLPNS  66

Query  357  LSYLAWP  377
            L+Y+AWP
Sbjct  67   LAYVAWP  73



>gb|AIA21658.1| oleate desaturase [Crambe filiformis]
Length=384

 Score =   202 bits (513),  Expect(2) = 4e-73, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW CQGC+LTG+WVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  88   LYWACQGCILTGLWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK+KSD+ W+ KYLNNP GR   L +Q TL WPLYL FNVS
Sbjct  148  TGSLERDEVFVPKKKSDIKWYGKYLNNPLGRTLMLTVQFTLGWPLYLAFNVS  199


 Score =   100 bits (250),  Expect(2) = 4e-73, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 70/88 (80%), Gaps = 1/88 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM V    K S+ + L+RVP   PPFTLG++KKAIPPHCF+RS+ RSFSY++YD+
Sbjct  1    MGAGGRMQVTPSPKTSETNTLKRVPCETPPFTLGDLKKAIPPHCFKRSIPRSFSYLLYDI  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWPF  380
            II+S  YY++T YF LLPHPL YLAWP 
Sbjct  61   IISSIFYYLSTTYFPLLPHPLPYLAWPL  88



>gb|AFK12600.1| fad2-3, partial [Helianthus annuus]
Length=348

 Score =   202 bits (514),  Expect(2) = 4e-73, Method: Compositional matrix adjust.
 Identities = 95/112 (85%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YWI QGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVP+FSWKYSHRRHHSN
Sbjct  74   VYWIFQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPYFSWKYSHRRHHSN  133

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGS+E DEVFVPK KS +   AKYLNNPPGR  TLL+ LT+ WPLYLMFNVS
Sbjct  134  TGSIEHDEVFVPKLKSSVRSTAKYLNNPPGRILTLLVTLTMGWPLYLMFNVS  185


 Score =   100 bits (248),  Expect(2) = 4e-73, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +3

Query  177  LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDLIIASSLYYVATNYFHLLPHP  356
            L+R  + KPPFT+G+IKK IPPHCF+RSV+RSFSYVVYDL IAS  YY+A NY  LLP+ 
Sbjct  7    LERALHEKPPFTVGDIKKVIPPHCFKRSVIRSFSYVVYDLTIASIFYYLANNYIPLLPNS  66

Query  357  LSYLAWP  377
            L+Y+AWP
Sbjct  67   LAYVAWP  73



>gb|AIA21659.1| oleate desaturase [Crambe filiformis]
Length=384

 Score =   201 bits (512),  Expect(2) = 5e-73, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW CQGC+LTG+WVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  88   LYWACQGCILTGLWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK+KSD+ W+ KYLNNP GR   L +Q TL WPLYL FNVS
Sbjct  148  TGSLERDEVFVPKKKSDIKWYGKYLNNPLGRTLMLTVQFTLGWPLYLAFNVS  199


 Score =   100 bits (250),  Expect(2) = 5e-73, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 70/88 (80%), Gaps = 1/88 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM V    K S+ + L+RVP   PPFTLG++KKAIPPHCF+RS+ RSFSY++YD+
Sbjct  1    MGAGGRMQVTPSPKTSETNTLKRVPCETPPFTLGDLKKAIPPHCFKRSIPRSFSYLLYDI  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWPF  380
            II+S  YY++T YF LLPHPL YLAWP 
Sbjct  61   IISSIFYYLSTTYFPLLPHPLPYLAWPL  88



>gb|AAL23676.1| delta-12 fatty acid desaturase [Persea americana]
Length=382

 Score =   193 bits (491),  Expect(2) = 5e-73, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 95/112 (85%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW  QGCVLTGVWVIAHECGHHAFSDY WLDDTVGLILHS LLVP+FSWKYSHRRHHSN
Sbjct  87   LYWALQGCVLTGVWVIAHECGHHAFSDYSWLDDTVGLILHSFLLVPYFSWKYSHRRHHSN  146

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSL  DEVFVPK KS + W +KYLNNPPGR  TL   LTL WPLYL FNVS
Sbjct  147  TGSLTSDEVFVPKPKSQMPWFSKYLNNPPGRFLTLAFSLTLGWPLYLAFNVS  198


 Score =   108 bits (271),  Expect(2) = 5e-73, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 66/88 (75%), Gaps = 2/88 (2%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDLI  299
            MGAGGRM+V     + K  L+RVP AKPPFT G++KKAIPPHCF RS+ RS SYVV DL 
Sbjct  1    MGAGGRMSV-VTPSVKKDVLERVPIAKPPFTFGQLKKAIPPHCFNRSIPRSMSYVVSDLT  59

Query  300  IASSLYYVATNYFHLLPHPLSY-LAWPF  380
            I+S LYY+AT Y  LLP PLSY +AWP 
Sbjct  60   ISSILYYLATTYIPLLPSPLSYFIAWPL  87



>gb|AFK12595.1| fad2-3, partial [Helianthus petiolaris]
Length=348

 Score =   202 bits (513),  Expect(2) = 5e-73, Method: Compositional matrix adjust.
 Identities = 95/112 (85%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YWI QGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVP+FSWKYSHRRHHSN
Sbjct  74   VYWIFQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPYFSWKYSHRRHHSN  133

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGS+E DEVFVPK KS +   AKYLNNPPGR  TLL+ LT+ WPLYLMFNVS
Sbjct  134  TGSIEHDEVFVPKLKSGVRSTAKYLNNPPGRILTLLVTLTMGWPLYLMFNVS  185


 Score =   100 bits (249),  Expect(2) = 5e-73, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +3

Query  177  LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDLIIASSLYYVATNYFHLLPHP  356
            L+R  + KPPFT+G+IKK IPPHCF+RSV+RSFSYVVYDL IAS  YY+A NY  LLP+ 
Sbjct  7    LERALHEKPPFTVGDIKKVIPPHCFKRSVIRSFSYVVYDLTIASIFYYLANNYIPLLPNS  66

Query  357  LSYLAWP  377
            L+Y+AWP
Sbjct  67   LAYVAWP  73



>ref|XP_002299149.1| microsomal omega-6 desaturase family protein [Populus trichocarpa]
 gb|EEE83954.1| microsomal omega-6 desaturase family protein [Populus trichocarpa]
Length=380

 Score =   190 bits (482),  Expect(2) = 5e-73, Method: Compositional matrix adjust.
 Identities = 85/112 (76%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YWI QGC+LTG+WVIAHECGHHAFSDY+W+DDTVGLILHSAL VP+FSWKYSHRRHHSN
Sbjct  89   IYWILQGCILTGLWVIAHECGHHAFSDYRWVDDTVGLILHSALFVPYFSWKYSHRRHHSN  148

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
             G L+RDEVFVPK KS + W++ YLNNPPGRA  L ++L L WPLYL FN S
Sbjct  149  IGCLDRDEVFVPKPKSQIPWYSMYLNNPPGRALGLAVKLLLGWPLYLTFNAS  200


 Score =   112 bits (280),  Expect(2) = 5e-73, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 67/88 (76%), Gaps = 2/88 (2%)
 Frame = +3

Query  120  MGAGGRMA--VPAEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYD  293
            MGA G     +  E K S   +++VP  KPPFTLG+IKKAIPPHCF+RS+LRSFSYVVYD
Sbjct  1    MGANGVFNPNIKGEEKESLSHIKKVPGTKPPFTLGQIKKAIPPHCFERSLLRSFSYVVYD  60

Query  294  LIIASSLYYVATNYFHLLPHPLSYLAWP  377
            L+I+S L Y+A  YFHLLP  L+Y+AWP
Sbjct  61   LLISSLLGYIAITYFHLLPSHLAYIAWP  88



>gb|ABC00770.1| delta-12 fatty acid desaturase type 02 [Crepis alpina]
Length=382

 Score =   196 bits (498),  Expect(2) = 8e-73, Method: Compositional matrix adjust.
 Identities = 89/111 (80%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = +2

Query  380  YWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSNT  559
            YWI QGCVLTGVWVIAHECGHHAFSDYQ++DDTVG +LHSALLVP+FSWKYSHRRHHSNT
Sbjct  89   YWITQGCVLTGVWVIAHECGHHAFSDYQFVDDTVGFLLHSALLVPYFSWKYSHRRHHSNT  148

Query  560  GSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            GSL+RDEVFVPK +S + W++KYLNNPPGR  ++L  LTL WPLYL FNVS
Sbjct  149  GSLDRDEVFVPKPRSKITWYSKYLNNPPGRIISMLATLTLGWPLYLAFNVS  199


 Score =   105 bits (263),  Expect(2) = 8e-73, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 63/86 (73%), Gaps = 1/86 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGG M+V       K + L+RVP  KPPFT+ ++KK IPPHCF RS+ RSFSYVV DL
Sbjct  1    MGAGGCMSVSDTKSEQKNNPLKRVPSEKPPFTISDLKKVIPPHCFNRSLTRSFSYVVSDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAW  374
            II+  LY++AT YFH LP PLS LAW
Sbjct  61   IISFLLYHIATAYFHHLPPPLSSLAW  86



>ref|XP_008344778.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Malus domestica]
 ref|XP_008363340.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Malus domestica]
Length=387

 Score =   187 bits (476),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 95/112 (85%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYWI QGC LTGVWVIAHECGHHAFSDYQ +DDTVGL+LHS LL P+FSWKYSHRRHHSN
Sbjct  89   LYWILQGCTLTGVWVIAHECGHHAFSDYQVVDDTVGLVLHSFLLTPYFSWKYSHRRHHSN  148

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            T SLERDEVFVPK KS + ++ KY NNPPGR  ++L+ LTL WPLYL FN S
Sbjct  149  TASLERDEVFVPKPKSKIPFYNKYFNNPPGRILSILVTLTLGWPLYLAFNAS  200


 Score =   113 bits (283),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 68/88 (77%), Gaps = 2/88 (2%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQDLQ-RVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGG M    + K  +   Q RVP +KPPFTL +IKKAIPPHCF RS+LRSFSY++YDL
Sbjct  1    MGAGGNMVTKTKSKKQEATHQKRVPVSKPPFTLSQIKKAIPPHCFNRSLLRSFSYLLYDL  60

Query  297  IIASSLYYVATNYFHLLPHP-LSYLAWP  377
             ++   Y++AT+YFHLLPHP LSY++WP
Sbjct  61   ALSFLFYHIATSYFHLLPHPLLSYISWP  88



>gb|AAV52834.1| delta-12 fatty acid desaturase [Tropaeolum majus]
Length=383

 Score =   180 bits (457),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 88/112 (79%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YW  QGCVLTGVWVIAHECGHHAFSDYQW+DDTVGLILHS LLVP+FSWK+SHRRHHSN
Sbjct  88   VYWAFQGCVLTGVWVIAHECGHHAFSDYQWVDDTVGLILHSFLLVPYFSWKHSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGS++RDEVFVPK+KS + W++ YLNNP GR  T+ I LTL WPLYL FNVS
Sbjct  148  TGSMDRDEVFVPKKKSQMRWYSPYLNNPLGRIITITITLTLGWPLYLAFNVS  199


 Score =   120 bits (302),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 70/86 (81%), Gaps = 1/86 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM++P   K +  D L+RVP+ KPPF+L ++KKAIPPHCF+RS++ SFSYVVYDL
Sbjct  1    MGAGGRMSIPPTSKKADVDALKRVPHLKPPFSLSQLKKAIPPHCFKRSLIHSFSYVVYDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAW  374
            +IAS  YYVAT YF  LP PLSY+AW
Sbjct  61   VIASIFYYVATTYFQHLPTPLSYVAW  86



>gb|AIA21651.1| oleate desaturase [Crambe filiformis]
Length=384

 Score =   202 bits (514),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW CQGCVLTG+WVIAHECGHHAFSDYQWLDDTVGLI HS LLVP+FSWKYSHRRHHSN
Sbjct  88   LYWACQGCVLTGLWVIAHECGHHAFSDYQWLDDTVGLIFHSFLLVPYFSWKYSHRRHHSN  147

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK+KSD+ W+ KYLNNP GR   L +Q TL WPLYL FNVS
Sbjct  148  TGSLERDEVFVPKKKSDIKWYGKYLNNPLGRTLMLTVQFTLGWPLYLAFNVS  199


 Score = 98.2 bits (243),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 69/88 (78%), Gaps = 1/88 (1%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQD-LQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MGAGGRM V    K S+ + L+RVP   PPF LG++KKAIPPHCF+RS+ RSFSY++YD+
Sbjct  1    MGAGGRMQVTPSPKNSETNTLKRVPCETPPFALGDLKKAIPPHCFKRSIPRSFSYLLYDI  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAWPF  380
            II+S  YY++T YF LLPHPL YLAWP 
Sbjct  61   IISSIFYYLSTTYFPLLPHPLPYLAWPL  88



>ref|XP_011037927.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 1-like [Populus euphratica]
Length=382

 Score =   194 bits (493),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            +YWI QG +LTG WVI+HECGHHAFSDY+W+DDTVGLILHSALLVP+FSWKYSHRRHHSN
Sbjct  87   MYWILQGSILTGAWVISHECGHHAFSDYRWVDDTVGLILHSALLVPYFSWKYSHRRHHSN  146

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK KS + W+++YLNNPPGRA +L + + L WPLYL FNVS
Sbjct  147  TGSLERDEVFVPKPKSRIAWYSQYLNNPPGRALSLGVTILLGWPLYLAFNVS  198


 Score =   106 bits (264),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDLI  299
            MGA    A   +    +  ++R+P+AKPPFTLG+IKKAIPPHCF+RS+LRSFSYVVYDL 
Sbjct  1    MGANRVFASSGKHGGKESRIKRMPHAKPPFTLGKIKKAIPPHCFERSLLRSFSYVVYDLS  60

Query  300  IASSLYYVATNYFHLLPHPLSYLAWP  377
            I+  L Y+A  YF LLP PLS +AWP
Sbjct  61   ISFLLCYIAITYFDLLPSPLSCVAWP  86



>emb|CAN73788.1| hypothetical protein VITISV_002517 [Vitis vinifera]
Length=366

 Score =   184 bits (468),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  377  LYWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSN  556
            LYW  QGC LTGVWVIAHECGHHAFSDYQWLDDTVGLILHS+LLVP+FSWK SHRRHHSN
Sbjct  81   LYWTLQGCTLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSSLLVPYFSWKISHRRHHSN  140

Query  557  TGSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
            TGSLERDEVFVPK KS + W +KYLNNP GRA TL I LTL WPLYL FNVS
Sbjct  141  TGSLERDEVFVPKPKSRIPWFSKYLNNPLGRALTLXITLTLGWPLYLAFNVS  192


 Score =   115 bits (289),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 67/86 (78%), Gaps = 6/86 (7%)
 Frame = +3

Query  120  MGAGGRMAVPAEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDLI  299
            MGAGGR++VP         +QRVP+ KPPFTLG+IKKAIPPHCFQRS+ RSFSYV YDL 
Sbjct  1    MGAGGRLSVP------NSPVQRVPHTKPPFTLGQIKKAIPPHCFQRSIPRSFSYVAYDLS  54

Query  300  IASSLYYVATNYFHLLPHPLSYLAWP  377
            +A   YY+AT+YF LLP  L+YLAWP
Sbjct  55   LAFLFYYIATSYFSLLPSWLTYLAWP  80



>gb|AGC65498.1| FAD2-1 protein [Carthamus tinctorius]
Length=380

 Score =   193 bits (491),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 88/111 (79%), Positives = 96/111 (86%), Gaps = 0/111 (0%)
 Frame = +2

Query  380  YWICQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSALLVPFFSWKYSHRRHHSNT  559
            YWI QGCVLTG WV+AHECGHHAFSDYQW+DDTVG I+HS LLVP+FSWKYSHRRHHSNT
Sbjct  89   YWIVQGCVLTGAWVVAHECGHHAFSDYQWVDDTVGFIVHSFLLVPYFSWKYSHRRHHSNT  148

Query  560  GSLERDEVFVPKQKSDLGWHAKYLNNPPGRAFTLLIQLTLXWPLYLMFNVS  712
             SLERDEVFVPK +S L W++KYLNNPPGR  +L   LTL WPLYL FNVS
Sbjct  149  ASLERDEVFVPKPRSKLPWYSKYLNNPPGRIISLFATLTLGWPLYLSFNVS  199


 Score =   107 bits (266),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = +3

Query  120  MGAGGRM-AVPAEGKMSKQDLQRVPYAKPPFTLGEIKKAIPPHCFQRSVLRSFSYVVYDL  296
            MG GG M A   + +  K  L RVP AKPPFT+ +IK+AIP HCF RS++RSFSY+VYDL
Sbjct  1    MGGGGCMSASETKAEEKKNPLDRVPCAKPPFTISDIKQAIPSHCFNRSLIRSFSYIVYDL  60

Query  297  IIASSLYYVATNYFHLLPHPLSYLAW  374
             IA   YY+AT Y H LP P SYLAW
Sbjct  61   AIAFVFYYLATTYIHRLPTPFSYLAW  86



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1246782646395