BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF051J20

Length=678
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009617291.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    326   2e-105   Nicotiana tomentosiformis
ref|XP_006345041.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    323   5e-104   Solanum tuberosum [potatoes]
ref|XP_009617290.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    322   1e-103   Nicotiana tomentosiformis
ref|XP_004236119.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    320   8e-103   
ref|XP_011071828.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    317   6e-102   Sesamum indicum [beniseed]
emb|CDP18933.1|  unnamed protein product                                317   7e-102   Coffea canephora [robusta coffee]
ref|XP_010028184.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    317   1e-101   Eucalyptus grandis [rose gum]
gb|KJB53132.1|  hypothetical protein B456_008G294300                    310   3e-100   Gossypium raimondii
gb|AFK41217.1|  unknown                                                 313   3e-100   Lotus japonicus
gb|AFW86313.1|  restorer of fertility2                                  310   7e-100   
gb|AAK58370.1|AF269064_1  T-cytoplasm male sterility restorer fac...    311   2e-99    Zea mays [maize]
gb|KJB53131.1|  hypothetical protein B456_008G294300                    310   3e-99    Gossypium raimondii
gb|KJB53133.1|  hypothetical protein B456_008G294300                    310   3e-99    Gossypium raimondii
ref|NP_001105891.1|  mitochondrial aldehyde dehydrogenase 2             311   3e-99    Zea mays [maize]
gb|AHM26656.1|  aldehyde dehydrogenase 2-1                              310   4e-99    Zea mays subsp. mays [corn]
gb|KHN18468.1|  Aldehyde dehydrogenase family 2 member B4, mitoch...    310   4e-99    Glycine soja [wild soybean]
ref|XP_007155410.1|  hypothetical protein PHAVU_003G199100g             310   4e-99    Phaseolus vulgaris [French bean]
ref|XP_007155411.1|  hypothetical protein PHAVU_003G199100g             310   5e-99    Phaseolus vulgaris [French bean]
dbj|BAB92019.1|  mitochondrial aldehyde dehydrogenase                   309   1e-98    Sorghum bicolor [broomcorn]
gb|KDP26565.1|  hypothetical protein JCGZ_17723                         309   1e-98    Jatropha curcas
gb|AAO72532.1|  aldehyde dehydrogenase 1 precursor                      308   2e-98    Lotus corniculatus
ref|XP_009363534.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    308   3e-98    Pyrus x bretschneideri [bai li]
ref|XP_003608978.1|  Mitochondrial aldehyde dehydrogenase               307   6e-98    
ref|XP_010101190.1|  Aldehyde dehydrogenase family 2 member             307   6e-98    Morus notabilis
ref|XP_007210569.1|  hypothetical protein PRUPE_ppa003869mg             307   6e-98    Prunus persica
ref|XP_008374451.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    306   9e-98    Malus domestica [apple tree]
gb|AES91175.2|  NAD-dependent aldehyde dehydrogenase family protein     306   1e-97    Medicago truncatula
ref|XP_008239742.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    306   1e-97    Prunus mume [ume]
gb|AAZ79355.1|  aldehyde dehydrogenase                                  306   1e-97    Vitis pseudoreticulata
ref|XP_002283132.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    306   1e-97    Vitis vinifera
ref|XP_010251301.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    306   2e-97    Nelumbo nucifera [Indian lotus]
emb|CAN63005.1|  hypothetical protein VITISV_013710                     306   2e-97    Vitis vinifera
gb|KHG08400.1|  Aldehyde dehydrogenase family 2 member B4, mitoch...    306   2e-97    Gossypium arboreum [tree cotton]
emb|CDP00179.1|  unnamed protein product                                305   4e-97    Coffea canephora [robusta coffee]
ref|XP_010678738.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    305   6e-97    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008221788.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    304   6e-97    Prunus mume [ume]
ref|XP_004138115.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    305   7e-97    Cucumis sativus [cucumbers]
ref|XP_004155012.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    305   8e-97    
ref|XP_004965205.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    305   8e-97    Setaria italica
ref|XP_010546022.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    303   2e-96    Tarenaya hassleriana [spider flower]
ref|XP_007036177.1|  Aldehyde dehydrogenase family 2 member B4          304   2e-96    
ref|XP_010682576.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    300   2e-96    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009363532.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    303   2e-96    Pyrus x bretschneideri [bai li]
ref|XP_010914166.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    304   3e-96    Elaeis guineensis
ref|XP_007221800.1|  hypothetical protein PRUPE_ppa004036mg             303   3e-96    Prunus persica
ref|XP_009391259.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    302   3e-96    Musa acuminata subsp. malaccensis [pisang utan]
gb|AAF73828.1|AF162665_1  aldehyde dehydrogenase                        303   3e-96    Oryza sativa [red rice]
ref|XP_010928601.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    303   3e-96    Elaeis guineensis
ref|XP_010426271.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    302   4e-96    Camelina sativa [gold-of-pleasure]
ref|XP_007031424.1|  Aldehyde dehydrogenase 2B4 isoform 2               298   4e-96    
ref|XP_010503421.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    302   4e-96    Camelina sativa [gold-of-pleasure]
gb|KDO69715.1|  hypothetical protein CISIN_1g012806mg                   298   4e-96    Citrus sinensis [apfelsine]
ref|NP_001057358.1|  Os06g0270900                                       303   4e-96    
gb|EAZ00462.1|  hypothetical protein OsI_22484                          303   4e-96    Oryza sativa Indica Group [Indian rice]
gb|KDO69714.1|  hypothetical protein CISIN_1g012806mg                   298   4e-96    Citrus sinensis [apfelsine]
ref|XP_004297642.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    302   5e-96    Fragaria vesca subsp. vesca
gb|EYU42550.1|  hypothetical protein MIMGU_mgv1a004919mg                301   5e-96    Erythranthe guttata [common monkey flower]
ref|XP_002877590.1|  ALDH2B4                                            302   5e-96    
ref|XP_008389628.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    302   5e-96    
ref|XP_008793883.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    301   8e-96    
ref|XP_004298932.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    301   8e-96    Fragaria vesca subsp. vesca
ref|XP_010913576.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    301   1e-95    Elaeis guineensis
ref|XP_002511424.1|  aldehyde dehydrogenase, putative                   301   1e-95    
gb|KDO69713.1|  hypothetical protein CISIN_1g012806mg                   298   2e-95    Citrus sinensis [apfelsine]
ref|XP_010515110.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    301   2e-95    Camelina sativa [gold-of-pleasure]
ref|XP_010682575.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    300   2e-95    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004508853.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    300   3e-95    Cicer arietinum [garbanzo]
emb|CDY36910.1|  BnaA06g16950D                                          300   3e-95    Brassica napus [oilseed rape]
ref|XP_010477684.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    300   3e-95    Camelina sativa [gold-of-pleasure]
ref|XP_009149853.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    300   3e-95    Brassica rapa
ref|XP_008367527.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    300   3e-95    
ref|XP_007153639.1|  hypothetical protein PHAVU_003G052500g             300   4e-95    Phaseolus vulgaris [French bean]
ref|XP_007031423.1|  Aldehyde dehydrogenase 2B4 isoform 1               299   5e-95    
ref|XP_010460154.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    300   5e-95    Camelina sativa [gold-of-pleasure]
ref|XP_008453101.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    300   5e-95    Cucumis melo [Oriental melon]
ref|XP_009391258.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    299   5e-95    Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY44985.1|  BnaCnng12150D                                          300   5e-95    Brassica napus [oilseed rape]
gb|KDP31120.1|  hypothetical protein JCGZ_11496                         300   5e-95    Jatropha curcas
ref|XP_008781996.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    300   6e-95    Phoenix dactylifera
ref|XP_009391257.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    299   7e-95    Musa acuminata subsp. malaccensis [pisang utan]
gb|AGV54428.1|  mitochondrial aldehyde dehydrogenase                    299   7e-95    Phaseolus vulgaris [French bean]
ref|XP_003527026.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    299   9e-95    
ref|XP_009612265.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    299   9e-95    Nicotiana tomentosiformis
ref|XP_006404308.1|  hypothetical protein EUTSA_v10010271mg             299   1e-94    Eutrema salsugineum [saltwater cress]
ref|XP_009391256.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    298   2e-94    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009759823.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    298   2e-94    Nicotiana sylvestris
gb|EPS72983.1|  mitochondrial benzaldehyde dehydrogenase                297   2e-94    Genlisea aurea
ref|XP_006476755.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    298   2e-94    Citrus sinensis [apfelsine]
ref|XP_006439784.1|  hypothetical protein CICLE_v10019638mg             298   2e-94    Citrus clementina [clementine]
ref|XP_011028588.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    298   2e-94    Populus euphratica
ref|XP_010498885.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    297   5e-94    Camelina sativa [gold-of-pleasure]
ref|XP_006844236.1|  hypothetical protein AMTR_s00006p00268060          296   5e-94    
ref|XP_011044320.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    296   6e-94    Populus euphratica
ref|XP_006290873.1|  hypothetical protein CARUB_v10016983mg             296   7e-94    Capsella rubella
gb|ABK92547.1|  unknown                                                 293   8e-94    Populus trichocarpa [western balsam poplar]
emb|CAA71003.1|  aldehyde dehydrogenase (NAD+)                          296   1e-93    Nicotiana tabacum [American tobacco]
gb|KJB50197.1|  hypothetical protein B456_008G158500                    296   1e-93    Gossypium raimondii
ref|XP_002301540.1|  mitochondrial aldehyde dehydrogenase family ...    296   2e-93    Populus trichocarpa [western balsam poplar]
ref|XP_002274863.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    295   2e-93    Vitis vinifera
ref|XP_004238676.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    295   2e-93    
gb|KCW86739.1|  hypothetical protein EUGRSUZ_B03349                     295   2e-93    Eucalyptus grandis [rose gum]
ref|XP_010551563.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    295   3e-93    Tarenaya hassleriana [spider flower]
ref|XP_010044646.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    295   3e-93    Eucalyptus grandis [rose gum]
ref|XP_006355977.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    295   3e-93    Solanum tuberosum [potatoes]
ref|XP_006656871.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    295   3e-93    Oryza brachyantha
gb|KHG27537.1|  Aldehyde dehydrogenase family 2 member B4, mitoch...    295   4e-93    Gossypium arboreum [tree cotton]
ref|XP_010653335.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    295   4e-93    Vitis vinifera
gb|ACM89738.1|  mitochondrial benzaldehyde dehydrogenase                294   6e-93    Antirrhinum majus [garden snapdragon]
dbj|BAB62757.1|  mitochondrial aldehyde dehydrogenase ALDH2             295   6e-93    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011463376.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    294   6e-93    Fragaria vesca subsp. vesca
ref|XP_002318034.1|  aldehyde dehydrogenase 1 precursor family pr...    293   9e-93    Populus trichocarpa [western balsam poplar]
ref|XP_003517756.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    293   1e-92    
ref|XP_010477682.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    293   1e-92    Camelina sativa [gold-of-pleasure]
gb|AFK49345.1|  unknown                                                 285   2e-92    Medicago truncatula
gb|KFK34098.1|  hypothetical protein AALP_AA5G101700                    293   2e-92    Arabis alpina [alpine rockcress]
gb|KHN00347.1|  Aldehyde dehydrogenase family 2 member B7, mitoch...    293   2e-92    Glycine soja [wild soybean]
ref|XP_004509835.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    293   2e-92    
ref|XP_004509834.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    293   3e-92    Cicer arietinum [garbanzo]
ref|XP_004297641.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    292   3e-92    Fragaria vesca subsp. vesca
ref|XP_010029207.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    292   3e-92    Eucalyptus grandis [rose gum]
ref|XP_010552639.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    292   4e-92    Tarenaya hassleriana [spider flower]
ref|XP_003519638.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    292   4e-92    
dbj|BAB92017.1|  mitochondrial aldehyde dehydrogenase                   292   5e-92    Secale cereale
gb|KCW56067.1|  hypothetical protein EUGRSUZ_I01824                     291   5e-92    Eucalyptus grandis [rose gum]
gb|KEH35052.1|  NAD-dependent aldehyde dehydrogenase family protein     288   6e-92    Medicago truncatula
gb|EMS51754.1|  Aldehyde dehydrogenase family 2 member B7, mitoch...    292   6e-92    Triticum urartu
gb|EMT04899.1|  Aldehyde dehydrogenase family 2 member B4, mitoch...    292   6e-92    
gb|AAL77004.1|  aldehyde dehydrogenase                                  283   6e-92    Allium cepa
gb|KJB11462.1|  hypothetical protein B456_001G261100                    286   7e-92    Gossypium raimondii
gb|KDO82494.1|  hypothetical protein CISIN_1g009035mg                   287   7e-92    Citrus sinensis [apfelsine]
ref|XP_010682577.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    291   7e-92    Beta vulgaris subsp. vulgaris [field beet]
gb|KEH35053.1|  NAD-dependent aldehyde dehydrogenase family protein     288   7e-92    Medicago truncatula
gb|KEH35051.1|  NAD-dependent aldehyde dehydrogenase family protein     288   9e-92    Medicago truncatula
ref|XP_011086550.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    291   1e-91    Sesamum indicum [beniseed]
ref|NP_190383.1|  aldehyde dehydrogenase 2B4                            291   1e-91    Arabidopsis thaliana [mouse-ear cress]
ref|NP_564204.1|  aldehyde dehydrogenase 2B7                            290   1e-91    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011003158.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    291   1e-91    Populus euphratica
gb|AAL99612.1|AF348416_1  mitochondrial aldehyde dehydrogenase          290   2e-91    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009399660.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    290   2e-91    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011044321.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    290   2e-91    Populus euphratica
ref|XP_003552014.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    290   3e-91    
ref|XP_006307216.1|  hypothetical protein CARUB_v10008816mg             290   3e-91    Capsella rubella
ref|XP_002893307.1|  hypothetical protein ARALYDRAFT_472641             290   3e-91    
gb|KJB31274.1|  hypothetical protein B456_005G183300                    289   4e-91    Gossypium raimondii
gb|KDO82493.1|  hypothetical protein CISIN_1g009035mg                   287   4e-91    Citrus sinensis [apfelsine]
gb|KDO82492.1|  hypothetical protein CISIN_1g009035mg                   287   5e-91    Citrus sinensis [apfelsine]
gb|KFK44454.1|  hypothetical protein AALP_AA1G258900                    288   6e-91    Arabis alpina [alpine rockcress]
ref|XP_009115500.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    289   6e-91    Brassica rapa
gb|EYU31278.1|  hypothetical protein MIMGU_mgv1a004311mg                288   8e-91    Erythranthe guttata [common monkey flower]
gb|ABK24267.1|  unknown                                                 289   9e-91    Picea sitchensis
gb|KEH35050.1|  NAD-dependent aldehyde dehydrogenase family protein     288   1e-90    Medicago truncatula
gb|KHG06517.1|  Aldehyde dehydrogenase family 2 member B7, mitoch...    288   1e-90    Gossypium arboreum [tree cotton]
emb|CDY47634.1|  BnaC05g18900D                                          288   1e-90    Brassica napus [oilseed rape]
gb|KJB11461.1|  hypothetical protein B456_001G261100                    288   1e-90    Gossypium raimondii
ref|XP_003532011.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    288   1e-90    
gb|KDO82485.1|  hypothetical protein CISIN_1g009035mg                   287   3e-90    Citrus sinensis [apfelsine]
ref|XP_006438422.1|  hypothetical protein CICLE_v10031155mg             287   4e-90    Citrus clementina [clementine]
ref|XP_010682578.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    287   4e-90    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009110081.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    287   4e-90    Brassica rapa
emb|CDY57318.1|  BnaA08g20300D                                          287   4e-90    Brassica napus [oilseed rape]
ref|XP_009761724.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    287   4e-90    Nicotiana sylvestris
gb|KEH19981.1|  NAD-dependent aldehyde dehydrogenase family protein     286   5e-90    Medicago truncatula
ref|XP_010029206.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    286   7e-90    Eucalyptus grandis [rose gum]
ref|XP_007157468.1|  hypothetical protein PHAVU_002G072100g             286   9e-90    Phaseolus vulgaris [French bean]
ref|XP_004139235.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    286   9e-90    
ref|XP_004156463.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    286   1e-89    
gb|KEH19980.1|  NAD-dependent aldehyde dehydrogenase family protein     286   1e-89    Medicago truncatula
emb|CDY61548.1|  BnaA09g29890D                                          286   1e-89    Brassica napus [oilseed rape]
ref|XP_008456004.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    285   1e-89    Cucumis melo [Oriental melon]
ref|XP_009150211.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    285   2e-89    Brassica rapa
ref|XP_009600000.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    285   2e-89    
emb|CDX91724.1|  BnaC08g06430D                                          285   2e-89    
gb|KGN60807.1|  hypothetical protein Csa_2G010420                       286   3e-89    Cucumis sativus [cucumbers]
ref|XP_011071082.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    284   4e-89    
ref|XP_003563967.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    283   1e-88    Brachypodium distachyon [annual false brome]
ref|XP_010271955.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    283   1e-88    Nelumbo nucifera [Indian lotus]
gb|EYU22484.1|  hypothetical protein MIMGU_mgv1a004342mg                283   2e-88    Erythranthe guttata [common monkey flower]
gb|ACU18804.1|  unknown                                                 271   2e-88    Glycine max [soybeans]
emb|CDX77883.1|  BnaC03g53360D                                          283   2e-88    
ref|XP_010037573.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    281   5e-88    Eucalyptus grandis [rose gum]
gb|AAC98035.1|  Strong similarity to gb|Y09876 aldehyde dehydroge...    280   9e-88    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004245256.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    281   9e-88    Solanum lycopersicum
ref|XP_006416054.1|  hypothetical protein EUTSA_v10007303mg             280   1e-87    Eutrema salsugineum [saltwater cress]
gb|KHN47185.1|  Aldehyde dehydrogenase family 2 member B4, mitoch...    279   5e-87    Glycine soja [wild soybean]
ref|XP_006594290.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    279   5e-87    Glycine max [soybeans]
ref|XP_003542700.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    279   5e-87    
ref|XP_010316283.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    278   6e-87    Solanum lycopersicum
ref|XP_006356663.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    278   9e-87    Solanum tuberosum [potatoes]
ref|XP_002525343.1|  aldehyde dehydrogenase, putative                   273   2e-86    
ref|XP_008793866.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    277   2e-86    Phoenix dactylifera
ref|XP_007044551.1|  Aldehyde dehydrogenase 2B4                         277   3e-86    
ref|XP_010100483.1|  Aldehyde dehydrogenase family 2 member             276   7e-86    Morus notabilis
ref|XP_010265814.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    275   2e-85    Nelumbo nucifera [Indian lotus]
gb|AEV54528.1|  aldehyde dehydrogenase ALDH2B4_V3                       275   2e-85    Vitis vinifera
gb|KHN23562.1|  Aldehyde dehydrogenase family 2 member B7, mitoch...    274   2e-85    Glycine soja [wild soybean]
gb|AAZ79358.1|  aldehyde dehydrogenase                                  274   2e-85    Vitis pseudoreticulata
ref|XP_004953799.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    273   2e-84    Setaria italica
gb|KDO82484.1|  hypothetical protein CISIN_1g009035mg                   270   3e-84    Citrus sinensis [apfelsine]
ref|XP_010928603.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    271   3e-84    Elaeis guineensis
ref|XP_004953798.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    272   4e-84    
ref|XP_007151102.1|  hypothetical protein PHAVU_004G018000g             268   5e-83    Phaseolus vulgaris [French bean]
emb|CDY21806.1|  BnaA06g20750D                                          262   7e-81    Brassica napus [oilseed rape]
gb|ABD35815.1|  putative mitochondrial aldehyde dehydrogenase           250   1e-80    Populus x canadensis [Canadian poplar]
gb|AAW50842.1|  aldehyde dehydrogenase                                  248   2e-79    Aegiceras corniculatum
gb|AAZ79356.1|  aldehyde dehydrogenase                                  255   1e-78    Vitis pseudoreticulata
gb|AEV54527.1|  aldehyde dehydrogenase ALDH2B4_V2                       255   1e-78    Vitis vinifera
gb|KJB50198.1|  hypothetical protein B456_008G158500                    255   2e-78    Gossypium raimondii
gb|AFW63787.1|  hypothetical protein ZEAMMB73_379378                    249   4e-77    
ref|XP_002321583.2|  aldehyde dehydrogenase 1 precursor family pr...    251   8e-77    
ref|XP_006647839.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    251   2e-76    
gb|AFW63788.1|  hypothetical protein ZEAMMB73_379378                    249   3e-76    
gb|ACG32898.1|  aldehyde dehydrogenase                                  250   6e-76    Zea mays [maize]
dbj|BAB92018.1|  mitochondrial aldehyde dehydrogenase                   250   9e-76    Sorghum bicolor [broomcorn]
gb|EEC73936.1|  hypothetical protein OsI_08800                          249   2e-75    Oryza sativa Indica Group [Indian rice]
ref|NP_001048010.1|  Os02g0730000                                       249   2e-75    
ref|NP_001105576.1|  aldehyde dehydrogenase2                            249   2e-75    Zea mays [maize]
gb|KHN05814.1|  Aldehyde dehydrogenase family 2 member B4, mitoch...    245   2e-75    Glycine soja [wild soybean]
gb|AAL99614.2|AF348418_1  mitochondrial aldehyde dehydrogenase RF2B     249   2e-75    Zea mays [maize]
gb|AHM26657.1|  aldehyde dehydrogenase 2-2                              249   2e-75    Zea mays subsp. mays [corn]
ref|XP_006439785.1|  hypothetical protein CICLE_v10019638mg             243   7e-74    
gb|EMT22926.1|  Aldehyde dehydrogenase family 2 member B4, mitoch...    245   6e-73    
ref|XP_001785650.1|  predicted protein                                  242   6e-73    
gb|AAK57987.1|  T cytoplasm male sterility restorer factor 2            228   1e-72    Zea mays [maize]
emb|CDY49384.1|  BnaA03g50730D                                          214   4e-65    Brassica napus [oilseed rape]
ref|XP_002978501.1|  hypothetical protein SELMODRAFT_233128             215   5e-63    
ref|XP_002970420.1|  hypothetical protein SELMODRAFT_231526             213   4e-62    
ref|WP_036269309.1|  betaine-aldehyde dehydrogenase                     213   5e-62    Methylocaldum szegediense
ref|XP_002983210.1|  hypothetical protein SELMODRAFT_234195             212   6e-62    
ref|XP_002961352.1|  hypothetical protein SELMODRAFT_266598             210   4e-61    
ref|XP_002961274.1|  hypothetical protein SELMODRAFT_164447             209   1e-60    
ref|XP_002983288.1|  hypothetical protein SELMODRAFT_180171             209   1e-60    
gb|ABR16485.1|  unknown                                                 205   3e-59    Picea sitchensis
ref|XP_003608940.1|  Aldehyde dehydrogenase                             197   2e-58    
ref|WP_036502729.1|  betaine-aldehyde dehydrogenase                     201   2e-57    Nitrosococcus oceani
ref|WP_002814365.1|  betaine-aldehyde dehydrogenase                     201   2e-57    Nitrosococcus oceani
emb|CDW77748.1|  betaine-aldehyde dehydrogenase                         199   5e-57    Stylonychia lemnae
gb|EWM25899.1|  aldehyde dehydrogenase                                  201   6e-57    Nannochloropsis gaditana
ref|WP_013034365.1|  betaine-aldehyde dehydrogenase                     198   1e-56    Nitrosococcus halophilus
emb|CDW85535.1|  betaine-aldehyde dehydrogenase                         192   4e-56    Stylonychia lemnae
ref|WP_015249427.1|  betaine-aldehyde dehydrogenase                     195   2e-55    Singulisphaera acidiphila
ref|WP_002643666.1|  betaine-aldehyde dehydrogenase                     194   3e-55    Gimesia maris
ref|WP_021832205.1|  Aldehyde dehydrogenase                             191   4e-55    
ref|WP_013219586.1|  betaine-aldehyde dehydrogenase                     194   6e-55    Nitrosococcus watsonii
ref|WP_007307870.1|  betaine-aldehyde dehydrogenase                     191   5e-54    Crocosphaera watsonii
emb|CCQ61589.1|  Aldehyde dehydrogenase                                 191   5e-54    Crocosphaera watsonii WH 0401
emb|CCQ69085.1|  Aldehyde dehydrogenase                                 191   6e-54    Crocosphaera watsonii WH 0402
ref|WP_007312907.1|  betaine-aldehyde dehydrogenase                     191   7e-54    Crocosphaera watsonii
gb|EJY82344.1|  hypothetical protein OXYTRI_20134                       191   9e-54    Oxytricha trifallax
ref|XP_005642981.1|  aldehyde dehydrogenase                             190   1e-53    Coccomyxa subellipsoidea C-169
ref|XP_010926057.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    190   2e-53    Elaeis guineensis
ref|XP_002324977.1|  aldehyde dehydrogenase family protein              190   2e-53    
ref|XP_005642984.1|  aldehyde dehydrogenase                             191   3e-53    Coccomyxa subellipsoidea C-169
ref|WP_008272605.1|  betaine-aldehyde dehydrogenase                     189   3e-53    Cyanothece sp. CCY0110
gb|EJY79302.1|  hypothetical protein OXYTRI_23427                       189   6e-53    Oxytricha trifallax
gb|AHH02396.1|  aldehyde dehydrogenase                                  177   9e-53    Aegiceras corniculatum
ref|WP_014098431.1|  betaine-aldehyde dehydrogenase                     188   1e-52    Bacillus coagulans
ref|WP_017550804.1|  betaine-aldehyde dehydrogenase                     188   1e-52    Bacillus coagulans
ref|WP_013859232.1|  betaine-aldehyde dehydrogenase                     188   1e-52    Bacillus coagulans
ref|WP_029141634.1|  betaine-aldehyde dehydrogenase                     188   1e-52    Bacillus coagulans
ref|WP_017554076.1|  betaine-aldehyde dehydrogenase                     187   1e-52    Bacillus coagulans
ref|XP_008808790.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    187   2e-52    Phoenix dactylifera
ref|WP_036019563.1|  betaine-aldehyde dehydrogenase                     187   2e-52    
ref|WP_011612157.1|  betaine-aldehyde dehydrogenase                     187   2e-52    Trichodesmium erythraeum
gb|EKU99215.1|  NAD-dependent aldehyde dehydrogenase                    187   2e-52    Leptolyngbya sp. PCC 7375
ref|WP_044747140.1|  betaine-aldehyde dehydrogenase                     187   2e-52    Bacillus alveayuensis
ref|XP_011043446.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    187   3e-52    Populus euphratica
ref|WP_010676364.1|  betaine-aldehyde dehydrogenase                     187   3e-52    Bacillus timonensis
ref|XP_002948098.1|  hypothetical protein VOLCADRAFT_73567              187   3e-52    Volvox carteri f. nagariensis
ref|WP_018662214.1|  betaine-aldehyde dehydrogenase                     187   3e-52    Bacillus acidiproducens
ref|XP_010088836.1|  Aldehyde dehydrogenase family 2 member C4          187   4e-52    
ref|WP_009547631.1|  MULTISPECIES: betaine-aldehyde dehydrogenase       186   4e-52    Cyanothece
ref|WP_026683483.1|  betaine-aldehyde dehydrogenase                     186   5e-52    Bacillus coagulans
ref|XP_010688155.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    186   6e-52    Beta vulgaris subsp. vulgaris [field beet]
ref|WP_019721171.1|  betaine-aldehyde dehydrogenase                     186   6e-52    Bacillus coagulans
ref|WP_017721107.1|  betaine-aldehyde dehydrogenase                     186   7e-52    Oscillatoria sp. PCC 10802
emb|CAD30313.1|  aldehyde dehydrogenase                                 186   7e-52    Geobacillus stearothermophilus
ref|XP_008657785.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    177   8e-52    
ref|XP_010926163.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    186   9e-52    Elaeis guineensis
ref|WP_008181335.1|  betaine-aldehyde dehydrogenase                     185   1e-51    Moorea producens
ref|NP_001043453.1|  Os01g0591000                                       185   1e-51    
ref|WP_009782331.1|  betaine-aldehyde dehydrogenase                     185   1e-51    
ref|WP_013324932.1|  betaine-aldehyde dehydrogenase                     184   2e-51    
ref|XP_006842238.1|  hypothetical protein AMTR_s00078p00188120          182   2e-51    
ref|XP_003569290.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    185   2e-51    
ref|WP_043903379.1|  betaine-aldehyde dehydrogenase                     184   2e-51    
ref|WP_008654380.1|  aldehyde dehydrogenase                             184   2e-51    
ref|WP_008665861.1|  aldehyde dehydrogenase                             184   3e-51    
ref|WP_037245914.1|  betaine-aldehyde dehydrogenase                     184   3e-51    
emb|CAD70567.1|  aldehyde dehydrogenase                                 184   3e-51    
ref|WP_011122652.1|  betaine-aldehyde dehydrogenase                     184   3e-51    
ref|WP_007334248.1|  betaine-aldehyde dehydrogenase                     184   3e-51    
ref|WP_023069382.1|  aldehyde dehydrogenase family protein              184   3e-51    
ref|XP_004711052.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    184   4e-51    
gb|ABO93608.1|  cytosolic aldehyde dehydrogenase                        184   4e-51    
ref|XP_004969048.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    184   4e-51    
ref|WP_035202128.1|  betaine-aldehyde dehydrogenase                     184   5e-51    
ref|XP_008361254.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    184   5e-51    
ref|WP_027725052.1|  betaine-aldehyde dehydrogenase                     184   5e-51    
ref|WP_041847559.1|  betaine-aldehyde dehydrogenase                     183   5e-51    
ref|WP_002654069.1|  betaine-aldehyde dehydrogenase                     183   5e-51    
ref|WP_034769244.1|  betaine-aldehyde dehydrogenase                     183   5e-51    
ref|WP_025909157.1|  betaine-aldehyde dehydrogenase                     184   5e-51    
ref|WP_026100754.1|  betaine-aldehyde dehydrogenase                     183   5e-51    
ref|WP_041845367.1|  betaine-aldehyde dehydrogenase                     183   6e-51    
ref|WP_011244911.1|  betaine-aldehyde dehydrogenase                     183   6e-51    
gb|EMS47816.1|  Aldehyde dehydrogenase family 2 member C4               183   7e-51    
ref|XP_004969047.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    183   7e-51    
emb|CDP03348.1|  unnamed protein product                                183   8e-51    
ref|WP_007911497.1|  betaine-aldehyde dehydrogenase                     183   8e-51    
emb|CBH32543.1|  retinal dehydrogenase, putative, expressed             183   8e-51    
ref|XP_006644328.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    183   9e-51    
ref|XP_004600315.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    183   9e-51    
ref|WP_019503923.1|  betaine-aldehyde dehydrogenase                     182   1e-50    
ref|XP_007524179.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    183   1e-50    
ref|XP_004747712.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    183   1e-50    
ref|WP_019390529.1|  MULTISPECIES: betaine-aldehyde dehydrogenase       182   1e-50    
gb|KEH21359.1|  cytosolic aldehyde dehydrogenase RF2C                   180   1e-50    
ref|XP_003940113.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    183   1e-50    
ref|WP_035430826.1|  betaine-aldehyde dehydrogenase                     182   1e-50    
ref|XP_009347162.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    182   1e-50    
ref|XP_010049712.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    182   1e-50    
ref|XP_008775315.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    182   1e-50    
ref|XP_010926277.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    182   2e-50    
gb|AHM26658.1|  aldehyde dehydrogenase 2-3                              182   2e-50    
dbj|BAD32861.1|  putative cytosolic aldehyde dehydrogenase              182   2e-50    
ref|WP_020062114.1|  betaine-aldehyde dehydrogenase                     182   2e-50    
ref|XP_010049711.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    182   2e-50    
ref|XP_001690955.1|  aldehyde dehydrogenase                             182   2e-50    
ref|XP_006886928.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    182   2e-50    
ref|NP_001043454.1|  Os01g0591300                                       182   2e-50    
ref|XP_538742.2|  PREDICTED: aldehyde dehydrogenase X, mitochondr...    182   2e-50    
gb|EAY74764.1|  hypothetical protein OsI_02656                          182   2e-50    
ref|XP_010967936.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    182   3e-50    
ref|NP_001266946.1|  aldehyde dehydrogenase X, mitochondrial            182   3e-50    
ref|XP_004581021.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    182   3e-50    
ref|WP_019153463.1|  betaine-aldehyde dehydrogenase                     181   3e-50    
ref|XP_008343978.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    181   4e-50    
gb|EAY74759.1|  hypothetical protein OsI_02651                          182   4e-50    
ref|XP_008386626.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    181   4e-50    
ref|XP_010250355.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    181   4e-50    
ref|XP_002514327.1|  aldehyde dehydrogenase, putative                   181   4e-50    
dbj|BAG36147.1|  unnamed protein product                                181   4e-50    
ref|XP_003995700.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    181   4e-50    
ref|NP_000683.3|  aldehyde dehydrogenase X, mitochondrial precursor     181   4e-50    
ref|XP_008463377.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    180   4e-50    
ref|WP_000080305.1|  aldehyde dehydrogenase                             175   4e-50    
ref|XP_009336918.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    181   5e-50    
ref|XP_004048099.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    181   5e-50    
ref|XP_003785199.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    181   5e-50    
ref|XP_008140103.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    181   5e-50    
gb|EFB19337.1|  hypothetical protein PANDA_000873                       181   5e-50    
ref|NP_001105046.1|  cytosolic aldehyde dehydrogenase RF2C              181   5e-50    
dbj|BAJ87654.1|  predicted protein                                      181   6e-50    
ref|XP_005326359.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    181   6e-50    
gb|KIZ05750.1|  aldehyde dehydrogenase (NAD+)                           181   6e-50    
gb|AAL99608.1|AF348412_1  cytosolic aldehyde dehydrogenase RF2C         181   7e-50    
ref|WP_036654086.1|  betaine-aldehyde dehydrogenase                     181   7e-50    
ref|XP_002913100.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    181   7e-50    
gb|KCW82463.1|  hypothetical protein EUGRSUZ_C03853                     179   7e-50    
ref|XP_010049708.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    181   7e-50    
gb|EFB16854.1|  hypothetical protein PANDA_002930                       181   7e-50    
ref|XP_004327205.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    181   7e-50    
ref|WP_008297989.1|  Phenylacetaldehyde dehydrogenase                   181   7e-50    
ref|XP_002914982.2|  PREDICTED: aldehyde dehydrogenase X, mitocho...    181   7e-50    
ref|WP_026562048.1|  betaine-aldehyde dehydrogenase                     180   8e-50    
ref|XP_004631881.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    181   8e-50    
ref|XP_008463376.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    181   8e-50    
ref|NP_001127576.1|  aldehyde dehydrogenase X, mitochondrial prec...    181   9e-50    
ref|WP_004434073.1|  betaine-aldehyde dehydrogenase                     180   9e-50    
ref|XP_004271508.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    181   1e-49    
ref|XP_003629648.1|  Aldehyde dehydrogenase                             180   1e-49    
ref|XP_010925091.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    180   1e-49    
gb|KCW82462.1|  hypothetical protein EUGRSUZ_C03853                     179   1e-49    
ref|WP_028782193.1|  betaine-aldehyde dehydrogenase                     180   1e-49    
ref|WP_034639974.1|  betaine-aldehyde dehydrogenase                     180   1e-49    
ref|XP_008582577.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    180   1e-49    
ref|XP_009234277.1|  PREDICTED: LOW QUALITY PROTEIN: aldehyde deh...    180   1e-49    
gb|EDZ67421.1|  aldehyde dehydrogenase (NAD) family protein             173   1e-49    
gb|EDL98822.1|  rCG55098                                                180   1e-49    
ref|XP_009402158.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    180   1e-49    
ref|XP_006644329.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    180   1e-49    
ref|WP_033674165.1|  betaine-aldehyde dehydrogenase                     174   1e-49    
gb|EJR50331.1|  hypothetical protein IIK_01400                          174   1e-49    
ref|WP_041075921.1|  betaine-aldehyde dehydrogenase                     179   1e-49    
ref|XP_007118627.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    180   1e-49    
ref|XP_004392372.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    180   1e-49    
ref|XP_009402159.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    180   1e-49    
ref|XP_008270467.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    180   1e-49    
ref|WP_006098251.1|  betaine-aldehyde dehydrogenase                     179   1e-49    
ref|XP_006053036.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    181   2e-49    
ref|WP_026573699.1|  betaine-aldehyde dehydrogenase                     179   2e-49    
gb|ABW03290.1|  aldehyde dehydrogenase 1 family, member B1              180   2e-49    
gb|AAH01619.1|  Aldehyde dehydrogenase 1 family, member B1              180   2e-49    
gb|AAP36452.1|  Homo sapiens aldehyde dehydrogenase 1 family, mem...    180   2e-49    
ref|XP_003500134.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    180   2e-49    
sp|P30837.3|AL1B1_HUMAN  RecName: Full=Aldehyde dehydrogenase X, ...    179   2e-49    
ref|XP_004677554.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    179   2e-49    
ref|WP_024094213.1|  putative aldehyde dehydrogenase DhaS               179   2e-49    
ref|XP_009048780.1|  hypothetical protein LOTGIDRAFT_177987             179   2e-49    
ref|WP_017560580.1|  aldehyde dehydrogenase                             173   2e-49    
ref|XP_006451112.1|  hypothetical protein CICLE_v10008077mg             179   2e-49    
pdb|1AG8|A  Chain A, Aldehyde Dehydrogenase From Bovine Mitochondria    179   2e-49    
gb|AIV00511.1|  aldehyde dehydrogenase 2-5                              179   3e-49    
ref|XP_005078799.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    179   3e-49    
gb|ACH63235.1|  alcohol dehydrogenase                                   179   3e-49    
ref|XP_001767457.1|  predicted protein                                  179   3e-49    
ref|XP_006973760.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    179   3e-49    
ref|XP_005883979.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    179   3e-49    
gb|KJB54166.1|  hypothetical protein B456_009G024000                    177   3e-49    
ref|WP_042353774.1|  betaine-aldehyde dehydrogenase                     179   3e-49    
ref|XP_010688156.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    179   3e-49    
ref|XP_003385758.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    177   3e-49    
ref|XP_010049713.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    179   3e-49    
ref|XP_006204897.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    179   3e-49    
ref|XP_003805159.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    179   3e-49    
emb|CAD10505.1|  aldehyde dehydrogenase                                 179   3e-49    
ref|XP_007197093.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    179   4e-49    
ref|NP_001068835.1|  aldehyde dehydrogenase, mitochondrial precursor    179   4e-49    
ref|XP_006096562.1|  PREDICTED: LOW QUALITY PROTEIN: aldehyde deh...    179   4e-49    
dbj|BAK05811.1|  predicted protein                                      179   4e-49    
ref|XP_010049715.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    179   4e-49    
ref|XP_004017458.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    179   4e-49    
ref|XP_007966861.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    179   4e-49    
ref|XP_010254147.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    178   4e-49    
ref|XP_006657096.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    179   4e-49    
ref|NP_001011975.1|  aldehyde dehydrogenase X, mitochondrial prec...    179   5e-49    
emb|CDP12738.1|  unnamed protein product                                179   5e-49    
ref|XP_004287089.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    178   5e-49    
ref|XP_003353634.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    179   5e-49    
ref|XP_005581304.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    179   5e-49    
ref|XP_004395895.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    179   5e-49    
gb|EHH23951.1|  Aldehyde dehydrogenase X, mitochondrial                 179   5e-49    
ref|XP_003911526.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    179   5e-49    
ref|XP_003796031.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    179   5e-49    
gb|EHH57231.1|  Aldehyde dehydrogenase X, mitochondrial                 179   5e-49    
ref|XP_007013215.1|  Aldehyde dehydrogenase 2C4                         178   5e-49    
ref|XP_010368301.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    179   5e-49    
gb|KIE10085.1|  betaine-aldehyde dehydrogenase                          178   5e-49    
gb|KHG07688.1|  Aldehyde dehydrogenase family 2 member C4               178   5e-49    
dbj|BAE30339.1|  unnamed protein product                                179   5e-49    
ref|XP_009336919.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    178   6e-49    
ref|XP_010049714.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    178   6e-49    
ref|WP_029629697.1|  betaine-aldehyde dehydrogenase                     178   6e-49    
ref|XP_006735811.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    178   6e-49    
ref|XP_004753300.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    178   6e-49    
ref|WP_010896716.1|  betaine-aldehyde dehydrogenase                     178   6e-49    
ref|XP_005883980.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    179   6e-49    
ref|WP_026677159.1|  betaine-aldehyde dehydrogenase                     178   6e-49    
gb|EGF24028.1|  aldehyde dehydrogenase 2                                177   6e-49    
gb|ELP34093.1|  retinal dehydrogenase                                   177   7e-49    
ref|XP_010088835.1|  Aldehyde dehydrogenase family 2 member C4          178   7e-49    
ref|WP_038563577.1|  betaine-aldehyde dehydrogenase                     178   7e-49    
ref|XP_010688154.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    178   7e-49    
gb|ACU22687.1|  unknown                                                 172   7e-49    
ref|XP_004635977.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    178   7e-49    
ref|XP_007966855.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    179   8e-49    
ref|XP_007966859.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    179   8e-49    
ref|XP_003761415.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    178   8e-49    
ref|XP_007966858.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    179   9e-49    
ref|XP_006143784.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    178   9e-49    
ref|XP_007152817.1|  hypothetical protein PHAVU_004G162200g             177   9e-49    
ref|XP_006735810.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    178   9e-49    
ref|XP_003569291.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    177   9e-49    
ref|WP_026694659.1|  betaine-aldehyde dehydrogenase                     177   9e-49    
ref|XP_007966860.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    179   1e-48    
ref|WP_017746980.1|  betaine-aldehyde dehydrogenase                     177   1e-48    
gb|AJF41235.1|  mitochondrial aldehyde dehydrogenase 2                  177   1e-48    
ref|XP_011458772.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    177   1e-48    
gb|KHN21546.1|  Aldehyde dehydrogenase family 2 member C4               177   1e-48    
gb|KJB54168.1|  hypothetical protein B456_009G024000                    177   1e-48    
ref|NP_001038076.1|  aldehyde dehydrogenase, mitochondrial precursor    177   1e-48    
ref|XP_011078348.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    177   1e-48    
gb|ACD02422.1|  mitochondrial aldehyde dehydrogenase 2                  177   1e-48    
ref|XP_004251601.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    177   1e-48    
ref|XP_004287091.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    177   1e-48    
ref|XP_008050620.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    177   1e-48    
ref|XP_007201949.1|  hypothetical protein PRUPE_ppa004555mg             177   1e-48    
ref|WP_013082880.1|  MULTISPECIES: betaine-aldehyde dehydrogenase       177   1e-48    
gb|AJI22990.1|  aldehyde dehydrogenase family protein                   177   1e-48    
ref|XP_004658363.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    177   1e-48    
ref|XP_001639716.1|  predicted protein                                  177   1e-48    
ref|WP_020722661.1|  betaine-aldehyde dehydrogenase                     177   1e-48    
ref|XP_005996458.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    177   1e-48    
ref|XP_009627665.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    177   1e-48    
ref|WP_013056742.1|  betaine-aldehyde dehydrogenase                     177   1e-48    
ref|XP_007130063.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    177   2e-48    
gb|KJB54167.1|  hypothetical protein B456_009G024000                    177   2e-48    
ref|WP_026963171.1|  betaine-aldehyde dehydrogenase                     177   2e-48    
ref|XP_005362186.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    177   2e-48    
gb|EPQ18726.1|  Aldehyde dehydrogenase X, mitochondrial                 179   2e-48    
ref|WP_042979097.1|  betaine-aldehyde dehydrogenase                     177   2e-48    
ref|XP_004287088.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    177   2e-48    
ref|NP_082546.1|  aldehyde dehydrogenase X, mitochondrial precursor     177   2e-48    
ref|WP_026576774.1|  betaine-aldehyde dehydrogenase                     177   2e-48    
ref|WP_042355927.1|  betaine-aldehyde dehydrogenase                     177   2e-48    
ref|XP_002110539.1|  expressed hypothetical protein                     176   2e-48    
ref|XP_004910950.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    177   2e-48    
ref|WP_033677838.1|  betaine-aldehyde dehydrogenase                     176   2e-48    
ref|XP_006579386.1|  PREDICTED: uncharacterized protein LOC100527...    177   2e-48    
ref|WP_002172852.1|  MULTISPECIES: betaine-aldehyde dehydrogenase       176   2e-48    



>ref|XP_009617291.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
isoform X2 [Nicotiana tomentosiformis]
Length=535

 Score =   326 bits (836),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 156/189 (83%), Positives = 170/189 (90%), Gaps = 0/189 (0%)
 Frame = +3

Query  111  FPSASAFLGWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTL  290
            FPSASA LG   GV   I RFSTAAAVEE+ +P V+V +T+ +ING+FVDSASGKTFPTL
Sbjct  16   FPSASAPLGRSNGVARHINRFSTAAAVEEVTTPPVQVSFTKLLINGQFVDSASGKTFPTL  75

Query  291  DPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDE  470
            DPRTE+VIA+VAEG+AEDINRAVAAARKAFDEGPWPKMSAYERS+IM KFADLVEKH DE
Sbjct  76   DPRTEEVIANVAEGDAEDINRAVAAARKAFDEGPWPKMSAYERSKIMFKFADLVEKHNDE  135

Query  471  LATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGV  650
            LA LETWDNGKPY QAA++E+P  VRLF YYAGWADKIHGLTVPADGPHHVQTLHEPIGV
Sbjct  136  LAALETWDNGKPYLQAAQAEVPSFVRLFRYYAGWADKIHGLTVPADGPHHVQTLHEPIGV  195

Query  651  AGQIIPWNF  677
            AGQIIPWNF
Sbjct  196  AGQIIPWNF  204



>ref|XP_006345041.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Solanum tuberosum]
Length=535

 Score =   323 bits (827),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 153/189 (81%), Positives = 170/189 (90%), Gaps = 0/189 (0%)
 Frame = +3

Query  111  FPSASAFLGWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTL  290
             PSASA LG  +GV   I RFSTAAAVEEL++P V+V +T+ +ING+FVDSASGKTFPTL
Sbjct  16   LPSASASLGRSHGVARHINRFSTAAAVEELITPPVQVNHTKLLINGQFVDSASGKTFPTL  75

Query  291  DPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDE  470
            DPRT +VIA+VAEG+ ED+NRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKH DE
Sbjct  76   DPRTGEVIANVAEGDLEDVNRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHNDE  135

Query  471  LATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGV  650
            +A LETWDNGKPY QAA++E+P  VRLF YYAGWADKIHGLTVPADGP+HVQTLHEPIGV
Sbjct  136  IAALETWDNGKPYLQAAQAEVPSFVRLFRYYAGWADKIHGLTVPADGPYHVQTLHEPIGV  195

Query  651  AGQIIPWNF  677
            AGQIIPWNF
Sbjct  196  AGQIIPWNF  204



>ref|XP_009617290.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
isoform X1 [Nicotiana tomentosiformis]
Length=536

 Score =   322 bits (825),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 156/190 (82%), Positives = 170/190 (89%), Gaps = 1/190 (1%)
 Frame = +3

Query  111  FPSASAFL-GWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPT  287
            FPSASA L G   GV   I RFSTAAAVEE+ +P V+V +T+ +ING+FVDSASGKTFPT
Sbjct  16   FPSASAPLAGRSNGVARHINRFSTAAAVEEVTTPPVQVSFTKLLINGQFVDSASGKTFPT  75

Query  288  LDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMD  467
            LDPRTE+VIA+VAEG+AEDINRAVAAARKAFDEGPWPKMSAYERS+IM KFADLVEKH D
Sbjct  76   LDPRTEEVIANVAEGDAEDINRAVAAARKAFDEGPWPKMSAYERSKIMFKFADLVEKHND  135

Query  468  ELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIG  647
            ELA LETWDNGKPY QAA++E+P  VRLF YYAGWADKIHGLTVPADGPHHVQTLHEPIG
Sbjct  136  ELAALETWDNGKPYLQAAQAEVPSFVRLFRYYAGWADKIHGLTVPADGPHHVQTLHEPIG  195

Query  648  VAGQIIPWNF  677
            VAGQIIPWNF
Sbjct  196  VAGQIIPWNF  205



>ref|XP_004236119.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial 
[Solanum lycopersicum]
Length=535

 Score =   320 bits (819),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 150/188 (80%), Positives = 168/188 (89%), Gaps = 0/188 (0%)
 Frame = +3

Query  114  PSASAFLGWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLD  293
            PS SA LG  +GV   I RFSTAAAVEE+++P V++ +T+ +ING+FVDSASGKTFPTLD
Sbjct  17   PSVSASLGRSHGVARHINRFSTAAAVEEIITPPVQINHTKLLINGQFVDSASGKTFPTLD  76

Query  294  PRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDEL  473
            PRT +VIA+VAEG+ ED+NRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKH DE+
Sbjct  77   PRTGEVIANVAEGDLEDVNRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHNDEI  136

Query  474  ATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVA  653
            A LETWDNGKPY QAA++E+P  VRLF YYAGWADKIHGLTVPADGPHHVQ LHEPIGVA
Sbjct  137  AALETWDNGKPYLQAAQAEVPSFVRLFRYYAGWADKIHGLTVPADGPHHVQILHEPIGVA  196

Query  654  GQIIPWNF  677
            GQIIPWNF
Sbjct  197  GQIIPWNF  204



>ref|XP_011071828.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial 
[Sesamum indicum]
Length=536

 Score =   317 bits (813),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 147/190 (77%), Positives = 168/190 (88%), Gaps = 1/190 (1%)
 Frame = +3

Query  111  FPSASAFLGWKYGV-ESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPT  287
             P++ A L  KYG+   G+QR++TA  +EE ++P V+V YT+ +ING+FVDSASGKTFPT
Sbjct  16   LPTSPASLARKYGLWGRGMQRYTTATVLEEPITPPVQVNYTKLLINGQFVDSASGKTFPT  75

Query  288  LDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMD  467
            LDPRT +VIAHVAEG+ ED+NRAV+AARKAFDEGPWPKMSAYERSRI+L+FADLVEKHM 
Sbjct  76   LDPRTGEVIAHVAEGDVEDVNRAVSAARKAFDEGPWPKMSAYERSRIILRFADLVEKHMQ  135

Query  468  ELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIG  647
            ELA LETWDNGKPYEQA  +ELP+ VRLFHYYAGWADKIHGLTVPADGPHHVQ LHEPIG
Sbjct  136  ELAQLETWDNGKPYEQALTAELPLFVRLFHYYAGWADKIHGLTVPADGPHHVQVLHEPIG  195

Query  648  VAGQIIPWNF  677
            VAGQIIPWNF
Sbjct  196  VAGQIIPWNF  205



>emb|CDP18933.1| unnamed protein product [Coffea canephora]
Length=534

 Score =   317 bits (812),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 149/187 (80%), Positives = 166/187 (89%), Gaps = 1/187 (1%)
 Frame = +3

Query  120  ASAFLGWKYGVESGIQRFSTA-AAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDP  296
            +S+F G  YGV SG+ RFSTA AAVEE +SP V++ YT+ +ING+FVDSASGKTFPTLDP
Sbjct  17   SSSFRGANYGVVSGMNRFSTATAAVEEPISPPVQINYTKLLINGQFVDSASGKTFPTLDP  76

Query  297  RTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELA  476
            RT +VIAHVAEG+ EDINRAV+AARKAFDEGPWPKM AYER+R++L+FADLVEKH DELA
Sbjct  77   RTGEVIAHVAEGDTEDINRAVSAARKAFDEGPWPKMPAYERARVLLRFADLVEKHSDELA  136

Query  477  TLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAG  656
             LETWDNGK YEQAA +ELP  VRLFHYYAGWADKIHGLT PADGPHHVQ LHEPIGVAG
Sbjct  137  ALETWDNGKTYEQAATAELPTFVRLFHYYAGWADKIHGLTAPADGPHHVQILHEPIGVAG  196

Query  657  QIIPWNF  677
            QIIPWNF
Sbjct  197  QIIPWNF  203



>ref|XP_010028184.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Eucalyptus grandis]
 gb|KCW83434.1| hypothetical protein EUGRSUZ_B00357 [Eucalyptus grandis]
Length=534

 Score =   317 bits (811),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 146/181 (81%), Positives = 165/181 (91%), Gaps = 0/181 (0%)
 Frame = +3

Query  135  GWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVI  314
            G  +GV S I R+STAAAVEEL+SP V++ YTQH+ING FVD+ASG+TFPT DPRT DV+
Sbjct  23   GRNHGVGSSISRYSTAAAVEELISPPVQISYTQHLINGHFVDAASGRTFPTYDPRTGDVL  82

Query  315  AHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWD  494
            AHVAEG+A+DI+RAVAAARKAFDEGPWPKM+AYERSRI+L+FADLVEKH DELA LETW+
Sbjct  83   AHVAEGDAKDIDRAVAAARKAFDEGPWPKMTAYERSRILLRFADLVEKHNDELAALETWN  142

Query  495  NGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWN  674
             GKPYEQ+AKSELPM+ RLF YYAGWADKIHGLTVPADG +HVQTLHEPIGVAGQIIPWN
Sbjct  143  CGKPYEQSAKSELPMLARLFRYYAGWADKIHGLTVPADGNYHVQTLHEPIGVAGQIIPWN  202

Query  675  F  677
            F
Sbjct  203  F  203



>gb|KJB53132.1| hypothetical protein B456_008G294300 [Gossypium raimondii]
Length=451

 Score =   310 bits (795),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 142/171 (83%), Positives = 162/171 (95%), Gaps = 0/171 (0%)
 Frame = +3

Query  165  QRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAED  344
            +RFSTAAA+E+L+ P V++ YTQ++I+GKFVD+ASGKTFPT DPRT DVIA+VAEG+AED
Sbjct  40   KRFSTAAALEDLIVPPVQIAYTQNLIDGKFVDAASGKTFPTYDPRTGDVIANVAEGDAED  99

Query  345  INRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAK  524
            I+RAVAAARKAFDEGPWPKM+ YERSRIML+FADLVEKH +ELA LETW+NGKP+EQ+AK
Sbjct  100  IDRAVAAARKAFDEGPWPKMTPYERSRIMLRFADLVEKHSEELAALETWNNGKPHEQSAK  159

Query  525  SELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            SELPM +RLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF
Sbjct  160  SELPMFIRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  210



>gb|AFK41217.1| unknown [Lotus japonicus]
Length=543

 Score =   313 bits (802),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 144/181 (80%), Positives = 163/181 (90%), Gaps = 3/181 (2%)
 Frame = +3

Query  135  GWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVI  314
            GW+    S   R+STAA VEEL++P V + YTQH+INGKFVD+ASGKTFP  DPRT DVI
Sbjct  35   GWR---NSNSHRYSTAAEVEELITPQVSINYTQHLINGKFVDAASGKTFPAYDPRTGDVI  91

Query  315  AHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWD  494
            AHVAEG+AED+NRAVAAARKAFDEGPWP+M+AYERSRI+L+FADLVEKH DE+A LETW+
Sbjct  92   AHVAEGDAEDVNRAVAAARKAFDEGPWPRMTAYERSRILLRFADLVEKHNDEIAALETWN  151

Query  495  NGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWN  674
            NGKPYEQAAK+E+PM+VRLF YYAGWADKIHGLTVPADG +HVQTLHEPIGVAGQIIPWN
Sbjct  152  NGKPYEQAAKAEVPMLVRLFRYYAGWADKIHGLTVPADGNYHVQTLHEPIGVAGQIIPWN  211

Query  675  F  677
            F
Sbjct  212  F  212



>gb|AFW86313.1| restorer of fertility2 [Zea mays]
Length=459

 Score =   310 bits (793),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 143/172 (83%), Positives = 158/172 (92%), Gaps = 0/172 (0%)
 Frame = +3

Query  162  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  341
            +QRFSTAAAVEE ++P+V V YT+ +ING FVDSASGKTFPTLDPRT +VIAHVAEG+AE
Sbjct  47   LQRFSTAAAVEEPITPSVHVNYTKLLINGNFVDSASGKTFPTLDPRTGEVIAHVAEGDAE  106

Query  342  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  521
            DINRAVAAARKAFDEGPWPKM+AYERSRI+L+FADL+EKH DELA LETWDNGKPYEQAA
Sbjct  107  DINRAVAAARKAFDEGPWPKMTAYERSRILLRFADLIEKHNDELAALETWDNGKPYEQAA  166

Query  522  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            + E+PM+ RL  YYAGWADKIHGL VPADGPHHVQ LHEPIGVAGQIIPWNF
Sbjct  167  QIEVPMVARLMRYYAGWADKIHGLIVPADGPHHVQILHEPIGVAGQIIPWNF  218



>gb|AAK58370.1|AF269064_1 T-cytoplasm male sterility restorer factor 2 [Zea mays]
Length=549

 Score =   311 bits (796),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 143/172 (83%), Positives = 158/172 (92%), Gaps = 0/172 (0%)
 Frame = +3

Query  162  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  341
            +QRFSTAAAVEE ++P+V V YT+ +ING FVDSASGKTFPTLDPRT +VIAHVAEG+AE
Sbjct  47   LQRFSTAAAVEEPITPSVHVNYTKLLINGNFVDSASGKTFPTLDPRTGEVIAHVAEGDAE  106

Query  342  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  521
            DINRAVAAARKAFDEGPWPKM+AYERSRI+L+FADL+EKH DELA LETWDNGKPYEQAA
Sbjct  107  DINRAVAAARKAFDEGPWPKMTAYERSRILLRFADLIEKHNDELAALETWDNGKPYEQAA  166

Query  522  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            + E+PM+ RL  YYAGWADKIHGL VPADGPHHVQ LHEPIGVAGQIIPWNF
Sbjct  167  QIEVPMVARLMRYYAGWADKIHGLIVPADGPHHVQILHEPIGVAGQIIPWNF  218



>gb|KJB53131.1| hypothetical protein B456_008G294300 [Gossypium raimondii]
Length=541

 Score =   310 bits (795),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 142/171 (83%), Positives = 162/171 (95%), Gaps = 0/171 (0%)
 Frame = +3

Query  165  QRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAED  344
            +RFSTAAA+E+L+ P V++ YTQ++I+GKFVD+ASGKTFPT DPRT DVIA+VAEG+AED
Sbjct  40   KRFSTAAALEDLIVPPVQIAYTQNLIDGKFVDAASGKTFPTYDPRTGDVIANVAEGDAED  99

Query  345  INRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAK  524
            I+RAVAAARKAFDEGPWPKM+ YERSRIML+FADLVEKH +ELA LETW+NGKP+EQ+AK
Sbjct  100  IDRAVAAARKAFDEGPWPKMTPYERSRIMLRFADLVEKHSEELAALETWNNGKPHEQSAK  159

Query  525  SELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            SELPM +RLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF
Sbjct  160  SELPMFIRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  210



>gb|KJB53133.1| hypothetical protein B456_008G294300 [Gossypium raimondii]
Length=530

 Score =   310 bits (795),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 142/171 (83%), Positives = 162/171 (95%), Gaps = 0/171 (0%)
 Frame = +3

Query  165  QRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAED  344
            +RFSTAAA+E+L+ P V++ YTQ++I+GKFVD+ASGKTFPT DPRT DVIA+VAEG+AED
Sbjct  40   KRFSTAAALEDLIVPPVQIAYTQNLIDGKFVDAASGKTFPTYDPRTGDVIANVAEGDAED  99

Query  345  INRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAK  524
            I+RAVAAARKAFDEGPWPKM+ YERSRIML+FADLVEKH +ELA LETW+NGKP+EQ+AK
Sbjct  100  IDRAVAAARKAFDEGPWPKMTPYERSRIMLRFADLVEKHSEELAALETWNNGKPHEQSAK  159

Query  525  SELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            SELPM +RLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF
Sbjct  160  SELPMFIRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  210



>ref|NP_001105891.1| mitochondrial aldehyde dehydrogenase 2 [Zea mays]
 gb|AAG43988.1|AF215823_1 T cytoplasm male sterility restorer factor 2 [Zea mays]
 gb|AAC49371.1| RF2 [Zea mays]
 gb|ACG38026.1| aldehyde dehydrogenase [Zea mays]
 gb|ACN28554.1| unknown [Zea mays]
 gb|AFW86312.1| restorer of fertility2 [Zea mays]
Length=549

 Score =   311 bits (796),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 143/172 (83%), Positives = 158/172 (92%), Gaps = 0/172 (0%)
 Frame = +3

Query  162  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  341
            +QRFSTAAAVEE ++P+V V YT+ +ING FVDSASGKTFPTLDPRT +VIAHVAEG+AE
Sbjct  47   LQRFSTAAAVEEPITPSVHVNYTKLLINGNFVDSASGKTFPTLDPRTGEVIAHVAEGDAE  106

Query  342  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  521
            DINRAVAAARKAFDEGPWPKM+AYERSRI+L+FADL+EKH DELA LETWDNGKPYEQAA
Sbjct  107  DINRAVAAARKAFDEGPWPKMTAYERSRILLRFADLIEKHNDELAALETWDNGKPYEQAA  166

Query  522  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            + E+PM+ RL  YYAGWADKIHGL VPADGPHHVQ LHEPIGVAGQIIPWNF
Sbjct  167  QIEVPMVARLMRYYAGWADKIHGLIVPADGPHHVQILHEPIGVAGQIIPWNF  218



>gb|AHM26656.1| aldehyde dehydrogenase 2-1 [Zea mays subsp. mays]
Length=549

 Score =   310 bits (795),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 143/172 (83%), Positives = 158/172 (92%), Gaps = 0/172 (0%)
 Frame = +3

Query  162  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  341
            +QRFSTAAAVEE ++P+V V YT+ +ING FVDSASGKTFPTLDPRT +VIAHVAEG+AE
Sbjct  47   LQRFSTAAAVEEPITPSVHVNYTKLLINGNFVDSASGKTFPTLDPRTGEVIAHVAEGDAE  106

Query  342  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  521
            DINRAVAAARKAFDEGPWPKM+AYERSRI+L+FADL+EKH DELA LETWDNGKPYEQAA
Sbjct  107  DINRAVAAARKAFDEGPWPKMTAYERSRILLRFADLIEKHNDELAALETWDNGKPYEQAA  166

Query  522  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            + E+PM+ RL  YYAGWADKIHGL VPADGPHHVQ LHEPIGVAGQIIPWNF
Sbjct  167  QIEVPMVARLMRYYAGWADKIHGLIVPADGPHHVQILHEPIGVAGQIIPWNF  218



>gb|KHN18468.1| Aldehyde dehydrogenase family 2 member B4, mitochondrial [Glycine 
soja]
Length=542

 Score =   310 bits (795),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 144/181 (80%), Positives = 163/181 (90%), Gaps = 5/181 (3%)
 Frame = +3

Query  135  GWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVI  314
            GW+      I RFSTAAAVEEL++P V ++YTQ++ING+FVD+ASGKTFPT DPR+ +VI
Sbjct  36   GWR-----NINRFSTAAAVEELITPQVSIRYTQNLINGQFVDAASGKTFPTYDPRSGEVI  90

Query  315  AHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWD  494
            A VAEG+ EDINRAV+AARKAFDEGPWPKM+AYERSRI+L+FADLVEKH DELA LETW+
Sbjct  91   AKVAEGDVEDINRAVSAARKAFDEGPWPKMTAYERSRILLRFADLVEKHSDELAALETWN  150

Query  495  NGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWN  674
            NGK YEQAAK+ELPM VRLFHYYAGWADKIHGLTVPADG +HVQTLHEPIGVAGQIIPWN
Sbjct  151  NGKTYEQAAKTELPMFVRLFHYYAGWADKIHGLTVPADGDYHVQTLHEPIGVAGQIIPWN  210

Query  675  F  677
            F
Sbjct  211  F  211



>ref|XP_007155410.1| hypothetical protein PHAVU_003G199100g [Phaseolus vulgaris]
 gb|ESW27404.1| hypothetical protein PHAVU_003G199100g [Phaseolus vulgaris]
Length=535

 Score =   310 bits (794),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 140/172 (81%), Positives = 161/172 (94%), Gaps = 0/172 (0%)
 Frame = +3

Query  162  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  341
            I RFSTAAAVE+L++P V ++YTQH+ING+FVD+ASGKTFP  DPR+ +VIA+VAEG+ E
Sbjct  33   INRFSTAAAVEDLITPQVPIRYTQHLINGQFVDAASGKTFPAYDPRSGEVIANVAEGDVE  92

Query  342  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  521
            DINRAV+AARKAFDEGPWPKM+AYERSRI+L+FADLVEKH DELA LETW+NGKP+EQAA
Sbjct  93   DINRAVSAARKAFDEGPWPKMTAYERSRILLRFADLVEKHSDELAALETWNNGKPFEQAA  152

Query  522  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            KSELP+ VRLFHYYAGWADKIHGLTVPADG +HVQTLHEP+GVAGQIIPWNF
Sbjct  153  KSELPLFVRLFHYYAGWADKIHGLTVPADGDYHVQTLHEPVGVAGQIIPWNF  204



>ref|XP_007155411.1| hypothetical protein PHAVU_003G199100g [Phaseolus vulgaris]
 gb|ESW27405.1| hypothetical protein PHAVU_003G199100g [Phaseolus vulgaris]
Length=536

 Score =   310 bits (794),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 140/172 (81%), Positives = 161/172 (94%), Gaps = 0/172 (0%)
 Frame = +3

Query  162  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  341
            I RFSTAAAVE+L++P V ++YTQH+ING+FVD+ASGKTFP  DPR+ +VIA+VAEG+ E
Sbjct  34   INRFSTAAAVEDLITPQVPIRYTQHLINGQFVDAASGKTFPAYDPRSGEVIANVAEGDVE  93

Query  342  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  521
            DINRAV+AARKAFDEGPWPKM+AYERSRI+L+FADLVEKH DELA LETW+NGKP+EQAA
Sbjct  94   DINRAVSAARKAFDEGPWPKMTAYERSRILLRFADLVEKHSDELAALETWNNGKPFEQAA  153

Query  522  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            KSELP+ VRLFHYYAGWADKIHGLTVPADG +HVQTLHEP+GVAGQIIPWNF
Sbjct  154  KSELPLFVRLFHYYAGWADKIHGLTVPADGDYHVQTLHEPVGVAGQIIPWNF  205



>dbj|BAB92019.1| mitochondrial aldehyde dehydrogenase [Sorghum bicolor]
Length=547

 Score =   309 bits (792),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 142/172 (83%), Positives = 158/172 (92%), Gaps = 0/172 (0%)
 Frame = +3

Query  162  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  341
            +QRFSTAAAVEE ++P+V+V YT+ +ING FVD+ASGKTFPTLDPRT +VIAHVAEG+AE
Sbjct  45   LQRFSTAAAVEEPITPSVQVNYTKLLINGNFVDAASGKTFPTLDPRTGEVIAHVAEGDAE  104

Query  342  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  521
            DINRAVAAARKAFDEGPWPKM+AYERSRI+L+FADL+EKH DELA LETWDNGKPYEQAA
Sbjct  105  DINRAVAAARKAFDEGPWPKMTAYERSRILLRFADLIEKHNDELAALETWDNGKPYEQAA  164

Query  522  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
              E+PM+ RL  YYAGWADKIHGL VPADGPHHVQ LHEPIGVAGQIIPWNF
Sbjct  165  HIEVPMVARLMRYYAGWADKIHGLVVPADGPHHVQILHEPIGVAGQIIPWNF  216



>gb|KDP26565.1| hypothetical protein JCGZ_17723 [Jatropha curcas]
Length=537

 Score =   309 bits (791),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 146/189 (77%), Positives = 164/189 (87%), Gaps = 2/189 (1%)
 Frame = +3

Query  117  SASAFL--GWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTL  290
            S SA    G    +  GI R+STAAAVEE + P+V V +TQ +ING+FVD+ASGKTFPTL
Sbjct  18   SGSALFSRGSNSSLARGISRYSTAAAVEEPIVPSVSVSHTQLLINGQFVDAASGKTFPTL  77

Query  291  DPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDE  470
            DPRT +VIAHVAEG+ EDINRAV+AARKAFDEGPWPKM+AYERSRIML+FADL+E H DE
Sbjct  78   DPRTGEVIAHVAEGDVEDINRAVSAARKAFDEGPWPKMTAYERSRIMLRFADLLEMHNDE  137

Query  471  LATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGV  650
            +A LETWDNGKPYEQAAK+E+PM+ RLF YYAGWADKIHGLTVPADG HHVQTLHEPIGV
Sbjct  138  IAALETWDNGKPYEQAAKAEIPMVARLFRYYAGWADKIHGLTVPADGQHHVQTLHEPIGV  197

Query  651  AGQIIPWNF  677
            AGQIIPWNF
Sbjct  198  AGQIIPWNF  206



>gb|AAO72532.1| aldehyde dehydrogenase 1 precursor [Lotus corniculatus]
Length=542

 Score =   308 bits (790),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 142/181 (78%), Positives = 161/181 (89%), Gaps = 4/181 (2%)
 Frame = +3

Query  135  GWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVI  314
            GW+    +   R+STAA VEEL++P V + YTQH+INGKFVD+ASGKTFP  DPRT DVI
Sbjct  35   GWR----NSNNRYSTAAVVEELITPQVSINYTQHLINGKFVDAASGKTFPAYDPRTGDVI  90

Query  315  AHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWD  494
            AHVAEG+AED+NRAVAAARKAFDEGPWP+M+AYERSRI+L+FADLVEKH DE+A LETW+
Sbjct  91   AHVAEGDAEDVNRAVAAARKAFDEGPWPRMTAYERSRILLRFADLVEKHNDEIAALETWN  150

Query  495  NGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWN  674
            NGKPYEQAAK+E+P  VRLF YYAGWADKIHGLTVPADG +HVQTLHEPIGVAGQIIPWN
Sbjct  151  NGKPYEQAAKAEVPTFVRLFRYYAGWADKIHGLTVPADGNYHVQTLHEPIGVAGQIIPWN  210

Query  675  F  677
            F
Sbjct  211  F  211



>ref|XP_009363534.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Pyrus x bretschneideri]
Length=534

 Score =   308 bits (788),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 143/190 (75%), Positives = 167/190 (88%), Gaps = 1/190 (1%)
 Frame = +3

Query  111  FPSASAFL-GWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPT  287
            F SAS F  G    V  GI ++ST A++E  +SP+V+V YTQ +ING+FVDSASGKTFPT
Sbjct  14   FTSASMFSKGRSSSVVRGIGKYSTDASIESPISPSVKVNYTQLLINGQFVDSASGKTFPT  73

Query  288  LDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMD  467
            LDPRT +VIAHVAEG+AED+NRAV+AARKAFDEGPWPKM+AYERSR++L+FADL+EKH D
Sbjct  74   LDPRTGEVIAHVAEGDAEDVNRAVSAARKAFDEGPWPKMTAYERSRVLLRFADLIEKHND  133

Query  468  ELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIG  647
            E+A LETWDNGKP+EQAAK E+PM+VR F YYAG+ADKIHGLTVPADG +HVQTLHEPIG
Sbjct  134  EIAALETWDNGKPFEQAAKIEVPMVVRFFRYYAGFADKIHGLTVPADGEYHVQTLHEPIG  193

Query  648  VAGQIIPWNF  677
            VAGQIIPWNF
Sbjct  194  VAGQIIPWNF  203



>ref|XP_003608978.1| Mitochondrial aldehyde dehydrogenase [Medicago truncatula]
Length=544

 Score =   307 bits (787),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 140/171 (82%), Positives = 157/171 (92%), Gaps = 0/171 (0%)
 Frame = +3

Query  165  QRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAED  344
             RFSTAAAV+EL++P V + YTQH+INGKFVD+ASGKTFPTLDPRT +VIAHVAEG+AED
Sbjct  43   NRFSTAAAVQELITPQVSINYTQHLINGKFVDAASGKTFPTLDPRTGEVIAHVAEGDAED  102

Query  345  INRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAK  524
            INRAV+AAR+AFD GPWPKMSAYER RI+L+FADLVEKH DE+A LE W+NGK YEQAAK
Sbjct  103  INRAVSAAREAFDNGPWPKMSAYERCRILLRFADLVEKHNDEIAALEAWNNGKLYEQAAK  162

Query  525  SELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            +E+PM VRLF YYAGWADKIHGLTVPADG +HVQTLHEPIGVAGQIIPWNF
Sbjct  163  AEVPMFVRLFRYYAGWADKIHGLTVPADGDYHVQTLHEPIGVAGQIIPWNF  213



>ref|XP_010101190.1| Aldehyde dehydrogenase family 2 member [Morus notabilis]
 gb|EXB87864.1| Aldehyde dehydrogenase family 2 member [Morus notabilis]
Length=546

 Score =   307 bits (787),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 141/174 (81%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = +3

Query  156  SGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGE  335
            + I RFST+ A EE + P VE+ YT+H+ING FVD+ASGKTFPT DPRTE+VIAHVAEG+
Sbjct  42   NSITRFSTSVAAEEAIIPPVEIAYTKHLINGHFVDAASGKTFPTYDPRTEEVIAHVAEGD  101

Query  336  AEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQ  515
            AEDINRAVAAARKAFDEGPWPKM+AYERSRIML+FADLVEKH DE+A LETW+NGKPYEQ
Sbjct  102  AEDINRAVAAARKAFDEGPWPKMTAYERSRIMLRFADLVEKHNDEIAALETWNNGKPYEQ  161

Query  516  AAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            AA SE+PM+ RLF YYAGWADKIHGLTVPADG +HVQTLHEPIGV GQIIPWNF
Sbjct  162  AATSEVPMLARLFRYYAGWADKIHGLTVPADGKYHVQTLHEPIGVTGQIIPWNF  215



>ref|XP_007210569.1| hypothetical protein PRUPE_ppa003869mg [Prunus persica]
 gb|EMJ11768.1| hypothetical protein PRUPE_ppa003869mg [Prunus persica]
Length=543

 Score =   307 bits (787),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 140/172 (81%), Positives = 159/172 (92%), Gaps = 0/172 (0%)
 Frame = +3

Query  162  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  341
            + RFSTAAA EEL+ P V++ +TQH+ING+FVD+ASGKTFPT DPRT +VIAHVAEG+AE
Sbjct  41   VNRFSTAAATEELIIPPVQISHTQHLINGQFVDAASGKTFPTYDPRTGEVIAHVAEGDAE  100

Query  342  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  521
            DINRAVAAARKAFDEGPWPKMSAYERSRI+L+FADLVEKH +ELA LETW+NGKPYEQA 
Sbjct  101  DINRAVAAARKAFDEGPWPKMSAYERSRILLRFADLVEKHSEELAALETWNNGKPYEQAL  160

Query  522  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
             +E+PM+ RLFHYYAGWADKIHGLTVPADG +H+QTLHEPIGVAGQIIPWNF
Sbjct  161  HAEIPMLARLFHYYAGWADKIHGLTVPADGKYHIQTLHEPIGVAGQIIPWNF  212



>ref|XP_008374451.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial 
[Malus domestica]
Length=539

 Score =   306 bits (785),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 141/172 (82%), Positives = 158/172 (92%), Gaps = 0/172 (0%)
 Frame = +3

Query  162  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  341
            + RFSTAAA EEL+ P V++ +TQH+INGKFVD+ASGKTFP  DPRT +VIAHVAEG+AE
Sbjct  37   VSRFSTAAATEELIIPPVQISHTQHLINGKFVDAASGKTFPAYDPRTGEVIAHVAEGDAE  96

Query  342  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  521
            DINRAVAAARKAFDEGPWPKMSAYERSRI+L+FADLVEK+ +ELA LETW+NGK YEQA 
Sbjct  97   DINRAVAAARKAFDEGPWPKMSAYERSRILLRFADLVEKNSEELAALETWNNGKTYEQAL  156

Query  522  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
             +ELPM+ RLFHYYAGWADKIHGLTVPADGP+HVQTLHEPIGVAGQIIPWNF
Sbjct  157  TAELPMLARLFHYYAGWADKIHGLTVPADGPYHVQTLHEPIGVAGQIIPWNF  208



>gb|AES91175.2| NAD-dependent aldehyde dehydrogenase family protein [Medicago 
truncatula]
Length=544

 Score =   306 bits (785),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 140/171 (82%), Positives = 157/171 (92%), Gaps = 0/171 (0%)
 Frame = +3

Query  165  QRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAED  344
             RFSTAAAV+EL++P V + YTQH+INGKFVD+ASGKTFPTLDPRT +VIAHVAEG+AED
Sbjct  43   NRFSTAAAVQELITPQVSINYTQHLINGKFVDAASGKTFPTLDPRTGEVIAHVAEGDAED  102

Query  345  INRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAK  524
            INRAV+AAR+AFD GPWPKMSAYER RI+L+FADLVEKH DE+A LE W+NGK YEQAAK
Sbjct  103  INRAVSAAREAFDNGPWPKMSAYERCRILLRFADLVEKHNDEIAALEAWNNGKLYEQAAK  162

Query  525  SELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            +E+PM VRLF YYAGWADKIHGLTVPADG +HVQTLHEPIGVAGQIIPWNF
Sbjct  163  AEVPMFVRLFRYYAGWADKIHGLTVPADGDYHVQTLHEPIGVAGQIIPWNF  213



>ref|XP_008239742.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial 
[Prunus mume]
Length=537

 Score =   306 bits (785),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 140/172 (81%), Positives = 158/172 (92%), Gaps = 0/172 (0%)
 Frame = +3

Query  162  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  341
            + RFSTAAA EEL+ P V++ +TQH+ING+FVD+ASGKTFP  DPRT +VIAHVAEG+AE
Sbjct  35   VNRFSTAAATEELIIPPVQISHTQHLINGQFVDAASGKTFPAYDPRTGEVIAHVAEGDAE  94

Query  342  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  521
            DINRAVAAARKAFDEGPWPKMSAYERSRI+L+FADLVEKH +ELA LETW+NGKPYEQA 
Sbjct  95   DINRAVAAARKAFDEGPWPKMSAYERSRILLRFADLVEKHSEELAALETWNNGKPYEQAL  154

Query  522  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
             +ELPM+ RLFHYYAGWADKIHGLTVPADG +H+QTLHEPIGVAGQIIPWNF
Sbjct  155  HAELPMLARLFHYYAGWADKIHGLTVPADGKYHIQTLHEPIGVAGQIIPWNF  206



>gb|AAZ79355.1| aldehyde dehydrogenase [Vitis pseudoreticulata]
Length=537

 Score =   306 bits (784),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 143/183 (78%), Positives = 161/183 (88%), Gaps = 1/183 (1%)
 Frame = +3

Query  132  LGWKYGVESGIQRFSTAAA-VEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTED  308
            LG  +     I RFSTAAA VEEL++P V++ YTQ +ING+FVD+ASGKTFPT DPRT +
Sbjct  24   LGKNFNRGKSIHRFSTAAAAVEELITPTVQINYTQLLINGQFVDAASGKTFPTFDPRTGE  83

Query  309  VIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLET  488
            VIA+VAEG+AEDINRAV+AARKAFDEGPWP+MS YERSRI+L+FADL EKH DELA LET
Sbjct  84   VIANVAEGDAEDINRAVSAARKAFDEGPWPRMSPYERSRILLRFADLAEKHNDELAALET  143

Query  489  WDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIP  668
            W+NGKPYEQAAK+ELP+ VRLF YYAGWADKIHGLTV ADGPHHVQ LHEPIGVAGQIIP
Sbjct  144  WNNGKPYEQAAKAELPLFVRLFRYYAGWADKIHGLTVQADGPHHVQILHEPIGVAGQIIP  203

Query  669  WNF  677
            WNF
Sbjct  204  WNF  206



>ref|XP_002283132.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial 
[Vitis vinifera]
 emb|CBI15054.3| unnamed protein product [Vitis vinifera]
Length=538

 Score =   306 bits (784),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 143/184 (78%), Positives = 161/184 (88%), Gaps = 2/184 (1%)
 Frame = +3

Query  132  LGWKYGVESGIQRFSTAAA--VEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTE  305
            LG  +     I RFSTAAA  VEEL++P V++ YTQ +ING+FVD+ASGKTFPT DPRT 
Sbjct  24   LGKNFNRGKSIHRFSTAAAAAVEELITPTVQINYTQLLINGQFVDAASGKTFPTFDPRTG  83

Query  306  DVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLE  485
            +VIA+VAEG+AEDINRAV+AARKAFDEGPWP+MS YERSRI+L+FADL EKH DELA LE
Sbjct  84   EVIANVAEGDAEDINRAVSAARKAFDEGPWPRMSPYERSRILLRFADLAEKHNDELAALE  143

Query  486  TWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQII  665
            TW+NGKPYEQAAK+ELP+ VRLF YYAGWADKIHGLTV ADGPHHVQ LHEPIGVAGQII
Sbjct  144  TWNNGKPYEQAAKAELPLFVRLFRYYAGWADKIHGLTVQADGPHHVQILHEPIGVAGQII  203

Query  666  PWNF  677
            PWNF
Sbjct  204  PWNF  207



>ref|XP_010251301.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Nelumbo nucifera]
Length=534

 Score =   306 bits (783),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 140/182 (77%), Positives = 162/182 (89%), Gaps = 0/182 (0%)
 Frame = +3

Query  132  LGWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDV  311
            LG       GI RFSTA A EE+++P V+V++TQ +ING+FVD+ASG+TFPTLDPRT +V
Sbjct  22   LGRNSSWSRGIYRFSTATATEEVITPPVQVEHTQLLINGQFVDAASGRTFPTLDPRTGEV  81

Query  312  IAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETW  491
            IAHVAEGE EDINRAV+AARKAFDEGPWPKM+AYERSRI+ +FADL+EKH DE+A +ETW
Sbjct  82   IAHVAEGEDEDINRAVSAARKAFDEGPWPKMTAYERSRIIYRFADLLEKHNDEIAAIETW  141

Query  492  DNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPW  671
            DNGKPYEQ+AK E+PM+ RLF YYAGWADKIHGLTVPADGP+HVQTLHEPIGVAGQIIPW
Sbjct  142  DNGKPYEQSAKVEIPMLTRLFRYYAGWADKIHGLTVPADGPYHVQTLHEPIGVAGQIIPW  201

Query  672  NF  677
            NF
Sbjct  202  NF  203



>emb|CAN63005.1| hypothetical protein VITISV_013710 [Vitis vinifera]
Length=538

 Score =   306 bits (783),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 143/184 (78%), Positives = 161/184 (88%), Gaps = 2/184 (1%)
 Frame = +3

Query  132  LGWKYGVESGIQRFSTAAA--VEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTE  305
            LG  +     I RFSTAAA  VEEL++P V++ YTQ +ING+FVD+ASGKTFPT DPRT 
Sbjct  24   LGKNFNRGKSIHRFSTAAAAAVEELITPTVQINYTQLLINGQFVDAASGKTFPTFDPRTG  83

Query  306  DVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLE  485
            +VIA+VAEG+AEDINRAV+AARKAFDEGPWP+MS YERSRI+L+FADL EKH DELA LE
Sbjct  84   EVIANVAEGDAEDINRAVSAARKAFDEGPWPRMSPYERSRILLRFADLAEKHNDELAALE  143

Query  486  TWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQII  665
            TW+NGKPYEQAAK+ELP+ VRLF YYAGWADKIHGLTV ADGPHHVQ LHEPIGVAGQII
Sbjct  144  TWNNGKPYEQAAKAELPLFVRLFRYYAGWADKIHGLTVQADGPHHVQILHEPIGVAGQII  203

Query  666  PWNF  677
            PWNF
Sbjct  204  PWNF  207



>gb|KHG08400.1| Aldehyde dehydrogenase family 2 member B4, mitochondrial [Gossypium 
arboreum]
Length=540

 Score =   306 bits (783),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 141/171 (82%), Positives = 160/171 (94%), Gaps = 0/171 (0%)
 Frame = +3

Query  165  QRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAED  344
            +RFSTAAA+E+L+ P V++ YTQ++I+GKFVD+ASGKTFPT DPRT DVIA+VAEG+AED
Sbjct  39   KRFSTAAALEDLIVPPVQIAYTQNLIDGKFVDAASGKTFPTYDPRTGDVIANVAEGDAED  98

Query  345  INRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAK  524
            I+RAVAAARKAFDEGPWPKM+ YERSRIML+FADLVEKH +ELA LETW+NGKP+EQAAK
Sbjct  99   IDRAVAAARKAFDEGPWPKMTPYERSRIMLRFADLVEKHSEELAALETWNNGKPHEQAAK  158

Query  525  SELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            SELPM +RLFHYYAGWADKIHGLTVPADG HHVQ LHEPIGVAGQIIPWNF
Sbjct  159  SELPMFIRLFHYYAGWADKIHGLTVPADGHHHVQILHEPIGVAGQIIPWNF  209



>emb|CDP00179.1| unnamed protein product [Coffea canephora]
Length=538

 Score =   305 bits (781),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 142/187 (76%), Positives = 164/187 (88%), Gaps = 1/187 (1%)
 Frame = +3

Query  120  ASAFLGWKYGVES-GIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDP  296
            AS   G K   ++  I R+STAAA+EE + P V V+YT+ +ING+FVD+ASGKTFPTLDP
Sbjct  21   ASRLTGGKSACQARAISRYSTAAALEEPIKPPVNVEYTKLLINGQFVDAASGKTFPTLDP  80

Query  297  RTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELA  476
            RT +VIAHVAEG+AED+NRAVAAARKAFDEGPWPK++AY+R RI+L+FADLVEKH DE+A
Sbjct  81   RTGEVIAHVAEGDAEDVNRAVAAARKAFDEGPWPKLTAYDRQRILLRFADLVEKHNDEIA  140

Query  477  TLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAG  656
             LETWDNGKPYEQAAK E+PM VRL  YYAGWADKIHG+TVPADGP+HVQTLHEPIGVAG
Sbjct  141  ALETWDNGKPYEQAAKIEVPMFVRLMRYYAGWADKIHGMTVPADGPYHVQTLHEPIGVAG  200

Query  657  QIIPWNF  677
            QIIPWNF
Sbjct  201  QIIPWNF  207



>ref|XP_010678738.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Beta vulgaris subsp. vulgaris]
Length=534

 Score =   305 bits (780),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 137/172 (80%), Positives = 159/172 (92%), Gaps = 0/172 (0%)
 Frame = +3

Query  162  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  341
            + RFST +A+E+ + P V++K+TQ +ING FVD+ASGKTFPT DPRT DVI HVAEG+AE
Sbjct  32   LSRFSTTSALEDPIIPNVDIKHTQLLINGNFVDAASGKTFPTYDPRTGDVITHVAEGDAE  91

Query  342  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  521
            DINRAVAAARKAFDEGPWPKM+AYER+RI+L+FADLVE+H +ELA LETWDNGKP++QA+
Sbjct  92   DINRAVAAARKAFDEGPWPKMTAYERARIILRFADLVEQHSEELAALETWDNGKPFQQAS  151

Query  522  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            KSELP+ VRLFHYYAGWADKIHGLTVPADGP+HVQTLHEPIGVAGQIIPWNF
Sbjct  152  KSELPLFVRLFHYYAGWADKIHGLTVPADGPYHVQTLHEPIGVAGQIIPWNF  203



>ref|XP_008221788.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial 
[Prunus mume]
Length=534

 Score =   304 bits (779),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 143/190 (75%), Positives = 166/190 (87%), Gaps = 1/190 (1%)
 Frame = +3

Query  111  FPSASAF-LGWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPT  287
            F SAS F  G    V  GI ++ST A+ E  + P+V+V YTQ +ING+FVD+ASGKTFPT
Sbjct  14   FTSASLFSAGRSSSVARGIGKYSTDASFEAPIIPSVKVNYTQLLINGQFVDAASGKTFPT  73

Query  288  LDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMD  467
            LDPRT +VIAHVAEG++EDINRAV+AARKAFDEGPWPKM+AYERSR++ +FADLVEKH D
Sbjct  74   LDPRTGNVIAHVAEGDSEDINRAVSAARKAFDEGPWPKMTAYERSRVLFRFADLVEKHND  133

Query  468  ELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIG  647
            E+ATLETWDNGKP+EQAAK+E+PMIVR F YYAG+ADKIHGLTVPADG +HVQTLHEPIG
Sbjct  134  EIATLETWDNGKPFEQAAKTEVPMIVRFFRYYAGFADKIHGLTVPADGEYHVQTLHEPIG  193

Query  648  VAGQIIPWNF  677
            VAGQIIPWNF
Sbjct  194  VAGQIIPWNF  203



>ref|XP_004138115.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Cucumis sativus]
 gb|KGN63591.1| hypothetical protein Csa_1G005520 [Cucumis sativus]
Length=548

 Score =   305 bits (780),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 143/186 (77%), Positives = 164/186 (88%), Gaps = 8/186 (4%)
 Frame = +3

Query  123  SAFLGWKYGVESGIQRFSTAA-AVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPR  299
            S FLG  YG       FST+A A EEL++P V++ YTQ++ING+FVDSASGKTFPT DPR
Sbjct  39   SRFLGRGYG-------FSTSALAEEELITPPVQINYTQNLINGQFVDSASGKTFPTYDPR  91

Query  300  TEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELAT  479
            T +VIAHVAEG+AED+NRAV+AARKAFDEGPWP+MSAYERSRI+L+FADL+EKH  EL+ 
Sbjct  92   TGEVIAHVAEGDAEDVNRAVSAARKAFDEGPWPRMSAYERSRILLRFADLIEKHTPELSA  151

Query  480  LETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQ  659
            LETW+NGKPYEQ+ KSELP++VRLFHYYAGWADKIHGLTVPADG HHVQ LHEPIGVAGQ
Sbjct  152  LETWNNGKPYEQSLKSELPLLVRLFHYYAGWADKIHGLTVPADGNHHVQVLHEPIGVAGQ  211

Query  660  IIPWNF  677
            IIPWNF
Sbjct  212  IIPWNF  217



>ref|XP_004155012.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Cucumis sativus]
Length=549

 Score =   305 bits (780),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 143/186 (77%), Positives = 164/186 (88%), Gaps = 8/186 (4%)
 Frame = +3

Query  123  SAFLGWKYGVESGIQRFSTAA-AVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPR  299
            S FLG  YG       FST+A A EEL++P V++ YTQ++ING+FVDSASGKTFPT DPR
Sbjct  39   SRFLGRGYG-------FSTSALAEEELITPPVQINYTQNLINGQFVDSASGKTFPTYDPR  91

Query  300  TEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELAT  479
            T +VIAHVAEG+AED+NRAV+AARKAFDEGPWP+MSAYERSRI+L+FADL+EKH  EL+ 
Sbjct  92   TGEVIAHVAEGDAEDVNRAVSAARKAFDEGPWPRMSAYERSRILLRFADLIEKHTPELSA  151

Query  480  LETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQ  659
            LETW+NGKPYEQ+ KSELP++VRLFHYYAGWADKIHGLTVPADG HHVQ LHEPIGVAGQ
Sbjct  152  LETWNNGKPYEQSLKSELPLLVRLFHYYAGWADKIHGLTVPADGNHHVQVLHEPIGVAGQ  211

Query  660  IIPWNF  677
            IIPWNF
Sbjct  212  IIPWNF  217



>ref|XP_004965205.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Setaria italica]
Length=549

 Score =   305 bits (780),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 140/172 (81%), Positives = 154/172 (90%), Gaps = 0/172 (0%)
 Frame = +3

Query  162  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  341
            +QRFSTAA  EE +SP V+V YT+ +ING FVDSASGKTFPTLDPRT +VIAHVAEG+AE
Sbjct  47   LQRFSTAAVAEEPISPPVQVNYTKLLINGNFVDSASGKTFPTLDPRTGEVIAHVAEGDAE  106

Query  342  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  521
            D+NRAVAAARKAFD GPWPKM+AYERSRI+L+FADL+EKH DELA LETWDNGKPYEQAA
Sbjct  107  DVNRAVAAARKAFDVGPWPKMTAYERSRILLRFADLIEKHNDELAALETWDNGKPYEQAA  166

Query  522  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
              E+PM+ RL  YYAGWADKIHGL VPADGPHHVQ LHEPIGVAGQIIPWNF
Sbjct  167  HIEVPMVARLMRYYAGWADKIHGLVVPADGPHHVQVLHEPIGVAGQIIPWNF  218



>ref|XP_010546022.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial 
[Tarenaya hassleriana]
Length=539

 Score =   303 bits (776),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 139/168 (83%), Positives = 157/168 (93%), Gaps = 0/168 (0%)
 Frame = +3

Query  174  STAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINR  353
            +TAAAVEE+++P V+V YTQH+ING FVDSASGKTFPTLDPRT +VIAHVAEG+AEDI+R
Sbjct  41   TTAAAVEEIINPPVQVSYTQHLINGNFVDSASGKTFPTLDPRTGEVIAHVAEGDAEDIDR  100

Query  354  AVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSEL  533
            AV AARKAFDEGPWPKM AYERSRI+L+FADLVEK+ +ELA LETWDNGKPYEQ++KSE+
Sbjct  101  AVKAARKAFDEGPWPKMPAYERSRILLRFADLVEKNSEELAILETWDNGKPYEQSSKSEI  160

Query  534  PMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            PM+ RLF YYAGWADKIHGLTVPADG +HVQTLHEPIGVAGQIIPWNF
Sbjct  161  PMLARLFRYYAGWADKIHGLTVPADGNYHVQTLHEPIGVAGQIIPWNF  208



>ref|XP_007036177.1| Aldehyde dehydrogenase family 2 member B4 [Theobroma cacao]
 gb|EOY20678.1| Aldehyde dehydrogenase family 2 member B4 [Theobroma cacao]
Length=567

 Score =   304 bits (778),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 138/172 (80%), Positives = 160/172 (93%), Gaps = 0/172 (0%)
 Frame = +3

Query  162  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  341
            I+R ST+ A+EEL+ P V++ YTQ++I+GKFVD+ASGKTFPT DPRT +VIAHVAEG+AE
Sbjct  38   IKRLSTSTALEELIVPPVQIAYTQNLIDGKFVDAASGKTFPTYDPRTGEVIAHVAEGDAE  97

Query  342  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  521
            D+NRAVAAARKAFDEGPWPKM+ YERSRI+L+FADLVEKH DELA LETW+NGK +EQAA
Sbjct  98   DVNRAVAAARKAFDEGPWPKMTPYERSRILLRFADLVEKHSDELAALETWNNGKLHEQAA  157

Query  522  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            K+ELP+++RLFHYYAGWADKIHGLTVPADG HHVQTLHEPIGVAGQIIPWNF
Sbjct  158  KAELPLLIRLFHYYAGWADKIHGLTVPADGNHHVQTLHEPIGVAGQIIPWNF  209



>ref|XP_010682576.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
isoform X2 [Beta vulgaris subsp. vulgaris]
Length=453

 Score =   300 bits (769),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = +3

Query  135  GWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVI  314
            G    V  G+QR+STAAA++E ++P VEV YT+ +ING+FVD+ASGKTF T+DPRT +VI
Sbjct  23   GRSSCVRRGLQRYSTAAAIDEPITPPVEVNYTKLLINGQFVDAASGKTFHTVDPRTGNVI  82

Query  315  AHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWD  494
            A VAEG+AED+NRAV+AARKAFDEGPWPKM+AYERSRI+L+ ADL+EKH D +A LETWD
Sbjct  83   ADVAEGDAEDVNRAVSAARKAFDEGPWPKMTAYERSRILLRGADLIEKHNDVIAALETWD  142

Query  495  NGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWN  674
            NGKPYEQ+AK E+PM+VRLF YYAGWADKIHGLT PADGP+HVQTLHEPIGVAGQIIPWN
Sbjct  143  NGKPYEQSAKVEIPMLVRLFRYYAGWADKIHGLTCPADGPYHVQTLHEPIGVAGQIIPWN  202

Query  675  F  677
            F
Sbjct  203  F  203



>ref|XP_009363532.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Pyrus x bretschneideri]
Length=534

 Score =   303 bits (775),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 141/190 (74%), Positives = 164/190 (86%), Gaps = 1/190 (1%)
 Frame = +3

Query  111  FPSASAFL-GWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPT  287
            F SAS F  G    V  GI ++ST A++E  +SP V+V YTQ +ING+FVDSASGKTFPT
Sbjct  14   FTSASLFSKGRTSSVVRGIGKYSTDASIESPISPTVKVNYTQLLINGQFVDSASGKTFPT  73

Query  288  LDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMD  467
            LDPRT +VIAHVAEG+AED+NRAV+AARKAFDEGPWPKM+AYERSR++ +FADL+EKH D
Sbjct  74   LDPRTGEVIAHVAEGDAEDVNRAVSAARKAFDEGPWPKMTAYERSRVLFRFADLIEKHND  133

Query  468  ELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIG  647
            E+A LETWDNGKP+EQAAK E+PM+ R F YYAG+ADKIHGLTVPADG +HVQTLHEPIG
Sbjct  134  EIAALETWDNGKPFEQAAKIEVPMLARFFRYYAGFADKIHGLTVPADGEYHVQTLHEPIG  193

Query  648  VAGQIIPWNF  677
            VAGQIIPWNF
Sbjct  194  VAGQIIPWNF  203



>ref|XP_010914166.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Elaeis guineensis]
Length=571

 Score =   304 bits (778),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 138/172 (80%), Positives = 156/172 (91%), Gaps = 0/172 (0%)
 Frame = +3

Query  162  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  341
            +QRFSTA AVEE ++P V+V +TQ +ING+FVD+ASGKTFPTLDPRT ++IAHVAEG+ E
Sbjct  69   LQRFSTAVAVEEPITPPVQVHHTQLLINGQFVDAASGKTFPTLDPRTGEMIAHVAEGDVE  128

Query  342  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  521
            D+NRAVAAARKAFDEGPWPKM+ YERSRI+L+FADLVEKH DE+A LETWDNGKPYEQAA
Sbjct  129  DVNRAVAAARKAFDEGPWPKMTGYERSRILLRFADLVEKHNDEIAALETWDNGKPYEQAA  188

Query  522  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
              E+PM+VRL  YYAGWADKIHGL VPADGPHHVQ LHEPIGVAGQIIPWNF
Sbjct  189  NVEVPMLVRLMRYYAGWADKIHGLVVPADGPHHVQVLHEPIGVAGQIIPWNF  240



>ref|XP_007221800.1| hypothetical protein PRUPE_ppa004036mg [Prunus persica]
 gb|EMJ22999.1| hypothetical protein PRUPE_ppa004036mg [Prunus persica]
Length=534

 Score =   303 bits (775),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 142/190 (75%), Positives = 166/190 (87%), Gaps = 1/190 (1%)
 Frame = +3

Query  111  FPSASAF-LGWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPT  287
            F SAS F  G    V  GI ++ST A+ E  + P+V+V YT+ +ING+FVD+ASGKTFPT
Sbjct  14   FTSASLFSAGRSSSVARGIGKYSTDASFEAPIIPSVKVNYTRLLINGQFVDAASGKTFPT  73

Query  288  LDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMD  467
            LDPRT +VIAHVAEG++EDINRAV+AARKAFDEGPWPKM+AYERSR++ +FADLVEKH D
Sbjct  74   LDPRTGNVIAHVAEGDSEDINRAVSAARKAFDEGPWPKMTAYERSRVLFRFADLVEKHND  133

Query  468  ELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIG  647
            E+ATLETWDNGKP+EQAAK+E+PMIVR F YYAG+ADKIHGLTVPADG +HVQTLHEPIG
Sbjct  134  EIATLETWDNGKPFEQAAKTEVPMIVRFFRYYAGFADKIHGLTVPADGEYHVQTLHEPIG  193

Query  648  VAGQIIPWNF  677
            VAGQIIPWNF
Sbjct  194  VAGQIIPWNF  203



>ref|XP_009391259.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
isoform X4 [Musa acuminata subsp. malaccensis]
Length=532

 Score =   302 bits (774),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 142/190 (75%), Positives = 165/190 (87%), Gaps = 1/190 (1%)
 Frame = +3

Query  111  FPSASAFLGWKYGVESGI-QRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPT  287
            F S +A L  K G  SG+ +RFS AAA+EE +SP V+VKY+Q +INGKFVDSASGKTFPT
Sbjct  12   FRSLAAPLFRKDGSASGVFRRFSIAAAIEEPISPPVQVKYSQLLINGKFVDSASGKTFPT  71

Query  288  LDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMD  467
            LDPR+ +VIA VAEG+AED+NRAV AARKAFDEGPWP+M+AYERSRI+ +FADL+EKH D
Sbjct  72   LDPRSGEVIAQVAEGDAEDVNRAVTAARKAFDEGPWPRMTAYERSRILNRFADLIEKHND  131

Query  468  ELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIG  647
            E+A LETWDNGKP+EQA++ E+PM+ RL  YYAGWADKIHGL VPADGPHHVQ LHEPIG
Sbjct  132  EIAALETWDNGKPFEQASQIEIPMLARLMRYYAGWADKIHGLVVPADGPHHVQVLHEPIG  191

Query  648  VAGQIIPWNF  677
            VAGQIIPWNF
Sbjct  192  VAGQIIPWNF  201



>gb|AAF73828.1|AF162665_1 aldehyde dehydrogenase [Oryza sativa]
Length=549

 Score =   303 bits (776),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 139/172 (81%), Positives = 155/172 (90%), Gaps = 0/172 (0%)
 Frame = +3

Query  162  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  341
            +QRFSTAA  EE +SP V+V YTQ +I+GKFVDSASGKTFPTLDPRT ++IAHVAEG+AE
Sbjct  47   LQRFSTAAVAEEPISPPVQVNYTQLLIDGKFVDSASGKTFPTLDPRTGELIAHVAEGDAE  106

Query  342  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  521
            DINRAV AARKAFDEGPWPKM+AYERSRI+L+FADL+EKH DE+A LETWDNGKPY QAA
Sbjct  107  DINRAVHAARKAFDEGPWPKMTAYERSRILLRFADLIEKHNDEIAALETWDNGKPYAQAA  166

Query  522  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            + E+PM+ RL  YYAGWADKIHGL VPADGPHHVQ LHEPIGVAGQIIPWNF
Sbjct  167  QIEVPMVARLMRYYAGWADKIHGLVVPADGPHHVQVLHEPIGVAGQIIPWNF  218



>ref|XP_010928601.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Elaeis guineensis]
Length=543

 Score =   303 bits (775),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 137/172 (80%), Positives = 158/172 (92%), Gaps = 0/172 (0%)
 Frame = +3

Query  162  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  341
            ++RFSTAAAVEE ++P V+V++TQ +ING+FVD+ASGKTFPTLDPRT DVIA VAEG+AE
Sbjct  41   LRRFSTAAAVEEHITPPVDVQHTQLLINGQFVDAASGKTFPTLDPRTGDVIACVAEGDAE  100

Query  342  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  521
            DINRAVAAARKAFDEGPWP+M+AYERSRI+L+FADL+EKH DE+A LETWDNGKPYEQ+A
Sbjct  101  DINRAVAAARKAFDEGPWPRMTAYERSRILLRFADLMEKHNDEIAALETWDNGKPYEQSA  160

Query  522  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
              E+PM++RL  YYAGWADKIHGL VPADGPHHVQ LHEPIGV GQIIPWNF
Sbjct  161  NIEVPMLIRLMRYYAGWADKIHGLVVPADGPHHVQVLHEPIGVVGQIIPWNF  212



>ref|XP_010426271.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Camelina sativa]
Length=537

 Score =   302 bits (774),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 137/172 (80%), Positives = 157/172 (91%), Gaps = 0/172 (0%)
 Frame = +3

Query  162  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  341
            ++RF T++A EEL+SP+V+V +TQ +I+G FVDSASGKTFPTLDPRT +VIAHVAEG+AE
Sbjct  35   LRRFGTSSAAEELISPSVQVSHTQLLIDGNFVDSASGKTFPTLDPRTGEVIAHVAEGDAE  94

Query  342  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  521
            DINRAV AARKAFDEGPWPKMSAYERSR+ML+FADLVEKH +ELA+LETWDNGKPY+Q+ 
Sbjct  95   DINRAVKAARKAFDEGPWPKMSAYERSRVMLRFADLVEKHSEELASLETWDNGKPYQQSK  154

Query  522  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
              E+PM  RLF YYAGWADKIHGLTVPADG +HVQTLHEPIGVAGQIIPWNF
Sbjct  155  NVEIPMFARLFRYYAGWADKIHGLTVPADGNYHVQTLHEPIGVAGQIIPWNF  206



>ref|XP_007031424.1| Aldehyde dehydrogenase 2B4 isoform 2, partial [Theobroma cacao]
 gb|EOY02350.1| Aldehyde dehydrogenase 2B4 isoform 2, partial [Theobroma cacao]
Length=405

 Score =   298 bits (764),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 135/173 (78%), Positives = 157/173 (91%), Gaps = 0/173 (0%)
 Frame = +3

Query  159  GIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEA  338
            GI  FST+AA++E +SP++ + +TQ +ING+FVD+ASGKTFPTLDPRT DVIAHVAEG+A
Sbjct  11   GINSFSTSAAIDEPISPSILIDHTQLLINGQFVDAASGKTFPTLDPRTGDVIAHVAEGDA  70

Query  339  EDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQA  518
            ED+NRAVAAARKAFDEGPWPK++AYERSRIM +FADL+EKH +E+ATLETWDNGKPYEQA
Sbjct  71   EDVNRAVAAARKAFDEGPWPKLTAYERSRIMFRFADLLEKHTEEVATLETWDNGKPYEQA  130

Query  519  AKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            AK E+P +VR+F YYAGWADKIHGLTVPADG HHVQTLHEP GV G IIPWNF
Sbjct  131  AKIEIPKVVRMFRYYAGWADKIHGLTVPADGQHHVQTLHEPYGVTGLIIPWNF  183



>ref|XP_010503421.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Camelina sativa]
Length=537

 Score =   302 bits (774),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 137/172 (80%), Positives = 157/172 (91%), Gaps = 0/172 (0%)
 Frame = +3

Query  162  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  341
            ++RF T++A EEL+SP+V+V +TQ +I+G FVDSASGKTFPTLDPRT +VIAHVAEG+AE
Sbjct  35   LRRFGTSSAAEELISPSVQVSHTQLLIDGNFVDSASGKTFPTLDPRTGEVIAHVAEGDAE  94

Query  342  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  521
            DINRAV AARKAFDEGPWPKMSAYERSR+ML+FADLVEKH +ELA+LETWDNGKPY+Q+ 
Sbjct  95   DINRAVKAARKAFDEGPWPKMSAYERSRVMLRFADLVEKHSEELASLETWDNGKPYQQSK  154

Query  522  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
              E+PM  RLF YYAGWADKIHGLTVPADG +HVQTLHEPIGVAGQIIPWNF
Sbjct  155  NVEIPMFARLFRYYAGWADKIHGLTVPADGNYHVQTLHEPIGVAGQIIPWNF  206



>gb|KDO69715.1| hypothetical protein CISIN_1g012806mg [Citrus sinensis]
Length=394

 Score =   298 bits (762),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 140/193 (73%), Positives = 164/193 (85%), Gaps = 4/193 (2%)
 Frame = +3

Query  111  FPSASAFLGWKYGVES----GIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKT  278
            FPSAS  L    G ES    GI RFSTAA VEE + P V++ YT+++ING+FVD+ASGKT
Sbjct  15   FPSASPSLLRSLGRESSRARGISRFSTAAVVEEPIIPPVQISYTKNLINGQFVDAASGKT  74

Query  279  FPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEK  458
            FP  DPRT +VIA+VAEG+AEDI+RAVA ARKAFDEGPWPKM+ YERSRIML+ ADL+EK
Sbjct  75   FPVYDPRTAEVIANVAEGDAEDIDRAVATARKAFDEGPWPKMTPYERSRIMLRAADLIEK  134

Query  459  HMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHE  638
            +M+ELA LETW+NGKPY Q+ KSE+PM+VRL HYYAGWADKIHGLTVP DG +H+QTLHE
Sbjct  135  NMEELAALETWNNGKPYVQSLKSEVPMVVRLLHYYAGWADKIHGLTVPGDGNYHIQTLHE  194

Query  639  PIGVAGQIIPWNF  677
            PIGVAGQI+PWNF
Sbjct  195  PIGVAGQIVPWNF  207



>ref|NP_001057358.1| Os06g0270900 [Oryza sativa Japonica Group]
 dbj|BAB19052.1| aldehyde dehydrogenase ALDH2b [Oryza sativa Japonica Group]
 dbj|BAD54414.1| aldehyde dehydrogenase ALDH2b [Oryza sativa Japonica Group]
 dbj|BAF19272.1| Os06g0270900 [Oryza sativa Japonica Group]
 gb|EAZ36586.1| hypothetical protein OsJ_20928 [Oryza sativa Japonica Group]
 dbj|BAG93278.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94020.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99957.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AJB98432.1| aldehyde dehydrogenase, partial [Oryza sativa]
Length=549

 Score =   303 bits (775),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 139/172 (81%), Positives = 154/172 (90%), Gaps = 0/172 (0%)
 Frame = +3

Query  162  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  341
            +QRFSTAA  EE +SP V+V YTQ +I+GKFVDSASGKTFPTLDPRT ++IAHVAEG+AE
Sbjct  47   LQRFSTAAVAEEPISPPVQVNYTQLLIDGKFVDSASGKTFPTLDPRTGELIAHVAEGDAE  106

Query  342  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  521
            DINRAV AARKAFDEGPWPKM+AYERSRI+L+FADL+EKH DE+A LETWDNGKPY QAA
Sbjct  107  DINRAVHAARKAFDEGPWPKMTAYERSRILLRFADLIEKHNDEIAALETWDNGKPYAQAA  166

Query  522  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
              E+PM+ RL  YYAGWADKIHGL VPADGPHHVQ LHEPIGVAGQIIPWNF
Sbjct  167  NIEVPMVARLMRYYAGWADKIHGLVVPADGPHHVQVLHEPIGVAGQIIPWNF  218



>gb|EAZ00462.1| hypothetical protein OsI_22484 [Oryza sativa Indica Group]
Length=549

 Score =   303 bits (775),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 139/172 (81%), Positives = 154/172 (90%), Gaps = 0/172 (0%)
 Frame = +3

Query  162  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  341
            +QRFSTAA  EE +SP V+V YTQ +I+GKFVDSASGKTFPTLDPRT ++IAHVAEG+AE
Sbjct  47   LQRFSTAAVAEEPISPPVQVNYTQLLIDGKFVDSASGKTFPTLDPRTGELIAHVAEGDAE  106

Query  342  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  521
            DINRAV AARKAFDEGPWPKM+AYERSRI+L+FADL+EKH DE+A LETWDNGKPY QAA
Sbjct  107  DINRAVHAARKAFDEGPWPKMTAYERSRILLRFADLIEKHNDEIAALETWDNGKPYAQAA  166

Query  522  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
              E+PM+ RL  YYAGWADKIHGL VPADGPHHVQ LHEPIGVAGQIIPWNF
Sbjct  167  NIEVPMVARLMRYYAGWADKIHGLVVPADGPHHVQVLHEPIGVAGQIIPWNF  218



>gb|KDO69714.1| hypothetical protein CISIN_1g012806mg [Citrus sinensis]
Length=393

 Score =   298 bits (762),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 140/193 (73%), Positives = 164/193 (85%), Gaps = 4/193 (2%)
 Frame = +3

Query  111  FPSASAFLGWKYGVES----GIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKT  278
            FPSAS  L    G ES    GI RFSTAA VEE + P V++ YT+++ING+FVD+ASGKT
Sbjct  15   FPSASPSLLRSLGRESSRARGISRFSTAAVVEEPIIPPVQISYTKNLINGQFVDAASGKT  74

Query  279  FPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEK  458
            FP  DPRT +VIA+VAEG+AEDI+RAVA ARKAFDEGPWPKM+ YERSRIML+ ADL+EK
Sbjct  75   FPVYDPRTAEVIANVAEGDAEDIDRAVATARKAFDEGPWPKMTPYERSRIMLRAADLIEK  134

Query  459  HMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHE  638
            +M+ELA LETW+NGKPY Q+ KSE+PM+VRL HYYAGWADKIHGLTVP DG +H+QTLHE
Sbjct  135  NMEELAALETWNNGKPYVQSLKSEVPMVVRLLHYYAGWADKIHGLTVPGDGNYHIQTLHE  194

Query  639  PIGVAGQIIPWNF  677
            PIGVAGQI+PWNF
Sbjct  195  PIGVAGQIVPWNF  207



>ref|XP_004297642.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Fragaria vesca subsp. vesca]
Length=535

 Score =   302 bits (774),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 167/191 (87%), Gaps = 2/191 (1%)
 Frame = +3

Query  111  FPSASAFLGWKYGVESGIQRFSTAAA--VEELVSPAVEVKYTQHIINGKFVDSASGKTFP  284
            F SAS+F   +  V  GI ++STAAA  VE+ ++P V+V +T+ +ING FVD+ASGKTFP
Sbjct  14   FTSASSFSKGRSSVSRGIGKYSTAAAAAVEDPITPPVKVGHTKLLINGHFVDAASGKTFP  73

Query  285  TLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHM  464
            TLDPRT DVIAHVAEG+AED++RAVAAARKAFDEGPWPKM+AYERSR++ +FADL+EKH 
Sbjct  74   TLDPRTGDVIAHVAEGDAEDVDRAVAAARKAFDEGPWPKMTAYERSRVLFRFADLIEKHN  133

Query  465  DELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPI  644
            DELA LETWDNGKP+EQ+AK E+PM+ R F YYAG+ADKIHGLTVPADGP+HVQTLHEPI
Sbjct  134  DELAALETWDNGKPFEQSAKIEIPMVARFFRYYAGYADKIHGLTVPADGPYHVQTLHEPI  193

Query  645  GVAGQIIPWNF  677
            GVAGQIIPWNF
Sbjct  194  GVAGQIIPWNF  204



>gb|EYU42550.1| hypothetical protein MIMGU_mgv1a004919mg [Erythranthe guttata]
Length=504

 Score =   301 bits (771),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 138/173 (80%), Positives = 157/173 (91%), Gaps = 1/173 (1%)
 Frame = +3

Query  162  IQRF-STAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEA  338
            +QRF S+AA ++E + P +++ YT+ +ING+FVDSASGKTFPTLDPRT +VIAHVAEG+A
Sbjct  1    MQRFTSSAAVIDEPIIPPLQINYTKLLINGQFVDSASGKTFPTLDPRTGEVIAHVAEGDA  60

Query  339  EDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQA  518
            EDINRAV+AARKAFDEGPWP+M+AYERSRIML+FADL EKH  ELA LETWDNGKPYEQA
Sbjct  61   EDINRAVSAARKAFDEGPWPRMTAYERSRIMLRFADLAEKHTQELAQLETWDNGKPYEQA  120

Query  519  AKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
              +ELP+ VRLFHYYAGWADKIHGLTVPADGPHHVQ LHEPIGVAGQIIPWNF
Sbjct  121  LTAELPLFVRLFHYYAGWADKIHGLTVPADGPHHVQVLHEPIGVAGQIIPWNF  173



>ref|XP_002877590.1| ALDH2B4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53849.1| ALDH2B4 [Arabidopsis lyrata subsp. lyrata]
Length=537

 Score =   302 bits (773),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 136/172 (79%), Positives = 157/172 (91%), Gaps = 0/172 (0%)
 Frame = +3

Query  162  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  341
            ++RF T++A EE+++P+V+V +TQ +ING FVDSASGKTFPTLDPRT +VIAHVAEG+AE
Sbjct  35   LRRFGTSSAAEEIINPSVQVSHTQLLINGNFVDSASGKTFPTLDPRTGEVIAHVAEGDAE  94

Query  342  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  521
            DINRAV AARKAFDEGPWPKMSAYERSR+ML+FADLVEKH +ELA+LETWDNGKPY+Q+ 
Sbjct  95   DINRAVKAARKAFDEGPWPKMSAYERSRVMLRFADLVEKHSEELASLETWDNGKPYQQSK  154

Query  522  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
              E+PM  RLF YYAGWADKIHGLTVPADG +HVQTLHEPIGVAGQIIPWNF
Sbjct  155  TVEIPMFARLFRYYAGWADKIHGLTVPADGNYHVQTLHEPIGVAGQIIPWNF  206



>ref|XP_008389628.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Malus domestica]
Length=534

 Score =   302 bits (773),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 140/190 (74%), Positives = 165/190 (87%), Gaps = 1/190 (1%)
 Frame = +3

Query  111  FPSASAFLGWKYG-VESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPT  287
            F SAS F   +   V  GI ++ST A++E  +SP+V+V YTQ +ING+FVDSASGKTFPT
Sbjct  14   FTSASMFSKXRSSSVVRGIGKYSTDASIESPISPSVKVNYTQLLINGQFVDSASGKTFPT  73

Query  288  LDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMD  467
            LDPRT +VIAHVAEG+AED+NRAV+AARKAFDEGPWPKM+AYERSR++ +FADL+EKH D
Sbjct  74   LDPRTGEVIAHVAEGDAEDVNRAVSAARKAFDEGPWPKMTAYERSRVLFRFADLIEKHND  133

Query  468  ELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIG  647
            E+A LETWDNGKP+EQAAK E+PM+ R F YYAG+ADKIHGLTVPADG +HVQTLHEPIG
Sbjct  134  EIAALETWDNGKPFEQAAKIEVPMVARFFRYYAGFADKIHGLTVPADGEYHVQTLHEPIG  193

Query  648  VAGQIIPWNF  677
            VAGQIIPWNF
Sbjct  194  VAGQIIPWNF  203



>ref|XP_008793883.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Phoenix dactylifera]
Length=540

 Score =   301 bits (772),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 136/172 (79%), Positives = 156/172 (91%), Gaps = 0/172 (0%)
 Frame = +3

Query  162  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  341
            ++RFSTA AVEE ++P V+V+ TQ +ING+FVD+ASGKTFPTLDPRT +VIAHVAEG+AE
Sbjct  38   LRRFSTAVAVEEPIAPPVQVQCTQLLINGQFVDAASGKTFPTLDPRTGEVIAHVAEGDAE  97

Query  342  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  521
            D+NRAVAAAR+AFDEGPWPKM+AYERSRI+L+FADL+EKH DE+A LETWDNGKPYEQAA
Sbjct  98   DVNRAVAAAREAFDEGPWPKMTAYERSRILLRFADLIEKHNDEIAALETWDNGKPYEQAA  157

Query  522  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
              E+PM+ RL  YY GWADKIHGL VPADGPHHVQ LHEPIGVAGQIIPWNF
Sbjct  158  NLEVPMLTRLMRYYGGWADKIHGLVVPADGPHHVQVLHEPIGVAGQIIPWNF  209



>ref|XP_004298932.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial 
[Fragaria vesca subsp. vesca]
Length=532

 Score =   301 bits (772),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 140/173 (81%), Positives = 161/173 (93%), Gaps = 1/173 (1%)
 Frame = +3

Query  162  IQRFS-TAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEA  338
            + RFS TAAA EEL++P V +++T+ +ING+FVDSASGKTFPT DPRT +VIAHVAEG+A
Sbjct  29   VSRFSSTAAASEELITPPVHIEHTKLLINGQFVDSASGKTFPTYDPRTGEVIAHVAEGDA  88

Query  339  EDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQA  518
            EDINRAVAAARKAFDEGPWPKMSAYERSRI+L+FADLVEKH +ELA LETW+NGKP+ QA
Sbjct  89   EDINRAVAAARKAFDEGPWPKMSAYERSRILLRFADLVEKHSEELAALETWNNGKPFVQA  148

Query  519  AKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            +++ELPM+VRL HYYAGWADKIHGLTVPADGP+HVQTLHEPIGVAGQIIPWNF
Sbjct  149  SQAELPMVVRLLHYYAGWADKIHGLTVPADGPYHVQTLHEPIGVAGQIIPWNF  201



>ref|XP_010913576.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Elaeis guineensis]
Length=543

 Score =   301 bits (772),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 137/172 (80%), Positives = 156/172 (91%), Gaps = 0/172 (0%)
 Frame = +3

Query  162  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  341
            ++RFSTA AVEE ++P V+V +TQ +ING+FVD+ASGKTFPTLDPRT +VIAHVAEG+ E
Sbjct  41   LRRFSTAVAVEEPITPPVQVHHTQLLINGQFVDAASGKTFPTLDPRTGEVIAHVAEGDVE  100

Query  342  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  521
            D+N AVAAARKAFDEGPWPKM+ YERSRI+L+FADL+EKH DELA LETWDNGKPYEQAA
Sbjct  101  DVNHAVAAARKAFDEGPWPKMTGYERSRILLRFADLIEKHNDELAALETWDNGKPYEQAA  160

Query  522  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
             +E+PM+VRL  YYAGWADKIHGL VPADGPHHVQ LHEPIGVAGQIIPWNF
Sbjct  161  NAEVPMLVRLMRYYAGWADKIHGLVVPADGPHHVQVLHEPIGVAGQIIPWNF  212



>ref|XP_002511424.1| aldehyde dehydrogenase, putative [Ricinus communis]
 gb|EEF52026.1| aldehyde dehydrogenase, putative [Ricinus communis]
Length=534

 Score =   301 bits (770),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 139/172 (81%), Positives = 155/172 (90%), Gaps = 0/172 (0%)
 Frame = +3

Query  162  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  341
            I RFSTAA  EE ++P V++ YTQH ING+FVD+ASGKTFP  DPRT  VIA VAEG+AE
Sbjct  32   IYRFSTAAVAEEPITPPVQISYTQHFINGQFVDAASGKTFPAYDPRTGQVIAQVAEGDAE  91

Query  342  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  521
            DINRAVAAARKAFDEGPWPKM+AYERSRI+L+FA+LVEK+ DELA LETW+NGKPYEQ+A
Sbjct  92   DINRAVAAARKAFDEGPWPKMTAYERSRIILRFAELVEKNNDELAALETWNNGKPYEQSA  151

Query  522  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            KSELP++ RLFHYYAGWADKIHGLTVPADG HHVQ LHEPIGVAGQIIPWNF
Sbjct  152  KSELPLLSRLFHYYAGWADKIHGLTVPADGNHHVQILHEPIGVAGQIIPWNF  203



>gb|KDO69713.1| hypothetical protein CISIN_1g012806mg [Citrus sinensis]
Length=456

 Score =   298 bits (764),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 140/193 (73%), Positives = 164/193 (85%), Gaps = 4/193 (2%)
 Frame = +3

Query  111  FPSASAFLGWKYGVES----GIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKT  278
            FPSAS  L    G ES    GI RFSTAA VEE + P V++ YT+++ING+FVD+ASGKT
Sbjct  15   FPSASPSLLRSLGRESSRARGISRFSTAAVVEEPIIPPVQISYTKNLINGQFVDAASGKT  74

Query  279  FPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEK  458
            FP  DPRT +VIA+VAEG+AEDI+RAVA ARKAFDEGPWPKM+ YERSRIML+ ADL+EK
Sbjct  75   FPVYDPRTAEVIANVAEGDAEDIDRAVATARKAFDEGPWPKMTPYERSRIMLRAADLIEK  134

Query  459  HMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHE  638
            +M+ELA LETW+NGKPY Q+ KSE+PM+VRL HYYAGWADKIHGLTVP DG +H+QTLHE
Sbjct  135  NMEELAALETWNNGKPYVQSLKSEVPMVVRLLHYYAGWADKIHGLTVPGDGNYHIQTLHE  194

Query  639  PIGVAGQIIPWNF  677
            PIGVAGQI+PWNF
Sbjct  195  PIGVAGQIVPWNF  207



>ref|XP_010515110.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial 
[Camelina sativa]
Length=537

 Score =   301 bits (770),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 136/172 (79%), Positives = 157/172 (91%), Gaps = 0/172 (0%)
 Frame = +3

Query  162  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  341
            ++RF T++A EEL+SP+V+V +TQ +I+G FVDSASG+TFPTLDPRT +VIAHVAEG+AE
Sbjct  35   LRRFGTSSAAEELISPSVQVSHTQLLIDGNFVDSASGQTFPTLDPRTGEVIAHVAEGDAE  94

Query  342  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  521
            DINRAV AARKAFDEGPWPKMSAYERSR+ML+FADLVEKH +ELA+LETWDNGKPY+Q+ 
Sbjct  95   DINRAVKAARKAFDEGPWPKMSAYERSRVMLRFADLVEKHSEELASLETWDNGKPYQQSK  154

Query  522  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
              E+PM  RLF YYAGWADKIHGLTVPADG +HVQTLHEPIGVAGQIIPWNF
Sbjct  155  NVEIPMFARLFRYYAGWADKIHGLTVPADGNYHVQTLHEPIGVAGQIIPWNF  206



>ref|XP_010682575.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
isoform X1 [Beta vulgaris subsp. vulgaris]
Length=534

 Score =   300 bits (769),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = +3

Query  135  GWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVI  314
            G    V  G+QR+STAAA++E ++P VEV YT+ +ING+FVD+ASGKTF T+DPRT +VI
Sbjct  23   GRSSCVRRGLQRYSTAAAIDEPITPPVEVNYTKLLINGQFVDAASGKTFHTVDPRTGNVI  82

Query  315  AHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWD  494
            A VAEG+AED+NRAV+AARKAFDEGPWPKM+AYERSRI+L+ ADL+EKH D +A LETWD
Sbjct  83   ADVAEGDAEDVNRAVSAARKAFDEGPWPKMTAYERSRILLRGADLIEKHNDVIAALETWD  142

Query  495  NGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWN  674
            NGKPYEQ+AK E+PM+VRLF YYAGWADKIHGLT PADGP+HVQTLHEPIGVAGQIIPWN
Sbjct  143  NGKPYEQSAKVEIPMLVRLFRYYAGWADKIHGLTCPADGPYHVQTLHEPIGVAGQIIPWN  202

Query  675  F  677
            F
Sbjct  203  F  203



>ref|XP_004508853.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
isoform X1 [Cicer arietinum]
Length=536

 Score =   300 bits (769),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 134/171 (78%), Positives = 155/171 (91%), Gaps = 0/171 (0%)
 Frame = +3

Query  165  QRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAED  344
             RFSTAAAVEEL++P V + YTQH+ING+FVD+ASGKTFPT DPRT +VIA VAEG+AED
Sbjct  35   NRFSTAAAVEELITPQVSINYTQHLINGQFVDAASGKTFPTYDPRTGEVIARVAEGDAED  94

Query  345  INRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAK  524
            INRAV+AARKAFD+GPWPKM+AYER RI+L+FADL+EKH DE+A LE+W+NGK YEQAAK
Sbjct  95   INRAVSAARKAFDDGPWPKMTAYERCRILLRFADLIEKHNDEIAALESWNNGKLYEQAAK  154

Query  525  SELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
             ELPM+VRLF YYAGW DKIHG+TVPADG +H+QTLHEPIGV GQIIPWNF
Sbjct  155  IELPMVVRLFRYYAGWTDKIHGMTVPADGDYHIQTLHEPIGVVGQIIPWNF  205



>emb|CDY36910.1| BnaA06g16950D [Brassica napus]
Length=539

 Score =   300 bits (769),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 167/194 (86%), Gaps = 5/194 (3%)
 Frame = +3

Query  111  FPSASAFLGWKYG--VESG---IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGK  275
            F ++S FL    G  + +G   ++RF T++A EE++SP+V+V YT+ +I+G FVD+ASGK
Sbjct  15   FSASSPFLSRSQGKNLNNGSRIVRRFGTSSAAEEVISPSVQVSYTKLLIDGNFVDAASGK  74

Query  276  TFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVE  455
            TFPTLDPRT +VIAHVAEG+AEDINRAV AARKAFDEGPWPKM+AYERSR+ML+FADLVE
Sbjct  75   TFPTLDPRTGEVIAHVAEGDAEDINRAVKAARKAFDEGPWPKMTAYERSRVMLRFADLVE  134

Query  456  KHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLH  635
            KH +ELA LE+WDNGK YEQA  +E+PM+ RLF YYAGWADKIHGLTVPADG +HVQTLH
Sbjct  135  KHSEELAALESWDNGKTYEQALTAEIPMVARLFRYYAGWADKIHGLTVPADGNYHVQTLH  194

Query  636  EPIGVAGQIIPWNF  677
            EPIGVAGQIIPWNF
Sbjct  195  EPIGVAGQIIPWNF  208



>ref|XP_010477684.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Camelina sativa]
Length=534

 Score =   300 bits (768),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 135/178 (76%), Positives = 161/178 (90%), Gaps = 1/178 (1%)
 Frame = +3

Query  147  GVESGIQRFST-AAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHV  323
            G+  GIQR+S  AAA+E  ++P V+V++TQ +ING+FVD+ASGKTFPTLDPR  +VIA V
Sbjct  26   GMNRGIQRYSNFAAALENTITPPVKVEHTQLLINGRFVDAASGKTFPTLDPRNGEVIAQV  85

Query  324  AEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGK  503
            AEG+AED+NRAVAAARKAFDEGPWP+M+AYERS+I+ + ADL+EKH DE+A LETWDNGK
Sbjct  86   AEGDAEDVNRAVAAARKAFDEGPWPRMTAYERSKILFRLADLIEKHNDEIAALETWDNGK  145

Query  504  PYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            P+EQ+AK E+PMIVR+F YYAGWADKIHG+TVPADGPHHVQTLHEPIGVAGQIIPWNF
Sbjct  146  PFEQSAKIEVPMIVRVFRYYAGWADKIHGMTVPADGPHHVQTLHEPIGVAGQIIPWNF  203



>ref|XP_009149853.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial 
[Brassica rapa]
Length=539

 Score =   300 bits (768),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 167/194 (86%), Gaps = 5/194 (3%)
 Frame = +3

Query  111  FPSASAFLGWKYG--VESG---IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGK  275
            F ++S FL    G  + +G   ++RF T++A EE++SP+V+V YT+ +I+G FVD+ASGK
Sbjct  15   FSASSPFLSRSQGRNLNNGSRIVRRFGTSSAAEEVISPSVQVSYTKLLIDGNFVDAASGK  74

Query  276  TFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVE  455
            TFPTLDPRT +VIAHVAEG+AEDINRAV AARKAFDEGPWPKM+AYERSR+ML+FADLVE
Sbjct  75   TFPTLDPRTGEVIAHVAEGDAEDINRAVKAARKAFDEGPWPKMTAYERSRVMLRFADLVE  134

Query  456  KHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLH  635
            KH +ELA LE+WDNGK YEQA  +E+PM+ RLF YYAGWADKIHGLTVPADG +HVQTLH
Sbjct  135  KHSEELAALESWDNGKTYEQALTAEIPMVARLFRYYAGWADKIHGLTVPADGNYHVQTLH  194

Query  636  EPIGVAGQIIPWNF  677
            EPIGVAGQIIPWNF
Sbjct  195  EPIGVAGQIIPWNF  208



>ref|XP_008367527.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Malus domestica]
Length=541

 Score =   300 bits (768),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 139/173 (80%), Positives = 157/173 (91%), Gaps = 1/173 (1%)
 Frame = +3

Query  162  IQRFS-TAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEA  338
            + RFS TA A EEL+ P V++ +TQH+INGKFVD+ASGK FPT DPRT +VIAHVAEG+A
Sbjct  38   VSRFSSTAVATEELIIPPVQISHTQHLINGKFVDAASGKKFPTYDPRTGEVIAHVAEGDA  97

Query  339  EDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQA  518
            EDINRAVAAARKAFDEGPWPKM AYERSRI+L+FADLVEK+ +ELA LETW+NGKPYEQA
Sbjct  98   EDINRAVAAARKAFDEGPWPKMGAYERSRILLRFADLVEKNSEELAALETWNNGKPYEQA  157

Query  519  AKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
              +E+PM+ RLFHYYAGWADKIHGLTVPADGP+HVQTLHEPIGVAGQIIPWNF
Sbjct  158  LTAEVPMLARLFHYYAGWADKIHGLTVPADGPYHVQTLHEPIGVAGQIIPWNF  210



>ref|XP_007153639.1| hypothetical protein PHAVU_003G052500g [Phaseolus vulgaris]
 gb|ESW25633.1| hypothetical protein PHAVU_003G052500g [Phaseolus vulgaris]
Length=535

 Score =   300 bits (767),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 136/172 (79%), Positives = 159/172 (92%), Gaps = 0/172 (0%)
 Frame = +3

Query  162  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  341
            + ++STAAA+EE + PAV+V+YTQ +I+GKFVD+ASGKTFPTLDPRT +VIAHVAEG +E
Sbjct  33   LCKYSTAAAIEEPIKPAVQVEYTQLLIDGKFVDAASGKTFPTLDPRTGEVIAHVAEGHSE  92

Query  342  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  521
            DI+RAVAAARKAFD GPWP+M+AYER RI+L+ ADL+EKH DE+A LETWDNGKPYEQ+A
Sbjct  93   DIDRAVAAARKAFDHGPWPRMTAYERQRILLRAADLIEKHNDEIAALETWDNGKPYEQSA  152

Query  522  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            K E+PM+VRLF YYAGWADKIHGLTVPADGP+HVQTLHEPIGVAGQIIPWNF
Sbjct  153  KIEIPMLVRLFRYYAGWADKIHGLTVPADGPYHVQTLHEPIGVAGQIIPWNF  204



>ref|XP_007031423.1| Aldehyde dehydrogenase 2B4 isoform 1 [Theobroma cacao]
 gb|EOY02349.1| Aldehyde dehydrogenase 2B4 isoform 1 [Theobroma cacao]
Length=511

 Score =   299 bits (765),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 135/173 (78%), Positives = 157/173 (91%), Gaps = 0/173 (0%)
 Frame = +3

Query  159  GIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEA  338
            GI  FST+AA++E +SP++ + +TQ +ING+FVD+ASGKTFPTLDPRT DVIAHVAEG+A
Sbjct  8    GINSFSTSAAIDEPISPSILIDHTQLLINGQFVDAASGKTFPTLDPRTGDVIAHVAEGDA  67

Query  339  EDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQA  518
            ED+NRAVAAARKAFDEGPWPK++AYERSRIM +FADL+EKH +E+ATLETWDNGKPYEQA
Sbjct  68   EDVNRAVAAARKAFDEGPWPKLTAYERSRIMFRFADLLEKHTEEVATLETWDNGKPYEQA  127

Query  519  AKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            AK E+P +VR+F YYAGWADKIHGLTVPADG HHVQTLHEP GV G IIPWNF
Sbjct  128  AKIEIPKVVRMFRYYAGWADKIHGLTVPADGQHHVQTLHEPYGVTGLIIPWNF  180



>ref|XP_010460154.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial 
[Camelina sativa]
Length=534

 Score =   300 bits (767),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 134/178 (75%), Positives = 161/178 (90%), Gaps = 1/178 (1%)
 Frame = +3

Query  147  GVESGIQRFST-AAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHV  323
            G+  G+QR+S  AAA+E  ++P V+V++TQ +ING+FVD+ASGKTFPTLDPR  +VIA V
Sbjct  26   GMNRGVQRYSNFAAALENTITPPVKVEHTQLLINGRFVDAASGKTFPTLDPRNGEVIAQV  85

Query  324  AEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGK  503
            AEG+AED+NRAVAAARKAFDEGPWP+M+AYERSRI+ +FADL+EKH DE+A LETWDNGK
Sbjct  86   AEGDAEDVNRAVAAARKAFDEGPWPRMTAYERSRILFRFADLIEKHNDEIAALETWDNGK  145

Query  504  PYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            P+EQAA+ E+PM+ R+F YYAGWADKIHG+TVPADGPHHVQTLHEPIGVAGQIIPWNF
Sbjct  146  PFEQAAQIEVPMLARVFRYYAGWADKIHGMTVPADGPHHVQTLHEPIGVAGQIIPWNF  203



>ref|XP_008453101.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Cucumis melo]
Length=554

 Score =   300 bits (768),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 142/186 (76%), Positives = 162/186 (87%), Gaps = 8/186 (4%)
 Frame = +3

Query  123  SAFLGWKYGVESGIQRFSTAA-AVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPR  299
            S FLG   G       F T+A A EEL++P V++ YTQ++ING+FVDSASGKTFPT DPR
Sbjct  45   SRFLGRGNG-------FGTSALAEEELITPPVQINYTQNLINGQFVDSASGKTFPTYDPR  97

Query  300  TEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELAT  479
            T +VIAHVAEG+AEDINRAV+AARKAFDEGPWP+MSAYERSRI+L+FADL+EKH  EL+ 
Sbjct  98   TGEVIAHVAEGDAEDINRAVSAARKAFDEGPWPRMSAYERSRILLRFADLIEKHAPELSA  157

Query  480  LETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQ  659
            LETW+NGKPYEQ+ KSELP++VRLFHYYAGWADKIHGLTVPADG HHVQ LHEPIGVAGQ
Sbjct  158  LETWNNGKPYEQSLKSELPLLVRLFHYYAGWADKIHGLTVPADGNHHVQVLHEPIGVAGQ  217

Query  660  IIPWNF  677
            IIPWNF
Sbjct  218  IIPWNF  223



>ref|XP_009391258.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
isoform X3 [Musa acuminata subsp. malaccensis]
Length=534

 Score =   299 bits (766),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 137/178 (77%), Positives = 159/178 (89%), Gaps = 1/178 (1%)
 Frame = +3

Query  147  GVESGI-QRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHV  323
            G  SG+ +RFS AAA+EE +SP V+VKY+Q +INGKFVDSASGKTFPTLDPR+ +VIA V
Sbjct  26   GSASGVFRRFSIAAAIEEPISPPVQVKYSQLLINGKFVDSASGKTFPTLDPRSGEVIAQV  85

Query  324  AEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGK  503
            AEG+AED+NRAV AARKAFDEGPWP+M+AYERSRI+ +FADL+EKH DE+A LETWDNGK
Sbjct  86   AEGDAEDVNRAVTAARKAFDEGPWPRMTAYERSRILNRFADLIEKHNDEIAALETWDNGK  145

Query  504  PYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            P+EQA++ E+PM+ RL  YYAGWADKIHGL VPADGPHHVQ LHEPIGVAGQIIPWNF
Sbjct  146  PFEQASQIEIPMLARLMRYYAGWADKIHGLVVPADGPHHVQVLHEPIGVAGQIIPWNF  203



>emb|CDY44985.1| BnaCnng12150D [Brassica napus]
Length=538

 Score =   300 bits (767),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 139/194 (72%), Positives = 167/194 (86%), Gaps = 5/194 (3%)
 Frame = +3

Query  111  FPSASAFLGWKYG--VESG---IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGK  275
            F ++S FL    G  + +G   ++RF T++A EE++SP+V+V YT+ +I+G FVD+ASGK
Sbjct  14   FSASSPFLSRSQGRNLNNGSRIVRRFGTSSAAEEVISPSVQVSYTKLLIDGNFVDAASGK  73

Query  276  TFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVE  455
            TFPTLDPRT +VIAHVAEG+AED+NRAV AARKAFDEGPWPKM+AYERSR+ML+FADLVE
Sbjct  74   TFPTLDPRTGEVIAHVAEGDAEDVNRAVKAARKAFDEGPWPKMTAYERSRVMLRFADLVE  133

Query  456  KHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLH  635
            KH +ELA LE+WDNGK YEQA  +E+PM+ RLF YYAGWADKIHGLTVPADG +HVQTLH
Sbjct  134  KHSEELAALESWDNGKTYEQALTAEIPMVARLFRYYAGWADKIHGLTVPADGNYHVQTLH  193

Query  636  EPIGVAGQIIPWNF  677
            EPIGVAGQIIPWNF
Sbjct  194  EPIGVAGQIIPWNF  207



>gb|KDP31120.1| hypothetical protein JCGZ_11496 [Jatropha curcas]
Length=541

 Score =   300 bits (767),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 136/172 (79%), Positives = 155/172 (90%), Gaps = 0/172 (0%)
 Frame = +3

Query  162  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  341
            I RFSTA+  EE ++P V+++YTQ++INGKFVD+ASGKTFP  DPRT +VIAHVAEG+AE
Sbjct  39   ICRFSTASVAEEPITPPVQIRYTQNLINGKFVDAASGKTFPAYDPRTGEVIAHVAEGDAE  98

Query  342  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  521
            DI+RAVAAARKAFDEGPWPKM+ YERSRI+L+FADLVEKH DELA LETW+NGKPYEQ+A
Sbjct  99   DIDRAVAAARKAFDEGPWPKMTPYERSRILLRFADLVEKHNDELAALETWNNGKPYEQSA  158

Query  522  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            KSELPM+ RLF YYAGWADKIHGLTVP D  HH+Q LHEPIGVAGQIIPWNF
Sbjct  159  KSELPMLARLFRYYAGWADKIHGLTVPGDSNHHIQVLHEPIGVAGQIIPWNF  210



>ref|XP_008781996.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial 
[Phoenix dactylifera]
Length=543

 Score =   300 bits (767),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 134/172 (78%), Positives = 154/172 (90%), Gaps = 0/172 (0%)
 Frame = +3

Query  162  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  341
            + RFSTA AVEE ++P V+V+YTQ +ING+FVD+ASG+TFPTLDPRT +VIAHVAEG+ E
Sbjct  41   LHRFSTAVAVEEPITPPVQVQYTQLLINGQFVDAASGRTFPTLDPRTGEVIAHVAEGDVE  100

Query  342  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  521
            D+NRAVAAARKAFD+GPWP+M+ YERSRI+L+FADL+EKH DE+A LETWDNGKPYEQAA
Sbjct  101  DVNRAVAAARKAFDQGPWPRMTGYERSRILLRFADLIEKHNDEIAALETWDNGKPYEQAA  160

Query  522  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
              E+PM  RL  YYAGWADKIHGL VPADGPHHVQ LHEPIGVAGQIIPWNF
Sbjct  161  NVEIPMFARLMRYYAGWADKIHGLVVPADGPHHVQVLHEPIGVAGQIIPWNF  212



>ref|XP_009391257.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=539

 Score =   299 bits (766),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 138/180 (77%), Positives = 160/180 (89%), Gaps = 1/180 (1%)
 Frame = +3

Query  141  KYGVESGI-QRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIA  317
            K G  SG+ +RFS AAA+EE +SP V+VKY+Q +INGKFVDSASGKTFPTLDPR+ +VIA
Sbjct  29   KDGSASGVFRRFSIAAAIEEPISPPVQVKYSQLLINGKFVDSASGKTFPTLDPRSGEVIA  88

Query  318  HVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDN  497
             VAEG+AED+NRAV AARKAFDEGPWP+M+AYERSRI+ +FADL+EKH DE+A LETWDN
Sbjct  89   QVAEGDAEDVNRAVTAARKAFDEGPWPRMTAYERSRILNRFADLIEKHNDEIAALETWDN  148

Query  498  GKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            GKP+EQA++ E+PM+ RL  YYAGWADKIHGL VPADGPHHVQ LHEPIGVAGQIIPWNF
Sbjct  149  GKPFEQASQIEIPMLARLMRYYAGWADKIHGLVVPADGPHHVQVLHEPIGVAGQIIPWNF  208



>gb|AGV54428.1| mitochondrial aldehyde dehydrogenase [Phaseolus vulgaris]
Length=535

 Score =   299 bits (766),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 136/172 (79%), Positives = 159/172 (92%), Gaps = 0/172 (0%)
 Frame = +3

Query  162  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  341
            + ++STAAA+EE + PAV+V+YTQ +I+GKFVD+ASGKTFPTLDPRT +VIAHVAEG +E
Sbjct  33   LCKYSTAAAIEEPIKPAVQVEYTQLLIDGKFVDAASGKTFPTLDPRTGEVIAHVAEGHSE  92

Query  342  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  521
            DI+RAVAAARKAFD GPWP+M+AYER RI+L+ ADL+EKH DE+A LETWDNGKPYEQ+A
Sbjct  93   DIDRAVAAARKAFDHGPWPRMTAYERQRILLRAADLIEKHNDEIAALETWDNGKPYEQSA  152

Query  522  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            K E+PM+VRLF YYAGWADKIHGLTVPADGP+HVQTLHEPIGVAGQIIPWNF
Sbjct  153  KIEIPMLVRLFRYYAGWADKIHGLTVPADGPYHVQTLHEPIGVAGQIIPWNF  204



>ref|XP_003527026.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Glycine max]
 gb|KHN19318.1| Aldehyde dehydrogenase family 2 member B4, mitochondrial [Glycine 
soja]
Length=540

 Score =   299 bits (765),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 163/191 (85%), Gaps = 2/191 (1%)
 Frame = +3

Query  111  FPSASAF--LGWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFP  284
            F +AS    LG   G      RFSTAAAVE+L++P V + YT+H+ING+FVD+ASGKTFP
Sbjct  19   FQAASLLHSLGRNSGKWGNFNRFSTAAAVEDLITPQVPITYTKHLINGQFVDAASGKTFP  78

Query  285  TLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHM  464
            T DPRT +VIA VAEG+AEDINRAV+AARKAFDEGPWPK++AYER +I+L+FADLVEKH 
Sbjct  79   TYDPRTGEVIAQVAEGDAEDINRAVSAARKAFDEGPWPKLTAYERCKIILRFADLVEKHG  138

Query  465  DELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPI  644
            DELA LETW+NGKPYEQ+A +ELP  VRLF YYAGWADKIHGLTVPADG +HV+TLHEPI
Sbjct  139  DELAALETWNNGKPYEQSATAELPTFVRLFRYYAGWADKIHGLTVPADGNYHVETLHEPI  198

Query  645  GVAGQIIPWNF  677
            GVAGQIIPWNF
Sbjct  199  GVAGQIIPWNF  209



>ref|XP_009612265.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Nicotiana tomentosiformis]
Length=536

 Score =   299 bits (765),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 135/170 (79%), Positives = 158/170 (93%), Gaps = 0/170 (0%)
 Frame = +3

Query  168  RFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDI  347
            ++STAAA+EE + PAV V++T+  ING+FVD+ASGKTFPTLDPRT +VIAHVAEG+AEDI
Sbjct  36   QYSTAAAIEEPIKPAVNVEHTKLFINGQFVDAASGKTFPTLDPRTGEVIAHVAEGDAEDI  95

Query  348  NRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKS  527
            NRAVAAARKAFDEGPWPKM+AYERS+I+L+ ADL+EKH D++ATLETWD GKPYEQAAK 
Sbjct  96   NRAVAAARKAFDEGPWPKMNAYERSKILLRLADLIEKHNDQIATLETWDTGKPYEQAAKI  155

Query  528  ELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            E+PM+VRL  YYAGWADKIHG+T+PADGP+HVQTLHEPIGVAGQIIPWNF
Sbjct  156  EVPMVVRLLRYYAGWADKIHGMTIPADGPYHVQTLHEPIGVAGQIIPWNF  205



>ref|XP_006404308.1| hypothetical protein EUTSA_v10010271mg [Eutrema salsugineum]
 dbj|BAJ34644.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ45761.1| hypothetical protein EUTSA_v10010271mg [Eutrema salsugineum]
Length=538

 Score =   299 bits (765),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 135/171 (79%), Positives = 157/171 (92%), Gaps = 0/171 (0%)
 Frame = +3

Query  165  QRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAED  344
            +RF T++A EE++SP+V+V +TQ +I+G FVD+ASGKTFPTLDPRT +VIAHVAEG+AED
Sbjct  37   RRFGTSSAAEEIISPSVQVSHTQLLIDGNFVDAASGKTFPTLDPRTGEVIAHVAEGDAED  96

Query  345  INRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAK  524
            INRAV AARKAFDEGPWPKM+AYERSRIML+FADLVEKH ++LA+LE+WDNGK YEQA  
Sbjct  97   INRAVKAARKAFDEGPWPKMTAYERSRIMLRFADLVEKHSEQLASLESWDNGKTYEQAKT  156

Query  525  SELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            SE+PM+ RLF YYAGWADKIHGLTVPADG +HVQTLHEPIGVAGQIIPWNF
Sbjct  157  SEIPMLARLFRYYAGWADKIHGLTVPADGNYHVQTLHEPIGVAGQIIPWNF  207



>ref|XP_009391256.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=541

 Score =   298 bits (764),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 137/178 (77%), Positives = 159/178 (89%), Gaps = 1/178 (1%)
 Frame = +3

Query  147  GVESGI-QRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHV  323
            G  SG+ +RFS AAA+EE +SP V+VKY+Q +INGKFVDSASGKTFPTLDPR+ +VIA V
Sbjct  33   GSASGVFRRFSIAAAIEEPISPPVQVKYSQLLINGKFVDSASGKTFPTLDPRSGEVIAQV  92

Query  324  AEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGK  503
            AEG+AED+NRAV AARKAFDEGPWP+M+AYERSRI+ +FADL+EKH DE+A LETWDNGK
Sbjct  93   AEGDAEDVNRAVTAARKAFDEGPWPRMTAYERSRILNRFADLIEKHNDEIAALETWDNGK  152

Query  504  PYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            P+EQA++ E+PM+ RL  YYAGWADKIHGL VPADGPHHVQ LHEPIGVAGQIIPWNF
Sbjct  153  PFEQASQIEIPMLARLMRYYAGWADKIHGLVVPADGPHHVQVLHEPIGVAGQIIPWNF  210



>ref|XP_009759823.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Nicotiana sylvestris]
Length=542

 Score =   298 bits (764),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 135/170 (79%), Positives = 158/170 (93%), Gaps = 0/170 (0%)
 Frame = +3

Query  168  RFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDI  347
            ++STAAA+EE + PAV V++T+  ING+FVD+ASGKTFPTLDPRT +VIAHVAEG+AEDI
Sbjct  42   QYSTAAAIEEPIKPAVNVEHTKLFINGQFVDAASGKTFPTLDPRTGEVIAHVAEGDAEDI  101

Query  348  NRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKS  527
            NRAVAAARKAFDEGPWPKM+AYERS+I+L+ ADL+EKH D++ATLETWD GKPYEQAAK 
Sbjct  102  NRAVAAARKAFDEGPWPKMNAYERSKILLRLADLIEKHNDQIATLETWDTGKPYEQAAKI  161

Query  528  ELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            E+PM+VRL  YYAGWADKIHG+T+PADGP+HVQTLHEPIGVAGQIIPWNF
Sbjct  162  EVPMVVRLLRYYAGWADKIHGMTIPADGPYHVQTLHEPIGVAGQIIPWNF  211



>gb|EPS72983.1| mitochondrial benzaldehyde dehydrogenase, partial [Genlisea aurea]
Length=512

 Score =   297 bits (761),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 135/174 (78%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = +3

Query  156  SGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGE  335
            +GI R+STAA +E+ + P V V+Y + +ING+FVD+ASGKTFPTLDPRT +VIAHVAEGE
Sbjct  8    NGIYRYSTAAVLEDPIKPPVSVQYDKLLINGQFVDAASGKTFPTLDPRTGEVIAHVAEGE  67

Query  336  AEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQ  515
            AEDINRAVA+ARKAFDEGPWP+++AYER RI+L+FADLVEK  DE+A LETWD+GKPYEQ
Sbjct  68   AEDINRAVASARKAFDEGPWPRLTAYERQRILLRFADLVEKSNDEIAALETWDSGKPYEQ  127

Query  516  AAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            AA+ E+PM VRLF YYAGWADKIHG+T+PADGPHHVQTLHEPIGVAGQIIPWNF
Sbjct  128  AAQIEVPMFVRLFRYYAGWADKIHGMTLPADGPHHVQTLHEPIGVAGQIIPWNF  181



>ref|XP_006476755.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Citrus sinensis]
Length=538

 Score =   298 bits (763),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 140/193 (73%), Positives = 164/193 (85%), Gaps = 4/193 (2%)
 Frame = +3

Query  111  FPSASAFLGWKYGVES----GIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKT  278
            FPSAS  L    G ES    GI RFSTAA VEE + P V++ YT+++ING+FVD+ASGKT
Sbjct  15   FPSASPSLLRSLGRESSRARGISRFSTAAVVEEPIIPPVQISYTKNLINGQFVDAASGKT  74

Query  279  FPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEK  458
            FP  DPRT +VIA+VAEG+AEDI+RAVA ARKAFDEGPWPKM+ YERSRIML+ ADL+EK
Sbjct  75   FPVYDPRTAEVIANVAEGDAEDIDRAVATARKAFDEGPWPKMTPYERSRIMLRAADLIEK  134

Query  459  HMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHE  638
            +M+ELA LETW+NGKPY Q+ KSE+PM+VRL HYYAGWADKIHGLTVP DG +H+QTLHE
Sbjct  135  NMEELAALETWNNGKPYVQSLKSEVPMVVRLLHYYAGWADKIHGLTVPGDGNYHIQTLHE  194

Query  639  PIGVAGQIIPWNF  677
            PIGVAGQI+PWNF
Sbjct  195  PIGVAGQIVPWNF  207



>ref|XP_006439784.1| hypothetical protein CICLE_v10019638mg [Citrus clementina]
 gb|ESR53024.1| hypothetical protein CICLE_v10019638mg [Citrus clementina]
Length=538

 Score =   298 bits (762),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 140/193 (73%), Positives = 164/193 (85%), Gaps = 4/193 (2%)
 Frame = +3

Query  111  FPSASAFLGWKYGVES----GIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKT  278
            FPSAS  L    G ES    GI RFSTAA VEE + P V++ YT+++ING+FVD+ASGKT
Sbjct  15   FPSASPSLLRSLGRESSRARGISRFSTAAVVEEPIIPPVQISYTKNLINGQFVDAASGKT  74

Query  279  FPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEK  458
            FP  DPRT +VIA+VAEG+AEDI+RAVA ARKAFDEGPWPKM+ YERSRIML+ ADL+EK
Sbjct  75   FPVYDPRTAEVIANVAEGDAEDIDRAVATARKAFDEGPWPKMTPYERSRIMLRAADLIEK  134

Query  459  HMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHE  638
            +M+ELA LETW+NGKPY Q+ KSE+PM+VRL HYYAGWADKIHGLTVP DG +H+QTLHE
Sbjct  135  NMEELAALETWNNGKPYVQSLKSEVPMVVRLLHYYAGWADKIHGLTVPGDGNYHIQTLHE  194

Query  639  PIGVAGQIIPWNF  677
            PIGVAGQI+PWNF
Sbjct  195  PIGVAGQIVPWNF  207



>ref|XP_011028588.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Populus euphratica]
Length=539

 Score =   298 bits (762),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 143/192 (74%), Positives = 162/192 (84%), Gaps = 4/192 (2%)
 Frame = +3

Query  114  PSASAFLGWKYG----VESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTF  281
            PSAS  L    G       G+ RFS AAA+EE ++P V++ YT+ +ING+FVD+ASGKTF
Sbjct  17   PSASTPLLLSRGKNPITGRGVYRFSNAAALEETITPPVQISYTKLLINGQFVDAASGKTF  76

Query  282  PTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKH  461
            PT DPRT +VIAHVAEG+AED+NRAVAAARKAFDEGPWPKMSAYERS IML+FADLV+KH
Sbjct  77   PTHDPRTGEVIAHVAEGDAEDVNRAVAAARKAFDEGPWPKMSAYERSLIMLRFADLVDKH  136

Query  462  MDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEP  641
              ELA LE+W++GKPYEQ+AKSELP   RLF YYAGWADKIHGLTVPADG HHVQTLHEP
Sbjct  137  RGELAALESWNSGKPYEQSAKSELPSFARLFRYYAGWADKIHGLTVPADGNHHVQTLHEP  196

Query  642  IGVAGQIIPWNF  677
            IGVAGQIIPWNF
Sbjct  197  IGVAGQIIPWNF  208



>ref|XP_010498885.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Camelina sativa]
Length=534

 Score =   297 bits (760),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 133/178 (75%), Positives = 160/178 (90%), Gaps = 1/178 (1%)
 Frame = +3

Query  147  GVESGIQRFST-AAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHV  323
            G+  G+QR+S  AAA+E  ++P V+V++TQ +ING+FVD+ASGKTFPTLDPR  +VIA V
Sbjct  26   GMNRGVQRYSNFAAALENTITPPVKVEHTQLLINGRFVDAASGKTFPTLDPRNGEVIAQV  85

Query  324  AEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGK  503
            AEG+AED+NRAVAAARKAFDEGPWP+M+AYERSRI+ +FADL+EKH DE+A LETWD GK
Sbjct  86   AEGDAEDVNRAVAAARKAFDEGPWPRMTAYERSRILFRFADLIEKHNDEIAALETWDCGK  145

Query  504  PYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            P+EQ+AK E+PM+ R+F YYAGWADKIHG+TVPADGPHHVQTLHEPIGVAGQIIPWNF
Sbjct  146  PFEQSAKIEVPMLARVFRYYAGWADKIHGMTVPADGPHHVQTLHEPIGVAGQIIPWNF  203



>ref|XP_006844236.1| hypothetical protein AMTR_s00006p00268060 [Amborella trichopoda]
 gb|ERN05911.1| hypothetical protein AMTR_s00006p00268060 [Amborella trichopoda]
Length=501

 Score =   296 bits (757),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 135/169 (80%), Positives = 153/169 (91%), Gaps = 0/169 (0%)
 Frame = +3

Query  171  FSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDIN  350
            FS+A A EE ++P V+V+YTQ +I GK+VDSASGKTFPTLDPRT +VIAHVAEG+AEDIN
Sbjct  2    FSSAVAAEEPITPPVQVEYTQLLIGGKYVDSASGKTFPTLDPRTGEVIAHVAEGDAEDIN  61

Query  351  RAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSE  530
            RAV+AARKAFD+GPWP+M+AYERSRI+ +FADLVEKH DELA LETWDNGKPYEQA+ +E
Sbjct  62   RAVSAARKAFDDGPWPRMTAYERSRILYRFADLVEKHNDELAALETWDNGKPYEQASLAE  121

Query  531  LPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            +PM VRL  YYAGWADKIHGL VPADGPHHVQ LHEPIGVAGQIIPWNF
Sbjct  122  IPMFVRLMRYYAGWADKIHGLVVPADGPHHVQVLHEPIGVAGQIIPWNF  170



>ref|XP_011044320.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Populus euphratica]
Length=538

 Score =   296 bits (759),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 137/173 (79%), Positives = 153/173 (88%), Gaps = 0/173 (0%)
 Frame = +3

Query  159  GIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEA  338
            GI RF TA A+EE ++P V++ YTQH INGKFVD+ASGKTFP  DPRT +VIAHVAEG+ 
Sbjct  35   GIYRFITATALEEPITPPVQISYTQHFINGKFVDAASGKTFPAYDPRTGEVIAHVAEGDT  94

Query  339  EDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQA  518
            ED+NRAVAAARKAFDEGPWPKMSAYERS IML+FADLV+KH DELA LE+W++GKPYEQ+
Sbjct  95   EDVNRAVAAARKAFDEGPWPKMSAYERSLIMLRFADLVDKHRDELAALESWNSGKPYEQS  154

Query  519  AKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            AKSELP   RLF YYAGWADKIHGLTVPAD  H+VQTLHEPIGVAGQIIPWNF
Sbjct  155  AKSELPSFARLFRYYAGWADKIHGLTVPADSNHYVQTLHEPIGVAGQIIPWNF  207



>ref|XP_006290873.1| hypothetical protein CARUB_v10016983mg [Capsella rubella]
 gb|EOA23771.1| hypothetical protein CARUB_v10016983mg [Capsella rubella]
Length=537

 Score =   296 bits (759),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 133/172 (77%), Positives = 156/172 (91%), Gaps = 0/172 (0%)
 Frame = +3

Query  162  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  341
            ++RF T++A EE+++P+V+V +TQ +I+G FVD+ASGKTFPTLDPRT +VIA VAEG+AE
Sbjct  35   LRRFGTSSAAEEIINPSVQVSHTQLLIDGNFVDAASGKTFPTLDPRTGEVIAQVAEGDAE  94

Query  342  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  521
            DINRAV AARKAFDEGPWPKMSAYERSR+ML+FADLVEKH +ELA+LETWDNGKPY+Q+ 
Sbjct  95   DINRAVKAARKAFDEGPWPKMSAYERSRVMLRFADLVEKHSEELASLETWDNGKPYQQSK  154

Query  522  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
              E+PM  RLF YYAGWADKIHGLTVPADG +HVQTLHEPIGVAGQIIPWNF
Sbjct  155  NVEIPMFARLFRYYAGWADKIHGLTVPADGNYHVQTLHEPIGVAGQIIPWNF  206



>gb|ABK92547.1| unknown [Populus trichocarpa]
Length=432

 Score =   293 bits (750),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 136/172 (79%), Positives = 152/172 (88%), Gaps = 0/172 (0%)
 Frame = +3

Query  162  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  341
            I RF TA A+EE ++P V++ YTQH INGKFVD+ASGKTFP  DPRT +VIAHVAEG+ E
Sbjct  34   IYRFITAKALEEPITPPVQISYTQHFINGKFVDAASGKTFPAYDPRTGEVIAHVAEGDNE  93

Query  342  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  521
            D+NRAVAAARKAFDEGPWPKMSAYERS IML+FADLV+KH DELA LE+W++GKPYEQ+A
Sbjct  94   DVNRAVAAARKAFDEGPWPKMSAYERSLIMLRFADLVDKHRDELAALESWNSGKPYEQSA  153

Query  522  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            KSELP   RLF YYAGWADKIHGLTVPAD  H+VQTLHEPIGVAGQIIPWNF
Sbjct  154  KSELPSFARLFRYYAGWADKIHGLTVPADSNHYVQTLHEPIGVAGQIIPWNF  205



>emb|CAA71003.1| aldehyde dehydrogenase (NAD+) [Nicotiana tabacum]
Length=542

 Score =   296 bits (758),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 134/170 (79%), Positives = 157/170 (92%), Gaps = 0/170 (0%)
 Frame = +3

Query  168  RFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDI  347
            ++STAAA+EE + PAV V++T+  ING+FVD+ASGKTFPTLDPRT +VIAHVAEG+AEDI
Sbjct  42   QYSTAAAIEEPIKPAVNVEHTKLFINGQFVDAASGKTFPTLDPRTGEVIAHVAEGDAEDI  101

Query  348  NRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKS  527
            NRAVAAARKAFDEGPWPKM+AYERS+I ++ ADL+EKH D++ATLETWD GKPYEQAAK 
Sbjct  102  NRAVAAARKAFDEGPWPKMNAYERSKIFVRLADLIEKHNDQIATLETWDTGKPYEQAAKI  161

Query  528  ELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            E+PM+VRL  YYAGWADKIHG+T+PADGP+HVQTLHEPIGVAGQIIPWNF
Sbjct  162  EVPMVVRLLRYYAGWADKIHGMTIPADGPYHVQTLHEPIGVAGQIIPWNF  211



>gb|KJB50197.1| hypothetical protein B456_008G158500 [Gossypium raimondii]
Length=531

 Score =   296 bits (757),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 134/175 (77%), Positives = 156/175 (89%), Gaps = 0/175 (0%)
 Frame = +3

Query  153  ESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEG  332
             S +  ++TAAA+E+ ++P++ V YT+ +ING FVDSASGKTFPT DPRT DVIAHVAEG
Sbjct  26   RSVVCSYTTAAALEKPITPSINVNYTKLLINGNFVDSASGKTFPTYDPRTGDVIAHVAEG  85

Query  333  EAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYE  512
            +AEDINRAV+AARKAFDEGPWPKM+AYERSR++ +FADL+++H +ELATLETWDNGKPYE
Sbjct  86   DAEDINRAVSAARKAFDEGPWPKMTAYERSRVLFRFADLIDQHTEELATLETWDNGKPYE  145

Query  513  QAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            QAAK ELPMI RL  YYAGWADKIHGLTVPAD PH VQT+HEPIGVAGQIIPWNF
Sbjct  146  QAAKIELPMISRLIRYYAGWADKIHGLTVPADSPHLVQTIHEPIGVAGQIIPWNF  200



>ref|XP_002301540.1| mitochondrial aldehyde dehydrogenase family protein [Populus 
trichocarpa]
 gb|EEE80813.1| mitochondrial aldehyde dehydrogenase family protein [Populus 
trichocarpa]
Length=540

 Score =   296 bits (757),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 135/173 (78%), Positives = 157/173 (91%), Gaps = 1/173 (1%)
 Frame = +3

Query  162  IQRFSTA-AAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEA  338
            I R++T  AAVE+ ++P V VKY Q +ING+FVD+ASGKTFPTLDPRT +VIAHVAEG+ 
Sbjct  37   ISRYNTTLAAVEDPITPPVSVKYNQLLINGQFVDAASGKTFPTLDPRTGEVIAHVAEGDV  96

Query  339  EDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQA  518
            ED+NRAV+AARKAFDEGPWP+M+AYERSRI+ +FADL+EKH DE+A LETWDNGKPYEQ+
Sbjct  97   EDVNRAVSAARKAFDEGPWPRMTAYERSRIIWRFADLLEKHTDEIAALETWDNGKPYEQS  156

Query  519  AKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            AK E+PM VR+F YYAGWADKIHGLTVPADGP+HVQTLHEPIGVAGQIIPWNF
Sbjct  157  AKIEIPMTVRIFRYYAGWADKIHGLTVPADGPYHVQTLHEPIGVAGQIIPWNF  209



>ref|XP_002274863.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial 
[Vitis vinifera]
 emb|CBI34947.3| unnamed protein product [Vitis vinifera]
Length=535

 Score =   295 bits (756),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 136/174 (78%), Positives = 154/174 (89%), Gaps = 1/174 (1%)
 Frame = +3

Query  159  GIQRFSTAAAVEEL-VSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGE  335
            G  RFSTA A EE  ++P V++ YTQ +ING+FVD+ASGKTFPTLDPRT DVIAHVAEGE
Sbjct  31   GSSRFSTAVATEEEPITPPVQIDYTQLLINGRFVDAASGKTFPTLDPRTGDVIAHVAEGE  90

Query  336  AEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQ  515
            AEDINRAV+AARKAFDEGPWPKM+ YERS I+ +FADL+EKH  E+A LE+WDNGKPYEQ
Sbjct  91   AEDINRAVSAARKAFDEGPWPKMTPYERSCILFRFADLLEKHCSEIAALESWDNGKPYEQ  150

Query  516  AAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            AA  E+PM++R+F YYAGWADKIHGLTVPADG HHVQTLHEPIGVAGQIIPWNF
Sbjct  151  AANVEIPMVIRVFRYYAGWADKIHGLTVPADGLHHVQTLHEPIGVAGQIIPWNF  204



>ref|XP_004238676.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial 
[Solanum lycopersicum]
Length=529

 Score =   295 bits (756),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 133/170 (78%), Positives = 155/170 (91%), Gaps = 0/170 (0%)
 Frame = +3

Query  168  RFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDI  347
            ++STAAA EE V P V V +T+ +ING+FVDSASGKTFPTLDPRT +VIAH+AEG+AEDI
Sbjct  29   KYSTAAAFEEPVKPTVNVDHTKLLINGQFVDSASGKTFPTLDPRTGEVIAHIAEGDAEDI  88

Query  348  NRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKS  527
            NRAVAAARKAFDEGPWP+M+AYERS+I+L+ ADL+EKH D++ATLETWD GKPY QAAK 
Sbjct  89   NRAVAAARKAFDEGPWPRMTAYERSKILLRLADLIEKHNDQIATLETWDTGKPYAQAAKI  148

Query  528  ELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            E+PM+VRL  YYAGWADKIHG+T+PADGP+HVQTLHEPIGVAGQIIPWNF
Sbjct  149  EVPMVVRLLRYYAGWADKIHGMTIPADGPYHVQTLHEPIGVAGQIIPWNF  198



>gb|KCW86739.1| hypothetical protein EUGRSUZ_B03349 [Eucalyptus grandis]
Length=544

 Score =   295 bits (756),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 136/172 (79%), Positives = 154/172 (90%), Gaps = 0/172 (0%)
 Frame = +3

Query  162  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  341
            I+ +STAAA+EE ++P V V +TQ  ING++VDSASGKTFPT DPRT +VIAHVAEGEAE
Sbjct  42   IKSYSTAAAIEEPINPGVTVNHTQLFINGQYVDSASGKTFPTFDPRTGEVIAHVAEGEAE  101

Query  342  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  521
            DINRAVAAARKAFDEGPWP+M+AYER+ ++ +FADL+EKH DE+A LETWDNGKPYEQAA
Sbjct  102  DINRAVAAARKAFDEGPWPRMTAYERANVLFRFADLLEKHNDEIAALETWDNGKPYEQAA  161

Query  522  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            K ELPMIVR   YYAGWADKIHGLTVPADG +HVQTLHEPIGVAGQIIPWNF
Sbjct  162  KIELPMIVRQIRYYAGWADKIHGLTVPADGQYHVQTLHEPIGVAGQIIPWNF  213



>ref|XP_010551563.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial 
[Tarenaya hassleriana]
Length=540

 Score =   295 bits (755),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 142/192 (74%), Positives = 163/192 (85%), Gaps = 4/192 (2%)
 Frame = +3

Query  114  PSASAFLGWKYGVESGIQRFSTAAA----VEELVSPAVEVKYTQHIINGKFVDSASGKTF  281
            PS  +  G    V  G+ R+STAAA    +E  +SP V+V+ TQ +I+GKFVDSASGKTF
Sbjct  18   PSLLSLGGKSPHVSRGVHRYSTAAAAAAALEVPISPPVKVELTQLLIDGKFVDSASGKTF  77

Query  282  PTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKH  461
            PTLDPRT DVIAHVAEG+ ED+NRAV+AAR AFDEGPWP+M+AYERS+I+L+ ADLVEKH
Sbjct  78   PTLDPRTGDVIAHVAEGDVEDVNRAVSAARMAFDEGPWPRMTAYERSKILLRCADLVEKH  137

Query  462  MDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEP  641
             DE+A LETWDNGKPY+QAAK E+PM+ RLF YYAGWADKIHGLTVPADGPHHVQTLHEP
Sbjct  138  NDEIAALETWDNGKPYDQAAKVEVPMLTRLFRYYAGWADKIHGLTVPADGPHHVQTLHEP  197

Query  642  IGVAGQIIPWNF  677
            IGVAGQIIPWNF
Sbjct  198  IGVAGQIIPWNF  209



>ref|XP_010044646.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Eucalyptus grandis]
 gb|KCW86738.1| hypothetical protein EUGRSUZ_B03349 [Eucalyptus grandis]
Length=544

 Score =   295 bits (755),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 136/172 (79%), Positives = 154/172 (90%), Gaps = 0/172 (0%)
 Frame = +3

Query  162  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  341
            I+ +STAAA+EE ++P V V +TQ  ING++VDSASGKTFPT DPRT +VIAHVAEGEAE
Sbjct  42   IKSYSTAAAIEEPINPGVTVNHTQLFINGQYVDSASGKTFPTFDPRTGEVIAHVAEGEAE  101

Query  342  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  521
            DINRAVAAARKAFDEGPWP+M+AYER+ ++ +FADL+EKH DE+A LETWDNGKPYEQAA
Sbjct  102  DINRAVAAARKAFDEGPWPRMTAYERANVLFRFADLLEKHNDEIAALETWDNGKPYEQAA  161

Query  522  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            K ELPMIVR   YYAGWADKIHGLTVPADG +HVQTLHEPIGVAGQIIPWNF
Sbjct  162  KIELPMIVRQIRYYAGWADKIHGLTVPADGQYHVQTLHEPIGVAGQIIPWNF  213



>ref|XP_006355977.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Solanum tuberosum]
Length=529

 Score =   295 bits (754),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 132/170 (78%), Positives = 155/170 (91%), Gaps = 0/170 (0%)
 Frame = +3

Query  168  RFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDI  347
            ++STAAA+EE + P V V +T+  ING+FVDSASGKTFPTLDPRT +VIAH+AEG+AEDI
Sbjct  29   KYSTAAALEEPIKPTVNVDHTKLFINGQFVDSASGKTFPTLDPRTGEVIAHIAEGDAEDI  88

Query  348  NRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKS  527
            NRAVAAARKAFDEGPWP+M+AYERS+I+L+ ADL+EKH D++ATLETWD GKPY QAAK 
Sbjct  89   NRAVAAARKAFDEGPWPRMTAYERSKILLRLADLIEKHNDQIATLETWDTGKPYAQAAKI  148

Query  528  ELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            E+PM+VRL  YYAGWADKIHG+T+PADGP+HVQTLHEPIGVAGQIIPWNF
Sbjct  149  EVPMVVRLLRYYAGWADKIHGMTIPADGPYHVQTLHEPIGVAGQIIPWNF  198



>ref|XP_006656871.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Oryza brachyantha]
Length=549

 Score =   295 bits (755),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 136/172 (79%), Positives = 152/172 (88%), Gaps = 0/172 (0%)
 Frame = +3

Query  162  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  341
            +QRFSTAAA EE +SP  +V+  Q +I GKFVDSASGKTF TLDPRT +VIAHV+EG+AE
Sbjct  47   LQRFSTAAAAEEPISPPFQVQDKQLLIGGKFVDSASGKTFSTLDPRTGEVIAHVSEGDAE  106

Query  342  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  521
            DINRAV+AARKAFDEGPWP+M+AYERSRI+L+FADL+EKH DELA LETWDNGKPY QAA
Sbjct  107  DINRAVSAARKAFDEGPWPRMTAYERSRILLRFADLIEKHNDELAALETWDNGKPYAQAA  166

Query  522  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
              E+PM+ RL  YYAGWADKIHGL VPADGPHHVQ LHEPIGVAGQIIPWNF
Sbjct  167  NIEVPMVARLMRYYAGWADKIHGLVVPADGPHHVQVLHEPIGVAGQIIPWNF  218



>gb|KHG27537.1| Aldehyde dehydrogenase family 2 member B4, mitochondrial [Gossypium 
arboreum]
Length=531

 Score =   295 bits (754),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 134/169 (79%), Positives = 154/169 (91%), Gaps = 0/169 (0%)
 Frame = +3

Query  171  FSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDIN  350
            ++TAAA+E+  +P+++V YT+ +ING FVDSASGKTFPT DPRT DVIAHVAEG+AEDIN
Sbjct  32   YTTAAALEKPFTPSIKVNYTKLLINGNFVDSASGKTFPTYDPRTGDVIAHVAEGDAEDIN  91

Query  351  RAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSE  530
            RAV+AARKAFDEGPWPKM+AYERSRI+ +FADL+++H +ELATLETWDNGKPYEQAAK E
Sbjct  92   RAVSAARKAFDEGPWPKMTAYERSRILFRFADLIDQHTEELATLETWDNGKPYEQAAKIE  151

Query  531  LPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            LPMI RL  YYAGWADKIHGLTVPAD PH VQT+HEPIGVAGQIIPWNF
Sbjct  152  LPMISRLIRYYAGWADKIHGLTVPADSPHLVQTIHEPIGVAGQIIPWNF  200



>ref|XP_010653335.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial 
[Vitis vinifera]
 emb|CBI32132.3| unnamed protein product [Vitis vinifera]
 gb|AFY12671.1| mitochondrial aldehyde dehydrogenase 2B8 [Vitis quinquangularis]
Length=538

 Score =   295 bits (754),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 134/182 (74%), Positives = 159/182 (87%), Gaps = 0/182 (0%)
 Frame = +3

Query  132  LGWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDV  311
            +G       GI R+STAA VEE ++P+V V YTQ +ING+FVD+A+GKTF TLDPRT +V
Sbjct  26   IGRNSSRRGGIFRYSTAAVVEEPINPSVNVNYTQLLINGQFVDAATGKTFETLDPRTGNV  85

Query  312  IAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETW  491
            IA VAEG+AED+NRAV+AARKAFDEGPWP+MS YERS+I+L+FADL+EKH DE+A LETW
Sbjct  86   IASVAEGDAEDVNRAVSAARKAFDEGPWPRMSPYERSKILLRFADLLEKHNDEIAALETW  145

Query  492  DNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPW  671
            DNGKP+EQAAK+E+P+++RL  YYAGWADKIHGLTVPADG H VQTLHEPIGVAGQIIPW
Sbjct  146  DNGKPFEQAAKAEVPLVIRLMRYYAGWADKIHGLTVPADGLHQVQTLHEPIGVAGQIIPW  205

Query  672  NF  677
            NF
Sbjct  206  NF  207



>gb|ACM89738.1| mitochondrial benzaldehyde dehydrogenase [Antirrhinum majus]
Length=534

 Score =   294 bits (753),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 136/175 (78%), Positives = 155/175 (89%), Gaps = 2/175 (1%)
 Frame = +3

Query  159  GIQRFSTAAA--VEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEG  332
            G+ R+ TAAA  +EE + P V V+Y + +ING+FVD+ASGKTFPTLDPR+ +VIAHVAEG
Sbjct  29   GVYRYGTAAAAALEEPIKPPVSVQYDKLLINGQFVDAASGKTFPTLDPRSGEVIAHVAEG  88

Query  333  EAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYE  512
            +AEDINRAVAAARKAFDEGPWPKM AYER +IML+FADLVEKH DE+A LE WD+GKPYE
Sbjct  89   DAEDINRAVAAARKAFDEGPWPKMPAYERQKIMLRFADLVEKHNDEVAALEAWDSGKPYE  148

Query  513  QAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            Q A+ E+PM VRLF YYAGWADKIHGLT+PADGPHHVQTLHEPIGVAGQIIPWNF
Sbjct  149  QCAQVEIPMFVRLFRYYAGWADKIHGLTIPADGPHHVQTLHEPIGVAGQIIPWNF  203



>dbj|BAB62757.1| mitochondrial aldehyde dehydrogenase ALDH2 [Hordeum vulgare subsp. 
vulgare]
 dbj|BAJ90704.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86905.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=549

 Score =   295 bits (754),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 134/172 (78%), Positives = 152/172 (88%), Gaps = 0/172 (0%)
 Frame = +3

Query  162  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  341
            +QRF TAAA EE +SP+V+V  TQ +INGKFVD+ASGKTFPTLDPRT +VIA V+EG+AE
Sbjct  47   LQRFGTAAAAEEPISPSVQVGETQLLINGKFVDAASGKTFPTLDPRTGEVIARVSEGDAE  106

Query  342  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  521
            D++RAV AARKAFDEGPWPKM+AYERSRI+L+FADL+EKH DE+A LETWDNGKPYEQAA
Sbjct  107  DVDRAVVAARKAFDEGPWPKMTAYERSRILLRFADLIEKHNDEIAALETWDNGKPYEQAA  166

Query  522  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
              E+PM+ RL  YYAGW DKIHGL VPADGPHHVQ LHEPIGV GQIIPWNF
Sbjct  167  HIEVPMLARLMRYYAGWTDKIHGLIVPADGPHHVQVLHEPIGVVGQIIPWNF  218



>ref|XP_011463376.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
isoform X1 [Fragaria vesca subsp. vesca]
Length=531

 Score =   294 bits (752),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 138/184 (75%), Positives = 160/184 (87%), Gaps = 1/184 (1%)
 Frame = +3

Query  129  FLGWKYGVESGIQRFSTAAA-VEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTE  305
             LG    V  GI ++STAAA VE+ ++P V V +T+ +ING+FVD+ASGKTFPTLDPRT 
Sbjct  17   LLGRSSSVSRGIGKYSTAAAAVEDPITPPVIVGHTKLLINGQFVDAASGKTFPTLDPRTG  76

Query  306  DVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLE  485
            DVIAHVAEG+AED+NRAVAAARKAFDEGPWPKM+AYERSR++ +FADL+EK  DELA LE
Sbjct  77   DVIAHVAEGDAEDVNRAVAAARKAFDEGPWPKMTAYERSRVLFRFADLIEKQNDELAALE  136

Query  486  TWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQII  665
            TWDNGKP+EQ+AK E+PM  R F YYAG+ADKIHGLTVPADGP+HVQTLHEPIGVAGQII
Sbjct  137  TWDNGKPFEQSAKIEVPMFARFFRYYAGYADKIHGLTVPADGPYHVQTLHEPIGVAGQII  196

Query  666  PWNF  677
            PWNF
Sbjct  197  PWNF  200



>ref|XP_002318034.1| aldehyde dehydrogenase 1 precursor family protein [Populus trichocarpa]
 gb|EEE96254.1| aldehyde dehydrogenase 1 precursor family protein [Populus trichocarpa]
Length=536

 Score =   293 bits (751),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 136/172 (79%), Positives = 152/172 (88%), Gaps = 0/172 (0%)
 Frame = +3

Query  162  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  341
            I RF TA A+EE ++P V++ YTQH INGKFVD+ASGKTFP  DPRT +VIAHVAEG+ E
Sbjct  34   IYRFITAKALEEPITPPVQISYTQHFINGKFVDAASGKTFPAYDPRTGEVIAHVAEGDNE  93

Query  342  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  521
            D+NRAVAAARKAFDEGPWPKMSAYERS IML+FADLV+KH DELA LE+W++GKPYEQ+A
Sbjct  94   DVNRAVAAARKAFDEGPWPKMSAYERSLIMLRFADLVDKHRDELAALESWNSGKPYEQSA  153

Query  522  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            KSELP   RLF YYAGWADKIHGLTVPAD  H+VQTLHEPIGVAGQIIPWNF
Sbjct  154  KSELPSFARLFRYYAGWADKIHGLTVPADSNHYVQTLHEPIGVAGQIIPWNF  205



>ref|XP_003517756.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Glycine max]
 gb|KHN12100.1| Aldehyde dehydrogenase family 2 member B7, mitochondrial [Glycine 
soja]
Length=538

 Score =   293 bits (751),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 134/170 (79%), Positives = 156/170 (92%), Gaps = 0/170 (0%)
 Frame = +3

Query  168  RFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDI  347
            +FSTAAA+EE + P V+V++TQ +I+GKFVD+A+GKTFPTLDPRT DVI+HVAEG+ ED+
Sbjct  38   KFSTAAAIEEPIKPPVKVEHTQLLIDGKFVDAATGKTFPTLDPRTGDVISHVAEGDHEDV  97

Query  348  NRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKS  527
            +RAVAAARKAFD GPWPKM+AYER RI+L+ ADL EKH DELA LETWDNGKPYEQ+A+ 
Sbjct  98   DRAVAAARKAFDHGPWPKMTAYERQRILLRAADLFEKHNDELAALETWDNGKPYEQSAQI  157

Query  528  ELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            E+PM+VRLF YYAGWADKIHGLTVPADGP+HVQTLHEPIGVAGQIIPWNF
Sbjct  158  EIPMLVRLFRYYAGWADKIHGLTVPADGPYHVQTLHEPIGVAGQIIPWNF  207



>ref|XP_010477682.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Camelina sativa]
Length=534

 Score =   293 bits (751),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 132/178 (74%), Positives = 158/178 (89%), Gaps = 1/178 (1%)
 Frame = +3

Query  147  GVESGIQRFST-AAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHV  323
            G+  GIQR+S  AA +E  ++P V+V++TQ +ING+FVD+ASGKTFPTLDPR  +VIA V
Sbjct  26   GMNRGIQRYSNFAADLENTITPPVKVEHTQLLINGRFVDAASGKTFPTLDPRNGEVIAQV  85

Query  324  AEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGK  503
            AEG+ ED+NRAVAAARKAFDEGPWP+M+AYERSRI+ +FADL+EKH DELA LE+WD GK
Sbjct  86   AEGDVEDVNRAVAAARKAFDEGPWPRMTAYERSRILFRFADLIEKHNDELAALESWDCGK  145

Query  504  PYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            P+EQ+AK E+PM+ R+F YYAGWADKIHG+TVPADGPHHVQTLHEPIGVAGQIIPWNF
Sbjct  146  PFEQSAKIEVPMLARVFRYYAGWADKIHGMTVPADGPHHVQTLHEPIGVAGQIIPWNF  203



>gb|AFK49345.1| unknown [Medicago truncatula]
Length=272

 Score =   285 bits (728),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 130/171 (76%), Positives = 156/171 (91%), Gaps = 1/171 (1%)
 Frame = +3

Query  168  RFSTAAAVEEL-VSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAED  344
            ++STAAA++E  + P+V+V +TQ +I+GKFVD+ASGKTFPTLDPRT +VIAHVAEG +ED
Sbjct  40   KYSTAAAIDEQPIKPSVQVDHTQLLIDGKFVDAASGKTFPTLDPRTGEVIAHVAEGHSED  99

Query  345  INRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAK  524
            ++RAVAAARKAFD+GPWPK  AYER +IML+ ADL+EKH D++A LETWDNGKPYEQ+A+
Sbjct  100  VDRAVAAARKAFDQGPWPKFPAYERQKIMLRAADLIEKHNDQIAALETWDNGKPYEQSAQ  159

Query  525  SELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
             E+PM+VRLF YYAGWADKIHGLTVPADGP+HVQTLHEPIGVAGQIIPWNF
Sbjct  160  IEIPMLVRLFRYYAGWADKIHGLTVPADGPYHVQTLHEPIGVAGQIIPWNF  210



>gb|KFK34098.1| hypothetical protein AALP_AA5G101700 [Arabis alpina]
Length=540

 Score =   293 bits (749),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 134/174 (77%), Positives = 156/174 (90%), Gaps = 2/174 (1%)
 Frame = +3

Query  162  IQRF--STAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGE  335
            ++RF  S++A  EE++SP+V+V YT+ +I+G FVDSASGKTFPTLDPRT +VIA VAEG+
Sbjct  36   VRRFGSSSSAVAEEIISPSVQVSYTKLLIDGNFVDSASGKTFPTLDPRTGEVIADVAEGD  95

Query  336  AEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQ  515
            AEDINRAV AARKAFDEGPWP+MSAYERSRIML+FADLVEKH +ELA+LE+WDNGKPY Q
Sbjct  96   AEDINRAVKAARKAFDEGPWPRMSAYERSRIMLRFADLVEKHSEELASLESWDNGKPYSQ  155

Query  516  AAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            +  +E+PM  RLF YYAGWADKIHGLTVPADG +HVQTLHEPIGVAGQIIPWNF
Sbjct  156  SKGTEIPMFARLFRYYAGWADKIHGLTVPADGNYHVQTLHEPIGVAGQIIPWNF  209



>gb|KHN00347.1| Aldehyde dehydrogenase family 2 member B7, mitochondrial [Glycine 
soja]
Length=539

 Score =   293 bits (749),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 132/170 (78%), Positives = 156/170 (92%), Gaps = 0/170 (0%)
 Frame = +3

Query  168  RFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDI  347
            +FSTAAA+EE + P ++V++TQ +I+GKFVD+A+GKTFPTLDPRT DVI+HVAEG+ ED+
Sbjct  39   KFSTAAAIEEPIKPPIKVEHTQLLIDGKFVDAATGKTFPTLDPRTGDVISHVAEGDHEDV  98

Query  348  NRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKS  527
            +RAVAAARKAFD GPWPKM+AYER RI+L+ ADL EKH D+LA LETWDNGKPYEQ+A+ 
Sbjct  99   DRAVAAARKAFDRGPWPKMTAYERQRILLRAADLFEKHNDDLAALETWDNGKPYEQSAQI  158

Query  528  ELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            E+PM+VRLF YYAGWADKIHGLTVPADGP+HVQTLHEPIGVAGQIIPWNF
Sbjct  159  EIPMLVRLFRYYAGWADKIHGLTVPADGPYHVQTLHEPIGVAGQIIPWNF  208



>ref|XP_004509835.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
isoform X2 [Cicer arietinum]
Length=538

 Score =   293 bits (749),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 134/173 (77%), Positives = 157/173 (91%), Gaps = 1/173 (1%)
 Frame = +3

Query  162  IQRFSTAAAVEEL-VSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEA  338
            + ++STAAAVEE  + P V+V +TQ +I+GKFVD+ASGKTFPTLDPRT +VIAHVAEG A
Sbjct  35   LSKYSTAAAVEEQPIKPTVQVDHTQLLIDGKFVDAASGKTFPTLDPRTGEVIAHVAEGHA  94

Query  339  EDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQA  518
            ED++RAVAAAR+AFD GPWPKM+AYER RI+L+ ADL+EKH DELA LETWDNGKP+EQ+
Sbjct  95   EDVDRAVAAARQAFDHGPWPKMTAYERQRILLRAADLIEKHNDELAALETWDNGKPFEQS  154

Query  519  AKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            AK+E+PM+VRL  YYAGWADKIHGLT+PADGPHHVQTLHEPIGVAGQIIPWNF
Sbjct  155  AKTEVPMLVRLIRYYAGWADKIHGLTIPADGPHHVQTLHEPIGVAGQIIPWNF  207



>ref|XP_004509834.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
isoform X1 [Cicer arietinum]
Length=539

 Score =   293 bits (749),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 134/173 (77%), Positives = 157/173 (91%), Gaps = 1/173 (1%)
 Frame = +3

Query  162  IQRFSTAAAVEEL-VSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEA  338
            + ++STAAAVEE  + P V+V +TQ +I+GKFVD+ASGKTFPTLDPRT +VIAHVAEG A
Sbjct  36   LSKYSTAAAVEEQPIKPTVQVDHTQLLIDGKFVDAASGKTFPTLDPRTGEVIAHVAEGHA  95

Query  339  EDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQA  518
            ED++RAVAAAR+AFD GPWPKM+AYER RI+L+ ADL+EKH DELA LETWDNGKP+EQ+
Sbjct  96   EDVDRAVAAARQAFDHGPWPKMTAYERQRILLRAADLIEKHNDELAALETWDNGKPFEQS  155

Query  519  AKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            AK+E+PM+VRL  YYAGWADKIHGLT+PADGPHHVQTLHEPIGVAGQIIPWNF
Sbjct  156  AKTEVPMLVRLIRYYAGWADKIHGLTIPADGPHHVQTLHEPIGVAGQIIPWNF  208



>ref|XP_004297641.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
isoform X2 [Fragaria vesca subsp. vesca]
Length=535

 Score =   292 bits (748),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 136/177 (77%), Positives = 158/177 (89%), Gaps = 1/177 (1%)
 Frame = +3

Query  150  VESGIQRFSTAAA-VEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVA  326
            V  GI ++STAAA VE+ ++P V V +T+ +ING+FVD+ASGKTFPTLDPRT DVIAHVA
Sbjct  28   VSRGIGKYSTAAAAVEDPITPPVIVGHTKLLINGQFVDAASGKTFPTLDPRTGDVIAHVA  87

Query  327  EGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKP  506
            EG+AED+NRAVAAARKAFDEGPWPKM+AYERSR++ +FADL+EK  DELA LETWDNGKP
Sbjct  88   EGDAEDVNRAVAAARKAFDEGPWPKMTAYERSRVLFRFADLIEKQNDELAALETWDNGKP  147

Query  507  YEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            +EQ+AK E+PM  R F YYAG+ADKIHGLTVPADGP+HVQTLHEPIGVAGQIIPWNF
Sbjct  148  FEQSAKIEVPMFARFFRYYAGYADKIHGLTVPADGPYHVQTLHEPIGVAGQIIPWNF  204



>ref|XP_010029207.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Eucalyptus grandis]
Length=532

 Score =   292 bits (747),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 132/182 (73%), Positives = 159/182 (87%), Gaps = 0/182 (0%)
 Frame = +3

Query  132  LGWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDV  311
            +G   G   GI  +S+++ V+E V+P+V++  TQ +INGKFVD+ASGKTFPTLDPRT DV
Sbjct  20   IGRSRGWTRGIGSYSSSSVVDEPVTPSVKITDTQLLINGKFVDAASGKTFPTLDPRTGDV  79

Query  312  IAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETW  491
            I HVAEG+AED+NRAVAAARKAFDEGPWP+M+AYERSRI+L+FADL+EKH+D+LA +ETW
Sbjct  80   ITHVAEGDAEDVNRAVAAARKAFDEGPWPRMTAYERSRILLRFADLLEKHIDDLAAIETW  139

Query  492  DNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPW  671
            DNGKPY+QAA+ E+P  +RL  YYAGWADKIHGLTVP DG +HVQTLHEPIGVAGQIIPW
Sbjct  140  DNGKPYKQAAEDEIPGFIRLMRYYAGWADKIHGLTVPVDGKYHVQTLHEPIGVAGQIIPW  199

Query  672  NF  677
            NF
Sbjct  200  NF  201



>ref|XP_010552639.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial 
[Tarenaya hassleriana]
Length=533

 Score =   292 bits (747),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 134/173 (77%), Positives = 158/173 (91%), Gaps = 1/173 (1%)
 Frame = +3

Query  162  IQRFSTAAA-VEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEA  338
            I R+STAAA + E + P V+V+YT  +I+GKFVD+ASGKTF TLDPRT +VI+HVAEG++
Sbjct  30   ISRYSTAAAALGEPIPPPVKVEYTHLLIDGKFVDAASGKTFTTLDPRTGEVISHVAEGDS  89

Query  339  EDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQA  518
            ED+NRAV+AARKAFDEGPWP+M+AYERS+I+L+FADL+EKH DE+A LETWDNGKPYEQ+
Sbjct  90   EDVNRAVSAARKAFDEGPWPRMTAYERSKILLRFADLIEKHNDEIAALETWDNGKPYEQS  149

Query  519  AKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            AK E+PM+ RLF YYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF
Sbjct  150  AKIEVPMLARLFRYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  202



>ref|XP_003519638.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Glycine max]
Length=539

 Score =   292 bits (747),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 132/170 (78%), Positives = 156/170 (92%), Gaps = 0/170 (0%)
 Frame = +3

Query  168  RFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDI  347
            +FSTAAA+EE + P ++V++TQ +I+GKFVD+A+GKTFPTLDPRT DVI+HVAEG+ ED+
Sbjct  39   KFSTAAAIEEPIKPPLKVEHTQLLIDGKFVDAATGKTFPTLDPRTGDVISHVAEGDHEDV  98

Query  348  NRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKS  527
            +RAVAAARKAFD GPWPKM+AYER RI+L+ ADL EKH D+LA LETWDNGKPYEQ+A+ 
Sbjct  99   DRAVAAARKAFDRGPWPKMTAYERQRILLRAADLFEKHNDDLAALETWDNGKPYEQSAQI  158

Query  528  ELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            E+PM+VRLF YYAGWADKIHGLTVPADGP+HVQTLHEPIGVAGQIIPWNF
Sbjct  159  EIPMLVRLFRYYAGWADKIHGLTVPADGPYHVQTLHEPIGVAGQIIPWNF  208



>dbj|BAB92017.1| mitochondrial aldehyde dehydrogenase [Secale cereale]
Length=549

 Score =   292 bits (748),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 132/172 (77%), Positives = 152/172 (88%), Gaps = 0/172 (0%)
 Frame = +3

Query  162  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  341
            +QRF TAAA EE +SP+V+V  TQ +INGKFVD+ASGKTFPTLDPRT +VIA V+EG+AE
Sbjct  47   LQRFGTAAAAEEPISPSVQVSETQLLINGKFVDAASGKTFPTLDPRTGEVIARVSEGDAE  106

Query  342  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  521
            D++RAV AARKAFD GPWPKM+AYERSRI+L+FADL+EKH D++A LETWDNGKPYEQAA
Sbjct  107  DVDRAVIAARKAFDHGPWPKMTAYERSRILLRFADLIEKHNDDIAALETWDNGKPYEQAA  166

Query  522  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            + E+PM+ RL  YYAGW DKIHGL VPADGPHHVQ LHEPIGV GQIIPWNF
Sbjct  167  QIEVPMLARLMRYYAGWTDKIHGLIVPADGPHHVQVLHEPIGVVGQIIPWNF  218



>gb|KCW56067.1| hypothetical protein EUGRSUZ_I01824, partial [Eucalyptus grandis]
Length=511

 Score =   291 bits (745),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 159/181 (88%), Gaps = 4/181 (2%)
 Frame = +3

Query  135  GWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVI  314
            GW  G+ S    +S+++ V+E V+P+V++  TQ +INGKFVD+ASGKTFPTLDPRT DVI
Sbjct  4    GWTRGIGS----YSSSSVVDEPVTPSVKITDTQLLINGKFVDAASGKTFPTLDPRTGDVI  59

Query  315  AHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWD  494
             HVAEG+AED+NRAVAAARKAFDEGPWP+M+AYERSRI+L+FADL+EKH+D+LA +ETWD
Sbjct  60   THVAEGDAEDVNRAVAAARKAFDEGPWPRMTAYERSRILLRFADLLEKHIDDLAAIETWD  119

Query  495  NGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWN  674
            NGKPY+QAA+ E+P  +RL  YYAGWADKIHGLTVP DG +HVQTLHEPIGVAGQIIPWN
Sbjct  120  NGKPYKQAAEDEIPGFIRLMRYYAGWADKIHGLTVPVDGKYHVQTLHEPIGVAGQIIPWN  179

Query  675  F  677
            F
Sbjct  180  F  180



>gb|KEH35052.1| NAD-dependent aldehyde dehydrogenase family protein [Medicago 
truncatula]
Length=431

 Score =   288 bits (738),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 133/182 (73%), Positives = 154/182 (85%), Gaps = 0/182 (0%)
 Frame = +3

Query  132  LGWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDV  311
            LG        I + STAA V+EL++P+VE++YT+++INGKF+D+ASGKTFP  DPRT +V
Sbjct  30   LGRDTQRSRNISKLSTAAEVDELITPSVEIRYTKNLINGKFMDAASGKTFPAYDPRTGEV  89

Query  312  IAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETW  491
            IAHVAEG+ EDINRAV+AARKAFDEGPWPKM+ YERSRI+L+ ADLVEKH DELA LETW
Sbjct  90   IAHVAEGDQEDINRAVSAARKAFDEGPWPKMTPYERSRILLRVADLVEKHNDELAALETW  149

Query  492  DNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPW  671
            +NGK YEQA   E+PM VRL  YYAGWADKIHGLTVPADG +HVQ LHEPIGVAGQIIPW
Sbjct  150  NNGKLYEQAVNIEVPMFVRLLRYYAGWADKIHGLTVPADGNYHVQVLHEPIGVAGQIIPW  209

Query  672  NF  677
            NF
Sbjct  210  NF  211



>gb|EMS51754.1| Aldehyde dehydrogenase family 2 member B7, mitochondrial [Triticum 
urartu]
Length=550

 Score =   292 bits (747),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 132/172 (77%), Positives = 152/172 (88%), Gaps = 0/172 (0%)
 Frame = +3

Query  162  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  341
            +QRF TAAA EE +SP+V+V  TQ +INGKFVD+ASGKTFPT+DPRT +VIA VAEG+AE
Sbjct  48   LQRFGTAAAAEEPISPSVQVGETQLLINGKFVDAASGKTFPTVDPRTGEVIARVAEGDAE  107

Query  342  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  521
            D++RAV AARKAFDEGPWP+M+AYERSRI+L+FADL+EKH D++A LETWDNGKPYEQAA
Sbjct  108  DVDRAVVAARKAFDEGPWPRMTAYERSRILLRFADLIEKHNDDIAALETWDNGKPYEQAA  167

Query  522  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
              E+PM+ RL  YYAGW DKIHGL VPADGPHHVQ LHEPIGV GQIIPWNF
Sbjct  168  HIEVPMLARLMRYYAGWTDKIHGLIVPADGPHHVQVLHEPIGVVGQIIPWNF  219



>gb|EMT04899.1| Aldehyde dehydrogenase family 2 member B4, mitochondrial [Aegilops 
tauschii]
Length=549

 Score =   292 bits (747),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 132/172 (77%), Positives = 152/172 (88%), Gaps = 0/172 (0%)
 Frame = +3

Query  162  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  341
            +QRF TAAA EE +SP+V+V  TQ +INGKFVD+ASGKTFPT+DPRT +VIA VAEG+AE
Sbjct  47   LQRFGTAAAAEEPISPSVQVGETQLLINGKFVDAASGKTFPTVDPRTGEVIARVAEGDAE  106

Query  342  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  521
            D++RAV AARKAFDEGPWP+M+AYERSRI+L+FADL+EKH D++A LETWDNGKPYEQAA
Sbjct  107  DVDRAVVAARKAFDEGPWPRMTAYERSRILLRFADLIEKHNDDIAALETWDNGKPYEQAA  166

Query  522  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
              E+PM+ RL  YYAGW DKIHGL VPADGPHHVQ LHEPIGV GQIIPWNF
Sbjct  167  HIEVPMLARLMRYYAGWTDKIHGLIVPADGPHHVQVLHEPIGVVGQIIPWNF  218



>gb|AAL77004.1| aldehyde dehydrogenase [Allium cepa]
Length=282

 Score =   283 bits (724),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 136/176 (77%), Positives = 155/176 (88%), Gaps = 2/176 (1%)
 Frame = +3

Query  156  SGIQRF-STAAAVEEL-VSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAE  329
            S IQ F STAAAVEE  ++P V+V+YTQ +INGK+VDSASGKTFP+LDPRT +VIAHV+E
Sbjct  30   SRIQNFGSTAAAVEEQPITPPVKVEYTQLLINGKYVDSASGKTFPSLDPRTGEVIAHVSE  89

Query  330  GEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPY  509
            G+AEDI+RAVAAARKAFDEGPW KM+AYERS I+L+FADL+EKH D +A LETWDNGKPY
Sbjct  90   GDAEDIDRAVAAARKAFDEGPWLKMTAYERSNILLRFADLIEKHNDHIAALETWDNGKPY  149

Query  510  EQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            EQAA  E+PM+VRL  YYAGW DKIHGL  PADGPHHVQ L+EPIGVAGQIIPWNF
Sbjct  150  EQAALVEIPMLVRLMRYYAGWTDKIHGLIXPADGPHHVQVLYEPIGVAGQIIPWNF  205



>gb|KJB11462.1| hypothetical protein B456_001G261100 [Gossypium raimondii]
Length=374

 Score =   286 bits (732),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 131/173 (76%), Positives = 153/173 (88%), Gaps = 1/173 (1%)
 Frame = +3

Query  162  IQRFSTAAA-VEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEA  338
            I  FSTAAA ++E + P++++ +TQ +ING+F+D+ASG+TFPT+DPRT DVIA VAEG+ 
Sbjct  27   INSFSTAAAAIDEPIHPSIQIDHTQLLINGQFIDAASGRTFPTIDPRTGDVIARVAEGDL  86

Query  339  EDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQA  518
            EDINRAVAAARKAFDEGPWPKM+AYERSRIML+FADL+EKH  E+A LETWDNGKPYEQA
Sbjct  87   EDINRAVAAARKAFDEGPWPKMTAYERSRIMLRFADLLEKHTGEVAKLETWDNGKPYEQA  146

Query  519  AKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            AK E+PM+VR+F YYAGWADKIHG TVPADG HHVQTLHEP GV G IIPWNF
Sbjct  147  AKIEIPMVVRMFRYYAGWADKIHGFTVPADGQHHVQTLHEPYGVCGLIIPWNF  199



>gb|KDO82494.1| hypothetical protein CISIN_1g009035mg [Citrus sinensis]
Length=392

 Score =   287 bits (734),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 127/162 (78%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = +3

Query  192  EELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAAR  371
            E+ ++P V+V YTQ +ING+FVDSASGKTFPTLDPRT DVI HVAEGEAED+NRAV+AAR
Sbjct  54   EDPITPPVKVDYTQLLINGQFVDSASGKTFPTLDPRTGDVITHVAEGEAEDVNRAVSAAR  113

Query  372  KAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRL  551
            KAFDEGPWP+M+AYERS+I+L+FADL+E+H DE+A LETWDNGKP+EQ+A++E+PM  RL
Sbjct  114  KAFDEGPWPRMTAYERSKIILRFADLLERHNDEIAALETWDNGKPFEQSAQTEVPMTTRL  173

Query  552  FHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            F YYAGWADKI GLT PADGP+HVQTLHEPIGVAGQIIPWNF
Sbjct  174  FRYYAGWADKIQGLTAPADGPYHVQTLHEPIGVAGQIIPWNF  215



>ref|XP_010682577.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Beta vulgaris subsp. vulgaris]
Length=535

 Score =   291 bits (745),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 133/172 (77%), Positives = 153/172 (89%), Gaps = 0/172 (0%)
 Frame = +3

Query  162  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  341
            + ++ST AA+EE + P V+VKY+Q +INGKFVDSASGK F T DPRT +VIA V+EG+AE
Sbjct  33   VCKYSTTAAIEEPIIPPVKVKYSQLLINGKFVDSASGKKFKTCDPRTGNVIAEVSEGDAE  92

Query  342  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  521
            DI+RAVAAARKAFDEGPWPKM+AYERS+I+LKFADL+E+H DE+A LETWDNGKPYEQAA
Sbjct  93   DIDRAVAAARKAFDEGPWPKMTAYERSQILLKFADLLEQHTDEIAALETWDNGKPYEQAA  152

Query  522  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            K ELPM VR+  YYAGW+DKIHGLT PADGP HVQTLHEPIGVAGQIIPWNF
Sbjct  153  KIELPMCVRIMRYYAGWSDKIHGLTAPADGPFHVQTLHEPIGVAGQIIPWNF  204



>gb|KEH35053.1| NAD-dependent aldehyde dehydrogenase family protein [Medicago 
truncatula]
Length=446

 Score =   288 bits (738),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 133/182 (73%), Positives = 154/182 (85%), Gaps = 0/182 (0%)
 Frame = +3

Query  132  LGWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDV  311
            LG        I + STAA V+EL++P+VE++YT+++INGKF+D+ASGKTFP  DPRT +V
Sbjct  30   LGRDTQRSRNISKLSTAAEVDELITPSVEIRYTKNLINGKFMDAASGKTFPAYDPRTGEV  89

Query  312  IAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETW  491
            IAHVAEG+ EDINRAV+AARKAFDEGPWPKM+ YERSRI+L+ ADLVEKH DELA LETW
Sbjct  90   IAHVAEGDQEDINRAVSAARKAFDEGPWPKMTPYERSRILLRVADLVEKHNDELAALETW  149

Query  492  DNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPW  671
            +NGK YEQA   E+PM VRL  YYAGWADKIHGLTVPADG +HVQ LHEPIGVAGQIIPW
Sbjct  150  NNGKLYEQAVNIEVPMFVRLLRYYAGWADKIHGLTVPADGNYHVQVLHEPIGVAGQIIPW  209

Query  672  NF  677
            NF
Sbjct  210  NF  211



>gb|KEH35051.1| NAD-dependent aldehyde dehydrogenase family protein [Medicago 
truncatula]
Length=456

 Score =   288 bits (738),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 133/182 (73%), Positives = 154/182 (85%), Gaps = 0/182 (0%)
 Frame = +3

Query  132  LGWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDV  311
            LG        I + STAA V+EL++P+VE++YT+++INGKF+D+ASGKTFP  DPRT +V
Sbjct  30   LGRDTQRSRNISKLSTAAEVDELITPSVEIRYTKNLINGKFMDAASGKTFPAYDPRTGEV  89

Query  312  IAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETW  491
            IAHVAEG+ EDINRAV+AARKAFDEGPWPKM+ YERSRI+L+ ADLVEKH DELA LETW
Sbjct  90   IAHVAEGDQEDINRAVSAARKAFDEGPWPKMTPYERSRILLRVADLVEKHNDELAALETW  149

Query  492  DNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPW  671
            +NGK YEQA   E+PM VRL  YYAGWADKIHGLTVPADG +HVQ LHEPIGVAGQIIPW
Sbjct  150  NNGKLYEQAVNIEVPMFVRLLRYYAGWADKIHGLTVPADGNYHVQVLHEPIGVAGQIIPW  209

Query  672  NF  677
            NF
Sbjct  210  NF  211



>ref|XP_011086550.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial 
[Sesamum indicum]
Length=532

 Score =   291 bits (744),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 136/176 (77%), Positives = 155/176 (88%), Gaps = 0/176 (0%)
 Frame = +3

Query  150  VESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAE  329
            V  GI R+STAAA E+ + P V V+Y + +ING+FVD+ASGKTFPTLDPRT +VIAHVAE
Sbjct  26   VGRGIYRYSTAAAHEDPIKPPVSVQYDKLLINGQFVDAASGKTFPTLDPRTGEVIAHVAE  85

Query  330  GEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPY  509
            G+AEDINRAVAAARKAFDEGPWPKM+AYER RI+L+FADLVEKH D++A LETWD+GK Y
Sbjct  86   GDAEDINRAVAAARKAFDEGPWPKMTAYERQRILLRFADLVEKHNDDIAALETWDSGKLY  145

Query  510  EQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            EQ A+ E+PM VRLF YYAGWADKIHGLT+PADG  HVQTLHEPIGVAGQIIPWNF
Sbjct  146  EQCAQIEVPMFVRLFRYYAGWADKIHGLTIPADGALHVQTLHEPIGVAGQIIPWNF  201



>ref|NP_190383.1| aldehyde dehydrogenase 2B4 [Arabidopsis thaliana]
 sp|Q9SU63.1|AL2B4_ARATH RecName: Full=Aldehyde dehydrogenase family 2 member B4, mitochondrial; 
Short=ALDH2a; Flags: Precursor [Arabidopsis thaliana]
 gb|AAG42016.1|AF327426_1 putative (NAD+) aldehyde dehydrogenase [Arabidopsis thaliana]
 gb|AAK15569.1|AF349522_1 putative aldehyde dehydrogenase (NAD+) [Arabidopsis thaliana]
 gb|AAK49627.1|AF372911_1 AT3g48000/T17F15_130 [Arabidopsis thaliana]
 emb|CAB41139.1| aldehyde dehydrogenase (NAD+)-like protein [Arabidopsis thaliana]
 dbj|BAA96792.1| aldehyde dehydrogenase [Arabidopsis thaliana]
 gb|AAL91287.1| AT3g48000/T17F15_130 [Arabidopsis thaliana]
 gb|AAM27003.1| aldehyde dehydrogenase ALDH2a [Arabidopsis thaliana]
 gb|AAN31892.1| putative aldehyde dehydrogenase (NAD+) [Arabidopsis thaliana]
 gb|AAP21179.1| At3g48000/T17F15_130 [Arabidopsis thaliana]
 gb|AEE78355.1| aldehyde dehydrogenase 2B4 [Arabidopsis thaliana]
Length=538

 Score =   291 bits (744),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 132/173 (76%), Positives = 155/173 (90%), Gaps = 1/173 (1%)
 Frame = +3

Query  162  IQRFSTA-AAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEA  338
            ++RF T+ AA EE+++P+V+V +TQ +ING FVDSASGKTFPTLDPRT +VIAHVAEG+A
Sbjct  35   LRRFGTSSAAAEEIINPSVQVSHTQLLINGNFVDSASGKTFPTLDPRTGEVIAHVAEGDA  94

Query  339  EDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQA  518
            EDINRAV AAR AFDEGPWPKMSAYERSR++L+FADLVEKH +ELA+LETWDNGKPY+Q+
Sbjct  95   EDINRAVKAARTAFDEGPWPKMSAYERSRVLLRFADLVEKHSEELASLETWDNGKPYQQS  154

Query  519  AKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
              +E+PM  RLF YYAGWADKIHGLT+PADG + V TLHEPIGVAGQIIPWNF
Sbjct  155  LTAEIPMFARLFRYYAGWADKIHGLTIPADGNYQVHTLHEPIGVAGQIIPWNF  207



>ref|NP_564204.1| aldehyde dehydrogenase 2B7 [Arabidopsis thaliana]
 sp|Q8S528.2|AL2B7_ARATH RecName: Full=Aldehyde dehydrogenase family 2 member B7, mitochondrial; 
Short=ALDH2b; Flags: Precursor [Arabidopsis thaliana]
 gb|AAK59643.1| putative aldehyde dehydrogenase [Arabidopsis thaliana]
 gb|AAM44960.1| putative aldehyde dehydrogenase [Arabidopsis thaliana]
 gb|AEE30433.1| aldehyde dehydrogenase 2B7 [Arabidopsis thaliana]
Length=534

 Score =   290 bits (743),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 130/178 (73%), Positives = 157/178 (88%), Gaps = 1/178 (1%)
 Frame = +3

Query  147  GVESGIQRFST-AAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHV  323
            G+  G QR+S  AAAVE  ++P V+V++TQ +I G+FVD+ SGKTFPTLDPR  +VIA V
Sbjct  26   GMNRGAQRYSNLAAAVENTITPPVKVEHTQLLIGGRFVDAVSGKTFPTLDPRNGEVIAQV  85

Query  324  AEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGK  503
            +EG+AED+NRAVAAARKAFDEGPWPKM+AYERS+I+ +FADL+EKH DE+A LETWDNGK
Sbjct  86   SEGDAEDVNRAVAAARKAFDEGPWPKMTAYERSKILFRFADLIEKHNDEIAALETWDNGK  145

Query  504  PYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            PYEQ+A+ E+PM+ R+F YYAGWADKIHG+T+P DGPHHVQTLHEPIGVAGQIIPWNF
Sbjct  146  PYEQSAQIEVPMLARVFRYYAGWADKIHGMTMPGDGPHHVQTLHEPIGVAGQIIPWNF  203



>ref|XP_011003158.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Populus euphratica]
Length=540

 Score =   291 bits (744),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 134/173 (77%), Positives = 155/173 (90%), Gaps = 1/173 (1%)
 Frame = +3

Query  162  IQRF-STAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEA  338
            I R+ S  AAVE+ ++P V VKY Q +ING+FVD+ASGKTFPTLDPRT +VIAHVAEG+ 
Sbjct  37   ICRYNSNLAAVEDPITPPVSVKYNQLLINGQFVDAASGKTFPTLDPRTGEVIAHVAEGDV  96

Query  339  EDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQA  518
            ED+NRAV+AARKAFDEGPWP+M+AYERSRI+ +FADL+EKH DE+A LETWDNGKP+EQA
Sbjct  97   EDVNRAVSAARKAFDEGPWPRMTAYERSRIIWRFADLLEKHTDEIAALETWDNGKPFEQA  156

Query  519  AKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            AK E+PM VR+F YYAGWADKIHGLTVPADG +HVQTLHEPIGVAGQIIPWNF
Sbjct  157  AKIEIPMTVRIFRYYAGWADKIHGLTVPADGQYHVQTLHEPIGVAGQIIPWNF  209



>gb|AAL99612.1|AF348416_1 mitochondrial aldehyde dehydrogenase [Arabidopsis thaliana]
Length=534

 Score =   290 bits (743),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 130/178 (73%), Positives = 157/178 (88%), Gaps = 1/178 (1%)
 Frame = +3

Query  147  GVESGIQRFST-AAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHV  323
            G+  G QR+S  AAAVE  ++P V+V++TQ +I G+FVD+ SGKTFPTLDPR  +VIA V
Sbjct  26   GMNRGAQRYSNLAAAVENTITPPVKVEHTQLLIGGRFVDAVSGKTFPTLDPRNGEVIAQV  85

Query  324  AEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGK  503
            +EG+AED+NRAVAAARKAFDEGPWPKM+AYERS+I+ +FADL+EKH DE+A LETWDNGK
Sbjct  86   SEGDAEDVNRAVAAARKAFDEGPWPKMTAYERSKILFRFADLIEKHNDEIAALETWDNGK  145

Query  504  PYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            PYEQ+A+ E+PM+ R+F YYAGWADKIHG+T+P DGPHHVQTLHEPIGVAGQIIPWNF
Sbjct  146  PYEQSAQIEVPMLARVFRYYAGWADKIHGMTMPGDGPHHVQTLHEPIGVAGQIIPWNF  203



>ref|XP_009399660.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Musa acuminata subsp. malaccensis]
Length=542

 Score =   290 bits (743),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 136/189 (72%), Positives = 159/189 (84%), Gaps = 2/189 (1%)
 Frame = +3

Query  117  SASAFLGWK-YGVESGIQR-FSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTL  290
            S S F G + +G  SG+ R FSTA A+EE + P V+V +TQ +ING+FVDSASG+TFPTL
Sbjct  23   SRSVFGGDRIHGSASGVLRGFSTATAIEEPIQPPVQVNHTQLLINGQFVDSASGRTFPTL  82

Query  291  DPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDE  470
            DPRT ++IAHVAEG+ ED+NRAV AARKAFDEGPWPKM+ Y+RS I+ +FADL+EKH DE
Sbjct  83   DPRTGELIAHVAEGDVEDVNRAVVAARKAFDEGPWPKMTGYQRSCILYRFADLIEKHNDE  142

Query  471  LATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGV  650
            +A LETWDNGKPYEQAAK+E+P + RL  YYAGWADKIHGL VPAD PHHVQ LHEPIGV
Sbjct  143  IAALETWDNGKPYEQAAKAEIPTLARLMRYYAGWADKIHGLIVPADSPHHVQVLHEPIGV  202

Query  651  AGQIIPWNF  677
            AGQIIPWNF
Sbjct  203  AGQIIPWNF  211



>ref|XP_011044321.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Populus euphratica]
Length=539

 Score =   290 bits (742),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 134/173 (77%), Positives = 150/173 (87%), Gaps = 0/173 (0%)
 Frame = +3

Query  159  GIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEA  338
            GI RF TA A+EE ++P V++ YTQH INGKFVD+ASGK FP  DPRT +VIAHVAEG+ 
Sbjct  36   GIYRFITATALEEPITPPVQISYTQHFINGKFVDAASGKIFPAYDPRTGEVIAHVAEGDT  95

Query  339  EDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQA  518
            ED+NRAVAAA KAFDEGPWPKMSAYERS IML+FADLV+KH DELA LE+W++GKPYEQ+
Sbjct  96   EDVNRAVAAACKAFDEGPWPKMSAYERSLIMLRFADLVDKHRDELAALESWNSGKPYEQS  155

Query  519  AKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            AKSELP   RLF YYAGW DKIHGLTVPAD  H+VQTLHEPIGVAGQIIPWNF
Sbjct  156  AKSELPSFARLFRYYAGWTDKIHGLTVPADSNHYVQTLHEPIGVAGQIIPWNF  208



>ref|XP_003552014.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Glycine max]
 gb|KHN39739.1| Aldehyde dehydrogenase family 2 member B4, mitochondrial [Glycine 
soja]
Length=536

 Score =   290 bits (741),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 137/187 (73%), Positives = 163/187 (87%), Gaps = 7/187 (4%)
 Frame = +3

Query  120  ASAFLGWKYGVESGIQRFSTAAAVEEL-VSPAVEVKYTQHIINGKFVDSASGKTFPTLDP  296
             + FLG ++       ++ST++A+EE  V P+V+V++TQ +I+GKFVD+ASGKTFPTLDP
Sbjct  25   GNGFLGSRH------CKYSTSSAIEEEPVKPSVQVEHTQLLIDGKFVDAASGKTFPTLDP  78

Query  297  RTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELA  476
            RT +VIAHVAEG +ED++RAVAAARKAFD GPWPKM+AYER RI+L+ ADL+EKH DELA
Sbjct  79   RTGEVIAHVAEGHSEDVDRAVAAARKAFDHGPWPKMTAYERQRILLRAADLLEKHNDELA  138

Query  477  TLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAG  656
             LETWDNGKPYEQAAK E+PM+VRL  YYAGWADKIHGLTVPADGP+HVQTLHEPIGVAG
Sbjct  139  ALETWDNGKPYEQAAKIEVPMLVRLIRYYAGWADKIHGLTVPADGPYHVQTLHEPIGVAG  198

Query  657  QIIPWNF  677
            QIIPWNF
Sbjct  199  QIIPWNF  205



>ref|XP_006307216.1| hypothetical protein CARUB_v10008816mg [Capsella rubella]
 gb|EOA40114.1| hypothetical protein CARUB_v10008816mg [Capsella rubella]
Length=532

 Score =   290 bits (741),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 130/177 (73%), Positives = 156/177 (88%), Gaps = 1/177 (1%)
 Frame = +3

Query  147  GVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVA  326
            G+  G+QR+S  A VE  ++P V+V++TQ +I GKFVD+ASGKTFPTLDPR  +VIA VA
Sbjct  26   GMNRGVQRYSNHA-VENTITPPVKVEHTQLLIGGKFVDAASGKTFPTLDPRNGEVIAQVA  84

Query  327  EGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKP  506
            EG+ ED+NRAVAAARKAFDEGPWP+M+AYERS+I+ +FADL+EKH DE+A LETWDNGKP
Sbjct  85   EGDVEDVNRAVAAARKAFDEGPWPRMTAYERSKILFRFADLIEKHNDEIAALETWDNGKP  144

Query  507  YEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            +EQAAK E+PM+ R+F YYAGWADKIHG+TVP DGP+HVQTLHEPIGVAGQIIPWNF
Sbjct  145  FEQAAKIEVPMLARVFRYYAGWADKIHGMTVPGDGPYHVQTLHEPIGVAGQIIPWNF  201



>ref|XP_002893307.1| hypothetical protein ARALYDRAFT_472641 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69566.1| hypothetical protein ARALYDRAFT_472641 [Arabidopsis lyrata subsp. 
lyrata]
Length=534

 Score =   290 bits (741),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 129/178 (72%), Positives = 156/178 (88%), Gaps = 1/178 (1%)
 Frame = +3

Query  147  GVESGIQRFSTAAA-VEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHV  323
            G+  G QR+S AAA VE  ++P V+V++TQ +I G+FVD+ SGKTFPTLDPR  +VIA V
Sbjct  26   GMNRGAQRYSNAAAAVENTITPPVKVEHTQLLIGGRFVDAVSGKTFPTLDPRNGEVIAQV  85

Query  324  AEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGK  503
            AEG+AED+NRAVAAARKAFDEGPWP+M+AYERS+I+ +FADL+EKH DE+A LETWDNGK
Sbjct  86   AEGDAEDVNRAVAAARKAFDEGPWPRMTAYERSKILFRFADLIEKHNDEIAALETWDNGK  145

Query  504  PYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            PYEQ+ + E+PM+ R+F YYAGWADKIHG+T+P DGPHHVQTLHEPIGVAGQIIPWNF
Sbjct  146  PYEQSVQIEVPMLARVFRYYAGWADKIHGMTMPGDGPHHVQTLHEPIGVAGQIIPWNF  203



>gb|KJB31274.1| hypothetical protein B456_005G183300 [Gossypium raimondii]
Length=509

 Score =   289 bits (739),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 130/177 (73%), Positives = 156/177 (88%), Gaps = 0/177 (0%)
 Frame = +3

Query  147  GVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVA  326
            GV   +  +ST+A +E  ++P+++V  TQ +ING FVDSASGKTFPT DPRT +VIAHVA
Sbjct  27   GVGRVVSGYSTSAGIENPINPSIKVHCTQLLINGNFVDSASGKTFPTYDPRTGNVIAHVA  86

Query  327  EGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKP  506
            EG+AEDI+RAV AARKAFDEGPWPKM+AYERS+++ +FADL++KH++ELATLETWDNGKP
Sbjct  87   EGDAEDIDRAVCAARKAFDEGPWPKMTAYERSKVLFRFADLLDKHIEELATLETWDNGKP  146

Query  507  YEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            YEQ+AK ELPMI R+  YYAGWADKIHGLT+PADGPH VQT+HEPIGVAGQIIPWNF
Sbjct  147  YEQSAKIELPMISRIIRYYAGWADKIHGLTIPADGPHLVQTIHEPIGVAGQIIPWNF  203



>gb|KDO82493.1| hypothetical protein CISIN_1g009035mg [Citrus sinensis]
Length=459

 Score =   287 bits (735),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 127/162 (78%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = +3

Query  192  EELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAAR  371
            E+ ++P V+V YTQ +ING+FVDSASGKTFPTLDPRT DVI HVAEGEAED+NRAV+AAR
Sbjct  54   EDPITPPVKVDYTQLLINGQFVDSASGKTFPTLDPRTGDVITHVAEGEAEDVNRAVSAAR  113

Query  372  KAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRL  551
            KAFDEGPWP+M+AYERS+I+L+FADL+E+H DE+A LETWDNGKP+EQ+A++E+PM  RL
Sbjct  114  KAFDEGPWPRMTAYERSKIILRFADLLERHNDEIAALETWDNGKPFEQSAQTEVPMTTRL  173

Query  552  FHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            F YYAGWADKI GLT PADGP+HVQTLHEPIGVAGQIIPWNF
Sbjct  174  FRYYAGWADKIQGLTAPADGPYHVQTLHEPIGVAGQIIPWNF  215



>gb|KDO82492.1| hypothetical protein CISIN_1g009035mg [Citrus sinensis]
Length=456

 Score =   287 bits (734),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 127/162 (78%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = +3

Query  192  EELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAAR  371
            E+ ++P V+V YTQ +ING+FVDSASGKTFPTLDPRT DVI HVAEGEAED+NRAV+AAR
Sbjct  54   EDPITPPVKVDYTQLLINGQFVDSASGKTFPTLDPRTGDVITHVAEGEAEDVNRAVSAAR  113

Query  372  KAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRL  551
            KAFDEGPWP+M+AYERS+I+L+FADL+E+H DE+A LETWDNGKP+EQ+A++E+PM  RL
Sbjct  114  KAFDEGPWPRMTAYERSKIILRFADLLERHNDEIAALETWDNGKPFEQSAQTEVPMTTRL  173

Query  552  FHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            F YYAGWADKI GLT PADGP+HVQTLHEPIGVAGQIIPWNF
Sbjct  174  FRYYAGWADKIQGLTAPADGPYHVQTLHEPIGVAGQIIPWNF  215



>gb|KFK44454.1| hypothetical protein AALP_AA1G258900 [Arabis alpina]
Length=524

 Score =   288 bits (738),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 155/177 (88%), Gaps = 4/177 (2%)
 Frame = +3

Query  159  GIQRFST----AAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVA  326
            G  R+S     AAA+E  ++P V+V++TQ +INGKFVD+ASGKTFPTLDPRT +VIA VA
Sbjct  17   GAYRYSNVSAAAAALENTITPPVKVEHTQLLINGKFVDAASGKTFPTLDPRTGEVIAQVA  76

Query  327  EGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKP  506
            EG+ ED+NRAV AARKAFDEGPWP+M+AYERSRI+L+FADL+EKH DE+A LETWDNGKP
Sbjct  77   EGDKEDVNRAVLAARKAFDEGPWPRMTAYERSRILLRFADLIEKHNDEIAALETWDNGKP  136

Query  507  YEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            YEQ+A+ E+PM+ R+F YYAGWADKIHG+TVP DG HHVQTLHEPIGVAGQIIPWNF
Sbjct  137  YEQSAQLEVPMLARVFRYYAGWADKIHGMTVPGDGSHHVQTLHEPIGVAGQIIPWNF  193



>ref|XP_009115500.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial 
[Brassica rapa]
Length=536

 Score =   289 bits (739),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 129/188 (69%), Positives = 160/188 (85%), Gaps = 0/188 (0%)
 Frame = +3

Query  114  PSASAFLGWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLD  293
            PS  A  G  + +  G+  +S  AA E+ ++P V+V++TQ +I GKFVD+ASGKTFPTLD
Sbjct  18   PSLFALRGKHHNMNRGVYGYSNVAAGEDTITPPVKVEHTQLLIGGKFVDAASGKTFPTLD  77

Query  294  PRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDEL  473
            PRT +VIA VAEG+ ED+NRAV+AARKAFDEGPWP+M+AYERS+I+L+FADLV+KH DE+
Sbjct  78   PRTGEVIAQVAEGDVEDVNRAVSAARKAFDEGPWPRMTAYERSKILLRFADLVDKHNDEI  137

Query  474  ATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVA  653
            A +ETWDNGKP+EQ++K E+PM+ R+F YYAGWADKIHG+TVP DG HHVQTLHEPIGVA
Sbjct  138  AAIETWDNGKPFEQSSKIEVPMLARVFRYYAGWADKIHGMTVPGDGSHHVQTLHEPIGVA  197

Query  654  GQIIPWNF  677
            GQIIPWNF
Sbjct  198  GQIIPWNF  205



>gb|EYU31278.1| hypothetical protein MIMGU_mgv1a004311mg [Erythranthe guttata]
 gb|EYU31279.1| hypothetical protein MIMGU_mgv1a004311mg [Erythranthe guttata]
Length=533

 Score =   288 bits (738),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 138/192 (72%), Positives = 160/192 (83%), Gaps = 5/192 (3%)
 Frame = +3

Query  117  SASAFLGWKYGVES----GIQRFSTAAA-VEELVSPAVEVKYTQHIINGKFVDSASGKTF  281
            S SA L  + G +S    GI R++TAAA +EE + P V VKY + +ING+FVD+ASGKTF
Sbjct  11   SRSAPLLSRRGKQSYTSRGIFRYTTAAAALEEPIKPPVNVKYDKLLINGQFVDAASGKTF  70

Query  282  PTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKH  461
            PTLDPRT +VI HV EG+AEDINRAV+AARKAFDEGPWPKM+AYER RI+L+FADLVEKH
Sbjct  71   PTLDPRTGEVITHVPEGDAEDINRAVSAARKAFDEGPWPKMTAYERQRILLRFADLVEKH  130

Query  462  MDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEP  641
             DE+A LETWD+GK +EQ AK E+PM VRLF YYAGW DKIHG+T+P DGPHHVQTLHEP
Sbjct  131  NDEIAALETWDSGKLFEQCAKIEVPMFVRLFRYYAGWTDKIHGMTIPGDGPHHVQTLHEP  190

Query  642  IGVAGQIIPWNF  677
            IGV GQIIPWNF
Sbjct  191  IGVCGQIIPWNF  202



>gb|ABK24267.1| unknown [Picea sitchensis]
Length=544

 Score =   289 bits (739),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 135/174 (78%), Positives = 156/174 (90%), Gaps = 1/174 (1%)
 Frame = +3

Query  159  GIQRFSTAA-AVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGE  335
            GI+R  TAA A+EE ++P V+VK+TQ +I+G+FV++ASGKTFPT DPRT DVIA+VAEG+
Sbjct  40   GIRRLGTAASALEEPIAPPVQVKHTQLLIDGQFVNAASGKTFPTFDPRTGDVIANVAEGD  99

Query  336  AEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQ  515
            A D+NRAV AARKAFD GPWPKM+AYERS IML+FADL+EKH DE+A LETWDNGKPYEQ
Sbjct  100  APDVNRAVKAARKAFDVGPWPKMTAYERSCIMLRFADLLEKHNDEIAALETWDNGKPYEQ  159

Query  516  AAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            A+  E+PM VRLF YYAGWADKIHGLTVPADGP+HVQTLHEPIGVAGQIIPWNF
Sbjct  160  ASLVEVPMAVRLFRYYAGWADKIHGLTVPADGPYHVQTLHEPIGVAGQIIPWNF  213



>gb|KEH35050.1| NAD-dependent aldehyde dehydrogenase family protein [Medicago 
truncatula]
Length=542

 Score =   288 bits (738),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 133/182 (73%), Positives = 154/182 (85%), Gaps = 0/182 (0%)
 Frame = +3

Query  132  LGWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDV  311
            LG        I + STAA V+EL++P+VE++YT+++INGKF+D+ASGKTFP  DPRT +V
Sbjct  30   LGRDTQRSRNISKLSTAAEVDELITPSVEIRYTKNLINGKFMDAASGKTFPAYDPRTGEV  89

Query  312  IAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETW  491
            IAHVAEG+ EDINRAV+AARKAFDEGPWPKM+ YERSRI+L+ ADLVEKH DELA LETW
Sbjct  90   IAHVAEGDQEDINRAVSAARKAFDEGPWPKMTPYERSRILLRVADLVEKHNDELAALETW  149

Query  492  DNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPW  671
            +NGK YEQA   E+PM VRL  YYAGWADKIHGLTVPADG +HVQ LHEPIGVAGQIIPW
Sbjct  150  NNGKLYEQAVNIEVPMFVRLLRYYAGWADKIHGLTVPADGNYHVQVLHEPIGVAGQIIPW  209

Query  672  NF  677
            NF
Sbjct  210  NF  211



>gb|KHG06517.1| Aldehyde dehydrogenase family 2 member B7, mitochondrial [Gossypium 
arboreum]
Length=531

 Score =   288 bits (737),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 131/174 (75%), Positives = 155/174 (89%), Gaps = 2/174 (1%)
 Frame = +3

Query  162  IQRFSTAAA--VEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGE  335
            I+ FSTAAA  ++E + P++++ +TQ +ING+FVD+ASGK+FPT+DPRT DVIA VAEG+
Sbjct  27   IKSFSTAAAAAIDEPIHPSIQIDHTQLLINGQFVDAASGKSFPTVDPRTGDVIARVAEGD  86

Query  336  AEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQ  515
             ED+NRAVAAARKAFDEGPWPKM+AYERSRIML+FADL+EKH +E+A LETWDNGKPYEQ
Sbjct  87   LEDVNRAVAAARKAFDEGPWPKMTAYERSRIMLRFADLLEKHTEEVAKLETWDNGKPYEQ  146

Query  516  AAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            AAK E+PM+VR+F YYAGWADKIHG TVPADG HHVQTLHEP GV G IIPWNF
Sbjct  147  AAKIEIPMVVRMFRYYAGWADKIHGFTVPADGQHHVQTLHEPYGVCGLIIPWNF  200



>emb|CDY47634.1| BnaC05g18900D [Brassica napus]
Length=544

 Score =   288 bits (738),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 129/188 (69%), Positives = 159/188 (85%), Gaps = 0/188 (0%)
 Frame = +3

Query  114  PSASAFLGWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLD  293
            PS  A  G  + +  G+  +S  AA E+ ++P V+V++TQ +I GKFVD+ASGKTFPTLD
Sbjct  18   PSLFALRGKHHNMNRGVYGYSNVAAAEDTITPPVKVEHTQLLIGGKFVDAASGKTFPTLD  77

Query  294  PRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDEL  473
            PRT +VIA VAEG+ ED+NRAV+AARKAFDEGPWP+M AYERS+I+L+FADLV+KH DE+
Sbjct  78   PRTGEVIAQVAEGDVEDVNRAVSAARKAFDEGPWPRMIAYERSKILLRFADLVDKHNDEI  137

Query  474  ATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVA  653
            A +ETWDNGKP+EQ++K E+PM+ R+F YYAGWADKIHG+TVP DG HHVQTLHEPIGVA
Sbjct  138  AAIETWDNGKPFEQSSKIEVPMLARVFRYYAGWADKIHGMTVPGDGSHHVQTLHEPIGVA  197

Query  654  GQIIPWNF  677
            GQIIPWNF
Sbjct  198  GQIIPWNF  205



>gb|KJB11461.1| hypothetical protein B456_001G261100 [Gossypium raimondii]
Length=530

 Score =   288 bits (736),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 131/173 (76%), Positives = 153/173 (88%), Gaps = 1/173 (1%)
 Frame = +3

Query  162  IQRFSTAAA-VEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEA  338
            I  FSTAAA ++E + P++++ +TQ +ING+F+D+ASG+TFPT+DPRT DVIA VAEG+ 
Sbjct  27   INSFSTAAAAIDEPIHPSIQIDHTQLLINGQFIDAASGRTFPTIDPRTGDVIARVAEGDL  86

Query  339  EDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQA  518
            EDINRAVAAARKAFDEGPWPKM+AYERSRIML+FADL+EKH  E+A LETWDNGKPYEQA
Sbjct  87   EDINRAVAAARKAFDEGPWPKMTAYERSRIMLRFADLLEKHTGEVAKLETWDNGKPYEQA  146

Query  519  AKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            AK E+PM+VR+F YYAGWADKIHG TVPADG HHVQTLHEP GV G IIPWNF
Sbjct  147  AKIEIPMVVRMFRYYAGWADKIHGFTVPADGQHHVQTLHEPYGVCGLIIPWNF  199



>ref|XP_003532011.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Glycine max]
 gb|KHN10599.1| Aldehyde dehydrogenase family 2 member B4, mitochondrial [Glycine 
soja]
Length=536

 Score =   288 bits (737),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 135/187 (72%), Positives = 161/187 (86%), Gaps = 7/187 (4%)
 Frame = +3

Query  120  ASAFLGWKYGVESGIQRFSTAAAVEEL-VSPAVEVKYTQHIINGKFVDSASGKTFPTLDP  296
             + FLG +        +FST+AA+EE  + P+++V++TQ +I+GKFVD+ASGKTF TLDP
Sbjct  25   GNGFLGSRQ------SKFSTSAAIEEEPIKPSIQVEHTQLLIDGKFVDAASGKTFQTLDP  78

Query  297  RTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELA  476
            RT +VIAHVAEG +ED++RAV+AARKAFD GPWPKM+AYER RI+L+ ADL+EKH DELA
Sbjct  79   RTGEVIAHVAEGHSEDVDRAVSAARKAFDHGPWPKMTAYERQRILLRVADLIEKHNDELA  138

Query  477  TLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAG  656
             LETWDNGKPYEQAAK E+PM+VRL  YYAGWADKIHGLTVPADGP+HVQTLHEPIGVAG
Sbjct  139  ALETWDNGKPYEQAAKIEVPMLVRLIRYYAGWADKIHGLTVPADGPYHVQTLHEPIGVAG  198

Query  657  QIIPWNF  677
            QIIPWNF
Sbjct  199  QIIPWNF  205



>gb|KDO82485.1| hypothetical protein CISIN_1g009035mg [Citrus sinensis]
Length=546

 Score =   287 bits (735),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 127/162 (78%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = +3

Query  192  EELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAAR  371
            E+ ++P V+V YTQ +ING+FVDSASGKTFPTLDPRT DVI HVAEGEAED+NRAV+AAR
Sbjct  54   EDPITPPVKVDYTQLLINGQFVDSASGKTFPTLDPRTGDVITHVAEGEAEDVNRAVSAAR  113

Query  372  KAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRL  551
            KAFDEGPWP+M+AYERS+I+L+FADL+E+H DE+A LETWDNGKP+EQ+A++E+PM  RL
Sbjct  114  KAFDEGPWPRMTAYERSKIILRFADLLERHNDEIAALETWDNGKPFEQSAQTEVPMTTRL  173

Query  552  FHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            F YYAGWADKI GLT PADGP+HVQTLHEPIGVAGQIIPWNF
Sbjct  174  FRYYAGWADKIQGLTAPADGPYHVQTLHEPIGVAGQIIPWNF  215



>ref|XP_006438422.1| hypothetical protein CICLE_v10031155mg [Citrus clementina]
 ref|XP_006483828.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Citrus sinensis]
 gb|ESR51662.1| hypothetical protein CICLE_v10031155mg [Citrus clementina]
Length=546

 Score =   287 bits (735),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 127/162 (78%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = +3

Query  192  EELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAAR  371
            E+ ++P V+V YTQ +ING+FVDSASGKTFPTLDPRT DVI HVAEGEAED+NRAV+AAR
Sbjct  54   EDPITPPVKVDYTQLLINGQFVDSASGKTFPTLDPRTGDVITHVAEGEAEDVNRAVSAAR  113

Query  372  KAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRL  551
            KAFDEGPWP+M+AYERS+I+L+FADL+E+H DE+A LETWDNGKP+EQ+A++E+PM  RL
Sbjct  114  KAFDEGPWPRMTAYERSKIILRFADLLERHNDEIAALETWDNGKPFEQSAQTEVPMTTRL  173

Query  552  FHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            F YYAGWADKI GLT PADGP+HVQTLHEPIGVAGQIIPWNF
Sbjct  174  FRYYAGWADKIQGLTAPADGPYHVQTLHEPIGVAGQIIPWNF  215



>ref|XP_010682578.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Beta vulgaris subsp. vulgaris]
Length=550

 Score =   287 bits (735),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 131/172 (76%), Positives = 150/172 (87%), Gaps = 0/172 (0%)
 Frame = +3

Query  162  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  341
            + R+STA A EE ++P V VKYTQ +ING+FVDSASGK   T DPRT +VI  V+EG+AE
Sbjct  48   VSRYSTATASEEPITPPVTVKYTQLLINGQFVDSASGKKMKTYDPRTGNVITEVSEGDAE  107

Query  342  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  521
            DINRAV+AAR AFDEGPWPKM+AYERS+I+ KFADL+E+H DE+A LETWDNGKPYEQA+
Sbjct  108  DINRAVSAARIAFDEGPWPKMTAYERSKILFKFADLLEQHTDEIAALETWDNGKPYEQAS  167

Query  522  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            K ELPM VRL  YYAGWADKIHGLTVPADGP+H+QTLHEPIGVAGQIIPWNF
Sbjct  168  KVELPMCVRLMRYYAGWADKIHGLTVPADGPYHMQTLHEPIGVAGQIIPWNF  219



>ref|XP_009110081.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial 
[Brassica rapa]
Length=537

 Score =   287 bits (734),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 128/177 (72%), Positives = 156/177 (88%), Gaps = 1/177 (1%)
 Frame = +3

Query  150  VESGIQRFST-AAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVA  326
            +  G +R+S  AA++E+ ++P V+V++TQ +INGKFVDSASGKTFPTLDPRT +VIA VA
Sbjct  30   LNRGARRYSNLAASLEDTITPPVKVEHTQLLINGKFVDSASGKTFPTLDPRTGEVIAQVA  89

Query  327  EGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKP  506
            EG+ ED+NRAV AARKAFD+GPWP+M+AYERS+I+ +FADL+EKH DE+A LETWDNGKP
Sbjct  90   EGDVEDVNRAVVAARKAFDQGPWPRMTAYERSKILFRFADLIEKHNDEIAALETWDNGKP  149

Query  507  YEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            YEQ+A  E+PM+ R+F YYAGWADKIHG+TVP DG HHVQTLHEPIGVAGQIIPWNF
Sbjct  150  YEQSANIEVPMLARVFRYYAGWADKIHGMTVPGDGSHHVQTLHEPIGVAGQIIPWNF  206



>emb|CDY57318.1| BnaA08g20300D [Brassica napus]
Length=537

 Score =   287 bits (734),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 128/177 (72%), Positives = 156/177 (88%), Gaps = 1/177 (1%)
 Frame = +3

Query  150  VESGIQRFST-AAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVA  326
            +  G +R+S  AA++E+ ++P V+V++TQ +INGKFVDSASGKTFPTLDPRT +VIA VA
Sbjct  30   LNRGARRYSNLAASLEDTITPPVKVEHTQLLINGKFVDSASGKTFPTLDPRTGEVIAQVA  89

Query  327  EGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKP  506
            EG+ ED+NRAV AARKAFD+GPWP+M+AYERS+I+ +FADL+EKH DE+A LETWDNGKP
Sbjct  90   EGDVEDVNRAVVAARKAFDQGPWPRMTAYERSKILFRFADLIEKHNDEIAALETWDNGKP  149

Query  507  YEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            YEQ+A  E+PM+ R+F YYAGWADKIHG+TVP DG HHVQTLHEPIGVAGQIIPWNF
Sbjct  150  YEQSANIEVPMLARVFRYYAGWADKIHGMTVPGDGSHHVQTLHEPIGVAGQIIPWNF  206



>ref|XP_009761724.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Nicotiana sylvestris]
Length=540

 Score =   287 bits (734),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 132/175 (75%), Positives = 149/175 (85%), Gaps = 0/175 (0%)
 Frame = +3

Query  153  ESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEG  332
            ++GI+ FS+A   EE ++P VEVKY Q +ING+FVD+ASGK FPT DPRT DVI  VAE 
Sbjct  36   KNGIRSFSSAVVHEEPITPPVEVKYKQLLINGQFVDAASGKMFPTYDPRTGDVITMVAEA  95

Query  333  EAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYE  512
            + ED+NRAV+AARKAFDEGPWPKMSAYERS IML+FAD +EKH DELA LETWDNGKPYE
Sbjct  96   DTEDVNRAVSAARKAFDEGPWPKMSAYERSCIMLRFADFLEKHGDELAALETWDNGKPYE  155

Query  513  QAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            QAA  E+PM++RLF YYAGWADKIHGLT PAD  HHVQ LHEPIGVAGQIIPWNF
Sbjct  156  QAANEEIPMLIRLFRYYAGWADKIHGLTAPADSLHHVQILHEPIGVAGQIIPWNF  210



>gb|KEH19981.1| NAD-dependent aldehyde dehydrogenase family protein [Medicago 
truncatula]
Length=509

 Score =   286 bits (731),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 130/171 (76%), Positives = 156/171 (91%), Gaps = 1/171 (1%)
 Frame = +3

Query  168  RFSTAAAVEEL-VSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAED  344
            ++STAAA++E  + P+V+V +TQ +I+GKFVD+ASGKTFPTLDPRT +VIAHVAEG +ED
Sbjct  40   KYSTAAAIDEQPIKPSVQVDHTQLLIDGKFVDAASGKTFPTLDPRTGEVIAHVAEGHSED  99

Query  345  INRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAK  524
            ++RAVAAARKAFD+GPWPK  AYER +IML+ ADL+EKH D++A LETWDNGKPYEQ+A+
Sbjct  100  VDRAVAAARKAFDQGPWPKFPAYERQKIMLRAADLIEKHNDQIAALETWDNGKPYEQSAQ  159

Query  525  SELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
             E+PM+VRLF YYAGWADKIHGLTVPADGP+HVQTLHEPIGVAGQIIPWNF
Sbjct  160  IEIPMLVRLFRYYAGWADKIHGLTVPADGPYHVQTLHEPIGVAGQIIPWNF  210



>ref|XP_010029206.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Eucalyptus grandis]
Length=532

 Score =   286 bits (732),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 130/182 (71%), Positives = 161/182 (88%), Gaps = 0/182 (0%)
 Frame = +3

Query  132  LGWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDV  311
            +G  +G   GI   S+++ V+EL++P+V++  TQ +INGKFVD+ASGKTFPTLDPRT DV
Sbjct  20   IGRSHGWVRGIGSSSSSSVVDELITPSVKIADTQLLINGKFVDAASGKTFPTLDPRTGDV  79

Query  312  IAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETW  491
            I HVAEG+AED++RAVAAARKAFDEGPWP+M+AYERS I+L+FADL+EKH+D+LA +ETW
Sbjct  80   ITHVAEGDAEDVDRAVAAARKAFDEGPWPRMTAYERSCILLRFADLLEKHIDDLAAIETW  139

Query  492  DNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPW  671
            DNGKPYEQAA+ E+P ++RL  YYAGWADKIHGLT+PADG +HVQTLHEPIGVAGQI+PW
Sbjct  140  DNGKPYEQAAEDEVPDVIRLMRYYAGWADKIHGLTIPADGEYHVQTLHEPIGVAGQIVPW  199

Query  672  NF  677
            NF
Sbjct  200  NF  201



>ref|XP_007157468.1| hypothetical protein PHAVU_002G072100g [Phaseolus vulgaris]
 gb|ESW29462.1| hypothetical protein PHAVU_002G072100g [Phaseolus vulgaris]
Length=538

 Score =   286 bits (732),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 131/170 (77%), Positives = 152/170 (89%), Gaps = 0/170 (0%)
 Frame = +3

Query  168  RFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDI  347
            +FSTAAA EE + P V V++TQ +I+GKFVD+ SGKTFPTLDPRT DVIA VAEG+ ED+
Sbjct  38   KFSTAAATEEPIKPPVRVEHTQLLIDGKFVDATSGKTFPTLDPRTGDVIALVAEGDHEDV  97

Query  348  NRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKS  527
            ++AV+ ARKAFD GPWPKM+AYER RI+L+ ADL+EKH DELA LETWDNGKPYEQ+A+ 
Sbjct  98   DQAVSVARKAFDHGPWPKMTAYERQRILLRAADLLEKHNDELAALETWDNGKPYEQSAQI  157

Query  528  ELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            E+P++VRLF YYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF
Sbjct  158  EVPIVVRLFRYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  207



>ref|XP_004139235.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Cucumis sativus]
Length=538

 Score =   286 bits (732),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 131/172 (76%), Positives = 153/172 (89%), Gaps = 0/172 (0%)
 Frame = +3

Query  162  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  341
            I ++STA+AVE+ ++P+V+V Y Q +ING+FVDS SGKTFPTLDPRT +VIA VAEG+A 
Sbjct  36   IAKYSTASAVEDPITPSVKVNYNQLLINGQFVDSVSGKTFPTLDPRTGEVIAEVAEGDAR  95

Query  342  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  521
            DI+ AV+AARKAFDEGPWPKM+AYERS+IML+FADLVEKH +E+A LETWDNGK YEQ+ 
Sbjct  96   DIDIAVSAARKAFDEGPWPKMTAYERSKIMLRFADLVEKHAEEVAALETWDNGKTYEQSL  155

Query  522  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            K E+PM VRLF YY GWADKIHGLTVPADG +HVQTLHEPIGVAGQIIPWNF
Sbjct  156  KIEIPMFVRLFRYYGGWADKIHGLTVPADGSYHVQTLHEPIGVAGQIIPWNF  207



>ref|XP_004156463.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Cucumis sativus]
Length=540

 Score =   286 bits (732),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 131/172 (76%), Positives = 153/172 (89%), Gaps = 0/172 (0%)
 Frame = +3

Query  162  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  341
            I ++STA+AVE+ ++P+V+V Y Q +ING+FVDS SGKTFPTLDPRT +VIA VAEG+A 
Sbjct  38   IAKYSTASAVEDPITPSVKVNYNQLLINGQFVDSVSGKTFPTLDPRTGEVIAEVAEGDAR  97

Query  342  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  521
            DI+ AV+AARKAFDEGPWPKM+AYERS+IML+FADLVEKH +E+A LETWDNGK YEQ+ 
Sbjct  98   DIDIAVSAARKAFDEGPWPKMTAYERSKIMLRFADLVEKHAEEVAALETWDNGKTYEQSL  157

Query  522  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            K E+PM VRLF YY GWADKIHGLTVPADG +HVQTLHEPIGVAGQIIPWNF
Sbjct  158  KIEIPMFVRLFRYYGGWADKIHGLTVPADGSYHVQTLHEPIGVAGQIIPWNF  209



>gb|KEH19980.1| NAD-dependent aldehyde dehydrogenase family protein [Medicago 
truncatula]
Length=541

 Score =   286 bits (731),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 130/171 (76%), Positives = 156/171 (91%), Gaps = 1/171 (1%)
 Frame = +3

Query  168  RFSTAAAVEEL-VSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAED  344
            ++STAAA++E  + P+V+V +TQ +I+GKFVD+ASGKTFPTLDPRT +VIAHVAEG +ED
Sbjct  40   KYSTAAAIDEQPIKPSVQVDHTQLLIDGKFVDAASGKTFPTLDPRTGEVIAHVAEGHSED  99

Query  345  INRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAK  524
            ++RAVAAARKAFD+GPWPK  AYER +IML+ ADL+EKH D++A LETWDNGKPYEQ+A+
Sbjct  100  VDRAVAAARKAFDQGPWPKFPAYERQKIMLRAADLIEKHNDQIAALETWDNGKPYEQSAQ  159

Query  525  SELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
             E+PM+VRLF YYAGWADKIHGLTVPADGP+HVQTLHEPIGVAGQIIPWNF
Sbjct  160  IEIPMLVRLFRYYAGWADKIHGLTVPADGPYHVQTLHEPIGVAGQIIPWNF  210



>emb|CDY61548.1| BnaA09g29890D, partial [Brassica napus]
Length=555

 Score =   286 bits (732),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 128/188 (68%), Positives = 159/188 (85%), Gaps = 0/188 (0%)
 Frame = +3

Query  114  PSASAFLGWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLD  293
            PS  A  G  + +  G+  +S  AA E+ ++P V+V++TQ +I GKFVD+ASGK FPTLD
Sbjct  37   PSLFALRGKHHNMYRGVYGYSNVAAAEDTITPPVKVEHTQLLIGGKFVDAASGKAFPTLD  96

Query  294  PRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDEL  473
            PRT +VIA VAEG+ ED+NRAV+AARKAFDEGPWP+M+AYERS+I+L+FADLV+KH DE+
Sbjct  97   PRTGEVIAQVAEGDVEDVNRAVSAARKAFDEGPWPRMTAYERSKILLRFADLVDKHNDEI  156

Query  474  ATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVA  653
            A +ETWDNGKP+EQ++K E+PM+ R+F YYAGWADKIHG+TVP DG HHVQTLHEPIGVA
Sbjct  157  AAIETWDNGKPFEQSSKIEVPMLARVFRYYAGWADKIHGMTVPGDGSHHVQTLHEPIGVA  216

Query  654  GQIIPWNF  677
            GQIIPWNF
Sbjct  217  GQIIPWNF  224



>ref|XP_008456004.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Cucumis melo]
Length=537

 Score =   285 bits (730),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 129/172 (75%), Positives = 155/172 (90%), Gaps = 0/172 (0%)
 Frame = +3

Query  162  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  341
            I ++STA+AVE+ ++P+V+V Y Q +ING+FVDS SGKTFPTLDPR+ +VIA+VAEG+A 
Sbjct  35   IAKYSTASAVEDPITPSVKVNYNQLLINGQFVDSVSGKTFPTLDPRSGEVIANVAEGDAR  94

Query  342  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  521
            D++ AV+AARKAFDEGPWPKM+AYERS+I+L+FADLVEKH +E+A LETWDNGK YEQ+ 
Sbjct  95   DVDIAVSAARKAFDEGPWPKMTAYERSKIILRFADLVEKHAEEVAALETWDNGKTYEQSL  154

Query  522  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            K E+PM VRLF YY GWADKIHGLTVPADGP+HVQTLHEPIGVAGQIIPWNF
Sbjct  155  KIEVPMFVRLFRYYGGWADKIHGLTVPADGPYHVQTLHEPIGVAGQIIPWNF  206



>ref|XP_009150211.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Brassica rapa]
Length=538

 Score =   285 bits (730),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 128/172 (74%), Positives = 153/172 (89%), Gaps = 0/172 (0%)
 Frame = +3

Query  162  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  341
            ++RF T++A E+++SP+V+V  TQ +I+G FVD+ SGKTF TLDPRT +VIA VAEG+AE
Sbjct  36   VRRFGTSSAAEKIISPSVQVSCTQLLIDGNFVDATSGKTFQTLDPRTGEVIADVAEGDAE  95

Query  342  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  521
            DI+RAV AARKAFD+GPWP+M+AYERSRIML+FADLVEKH +ELA LETWDNGK Y+QA 
Sbjct  96   DIDRAVKAARKAFDKGPWPRMTAYERSRIMLRFADLVEKHSEELAALETWDNGKTYQQAK  155

Query  522  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
             +E+PM+ RLF YYAGWADKIHGLTVPADG +HVQTLHEPIGVAGQIIPWNF
Sbjct  156  TAEIPMLARLFRYYAGWADKIHGLTVPADGNYHVQTLHEPIGVAGQIIPWNF  207



>ref|XP_009600000.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Nicotiana tomentosiformis]
Length=544

 Score =   285 bits (730),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 132/175 (75%), Positives = 150/175 (86%), Gaps = 0/175 (0%)
 Frame = +3

Query  153  ESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEG  332
            ++GI+ FS+A   EE ++P VEVKY Q +ING+FVD+ASGK FPT DPRT DVI  VAE 
Sbjct  40   KNGIRSFSSAVVHEEPITPPVEVKYKQLLINGQFVDAASGKMFPTYDPRTGDVITMVAEA  99

Query  333  EAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYE  512
            + ED+NRAV+AARKAFDEGPWPKMSAYERS IML+FADL+EKH DELA LET+DNGKPYE
Sbjct  100  DTEDVNRAVSAARKAFDEGPWPKMSAYERSCIMLRFADLLEKHSDELAELETYDNGKPYE  159

Query  513  QAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            QAA  E+PM++RLF YYAGWADKIHGLT PAD  HHVQ LHEPIGVAGQIIPWNF
Sbjct  160  QAANEEIPMLLRLFRYYAGWADKIHGLTAPADSLHHVQILHEPIGVAGQIIPWNF  214



>emb|CDX91724.1| BnaC08g06430D [Brassica napus]
Length=537

 Score =   285 bits (730),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 129/177 (73%), Positives = 155/177 (88%), Gaps = 1/177 (1%)
 Frame = +3

Query  150  VESGIQRFST-AAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVA  326
            +  G +R+S  AA++E+ ++P V+V+ TQ +INGKFVDSASGKTFPTLDPRT +VIA VA
Sbjct  30   MNRGARRYSNLAASLEDTITPPVKVEQTQLLINGKFVDSASGKTFPTLDPRTGEVIAQVA  89

Query  327  EGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKP  506
            EG+ ED+NRAV AARKAFDEGPWP+M+AYERS+I+ +FADL+EKH DE+A LETWDNGKP
Sbjct  90   EGDVEDVNRAVVAARKAFDEGPWPRMTAYERSKILFRFADLIEKHNDEIAALETWDNGKP  149

Query  507  YEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            YEQ+AK E+PM+ R+F YYAGWADKIHG+TV  DG HHVQTLHEPIGVAGQIIPWNF
Sbjct  150  YEQSAKIEVPMLARVFRYYAGWADKIHGMTVRGDGSHHVQTLHEPIGVAGQIIPWNF  206



>gb|KGN60807.1| hypothetical protein Csa_2G010420 [Cucumis sativus]
Length=592

 Score =   286 bits (732),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 131/172 (76%), Positives = 153/172 (89%), Gaps = 0/172 (0%)
 Frame = +3

Query  162  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  341
            I ++STA+AVE+ ++P+V+V Y Q +ING+FVDS SGKTFPTLDPRT +VIA VAEG+A 
Sbjct  90   IAKYSTASAVEDPITPSVKVNYNQLLINGQFVDSVSGKTFPTLDPRTGEVIAEVAEGDAR  149

Query  342  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  521
            DI+ AV+AARKAFDEGPWPKM+AYERS+IML+FADLVEKH +E+A LETWDNGK YEQ+ 
Sbjct  150  DIDIAVSAARKAFDEGPWPKMTAYERSKIMLRFADLVEKHAEEVAALETWDNGKTYEQSL  209

Query  522  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            K E+PM VRLF YY GWADKIHGLTVPADG +HVQTLHEPIGVAGQIIPWNF
Sbjct  210  KIEIPMFVRLFRYYGGWADKIHGLTVPADGSYHVQTLHEPIGVAGQIIPWNF  261



>ref|XP_011071082.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Sesamum indicum]
Length=525

 Score =   284 bits (726),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 133/179 (74%), Positives = 156/179 (87%), Gaps = 3/179 (2%)
 Frame = +3

Query  141  KYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAH  320
            +YG   GI R+ T +A +E + P V V+Y + +ING+FVD+ASGKTFPTLDPR+ +VIAH
Sbjct  19   RYG--RGIYRYGTTSA-QEPIKPPVTVEYDKLLINGQFVDAASGKTFPTLDPRSGEVIAH  75

Query  321  VAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNG  500
            VAEG+ EDINRAVAAARKAFDEGPWPKM+AYER RIML+FADLVEKH DE+A LETWDNG
Sbjct  76   VAEGDTEDINRAVAAARKAFDEGPWPKMTAYERCRIMLRFADLVEKHNDEIAALETWDNG  135

Query  501  KPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            K YEQ+A  E+PM+VRLF YYAGWADKIHGLT+ ADGP++VQ+LHEPIGVAGQIIPWNF
Sbjct  136  KVYEQSAHIEIPMLVRLFRYYAGWADKIHGLTIRADGPYNVQSLHEPIGVAGQIIPWNF  194



>ref|XP_003563967.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Brachypodium distachyon]
Length=548

 Score =   283 bits (725),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 131/172 (76%), Positives = 150/172 (87%), Gaps = 0/172 (0%)
 Frame = +3

Query  162  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  341
            +QRF TAA  EE +SP V+V  T+ +INGKFVD+ SGKTFPTLDPRT +VIAHVAEG+A+
Sbjct  46   LQRFGTAAVAEEPISPPVKVGETKLLINGKFVDAVSGKTFPTLDPRTGEVIAHVAEGDAK  105

Query  342  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  521
            DI+ AVAAARKAFDEGPWP+M+AYERSRI+L+FADL+EKH D+LA LETWDNGK +EQAA
Sbjct  106  DIDLAVAAARKAFDEGPWPRMTAYERSRILLRFADLIEKHNDDLAALETWDNGKTFEQAA  165

Query  522  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
              ELPMI RL  YYAGW+DKIHGL VPAD PHHVQ L+EPIGVAGQIIPWNF
Sbjct  166  HIELPMIARLMRYYAGWSDKIHGLVVPADSPHHVQVLYEPIGVAGQIIPWNF  217



>ref|XP_010271955.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial 
[Nelumbo nucifera]
Length=534

 Score =   283 bits (724),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 130/182 (71%), Positives = 156/182 (86%), Gaps = 0/182 (0%)
 Frame = +3

Query  132  LGWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDV  311
            LG K      I  F TA  +EE  +P ++V++TQ +ING+FVD+ASG+TFPTLDP  E+V
Sbjct  22   LGRKSSWGRDIYCFCTANTIEEPSTPPIQVEHTQLLINGQFVDAASGRTFPTLDPSKEEV  81

Query  312  IAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETW  491
            IAHV+EG+AEDINRAV+AARKAFDEGPWP+M+AYER++IM +FADL+EK+ DE+A LE+ 
Sbjct  82   IAHVSEGDAEDINRAVSAARKAFDEGPWPRMTAYERAKIMYRFADLLEKYNDEIAALESL  141

Query  492  DNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPW  671
            D+GKPYEQAAK E+P + RLF YYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPW
Sbjct  142  DSGKPYEQAAKVEIPTVTRLFRYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPW  201

Query  672  NF  677
            NF
Sbjct  202  NF  203



>gb|EYU22484.1| hypothetical protein MIMGU_mgv1a004342mg [Erythranthe guttata]
Length=532

 Score =   283 bits (723),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 124/176 (70%), Positives = 153/176 (87%), Gaps = 0/176 (0%)
 Frame = +3

Query  150  VESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAE  329
            +  GI  +S +A+++  + P V V+Y + +ING+FV++ASGKTFPTLDPR+ +VIAHV+E
Sbjct  26   LSRGIYHYSKSASLDNPIKPPVTVQYDKLLINGQFVEAASGKTFPTLDPRSGEVIAHVSE  85

Query  330  GEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPY  509
            G+ ED+NRAVA+ARKAFDEGPWPKM+AYERS+IM +FADL+EKH DE+A LETWDNGKP+
Sbjct  86   GDLEDVNRAVASARKAFDEGPWPKMTAYERSKIMFRFADLIEKHNDEIAALETWDNGKPF  145

Query  510  EQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            EQ+AK E+PM+ RLF YY GWADKIHGLT+  DGPHHVQTLHEPIGVAGQIIPWNF
Sbjct  146  EQSAKIEVPMLARLFRYYGGWADKIHGLTIRGDGPHHVQTLHEPIGVAGQIIPWNF  201



>gb|ACU18804.1| unknown [Glycine max]
Length=199

 Score =   271 bits (694),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 126/171 (74%), Positives = 148/171 (87%), Gaps = 0/171 (0%)
 Frame = +3

Query  132  LGWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDV  311
            LG   G      RFSTAAAVE+L++P V + YT+H+ING+FVD+ASGKTFPT DPRT +V
Sbjct  28   LGRNSGKWGNFNRFSTAAAVEDLITPQVPITYTKHLINGQFVDAASGKTFPTYDPRTGEV  87

Query  312  IAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETW  491
            IA VAEG+AEDINRAV+AARKAFDEGPWPK++AYER +I+L+FADLVEKH DELA LETW
Sbjct  88   IAQVAEGDAEDINRAVSAARKAFDEGPWPKLTAYERCKIILRFADLVEKHGDELAALETW  147

Query  492  DNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPI  644
            +NGKPYEQ+A +ELP  VRLF YYAGWADKIHGLTVPADG +HV+TLHEP+
Sbjct  148  NNGKPYEQSATAELPTFVRLFRYYAGWADKIHGLTVPADGNYHVETLHEPM  198



>emb|CDX77883.1| BnaC03g53360D [Brassica napus]
Length=572

 Score =   283 bits (725),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 128/178 (72%), Positives = 153/178 (86%), Gaps = 0/178 (0%)
 Frame = +3

Query  144  YGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHV  323
            Y     ++RF  ++A E+++ P+V+V YTQ +I+G FVD+ASGKTFPT+DPRT +VIA V
Sbjct  30   YNASRVVRRFGISSAAEKIIRPSVQVSYTQLLIDGNFVDAASGKTFPTIDPRTGEVIADV  89

Query  324  AEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGK  503
            AEG+AEDI+ AV AARKAFDEGPWPKM+AYERSRIML+FADLVEKH ++LA LETWDNGK
Sbjct  90   AEGDAEDIDWAVKAARKAFDEGPWPKMTAYERSRIMLRFADLVEKHSEDLAALETWDNGK  149

Query  504  PYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
             Y+QA  +E+PM+ RLF YYAGWADKIHGLTVPADG +HVQTLHEPIGVAGQI PWNF
Sbjct  150  TYQQAKTAEIPMLARLFRYYAGWADKIHGLTVPADGNYHVQTLHEPIGVAGQINPWNF  207



>ref|XP_010037573.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Eucalyptus grandis]
 gb|KCW49300.1| hypothetical protein EUGRSUZ_K02858 [Eucalyptus grandis]
 gb|KCW49301.1| hypothetical protein EUGRSUZ_K02858 [Eucalyptus grandis]
Length=542

 Score =   281 bits (720),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 135/180 (75%), Positives = 155/180 (86%), Gaps = 3/180 (2%)
 Frame = +3

Query  147  GVESGIQRFSTAAA---VEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIA  317
            G+   I RFSTAAA   +EELV P V+V +TQ +ING+FVDSASGKTFP  DPRT +VIA
Sbjct  32   GLRRSIPRFSTAAAAAALEELVIPPVQVCHTQLLINGQFVDSASGKTFPAYDPRTAEVIA  91

Query  318  HVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDN  497
            HVAEG+ ED++RAVAAARKAFDEGPWPKM+ YER RI+L+FADLVEKH +ELA LETW+N
Sbjct  92   HVAEGDGEDVDRAVAAARKAFDEGPWPKMTPYERCRILLRFADLVEKHSEELAALETWNN  151

Query  498  GKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            GKPYEQA  SE+P + RLF YYAGWADKIHG+TVPADG +H+QTLHEPIGVAGQIIPWNF
Sbjct  152  GKPYEQALHSEIPSMARLFRYYAGWADKIHGMTVPADGNYHMQTLHEPIGVAGQIIPWNF  211



>gb|AAC98035.1| Strong similarity to gb|Y09876 aldehyde dehydrogenase (NAD+) 
from Nicotiana tabacum and a member of the aldehyde dehydrogenase 
family PF|00171. ESTs gb|F15117, gb|R83958 and gb|586262 
come from this gene [Arabidopsis thaliana]
Length=519

 Score =   280 bits (717),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 129/188 (69%), Positives = 156/188 (83%), Gaps = 12/188 (6%)
 Frame = +3

Query  150  VESGIQRFST-AAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVA  326
            +  G QR+S  AAAVE  ++P V+V++TQ +I G+FVD+ SGKTFPTLDPR  +VIA V+
Sbjct  1    MNRGAQRYSNLAAAVENTITPPVKVEHTQLLIGGRFVDAVSGKTFPTLDPRNGEVIAQVS  60

Query  327  EGEAEDINRAVAAARKAFDEGPWPKMSAY-----------ERSRIMLKFADLVEKHMDEL  473
            EG+AED+NRAVAAARKAFDEGPWPKM+AY           ERS+I+ +FADL+EKH DE+
Sbjct  61   EGDAEDVNRAVAAARKAFDEGPWPKMTAYVYNKVVLCLSSERSKILFRFADLIEKHNDEI  120

Query  474  ATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVA  653
            A LETWDNGKPYEQ+A+ E+PM+ R+F YYAGWADKIHG+T+P DGPHHVQTLHEPIGVA
Sbjct  121  AALETWDNGKPYEQSAQIEVPMLARVFRYYAGWADKIHGMTMPGDGPHHVQTLHEPIGVA  180

Query  654  GQIIPWNF  677
            GQIIPWNF
Sbjct  181  GQIIPWNF  188



>ref|XP_004245256.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Solanum lycopersicum]
Length=534

 Score =   281 bits (718),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 128/170 (75%), Positives = 149/170 (88%), Gaps = 2/170 (1%)
 Frame = +3

Query  168  RFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDI  347
            R++TAA  ++ + P+V V+YT+  ING+FVDSASGKTFPTLDPRT +VIAHVAEG+ EDI
Sbjct  36   RYTTAA--QDPIKPSVNVEYTKLFINGQFVDSASGKTFPTLDPRTGEVIAHVAEGDVEDI  93

Query  348  NRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKS  527
            NRAV AAR AFDEGPWPKMSAYERS+I+ + ADL+EKH DE+ATLETWD+GK Y+Q A  
Sbjct  94   NRAVVAARNAFDEGPWPKMSAYERSKILFRIADLIEKHNDEIATLETWDSGKLYQQVATI  153

Query  528  ELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            E+PMIVRL  YYAGWADKIHG+TVPADGP+HVQTLHEPIGV GQIIPWNF
Sbjct  154  EIPMIVRLLRYYAGWADKIHGMTVPADGPYHVQTLHEPIGVVGQIIPWNF  203



>ref|XP_006416054.1| hypothetical protein EUTSA_v10007303mg [Eutrema salsugineum]
 gb|ESQ34407.1| hypothetical protein EUTSA_v10007303mg [Eutrema salsugineum]
Length=541

 Score =   280 bits (717),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 129/180 (72%), Positives = 156/180 (87%), Gaps = 4/180 (2%)
 Frame = +3

Query  150  VESGIQRFST----AAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIA  317
            +  G +R+S     AAA+E+ ++P V+V++TQ +I GKFVD+ASGKTFPTLDPRT +VIA
Sbjct  31   MNRGARRYSNLAAAAAALEDTITPPVKVEHTQLLIGGKFVDAASGKTFPTLDPRTGEVIA  90

Query  318  HVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDN  497
             VAEG+ ED+NRAV AARKAFDEGPWP+M+AYERS+I+ +FADL+EKH DE+A LETWDN
Sbjct  91   QVAEGDVEDVNRAVLAARKAFDEGPWPRMTAYERSKILFRFADLIEKHNDEIAALETWDN  150

Query  498  GKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            GKPYEQ+AK E+PM+ R+F YYAGWADKIHG+TVP DG HHVQTLHEPIGVAGQIIPWNF
Sbjct  151  GKPYEQSAKIEVPMLARVFRYYAGWADKIHGMTVPGDGSHHVQTLHEPIGVAGQIIPWNF  210



>gb|KHN47185.1| Aldehyde dehydrogenase family 2 member B4, mitochondrial [Glycine 
soja]
Length=538

 Score =   279 bits (713),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 132/180 (73%), Positives = 156/180 (87%), Gaps = 3/180 (2%)
 Frame = +3

Query  138  WKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIA  317
            W+  + SGI   S  A VE  ++P V++  +Q +I+GKFVD+ASGKTFPT DPRT DVIA
Sbjct  33   WQRSI-SGIAA-SVVADVEPSIAP-VQIDQSQLLIDGKFVDAASGKTFPTFDPRTGDVIA  89

Query  318  HVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDN  497
            +VAEG+AED+NRAV AARKAFDEGPWPKM+AYERSRI+L+FADL+EKH DE+A +ETWD+
Sbjct  90   NVAEGDAEDVNRAVHAARKAFDEGPWPKMTAYERSRIILRFADLLEKHNDEVAAIETWDS  149

Query  498  GKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            GK YEQAA  E+PM+VRLF YYAGWADKIHGLTVPADGP+HVQTLHEPIGVAGQI+PWNF
Sbjct  150  GKTYEQAANVEIPMVVRLFRYYAGWADKIHGLTVPADGPYHVQTLHEPIGVAGQIVPWNF  209



>ref|XP_006594290.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
isoform X2 [Glycine max]
Length=537

 Score =   279 bits (713),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 132/180 (73%), Positives = 156/180 (87%), Gaps = 3/180 (2%)
 Frame = +3

Query  138  WKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIA  317
            W+  + SGI   S  A VE  ++P V++  +Q +I+GKFVD+ASGKTFPT DPRT DVIA
Sbjct  30   WQRSI-SGIAA-SVVADVEPSIAP-VQIDQSQLLIDGKFVDAASGKTFPTFDPRTGDVIA  86

Query  318  HVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDN  497
            +VAEG+AED+NRAV AARKAFDEGPWPKM+AYERSRI+L+FADL+EKH DE+A +ETWD+
Sbjct  87   NVAEGDAEDVNRAVHAARKAFDEGPWPKMTAYERSRIILRFADLLEKHNDEVAAIETWDS  146

Query  498  GKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            GK YEQAA  E+PM+VRLF YYAGWADKIHGLTVPADGP+HVQTLHEPIGVAGQI+PWNF
Sbjct  147  GKTYEQAANVEIPMVVRLFRYYAGWADKIHGLTVPADGPYHVQTLHEPIGVAGQIVPWNF  206



>ref|XP_003542700.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
isoform X1 [Glycine max]
Length=540

 Score =   279 bits (713),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 132/180 (73%), Positives = 156/180 (87%), Gaps = 3/180 (2%)
 Frame = +3

Query  138  WKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIA  317
            W+  + SGI   S  A VE  ++P V++  +Q +I+GKFVD+ASGKTFPT DPRT DVIA
Sbjct  33   WQRSI-SGIAA-SVVADVEPSIAP-VQIDQSQLLIDGKFVDAASGKTFPTFDPRTGDVIA  89

Query  318  HVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDN  497
            +VAEG+AED+NRAV AARKAFDEGPWPKM+AYERSRI+L+FADL+EKH DE+A +ETWD+
Sbjct  90   NVAEGDAEDVNRAVHAARKAFDEGPWPKMTAYERSRIILRFADLLEKHNDEVAAIETWDS  149

Query  498  GKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            GK YEQAA  E+PM+VRLF YYAGWADKIHGLTVPADGP+HVQTLHEPIGVAGQI+PWNF
Sbjct  150  GKTYEQAANVEIPMVVRLFRYYAGWADKIHGLTVPADGPYHVQTLHEPIGVAGQIVPWNF  209



>ref|XP_010316283.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Solanum lycopersicum]
Length=528

 Score =   278 bits (712),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 129/174 (74%), Positives = 147/174 (84%), Gaps = 1/174 (1%)
 Frame = +3

Query  159  GIQRFSTAAAV-EELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGE  335
            GI+RF ++A V EE ++P VEVKY Q +ING+FVD+ASGKTFPT DPRT + I  VAE +
Sbjct  25   GIRRFCSSAVVHEEPITPPVEVKYNQLLINGQFVDAASGKTFPTFDPRTGEAITTVAEAD  84

Query  336  AEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQ  515
             ED+NRAV AARKAFDEGPWPKM+  ERS IML+FADL+E+H DELA LETWD GKPYEQ
Sbjct  85   TEDVNRAVFAARKAFDEGPWPKMTCAERSCIMLQFADLLERHSDELAALETWDKGKPYEQ  144

Query  516  AAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            AA  E+PM++RLF YYAGWADKIHGLT PAD  HHVQTLHEPIGVAGQIIPWNF
Sbjct  145  AANEEIPMLIRLFRYYAGWADKIHGLTAPADSLHHVQTLHEPIGVAGQIIPWNF  198



>ref|XP_006356663.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Solanum tuberosum]
Length=537

 Score =   278 bits (711),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 125/171 (73%), Positives = 149/171 (87%), Gaps = 1/171 (1%)
 Frame = +3

Query  168  RFSTAAAV-EELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAED  344
            R++TAA + ++ + P+V V+YT+  ING+FVDS SGKTFPTLDPRT +VIAHVAEG+ ED
Sbjct  36   RYTTAAPIAQDPIKPSVNVEYTKLFINGQFVDSTSGKTFPTLDPRTGEVIAHVAEGDVED  95

Query  345  INRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAK  524
            INRAV AAR AFDEGPWPKMSAYERS+++ + ADL+EKH DE+ATLETWD+GK Y+Q A 
Sbjct  96   INRAVVAARNAFDEGPWPKMSAYERSKVLFRIADLIEKHNDEIATLETWDSGKLYQQVAT  155

Query  525  SELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
             E+PMIVR+  YYAGWADKIHG+TVPADGP+HVQTLHEPIGV GQIIPWNF
Sbjct  156  IEIPMIVRILRYYAGWADKIHGMTVPADGPYHVQTLHEPIGVVGQIIPWNF  206



>ref|XP_002525343.1| aldehyde dehydrogenase, putative [Ricinus communis]
 gb|EEF36981.1| aldehyde dehydrogenase, putative [Ricinus communis]
Length=385

 Score =   273 bits (698),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 125/143 (87%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  249  KFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRI  428
            KFVD+ASG+TFPTLDPRT +VIAHVAEG+AEDINRAV+AARKAFDEG WPKM+AYERSRI
Sbjct  14   KFVDAASGRTFPTLDPRTGEVIAHVAEGDAEDINRAVSAARKAFDEGSWPKMTAYERSRI  73

Query  429  MLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPAD  608
            ML+FADL+EKH DELA LETWDNGKPYEQAAK E+PM+ RLF YYAGWADKIHGLTVPAD
Sbjct  74   MLRFADLIEKHNDELAALETWDNGKPYEQAAKGEIPMVARLFRYYAGWADKIHGLTVPAD  133

Query  609  GPHHVQTLHEPIGVAGQIIPWNF  677
            G HHVQTLHEPIGVAGQIIPWNF
Sbjct  134  GQHHVQTLHEPIGVAGQIIPWNF  156



>ref|XP_008793866.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Phoenix dactylifera]
Length=538

 Score =   277 bits (709),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 128/172 (74%), Positives = 147/172 (85%), Gaps = 3/172 (2%)
 Frame = +3

Query  162  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  341
            ++ FS AA   E ++P V+V +TQ +I+GKFVDSASG+TFPTLDPRT +VIAHVAEG+ E
Sbjct  39   LRMFSIAA---EPITPPVQVHHTQLLIDGKFVDSASGRTFPTLDPRTGEVIAHVAEGDLE  95

Query  342  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  521
            DINRAV+AARKAFDEGPWPKMS YERS I+ +FADL+EKH DE+A LETWD GKPYE  A
Sbjct  96   DINRAVSAARKAFDEGPWPKMSGYERSHILYRFADLIEKHNDEIAALETWDGGKPYEHTA  155

Query  522  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            + E+PM+ RL  YYAGWADKIHGL VPADGPHHVQ LHEPIGVAGQIIPWNF
Sbjct  156  QKEIPMVTRLMRYYAGWADKIHGLVVPADGPHHVQVLHEPIGVAGQIIPWNF  207



>ref|XP_007044551.1| Aldehyde dehydrogenase 2B4 [Theobroma cacao]
 gb|EOY00383.1| Aldehyde dehydrogenase 2B4 [Theobroma cacao]
Length=538

 Score =   277 bits (708),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 128/172 (74%), Positives = 145/172 (84%), Gaps = 0/172 (0%)
 Frame = +3

Query  162  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  341
            + R+ T  A  E  +  V+V +TQ +ING FVDSASGKTFPT DPRT DVIA+VAEG+ E
Sbjct  36   VSRYGTTCASVENPNIPVKVNHTQLLINGNFVDSASGKTFPTYDPRTGDVIAYVAEGDTE  95

Query  342  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  521
            DINRAV+AARKAFDEGPWPKM+AYERS ++ +FADL++KH +ELA LETWDNGK YEQAA
Sbjct  96   DINRAVSAARKAFDEGPWPKMTAYERSMVLFRFADLIDKHTEELAILETWDNGKTYEQAA  155

Query  522  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            K ELPMI RL  YYAGWADKIHGLTVPAD  HHVQT+HEPIGVAGQIIPWNF
Sbjct  156  KIELPMISRLIRYYAGWADKIHGLTVPADSSHHVQTIHEPIGVAGQIIPWNF  207



>ref|XP_010100483.1| Aldehyde dehydrogenase family 2 member [Morus notabilis]
 gb|EXB82617.1| Aldehyde dehydrogenase family 2 member [Morus notabilis]
Length=537

 Score =   276 bits (705),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 124/172 (72%), Positives = 145/172 (84%), Gaps = 0/172 (0%)
 Frame = +3

Query  162  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  341
            +  + TAAA+EE + P+V +++T+ +ING+FVDS SGKTFPT DPRT +VI HVAEG  E
Sbjct  35   VANYGTAAAIEEPIKPSVSIEHTKLLINGQFVDSVSGKTFPTFDPRTGEVITHVAEGGKE  94

Query  342  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  521
            D++ AVA ARKAFDEGPWPKM+AYERS ++L+FADL+EKH +ELA LETWDNGKPYEQA 
Sbjct  95   DVDLAVAVARKAFDEGPWPKMTAYERSLVLLRFADLLEKHTEELAKLETWDNGKPYEQAL  154

Query  522  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
              ELP+ VRL  YYAGWADKIHGLT  ADGPHHVQTLHEPIGV GQIIPWNF
Sbjct  155  NVELPICVRLIRYYAGWADKIHGLTAQADGPHHVQTLHEPIGVCGQIIPWNF  206



>ref|XP_010265814.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Nelumbo nucifera]
Length=539

 Score =   275 bits (703),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 125/173 (72%), Positives = 151/173 (87%), Gaps = 1/173 (1%)
 Frame = +3

Query  162  IQRFSTAAAVEE-LVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEA  338
            I RFSTAA  EE ++ P V+V++TQ +ING+FVD+ASG+TFPT DPR+ D+I HVAEG+ 
Sbjct  36   ISRFSTAALTEEEVIIPPVQVEHTQLLINGQFVDAASGRTFPTFDPRSGDLITHVAEGDE  95

Query  339  EDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQA  518
            EDINRAV AAR+AFD+GPWP+M+AYERS+I+ +FADL+EKH DE+A LETWD+GKPYE  
Sbjct  96   EDINRAVFAAREAFDDGPWPRMTAYERSKIIYRFADLLEKHNDEIAALETWDSGKPYEHT  155

Query  519  AKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            A  E+P + RLF Y+AGWADKIHGLTVPADGP+HVQTLHEPIGVAGQIIPWNF
Sbjct  156  ANVEIPKMTRLFRYFAGWADKIHGLTVPADGPYHVQTLHEPIGVAGQIIPWNF  208



>gb|AEV54528.1| aldehyde dehydrogenase ALDH2B4_V3 [Vitis vinifera]
Length=524

 Score =   275 bits (702),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 134/186 (72%), Positives = 151/186 (81%), Gaps = 14/186 (8%)
 Frame = +3

Query  123  SAFLGWKYGVESGIQRFSTAAA-VEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPR  299
            S  LG  +     I RFSTAAA VEEL++P V++ YTQ +ING+FVD+AS          
Sbjct  21   SLSLGKNFNRGKSIHRFSTAAAAVEELITPTVQINYTQLLINGQFVDAAS----------  70

Query  300  TEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELAT  479
               VIA+VAEG+AEDINRAV+AARKAFDEGPWP+MS YERSRI+L+FADL EKH DELA 
Sbjct  71   ---VIANVAEGDAEDINRAVSAARKAFDEGPWPRMSPYERSRILLRFADLAEKHNDELAA  127

Query  480  LETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQ  659
            LETW+NGKPYEQAAK+ELP+ VRLF YYAGWADKIHGLTV ADGPHHVQ LHEPIGVAGQ
Sbjct  128  LETWNNGKPYEQAAKAELPLFVRLFRYYAGWADKIHGLTVQADGPHHVQILHEPIGVAGQ  187

Query  660  IIPWNF  677
            IIPWNF
Sbjct  188  IIPWNF  193



>gb|KHN23562.1| Aldehyde dehydrogenase family 2 member B7, mitochondrial [Glycine 
soja]
Length=510

 Score =   274 bits (700),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 149/168 (89%), Gaps = 1/168 (1%)
 Frame = +3

Query  174  STAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINR  353
            S AA VE  ++P V++ ++Q +I+G+FVD+ASGKTFPT DPRT DVIA+VAEG+ ED+NR
Sbjct  30   SAAADVEPSIAP-VQIDHSQLLIDGQFVDAASGKTFPTFDPRTGDVIANVAEGDTEDVNR  88

Query  354  AVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSEL  533
            AV AARKAFDEGPWPKM+AYERSRI+L FA L+EKH DE+A +ETWD+GK YEQAAK E+
Sbjct  89   AVRAARKAFDEGPWPKMTAYERSRIILHFAGLLEKHNDEVAAIETWDSGKTYEQAAKVEI  148

Query  534  PMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            PM+VRLF YYAGW DKIHGLTVPADGP+HVQTLHEPIGVAGQI+PWNF
Sbjct  149  PMVVRLFRYYAGWVDKIHGLTVPADGPYHVQTLHEPIGVAGQIVPWNF  196



>gb|AAZ79358.1| aldehyde dehydrogenase [Vitis pseudoreticulata]
Length=524

 Score =   274 bits (701),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 134/186 (72%), Positives = 151/186 (81%), Gaps = 14/186 (8%)
 Frame = +3

Query  123  SAFLGWKYGVESGIQRFSTAAA-VEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPR  299
            S  LG  +     I RFSTAAA VEEL++P V++ YTQ +ING+FVD+AS          
Sbjct  21   SLSLGKNFNRGKSIHRFSTAAAAVEELITPTVQINYTQLLINGQFVDAAS----------  70

Query  300  TEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELAT  479
               VIA+VAEG+AEDINRAV+AARKAFDEGPWP+MS YERSRI+L+FADL EKH DELA 
Sbjct  71   ---VIANVAEGDAEDINRAVSAARKAFDEGPWPRMSPYERSRILLRFADLAEKHNDELAA  127

Query  480  LETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQ  659
            LETW+NGKPYEQAAK+ELP+ VRLF YYAGWADKIHGLTV ADGPHHVQ LHEPIGVAGQ
Sbjct  128  LETWNNGKPYEQAAKAELPLFVRLFRYYAGWADKIHGLTVQADGPHHVQILHEPIGVAGQ  187

Query  660  IIPWNF  677
            IIPWNF
Sbjct  188  IIPWNF  193



>ref|XP_004953799.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
isoform X2 [Setaria italica]
Length=548

 Score =   273 bits (697),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 120/162 (74%), Positives = 142/162 (88%), Gaps = 0/162 (0%)
 Frame = +3

Query  192  EELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAAR  371
            EE + PAVE+K+TQ +ING FVD+ASGKTFPTLDPRT +VIA VAEG++EDI+RAVAAAR
Sbjct  56   EEPIQPAVEIKHTQLLINGNFVDAASGKTFPTLDPRTGEVIARVAEGDSEDIDRAVAAAR  115

Query  372  KAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRL  551
            KAFDEGPWP+M+AYER R++L+FADL+E+H DE+A LETWDNGK   Q+A +E+PM+ R 
Sbjct  116  KAFDEGPWPRMTAYERCRVLLRFADLIERHADEIAALETWDNGKTLAQSAGAEVPMLARC  175

Query  552  FHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
              YYAGWADKIHGL VPADG HHVQ LHEP+GVAGQIIPWNF
Sbjct  176  MRYYAGWADKIHGLVVPADGAHHVQVLHEPVGVAGQIIPWNF  217



>gb|KDO82484.1| hypothetical protein CISIN_1g009035mg [Citrus sinensis]
Length=493

 Score =   270 bits (691),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = +3

Query  192  EELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAAR  371
            E+ ++P V+V YTQ +ING+FVDSASGKTFPTLDPRT DVI HVAEGEAED+NRAV+AAR
Sbjct  54   EDPITPPVKVDYTQLLINGQFVDSASGKTFPTLDPRTGDVITHVAEGEAEDVNRAVSAAR  113

Query  372  KAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRL  551
            KAFDEGPWP+M+AYERS+I+L+FADL+E+H DE+A LETWDNGKP+EQ+A++E+PM  RL
Sbjct  114  KAFDEGPWPRMTAYERSKIILRFADLLERHNDEIAALETWDNGKPFEQSAQTEVPMTTRL  173

Query  552  FHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAG  656
            F YYAGWADKI GLT PADGP+HVQTLHEPIGVAG
Sbjct  174  FRYYAGWADKIQGLTAPADGPYHVQTLHEPIGVAG  208



>ref|XP_010928603.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Elaeis guineensis]
Length=538

 Score =   271 bits (694),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 128/188 (68%), Positives = 156/188 (83%), Gaps = 3/188 (2%)
 Frame = +3

Query  117  SASAFLGWK-YGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLD  293
            S+S F G + + +  G+ R  + AA  E ++P VEV +TQ +I+GKFVDSASGKTFPTLD
Sbjct  22   SSSLFPGARTHDLAFGVLRMFSMAA--EPITPPVEVHHTQLLIDGKFVDSASGKTFPTLD  79

Query  294  PRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDEL  473
            PRT +VIAHVAE + ED+NRAV+AARKAFDEGPWPKM+ YERS I+ +FADL+EKH DE+
Sbjct  80   PRTGEVIAHVAEADLEDVNRAVSAARKAFDEGPWPKMTGYERSHILYRFADLIEKHNDEI  139

Query  474  ATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVA  653
            A LETW++GKPYE  ++ E+P++ RL  YYAGWADKIHGLTVPADGP+HVQ LHEPIGVA
Sbjct  140  AALETWNSGKPYEHTSQKEVPLVTRLMRYYAGWADKIHGLTVPADGPYHVQVLHEPIGVA  199

Query  654  GQIIPWNF  677
            GQIIPWNF
Sbjct  200  GQIIPWNF  207



>ref|XP_004953798.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
isoform X1 [Setaria italica]
Length=555

 Score =   272 bits (695),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 120/162 (74%), Positives = 142/162 (88%), Gaps = 0/162 (0%)
 Frame = +3

Query  192  EELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAAR  371
            EE + PAVE+K+TQ +ING FVD+ASGKTFPTLDPRT +VIA VAEG++EDI+RAVAAAR
Sbjct  63   EEPIQPAVEIKHTQLLINGNFVDAASGKTFPTLDPRTGEVIARVAEGDSEDIDRAVAAAR  122

Query  372  KAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRL  551
            KAFDEGPWP+M+AYER R++L+FADL+E+H DE+A LETWDNGK   Q+A +E+PM+ R 
Sbjct  123  KAFDEGPWPRMTAYERCRVLLRFADLIERHADEIAALETWDNGKTLAQSAGAEVPMLARC  182

Query  552  FHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
              YYAGWADKIHGL VPADG HHVQ LHEP+GVAGQIIPWNF
Sbjct  183  MRYYAGWADKIHGLVVPADGAHHVQVLHEPVGVAGQIIPWNF  224



>ref|XP_007151102.1| hypothetical protein PHAVU_004G018000g [Phaseolus vulgaris]
 gb|ESW23096.1| hypothetical protein PHAVU_004G018000g [Phaseolus vulgaris]
Length=522

 Score =   268 bits (685),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = +3

Query  207  PAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDE  386
            P V++++ Q +I+G FVD+ASGKTFPT DPRT D IA+VAE + ED+NRAV AARKAFDE
Sbjct  42   PPVQIEHNQLLIDGLFVDAASGKTFPTNDPRTGDTIANVAEADVEDVNRAVRAARKAFDE  101

Query  387  GPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYA  566
            GPWPKM+AYERSRI+L+ AD++EKH DE+A +ETWD+GKPYEQAA  E+PM+VRLF YYA
Sbjct  102  GPWPKMTAYERSRIILRCADILEKHNDEVAAIETWDSGKPYEQAANVEIPMVVRLFRYYA  161

Query  567  GWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            GWADKIHGLTVPADGP+HVQTLHEPIGVAGQI+PWNF
Sbjct  162  GWADKIHGLTVPADGPYHVQTLHEPIGVAGQIVPWNF  198



>emb|CDY21806.1| BnaA06g20750D [Brassica napus]
Length=496

 Score =   262 bits (669),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = +3

Query  225  YTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKM  404
            YTQ +I+G FVD+ASGKTF TLDPRT +VIA VAEG+AEDI+RAV AARKAFDEG WP+M
Sbjct  15   YTQLLIDGNFVDAASGKTFQTLDPRTGEVIADVAEGDAEDIDRAVKAARKAFDEGSWPRM  74

Query  405  SAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKI  584
            +AYERSRIML+FADLVEKH +ELA LETWDNGK Y+QA  +E+PM+ RLF YYAGWADKI
Sbjct  75   TAYERSRIMLRFADLVEKHSEELAALETWDNGKTYQQAKTAEIPMLARLFRYYAGWADKI  134

Query  585  HGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            HGLTVPADG +HVQTLHEPIG AGQIIPWNF
Sbjct  135  HGLTVPADGNYHVQTLHEPIGAAGQIIPWNF  165



>gb|ABD35815.1| putative mitochondrial aldehyde dehydrogenase [Populus x canadensis]
Length=149

 Score =   250 bits (638),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 135/149 (91%), Gaps = 0/149 (0%)
 Frame = +3

Query  177  TAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRA  356
            T AAVE+ ++P V VKY Q +ING+FVD+ASGKTFPTLDPRT +VIAHVAEG+ ED+NRA
Sbjct  1    TLAAVEDPITPPVSVKYNQLLINGQFVDAASGKTFPTLDPRTGEVIAHVAEGDVEDVNRA  60

Query  357  VAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELP  536
            V+AARKAFDEGPWP+M+AYERSRI+ +FADL+EKH DE+A LETWDNGKPYEQ+AK E+P
Sbjct  61   VSAARKAFDEGPWPRMTAYERSRIIWRFADLLEKHTDEIAALETWDNGKPYEQSAKIEIP  120

Query  537  MIVRLFHYYAGWADKIHGLTVPADGPHHV  623
            M VR+F YYAGWADKIHGLTVPADGP+HV
Sbjct  121  MTVRIFRYYAGWADKIHGLTVPADGPYHV  149



>gb|AAW50842.1| aldehyde dehydrogenase [Aegiceras corniculatum]
Length=186

 Score =   248 bits (632),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 114/141 (81%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = +3

Query  255  VDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIML  434
            VDSASG+TFPT DPRT +VIAH+AEG+ EDINRAV AARKAFDEGPWP+M+AYERSRI+L
Sbjct  1    VDSASGRTFPTYDPRTGEVIAHLAEGDEEDINRAVNAARKAFDEGPWPRMTAYERSRILL  60

Query  435  KFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGP  614
            + ADLVEKH +ELA LETW+NGKPYEQAA++ELP+ VRLFHYYAGWADKIHGLTV +DGP
Sbjct  61   RCADLVEKHSEELAALETWNNGKPYEQAAEAELPLFVRLFHYYAGWADKIHGLTVQSDGP  120

Query  615  HHVQTLHEPIGVAGQIIPWNF  677
            +H Q LHEPIGVA QIIPWNF
Sbjct  121  YHTQVLHEPIGVARQIIPWNF  141



>gb|AAZ79356.1| aldehyde dehydrogenase [Vitis pseudoreticulata]
Length=477

 Score =   255 bits (652),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 116/137 (85%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = +3

Query  267  SGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFAD  446
            +GKTFPT DPRT +VIA+VAEG+AEDINRAV+AARKAFDEGPWP+MS YERSRI+L+FAD
Sbjct  10   TGKTFPTFDPRTGEVIANVAEGDAEDINRAVSAARKAFDEGPWPRMSPYERSRILLRFAD  69

Query  447  LVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQ  626
            L EKH DELA LETW+NGKPYEQAAK+ELP+ VRLF YYAGWADKIHGLTV ADGPHHVQ
Sbjct  70   LAEKHNDELAALETWNNGKPYEQAAKAELPLFVRLFRYYAGWADKIHGLTVQADGPHHVQ  129

Query  627  TLHEPIGVAGQIIPWNF  677
             LHEPIGVAGQIIPWNF
Sbjct  130  ILHEPIGVAGQIIPWNF  146



>gb|AEV54527.1| aldehyde dehydrogenase ALDH2B4_V2 [Vitis vinifera]
Length=477

 Score =   255 bits (652),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 116/137 (85%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = +3

Query  267  SGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFAD  446
            +GKTFPT DPRT +VIA+VAEG+AEDINRAV+AARKAFDEGPWP+MS YERSRI+L+FAD
Sbjct  10   TGKTFPTFDPRTGEVIANVAEGDAEDINRAVSAARKAFDEGPWPRMSPYERSRILLRFAD  69

Query  447  LVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQ  626
            L EKH DELA LETW+NGKPYEQAAK+ELP+ VRLF YYAGWADKIHGLTV ADGPHHVQ
Sbjct  70   LAEKHNDELAALETWNNGKPYEQAAKAELPLFVRLFRYYAGWADKIHGLTVQADGPHHVQ  129

Query  627  TLHEPIGVAGQIIPWNF  677
             LHEPIGVAGQIIPWNF
Sbjct  130  ILHEPIGVAGQIIPWNF  146



>gb|KJB50198.1| hypothetical protein B456_008G158500 [Gossypium raimondii]
Length=492

 Score =   255 bits (652),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = +3

Query  255  VDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIML  434
            ++ + GKTFPT DPRT DVIAHVAEG+AEDINRAV+AARKAFDEGPWPKM+AYERSR++ 
Sbjct  21   LNQSHGKTFPTYDPRTGDVIAHVAEGDAEDINRAVSAARKAFDEGPWPKMTAYERSRVLF  80

Query  435  KFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGP  614
            +FADL+++H +ELATLETWDNGKPYEQAAK ELPMI RL  YYAGWADKIHGLTVPAD P
Sbjct  81   RFADLIDQHTEELATLETWDNGKPYEQAAKIELPMISRLIRYYAGWADKIHGLTVPADSP  140

Query  615  HHVQTLHEPIGVAGQIIPWNF  677
            H VQT+HEPIGVAGQIIPWNF
Sbjct  141  HLVQTIHEPIGVAGQIIPWNF  161



>gb|AFW63787.1| hypothetical protein ZEAMMB73_379378 [Zea mays]
Length=401

 Score =   249 bits (637),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = +3

Query  201  VSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAF  380
            + PAVEVK+TQ +ING FVD+ASGKTFPTLDPRT +VIA VAEG++EDI+RAVAAAR+AF
Sbjct  61   IQPAVEVKHTQLLINGNFVDAASGKTFPTLDPRTGEVIARVAEGDSEDIDRAVAAARRAF  120

Query  381  DEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHY  560
            DEGPWP+M+AYER R++L+FADL+E+H +E+A LETWDNGK   QAA +E+PM+ R   Y
Sbjct  121  DEGPWPRMTAYERCRVLLRFADLIERHAEEVAALETWDNGKTLAQAAGAEVPMVARCVRY  180

Query  561  YAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            YAGWADKIHGL  PADG HHVQ LHEP+GVAGQIIPWNF
Sbjct  181  YAGWADKIHGLVAPADGAHHVQVLHEPVGVAGQIIPWNF  219



>ref|XP_002321583.2| aldehyde dehydrogenase 1 precursor family protein [Populus trichocarpa]
 gb|EEF05710.2| aldehyde dehydrogenase 1 precursor family protein [Populus trichocarpa]
Length=497

 Score =   251 bits (641),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 126/138 (91%), Gaps = 0/138 (0%)
 Frame = +3

Query  264  ASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFA  443
            + GKTFPT DPRT +VIAHVAEG+AED+NRAVAAARKAFDEGPWPKMSAYERS IML+FA
Sbjct  29   SRGKTFPTHDPRTGEVIAHVAEGDAEDVNRAVAAARKAFDEGPWPKMSAYERSLIMLRFA  88

Query  444  DLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHV  623
            DLV+KH  ELA LE+W++GKPYEQ+AKSELP   RLF YYAGWADKIHGLTVPADG HHV
Sbjct  89   DLVDKHRGELAALESWNSGKPYEQSAKSELPSFARLFRYYAGWADKIHGLTVPADGNHHV  148

Query  624  QTLHEPIGVAGQIIPWNF  677
            QTLHEPIGVAGQIIPWNF
Sbjct  149  QTLHEPIGVAGQIIPWNF  166



>ref|XP_006647839.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Oryza brachyantha]
Length=551

 Score =   251 bits (642),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 124/177 (70%), Positives = 146/177 (82%), Gaps = 5/177 (3%)
 Frame = +3

Query  162  IQRFSTAAAVE-----ELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVA  326
            I RFS A A       E + P VEVKYT+ +ING FVD+ASG+TFPT+DPRT +VIA VA
Sbjct  44   IHRFSAAPAAAGGARGEPIQPPVEVKYTKLLINGNFVDAASGRTFPTVDPRTGEVIARVA  103

Query  327  EGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKP  506
            EG+AEDINRAVAAAR+AFDEGPWP+M+AYER R++L+FADL+E+H +E+ATLETWD GK 
Sbjct  104  EGDAEDINRAVAAARRAFDEGPWPRMTAYERCRVLLRFADLIEQHAEEIATLETWDGGKT  163

Query  507  YEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
             EQ +  E+PM+ R   YYAGWADKIHGL VPADGPHHVQ LHEPIGVAGQ+IPWNF
Sbjct  164  LEQTSGKEVPMVARSMRYYAGWADKIHGLVVPADGPHHVQVLHEPIGVAGQVIPWNF  220



>gb|AFW63788.1| hypothetical protein ZEAMMB73_379378 [Zea mays]
Length=468

 Score =   249 bits (635),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = +3

Query  201  VSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAF  380
            + PAVEVK+TQ +ING FVD+ASGKTFPTLDPRT +VIA VAEG++EDI+RAVAAAR+AF
Sbjct  61   IQPAVEVKHTQLLINGNFVDAASGKTFPTLDPRTGEVIARVAEGDSEDIDRAVAAARRAF  120

Query  381  DEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHY  560
            DEGPWP+M+AYER R++L+FADL+E+H +E+A LETWDNGK   QAA +E+PM+ R   Y
Sbjct  121  DEGPWPRMTAYERCRVLLRFADLIERHAEEVAALETWDNGKTLAQAAGAEVPMVARCVRY  180

Query  561  YAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            YAGWADKIHGL  PADG HHVQ LHEP+GVAGQIIPWNF
Sbjct  181  YAGWADKIHGLVAPADGAHHVQVLHEPVGVAGQIIPWNF  219



>gb|ACG32898.1| aldehyde dehydrogenase [Zea mays]
Length=550

 Score =   250 bits (639),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 127/190 (67%), Positives = 151/190 (79%), Gaps = 8/190 (4%)
 Frame = +3

Query  123  SAFLGWKYGVESGIQRFSTAAAVEEL-----VSPAVEVKYTQHIINGKFVDSASGKTFPT  287
            SA LG      + + RFSTA A         + PAVEVK+TQ +ING FVD+ASGKTFPT
Sbjct  33   SALLGSG---AAALHRFSTAPASAAAAAEEPIQPAVEVKHTQLLINGNFVDAASGKTFPT  89

Query  288  LDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMD  467
            LDPRT +VIA VAEG++EDI+RAVAAAR+AFDEGPWP+M+AYER R++L+FADL+E+H +
Sbjct  90   LDPRTGEVIARVAEGDSEDIDRAVAAARRAFDEGPWPRMTAYERCRVLLRFADLIERHAE  149

Query  468  ELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIG  647
            E+A LETWDNGK   QAA +E+PM+ R   YYAGWADKIHGL  PADG HHVQ LHEP+G
Sbjct  150  EVAALETWDNGKTLAQAAGAEVPMVARCVRYYAGWADKIHGLVAPADGAHHVQVLHEPVG  209

Query  648  VAGQIIPWNF  677
            VAGQIIPWNF
Sbjct  210  VAGQIIPWNF  219



>dbj|BAB92018.1| mitochondrial aldehyde dehydrogenase [Sorghum bicolor]
Length=551

 Score =   250 bits (638),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = +3

Query  201  VSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAF  380
            + PAVEVK+TQ +ING FVD+ASGKTFPTLDPRT +VIA VAEG++EDI+RAVAAAR+AF
Sbjct  62   IQPAVEVKHTQLLINGNFVDAASGKTFPTLDPRTGEVIARVAEGDSEDIDRAVAAARRAF  121

Query  381  DEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHY  560
            DEGPWP+M+AYER R++L+FADL+E+H +E+A LETWDNGK   QAA +E+PM+ R   Y
Sbjct  122  DEGPWPRMTAYERCRVLLRFADLIERHAEEIAALETWDNGKTLAQAAGAEVPMVARCIRY  181

Query  561  YAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            YAGWADKIHGL VP DG HHVQ LHEP+GVAGQIIPWNF
Sbjct  182  YAGWADKIHGLVVPGDGAHHVQVLHEPVGVAGQIIPWNF  220



>gb|EEC73936.1| hypothetical protein OsI_08800 [Oryza sativa Indica Group]
Length=553

 Score =   249 bits (637),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = +3

Query  201  VSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAF  380
            + P V+VKYT+ +ING FVD+ASGKTF T+DPRT DVIA VAEG+AED+NRAVAAAR+AF
Sbjct  64   IQPPVDVKYTKLLINGNFVDAASGKTFATVDPRTGDVIARVAEGDAEDVNRAVAAARRAF  123

Query  381  DEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHY  560
            DEGPWP+M+AYER R++L+FADL+E+H DE+A LETWD GK  EQ   +E+PM+ R   Y
Sbjct  124  DEGPWPRMTAYERCRVLLRFADLIEQHADEIAALETWDGGKTLEQTTGTEVPMVARYMRY  183

Query  561  YAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            Y GWADKIHGL VPADGPHHVQ LHEPIGVAGQIIPWNF
Sbjct  184  YGGWADKIHGLVVPADGPHHVQVLHEPIGVAGQIIPWNF  222



>ref|NP_001048010.1| Os02g0730000 [Oryza sativa Japonica Group]
 dbj|BAA96793.1| mitochondrial aldehyde dehydrogenase ALDH2a [Oryza sativa Japonica 
Group]
 dbj|BAD15919.1| putative mitochondrial aldehyde dehydrogenase ALDH2a [Oryza sativa 
Japonica Group]
 dbj|BAD16358.1| putative mitochondrial aldehyde dehydrogenase ALDH2a [Oryza sativa 
Japonica Group]
 dbj|BAF09924.1| Os02g0730000 [Oryza sativa Japonica Group]
 dbj|BAH00573.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57740.1| hypothetical protein OsJ_08254 [Oryza sativa Japonica Group]
Length=553

 Score =   249 bits (636),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = +3

Query  201  VSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAF  380
            + P V+VKYT+ +ING FVD+ASGKTF T+DPRT DVIA VAEG+AED+NRAVAAAR+AF
Sbjct  64   IQPPVDVKYTKLLINGNFVDAASGKTFATVDPRTGDVIARVAEGDAEDVNRAVAAARRAF  123

Query  381  DEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHY  560
            DEGPWP+M+AYER R++L+FADL+E+H DE+A LETWD GK  EQ   +E+PM+ R   Y
Sbjct  124  DEGPWPRMTAYERCRVLLRFADLIEQHADEIAALETWDGGKTLEQTTGTEVPMVARYMRY  183

Query  561  YAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            Y GWADKIHGL VPADGPHHVQ LHEPIGVAGQIIPWNF
Sbjct  184  YGGWADKIHGLVVPADGPHHVQVLHEPIGVAGQIIPWNF  222



>ref|NP_001105576.1| aldehyde dehydrogenase2 [Zea mays]
 gb|AAL99613.1|AF348417_1 mitochondrial aldehyde dehydrogenase RF2B [Zea mays]
Length=550

 Score =   249 bits (636),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 126/190 (66%), Positives = 151/190 (79%), Gaps = 8/190 (4%)
 Frame = +3

Query  123  SAFLGWKYGVESGIQRFSTAAAVEEL-----VSPAVEVKYTQHIINGKFVDSASGKTFPT  287
            SA LG      + + RFSTA A         + PAVEVK+TQ +ING FVD+ASGKTFPT
Sbjct  33   SALLGSG---AAALHRFSTAPASAAAAAEEPIQPAVEVKHTQLLINGNFVDAASGKTFPT  89

Query  288  LDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMD  467
            LDPRT +VIA VAEG++EDI+RAVAAAR+AFDEGPWP+M+AY+R R++L+FADL+E+H +
Sbjct  90   LDPRTGEVIARVAEGDSEDIDRAVAAARRAFDEGPWPRMTAYDRCRVLLRFADLIERHAE  149

Query  468  ELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIG  647
            E+A LETWDNGK   QAA +E+PM+ R   YYAGWADKIHGL  PADG HHVQ LHEP+G
Sbjct  150  EVAALETWDNGKTLAQAAGAEVPMVARCVRYYAGWADKIHGLVAPADGAHHVQVLHEPVG  209

Query  648  VAGQIIPWNF  677
            VAGQIIPWNF
Sbjct  210  VAGQIIPWNF  219



>gb|KHN05814.1| Aldehyde dehydrogenase family 2 member B4, mitochondrial [Glycine 
soja]
Length=403

 Score =   245 bits (625),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 126/183 (69%), Positives = 141/183 (77%), Gaps = 18/183 (10%)
 Frame = +3

Query  135  GWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDS--ASGKTFPTLDPRTED  308
            G   G    + RFSTAAAVEEL+ P V + YT+H+ING+FVD+  ASGKTFPT DPRT +
Sbjct  19   GRNSGKWGNVNRFSTAAAVEELIIPQVPITYTKHLINGQFVDADAASGKTFPTYDPRTGE  78

Query  309  VIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLET  488
            VIA VAEG+AEDINRAV+AARKAFDEGPWPKM+AY              KH DELA L+T
Sbjct  79   VIARVAEGDAEDINRAVSAARKAFDEGPWPKMTAY--------------KHSDELAALKT  124

Query  489  WDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIP  668
            W+NGKPYEQ A SELP  VRLF YYA  ADKIHGLTVPADG +HV+TLHE IGVAGQIIP
Sbjct  125  WNNGKPYEQWATSELPTFVRLFRYYA--ADKIHGLTVPADGNYHVETLHELIGVAGQIIP  182

Query  669  WNF  677
            WNF
Sbjct  183  WNF  185



>gb|AAL99614.2|AF348418_1 mitochondrial aldehyde dehydrogenase RF2B [Zea mays]
 gb|AFW63789.1| aldehyde dehydrogenase [Zea mays]
Length=550

 Score =   249 bits (636),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = +3

Query  201  VSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAF  380
            + PAVEVK+TQ +ING FVD+ASGKTFPTLDPRT +VIA VAEG++EDI+RAVAAAR+AF
Sbjct  61   IQPAVEVKHTQLLINGNFVDAASGKTFPTLDPRTGEVIARVAEGDSEDIDRAVAAARRAF  120

Query  381  DEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHY  560
            DEGPWP+M+AYER R++L+FADL+E+H +E+A LETWDNGK   QAA +E+PM+ R   Y
Sbjct  121  DEGPWPRMTAYERCRVLLRFADLIERHAEEVAALETWDNGKTLAQAAGAEVPMVARCVRY  180

Query  561  YAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            YAGWADKIHGL  PADG HHVQ LHEP+GVAGQIIPWNF
Sbjct  181  YAGWADKIHGLVAPADGAHHVQVLHEPVGVAGQIIPWNF  219



>gb|AHM26657.1| aldehyde dehydrogenase 2-2 [Zea mays subsp. mays]
Length=550

 Score =   249 bits (635),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = +3

Query  201  VSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAF  380
            + PAVEVK+TQ +ING FVD+ASGKTFPTLDPRT +VIA VAEG++EDI+RAVAAAR+AF
Sbjct  61   IQPAVEVKHTQLLINGNFVDAASGKTFPTLDPRTGEVIARVAEGDSEDIDRAVAAARRAF  120

Query  381  DEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHY  560
            DEGPWP+M+AYER R++L+FADL+E+H +E+A LETWDNGK   QAA +E+PM+ R   Y
Sbjct  121  DEGPWPRMTAYERCRVLLRFADLIERHAEEVAALETWDNGKTLAQAAGAEVPMVARCVRY  180

Query  561  YAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            YAGWADKIHGL  PADG HHVQ LHEP+GVAGQIIPWNF
Sbjct  181  YAGWADKIHGLVAPADGAHHVQVLHEPVGVAGQIIPWNF  219



>ref|XP_006439785.1| hypothetical protein CICLE_v10019638mg [Citrus clementina]
 gb|ESR53025.1| hypothetical protein CICLE_v10019638mg [Citrus clementina]
Length=478

 Score =   243 bits (620),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = +3

Query  264  ASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFA  443
            A GKTFP  DPRT +VIA+VAEG+AEDI+RAVA ARKAFDEGPWPKM+ YERSRIML+ A
Sbjct  10   ALGKTFPVYDPRTAEVIANVAEGDAEDIDRAVATARKAFDEGPWPKMTPYERSRIMLRAA  69

Query  444  DLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHV  623
            DL+EK+M+ELA LETW+NGKPY Q+ KSE+PM+VRL HYYAGWADKIHGLTVP DG +H+
Sbjct  70   DLIEKNMEELAALETWNNGKPYVQSLKSEVPMVVRLLHYYAGWADKIHGLTVPGDGNYHI  129

Query  624  QTLHEPIGVAGQIIPWNF  677
            QTLHEPIGVAGQI+PWNF
Sbjct  130  QTLHEPIGVAGQIVPWNF  147



>gb|EMT22926.1| Aldehyde dehydrogenase family 2 member B4, mitochondrial [Aegilops 
tauschii]
Length=678

 Score =   245 bits (626),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 121/174 (70%), Positives = 143/174 (82%), Gaps = 3/174 (2%)
 Frame = +3

Query  162  IQRFSTAAAV---EELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEG  332
            + RFSTA A    EE + P VEVKYTQ +ING FVD+ASG+TFPT+DPRT +VIA VAEG
Sbjct  40   VYRFSTAPAATADEEPIKPPVEVKYTQLLINGNFVDAASGRTFPTVDPRTGEVIARVAEG  99

Query  333  EAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYE  512
            +AEDI+RAVAAAR+AFDEGPWP+M+AYER R++L+FADL+E+H DE+A  E+WD GKP E
Sbjct  100  DAEDIDRAVAAARRAFDEGPWPRMTAYERCRVLLRFADLMERHNDEIAARESWDGGKPLE  159

Query  513  QAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWN  674
            Q+A  E+P   R    YAGWADKIHG+ VPADGPHHVQ L EPIGVAGQIIPWN
Sbjct  160  QSAGGEVPRAARCMRSYAGWADKIHGMVVPADGPHHVQVLREPIGVAGQIIPWN  213



>ref|XP_001785650.1| predicted protein [Physcomitrella patens]
 gb|EDQ49530.1| predicted protein [Physcomitrella patens]
Length=530

 Score =   242 bits (618),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 132/155 (85%), Gaps = 0/155 (0%)
 Frame = +3

Query  213  VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGP  392
            VEVK T+ +I+G+FVD+ASGKTFPT+DPR+E VIAHVAEG+ ED+NRAV AARKAFD GP
Sbjct  45   VEVKLTKLLIDGEFVDAASGKTFPTIDPRSEQVIAHVAEGDVEDVNRAVRAARKAFDHGP  104

Query  393  WPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGW  572
            WPKM  ++R RI+LK+ADL+++H DELA LET D+GKPYEQA  +ELP++ R F Y+AGW
Sbjct  105  WPKMPPFQRQRILLKYADLLDQHADELAALETMDSGKPYEQARYAELPLMSRQFRYFAGW  164

Query  573  ADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            ADKI G T P+DG H VQTLHEPIGV GQIIPWNF
Sbjct  165  ADKIFGTTGPSDGIHAVQTLHEPIGVVGQIIPWNF  199



>gb|AAK57987.1| T cytoplasm male sterility restorer factor 2, partial [Zea mays]
Length=129

 Score =   228 bits (582),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 107/127 (84%), Positives = 116/127 (91%), Gaps = 0/127 (0%)
 Frame = +3

Query  297  RTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELA  476
            RT +VIAHVAEG+AEDINRAVAAARKAFDEGPWPKM+AYERSRI+L+FADL+EKH DELA
Sbjct  1    RTGEVIAHVAEGDAEDINRAVAAARKAFDEGPWPKMTAYERSRILLRFADLIEKHNDELA  60

Query  477  TLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAG  656
             LETWDNGKPYEQAA+ E+PM+ RL  YYAGWADKIHGL VPADGPHHVQ LHEPIGVAG
Sbjct  61   ALETWDNGKPYEQAAQIEVPMVARLMRYYAGWADKIHGLIVPADGPHHVQILHEPIGVAG  120

Query  657  QIIPWNF  677
            QIIP  F
Sbjct  121  QIIPGTF  127



>emb|CDY49384.1| BnaA03g50730D [Brassica napus]
Length=257

 Score =   214 bits (544),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 105/161 (65%), Positives = 125/161 (78%), Gaps = 2/161 (1%)
 Frame = +3

Query  201  VSPA--VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARK  374
            VSP   ++  YTQ   NG FV +ASGKTFP LD RT++VIA+VAEG+AEDINRA+ AARK
Sbjct  91   VSPTFFIQFSYTQFPNNGNFVGAASGKTFPALDTRTKEVIANVAEGDAEDINRAMKAARK  150

Query  375  AFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLF  554
            + DEG WPKM AYE S+I+L+F  LVEKH +ELA L+T  NG  Y+QA  +E+ MI  LF
Sbjct  151  SIDEGAWPKMIAYENSKIVLRFTYLVEKHSEELAALDTCGNGNTYDQAKTAEIAMIAGLF  210

Query  555  HYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
               AG ADKIHGLT+PA+G +HVQTLHEPI VAGQIIPWNF
Sbjct  211  CNDAGGADKIHGLTIPANGNYHVQTLHEPICVAGQIIPWNF  251



>ref|XP_002978501.1| hypothetical protein SELMODRAFT_233128 [Selaginella moellendorffii]
 gb|EFJ20487.1| hypothetical protein SELMODRAFT_233128 [Selaginella moellendorffii]
Length=497

 Score =   215 bits (548),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 118/142 (83%), Gaps = 1/142 (1%)
 Frame = +3

Query  255  VDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIML  434
            + +  G+TFPT+DPRTE+V+A VA+ + EDINRAV AARKAFD GPWP+M+AYERS+I+L
Sbjct  25   IGACPGETFPTVDPRTEEVLADVAKADVEDINRAVKAARKAFDHGPWPRMTAYERSKILL  84

Query  435  KFADLVEKHMDELATLETWDNGKPYEQAAKSELP-MIVRLFHYYAGWADKIHGLTVPADG  611
            K+ADL+EKH DELATL++ D+GK Y Q+   E+P  + RLF YYAGWADKIHG T+PADG
Sbjct  85   KYADLLEKHNDELATLDSLDSGKLYSQSQGVEIPHFVTRLFRYYAGWADKIHGKTLPADG  144

Query  612  PHHVQTLHEPIGVAGQIIPWNF  677
            PH V T HEPIGV GQIIPWNF
Sbjct  145  PHQVLTFHEPIGVVGQIIPWNF  166



>ref|XP_002970420.1| hypothetical protein SELMODRAFT_231526 [Selaginella moellendorffii]
 gb|EFJ28550.1| hypothetical protein SELMODRAFT_231526 [Selaginella moellendorffii]
Length=488

 Score =   213 bits (541),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 96/136 (71%), Positives = 115/136 (85%), Gaps = 1/136 (1%)
 Frame = +3

Query  273  KTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLV  452
            +TFPT+DPRTE+V+A VA+ + EDINRAV AARKAFD GPWP+M+AYERS+I+LK+ADL+
Sbjct  22   ETFPTVDPRTEEVLADVAKADVEDINRAVKAARKAFDHGPWPRMTAYERSKILLKYADLL  81

Query  453  EKHMDELATLETWDNGKPYEQAAKSELP-MIVRLFHYYAGWADKIHGLTVPADGPHHVQT  629
            EKH DELATL++ D+GK Y Q+   E+P  + RLF YYAGWADKIHG T+PADGPH V T
Sbjct  82   EKHNDELATLDSLDSGKLYSQSQGVEIPHFVTRLFRYYAGWADKIHGKTLPADGPHQVLT  141

Query  630  LHEPIGVAGQIIPWNF  677
             HEPIGV GQIIPWNF
Sbjct  142  FHEPIGVVGQIIPWNF  157



>ref|WP_036269309.1| betaine-aldehyde dehydrogenase [Methylocaldum szegediense]
Length=492

 Score =   213 bits (541),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 95/162 (59%), Positives = 127/162 (78%), Gaps = 1/162 (1%)
 Frame = +3

Query  195  ELVSPA-VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAAR  371
            +L++P+ +++  T+ +I+GK+VDSASGKTF T++P T +VIAHVAEG+ ED++RAV AAR
Sbjct  6    KLINPSEIKISQTKMLIDGKWVDSASGKTFETINPATGEVIAHVAEGDREDVDRAVRAAR  65

Query  372  KAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRL  551
            KAF+EGPW KMSA ER R + + ADL+EKH DELA LET +NGKP  ++  ++LP+ +  
Sbjct  66   KAFEEGPWRKMSARERGRCLYRLADLIEKHFDELAALETLNNGKPINESRSADLPLTIEC  125

Query  552  FHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            + YYAGWADKI G T+P +GP    T HEP+GV GQIIPWNF
Sbjct  126  YRYYAGWADKIEGKTIPINGPFFTYTRHEPVGVVGQIIPWNF  167



>ref|XP_002983210.1| hypothetical protein SELMODRAFT_234195 [Selaginella moellendorffii]
 gb|EFJ15552.1| hypothetical protein SELMODRAFT_234195 [Selaginella moellendorffii]
Length=483

 Score =   212 bits (540),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 89/138 (64%), Positives = 117/138 (85%), Gaps = 0/138 (0%)
 Frame = +3

Query  264  ASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFA  443
            A+GKTFPT+DPR+E++IA VAEG+ ED+NRAV AAR AF++GPWP+M+AYERS+I+ ++A
Sbjct  15   ATGKTFPTIDPRSEEIIAQVAEGDEEDVNRAVKAARNAFEKGPWPRMTAYERSKILFRYA  74

Query  444  DLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHV  623
            DL+E+H DEL  L+  D+GK  +QA  +E+P ++R F YYAGWADKIHG+T+ AD PHHV
Sbjct  75   DLLEQHSDELVALDVLDSGKTIDQATFAEMPNVIRWFRYYAGWADKIHGMTLQADSPHHV  134

Query  624  QTLHEPIGVAGQIIPWNF  677
             TLHEP+GV GQI+PWNF
Sbjct  135  HTLHEPVGVVGQIVPWNF  152



>ref|XP_002961352.1| hypothetical protein SELMODRAFT_266598 [Selaginella moellendorffii]
 gb|EFJ38891.1| hypothetical protein SELMODRAFT_266598 [Selaginella moellendorffii]
Length=491

 Score =   210 bits (534),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 89/135 (66%), Positives = 114/135 (84%), Gaps = 0/135 (0%)
 Frame = +3

Query  273  KTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLV  452
            KTFPT+DPR+E++IA VAEG+ ED+NRAV AAR AF++GPWP+M+AYERS+I+ ++ADL+
Sbjct  26   KTFPTIDPRSEEIIAQVAEGDEEDVNRAVKAARNAFEKGPWPRMTAYERSKILFRYADLL  85

Query  453  EKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTL  632
            E+H DEL  L+  DNGK  +QA  +E+P ++R F YYAGWADKIHG+T+ AD PHHV TL
Sbjct  86   EQHSDELVALDVLDNGKTIDQATFAEMPNVIRWFRYYAGWADKIHGMTLQADSPHHVHTL  145

Query  633  HEPIGVAGQIIPWNF  677
            HEPIGV GQI+PWNF
Sbjct  146  HEPIGVVGQIVPWNF  160



>ref|XP_002961274.1| hypothetical protein SELMODRAFT_164447 [Selaginella moellendorffii]
 gb|EFJ38813.1| hypothetical protein SELMODRAFT_164447 [Selaginella moellendorffii]
Length=500

 Score =   209 bits (532),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 98/160 (61%), Positives = 120/160 (75%), Gaps = 1/160 (1%)
 Frame = +3

Query  201  VSPA-VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKA  377
            + PA V VKYT+  I+G+FVD+ SG+TF TLDPR  +VI+ VAE + +D++ AV AARKA
Sbjct  11   IGPAPVSVKYTKLFIDGQFVDAVSGRTFETLDPRNGEVISKVAEADKQDVDVAVKAARKA  70

Query  378  FDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFH  557
            FD GPWP++S Y R RI+LKFADL+E H DELA LET DNGKP +     +LPM +RL  
Sbjct  71   FDHGPWPRLSGYARGRILLKFADLLEHHFDELAALETLDNGKPLDLVKYVDLPMALRLLR  130

Query  558  YYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
             +AG+ADKI G TV  DGP+H  TL EPIGV GQIIPWNF
Sbjct  131  SFAGFADKICGKTVKIDGPYHAYTLLEPIGVVGQIIPWNF  170



>ref|XP_002983288.1| hypothetical protein SELMODRAFT_180171 [Selaginella moellendorffii]
 gb|EFJ15630.1| hypothetical protein SELMODRAFT_180171 [Selaginella moellendorffii]
Length=500

 Score =   209 bits (531),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 98/160 (61%), Positives = 120/160 (75%), Gaps = 1/160 (1%)
 Frame = +3

Query  201  VSPA-VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKA  377
            + PA V VKYT+  I+G+FVD+ SG+TF TLDPR  +VI+ VAE + +D++ AV AARKA
Sbjct  11   IGPAPVSVKYTKLFIDGQFVDAVSGRTFETLDPRNGEVISKVAEADKQDVDVAVKAARKA  70

Query  378  FDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFH  557
            FD GPWP++S Y R RI+LKFADL+E H DELA LET DNGKP +     +LPM +RL  
Sbjct  71   FDHGPWPRLSGYARGRILLKFADLLEHHFDELAALETLDNGKPLDLVKYVDLPMALRLLR  130

Query  558  YYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
             +AG+ADKI G TV  DGP+H  TL EPIGV GQIIPWNF
Sbjct  131  SFAGFADKICGKTVKIDGPYHAYTLLEPIGVVGQIIPWNF  170



>gb|ABR16485.1| unknown [Picea sitchensis]
Length=500

 Score =   205 bits (522),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 117/159 (74%), Gaps = 0/159 (0%)
 Frame = +3

Query  201  VSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAF  380
            V P V VKYT+  ING+FVDS SGKTF TLDPRT + I  V+E + ED++ AV AAR AF
Sbjct  11   VLPPVTVKYTKLFINGEFVDSVSGKTFETLDPRTGEAITRVSEAQKEDVDLAVKAARAAF  70

Query  381  DEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHY  560
            D GPWP+MS +ER RI+ K+ADLV +H DELA LET+DNGKP + A   ++P  V +  Y
Sbjct  71   DHGPWPRMSGFERGRILYKYADLVSQHGDELAALETFDNGKPLDMARILDIPYSVEVIRY  130

Query  561  YAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
             AG+ADKIHGLT+   G +   TLHEPIGV GQ+IPWNF
Sbjct  131  NAGFADKIHGLTLKMSGQYQGYTLHEPIGVVGQMIPWNF  169



>ref|XP_003608940.1| Aldehyde dehydrogenase [Medicago truncatula]
Length=282

 Score =   197 bits (502),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 108/129 (84%), Gaps = 0/129 (0%)
 Frame = +3

Query  132  LGWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDV  311
            LG K        RFSTAAAV+EL++P V + YTQH+INGKFVD+ASGKTFPTLDPRT +V
Sbjct  32   LGRKSEGLINTNRFSTAAAVQELITPQVSINYTQHLINGKFVDAASGKTFPTLDPRTGEV  91

Query  312  IAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETW  491
            IAHVAEG+AEDINRAV+AAR+AFD GPWPKMSAYER RI+L+FADLVEKH DE+A LE W
Sbjct  92   IAHVAEGDAEDINRAVSAAREAFDNGPWPKMSAYERCRILLRFADLVEKHNDEIAALEAW  151

Query  492  DNGKPYEQA  518
            +NG+  + A
Sbjct  152  NNGRRADDA  160



>ref|WP_036502729.1| betaine-aldehyde dehydrogenase [Nitrosococcus oceani]
 gb|KFI21710.1| betaine-aldehyde dehydrogenase [Nitrosococcus oceani]
Length=494

 Score =   201 bits (510),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/155 (61%), Positives = 113/155 (73%), Gaps = 0/155 (0%)
 Frame = +3

Query  213  VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGP  392
            VEV+ T+ +I+GKF DS SGKTF T+DP TE+VIA VAEG+AEDI+ AV AARKAFD GP
Sbjct  15   VEVRQTRLLIDGKFCDSLSGKTFATIDPATEEVIAQVAEGDAEDIDLAVQAARKAFDSGP  74

Query  393  WPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGW  572
            W +M A ER R MLK+ADL+E HM+ELA LE  DNGKP  +A   ++P       Y+AGW
Sbjct  75   WHRMDARERGRRMLKWADLIEAHMEELAKLEVLDNGKPINEALGYDIPSAAATLRYFAGW  134

Query  573  ADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            ADKIHG T+P  GP    T  EP+GV G IIPWNF
Sbjct  135  ADKIHGKTIPISGPFFTYTRREPVGVCGLIIPWNF  169



>ref|WP_002814365.1| betaine-aldehyde dehydrogenase [Nitrosococcus oceani]
 gb|ABA59058.1| aldehyde dehydrogenase (acceptor) [Nitrosococcus oceani ATCC 
19707]
 gb|EDZ65209.1| aldehyde dehydrogenase (NAD) family protein [Nitrosococcus oceani 
AFC27]
 gb|KFI18483.1| betaine-aldehyde dehydrogenase [Nitrosococcus oceani C-27]
Length=494

 Score =   201 bits (510),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/155 (61%), Positives = 113/155 (73%), Gaps = 0/155 (0%)
 Frame = +3

Query  213  VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGP  392
            VEV+ T+ +I+GKF DS SGKTF T+DP TE+VIA VAEG+AEDI+ AV AARKAFD GP
Sbjct  15   VEVRQTRLLIDGKFCDSLSGKTFATIDPATEEVIAQVAEGDAEDIDLAVQAARKAFDSGP  74

Query  393  WPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGW  572
            W +M A ER R MLK+ADL+E HM+ELA LE  DNGKP  +A   ++P       Y+AGW
Sbjct  75   WHRMDARERGRRMLKWADLIEAHMEELAKLEVLDNGKPINEALGYDIPSAAATLRYFAGW  134

Query  573  ADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            ADKIHG T+P  GP    T  EP+GV G IIPWNF
Sbjct  135  ADKIHGKTIPISGPFFTYTRREPVGVCGLIIPWNF  169



>emb|CDW77748.1| betaine-aldehyde dehydrogenase [Stylonychia lemnae]
Length=502

 Score =   199 bits (507),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 90/155 (58%), Positives = 114/155 (74%), Gaps = 0/155 (0%)
 Frame = +3

Query  213  VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGP  392
            V+ + TQ +I+GKFV+S SGKTF T +P TE+ I  V E +  D+++AV AARKAFDEGP
Sbjct  17   VQPRLTQLLIDGKFVNSVSGKTFDTFNPSTEEKIISVQEADKHDVDKAVNAARKAFDEGP  76

Query  393  WPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGW  572
            W +M+A ER +IM +FADLVEKH DELA LE  DNGKP   A  +++P++V    YYAGW
Sbjct  77   WRRMAASERGKIMYRFADLVEKHTDELANLEALDNGKPAAIAKIADIPLVVNTLRYYAGW  136

Query  573  ADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
             DKIHG T+P +GP+   T  EP+GV GQIIPWNF
Sbjct  137  TDKIHGKTIPVNGPYFAYTKEEPVGVCGQIIPWNF  171



>gb|EWM25899.1| aldehyde dehydrogenase [Nannochloropsis gaditana]
Length=601

 Score =   201 bits (512),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 94/181 (52%), Positives = 124/181 (69%), Gaps = 5/181 (3%)
 Frame = +3

Query  150  VESGIQRFSTAAAVEEL-----VSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVI  314
            + +  +RF++  AV  L     + P+   + TQ +I+GKF D+ SGKTF T+DPRTE+ I
Sbjct  38   LSTACKRFASFKAVRGLHNAAPIKPSHHPRITQLLIDGKFTDAVSGKTFQTIDPRTEETI  97

Query  315  AHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWD  494
              VA  + ED+N AV AARKAF+ GPW KMS  ER +I+ + ADL+E H +ELA LET D
Sbjct  98   VEVAAADKEDVNLAVNAARKAFETGPWRKMSGRERGKILFRLADLMEAHKEELAVLETLD  157

Query  495  NGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWN  674
            NGKP   +  S++P+ +  + Y+AGWADKIHG T+P DGP    TL EP+GV GQIIPWN
Sbjct  158  NGKPLSLSRNSDVPLAIDHYRYFAGWADKIHGQTIPVDGPFFAYTLREPVGVVGQIIPWN  217

Query  675  F  677
            F
Sbjct  218  F  218



>ref|WP_013034365.1| betaine-aldehyde dehydrogenase [Nitrosococcus halophilus]
 gb|ADE16516.1| Retinal dehydrogenase [Nitrosococcus halophilus Nc 4]
Length=494

 Score =   198 bits (504),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/155 (61%), Positives = 113/155 (73%), Gaps = 0/155 (0%)
 Frame = +3

Query  213  VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGP  392
            VEV+ T+ +I+G+F DS SGKTF T+DP TE+VIA VAEG+AEDI+ AV AARKAFD GP
Sbjct  15   VEVRQTRLLIDGEFRDSLSGKTFATIDPVTEEVIAQVAEGDAEDIDLAVKAARKAFDTGP  74

Query  393  WPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGW  572
            W +M A ER R MLK+ADL+E HM+ELA LE  DNGKP  +A   ++P       Y+AGW
Sbjct  75   WQQMDARERGRRMLKWADLIETHMEELAKLEVLDNGKPINEALGYDIPSAAATIRYFAGW  134

Query  573  ADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            ADKIHG T+P  GP    T  EP+GV G IIPWNF
Sbjct  135  ADKIHGKTIPVSGPFFTYTRREPVGVCGLIIPWNF  169



>emb|CDW85535.1| betaine-aldehyde dehydrogenase [Stylonychia lemnae]
Length=315

 Score =   192 bits (489),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 114/155 (74%), Gaps = 0/155 (0%)
 Frame = +3

Query  213  VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGP  392
            ++ + TQ +INGKFV+SASG+TF T +P TE+ IA V E  AED++RAV AARKAFDEGP
Sbjct  16   IKPRVTQLLINGKFVNSASGQTFDTFNPATEEKIASVQEAGAEDVDRAVKAARKAFDEGP  75

Query  393  WPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGW  572
            W +M+A ER +++ K ADL++K+++EL  LE  DNGKP   A + ++P       YYAGW
Sbjct  76   WRRMAASERGKLLCKLADLIDKNVEELGYLEALDNGKPEMIATQGDVPFCAMTLRYYAGW  135

Query  573  ADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            ADKIHG T+P +GP+   T  EP+GV GQIIPWN+
Sbjct  136  ADKIHGKTIPVNGPYFAYTKEEPVGVCGQIIPWNY  170



>ref|WP_015249427.1| betaine-aldehyde dehydrogenase [Singulisphaera acidiphila]
 gb|AGA30341.1| NAD-dependent aldehyde dehydrogenase [Singulisphaera acidiphila 
DSM 18658]
Length=491

 Score =   195 bits (496),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 115/150 (77%), Gaps = 0/150 (0%)
 Frame = +3

Query  228  TQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMS  407
            T+ +I+GK+ DS SGKTF T++P TE+VIA VAEG+A DI+ AV AARKAFD GPW KM 
Sbjct  17   TKLLIDGKWRDSLSGKTFDTVNPATEEVIAQVAEGDAADIDLAVKAARKAFDSGPWRKMD  76

Query  408  AYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIH  587
            A +R R+M +FADL+E+++DELA LET DNGKP  ++  ++LP+++  F YYAGWADKI 
Sbjct  77   ARDRGRLMNRFADLIEENVDELAELETLDNGKPIGESRHADLPLVIDCFRYYAGWADKIS  136

Query  588  GLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            G TVP  G     T  EPIGVAGQIIPWNF
Sbjct  137  GQTVPIRGNFFCYTKREPIGVAGQIIPWNF  166



>ref|WP_002643666.1| betaine-aldehyde dehydrogenase [Planctomyces maris]
 gb|EDL62339.1| aldehyde dehydrogenase [Planctomyces maris DSM 8797]
Length=492

 Score =   194 bits (494),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 122/166 (73%), Gaps = 0/166 (0%)
 Frame = +3

Query  180  AAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAV  359
            A  + + V+   +++ TQ +I+GK+VD+ SGKTF T++P TE+VIA VAEG+A DI+ AV
Sbjct  2    ATEILDTVANTPQIRQTQLLIDGKWVDAISGKTFATINPATEEVIAEVAEGDAADIDLAV  61

Query  360  AAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPM  539
             AARKAF+ GPW KM A +R R++ + ADL+E++++ELA LE+ DNGKP   +  ++LP+
Sbjct  62   KAARKAFESGPWSKMDARDRGRLIYRLADLIEENIEELAALESLDNGKPIRDSRAADLPL  121

Query  540  IVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            ++    YYAGWADKI G T+P  G H   T  EP+GVAGQIIPWNF
Sbjct  122  VIDCLRYYAGWADKIEGTTIPIRGNHFCYTRREPLGVAGQIIPWNF  167



>ref|WP_021832205.1| Aldehyde dehydrogenase [Crocosphaera watsonii]
 emb|CCQ53790.1| Aldehyde dehydrogenase [Crocosphaera watsonii WH 0005]
Length=356

 Score =   191 bits (485),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 118/155 (76%), Gaps = 0/155 (0%)
 Frame = +3

Query  213  VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGP  392
            V++  TQ +IN K+V+SASGK F T++P T +VI  VAE +A D+++AV AAR AF++G 
Sbjct  37   VKIGPTQLLINNKWVESASGKRFETINPSTGEVICDVAEADAADVDKAVIAARNAFNQGD  96

Query  393  WPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGW  572
            WPK+SA +R +++ K ADL+E +++ELA LET DNGKPY+ +  ++L +++  + YYAGW
Sbjct  97   WPKLSATQRGQLLYKLADLIEANIEELARLETLDNGKPYQDSLNADLQLVIACYRYYAGW  156

Query  573  ADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            ADKI G T+P +GP+   T HEP+GV GQIIPWNF
Sbjct  157  ADKIQGKTIPINGPYFCYTSHEPVGVVGQIIPWNF  191



>ref|WP_013219586.1| betaine-aldehyde dehydrogenase [Nitrosococcus watsonii]
 gb|ADJ27478.1| Retinal dehydrogenase [Nitrosococcus watsonii C-113]
Length=494

 Score =   194 bits (492),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 92/155 (59%), Positives = 112/155 (72%), Gaps = 0/155 (0%)
 Frame = +3

Query  213  VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGP  392
            V V+ T+ +I+G+F +S SGKTF T+DP TE+VIA VAEG+AEDI+ AV AARKAFD GP
Sbjct  15   VAVRQTRLLIDGEFRNSLSGKTFATVDPSTEEVIAQVAEGDAEDIDLAVQAARKAFDSGP  74

Query  393  WPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGW  572
            W +M A ER R MLK+ADL+E HM+ELA LE  DNGKP  +A   ++P       Y+AGW
Sbjct  75   WRQMDARERGRRMLKWADLIEDHMEELAKLEVLDNGKPINEALGYDIPSAAATLRYFAGW  134

Query  573  ADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            ADKIHG T+P  GP    T  EP+GV G IIPWNF
Sbjct  135  ADKIHGKTIPISGPFFTYTRREPVGVCGLIIPWNF  169



>ref|WP_007307870.1| betaine-aldehyde dehydrogenase [Crocosphaera watsonii]
 gb|EAM48335.1| Aldehyde dehydrogenase (NAD+) [Crocosphaera watsonii WH 8501]
 emb|CCQ51857.1| Aldehyde dehydrogenase [Crocosphaera watsonii WH 8502]
Length=490

 Score =   191 bits (486),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 118/155 (76%), Gaps = 0/155 (0%)
 Frame = +3

Query  213  VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGP  392
            V++  TQ +IN K+V+SASGK F T++P T +VI  VAE +A D+++AV AAR AF++G 
Sbjct  11   VKIGPTQLLINNKWVESASGKRFETINPSTGEVICDVAEADAADVDKAVIAARNAFNQGD  70

Query  393  WPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGW  572
            WPK+SA +R +++ K ADL+E +++ELA LET DNGKPY+ +  ++L +++  + YYAGW
Sbjct  71   WPKLSATQRGQLLYKLADLIEANIEELARLETLDNGKPYQDSLNADLQLVIACYRYYAGW  130

Query  573  ADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            ADKI G T+P +GP+   T HEP+GV GQIIPWNF
Sbjct  131  ADKIQGKTIPINGPYFCYTRHEPVGVVGQIIPWNF  165



>emb|CCQ61589.1| Aldehyde dehydrogenase [Crocosphaera watsonii WH 0401]
Length=490

 Score =   191 bits (486),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 118/155 (76%), Gaps = 0/155 (0%)
 Frame = +3

Query  213  VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGP  392
            V++  TQ +IN K+V+SASGK F T++P T +VI  VAE +A D+++AV AAR AF++G 
Sbjct  11   VKIGPTQLLINNKWVESASGKRFETINPSTGEVICDVAEADAADVDKAVIAARNAFNQGD  70

Query  393  WPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGW  572
            WPK+SA +R +++ K ADL+E +++ELA LET DNGKPY+ +  ++L +++  + YYAGW
Sbjct  71   WPKLSATQRGQLLYKLADLIEANIEELARLETLDNGKPYQDSLNADLQLVIACYRYYAGW  130

Query  573  ADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            ADKI G T+P +GP+   T HEP+GV GQIIPWNF
Sbjct  131  ADKIQGKTIPINGPYFCYTRHEPVGVVGQIIPWNF  165



>emb|CCQ69085.1| Aldehyde dehydrogenase [Crocosphaera watsonii WH 0402]
Length=490

 Score =   191 bits (485),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 118/155 (76%), Gaps = 0/155 (0%)
 Frame = +3

Query  213  VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGP  392
            V++  TQ +IN K+V+SASGK F T++P T +VI  VAE +A D+++AV AAR AF++G 
Sbjct  11   VKIGPTQLLINNKWVESASGKRFETINPSTGEVICDVAEADAADVDKAVIAARNAFNQGD  70

Query  393  WPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGW  572
            WPK+SA +R +++ K ADL+E +++ELA LET DNGKPY+ +  ++L +++  + YYAGW
Sbjct  71   WPKLSATQRGQLLYKLADLIEANIEELARLETLDNGKPYQDSLNADLQLVIACYRYYAGW  130

Query  573  ADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            ADKI G T+P +GP+   T HEP+GV GQIIPWNF
Sbjct  131  ADKIQGKTIPINGPYFCYTRHEPVGVVGQIIPWNF  165



>ref|WP_007312907.1| betaine-aldehyde dehydrogenase [Crocosphaera watsonii]
 gb|EHJ10116.1| aldehyde dehydrogenase [Crocosphaera watsonii WH 0003]
Length=490

 Score =   191 bits (485),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 118/155 (76%), Gaps = 0/155 (0%)
 Frame = +3

Query  213  VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGP  392
            V++  TQ +IN K+V+SASGK F T++P T +VI  VAE +A D+++AV AAR AF++G 
Sbjct  11   VKIGPTQLLINNKWVESASGKRFETINPSTGEVICDVAEADAADVDKAVIAARNAFNQGD  70

Query  393  WPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGW  572
            WPK+SA +R +++ K ADL+E +++ELA LET DNGKPY+ +  ++L +++  + YYAGW
Sbjct  71   WPKLSATQRGQLLYKLADLIEANIEELARLETLDNGKPYQDSLNADLQLVIACYRYYAGW  130

Query  573  ADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            ADKI G T+P +GP+   T HEP+GV GQIIPWNF
Sbjct  131  ADKIQGKTIPINGPYFCYTSHEPVGVVGQIIPWNF  165



>gb|EJY82344.1| hypothetical protein OXYTRI_20134 [Oxytricha trifallax]
Length=505

 Score =   191 bits (485),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 93/168 (55%), Positives = 114/168 (68%), Gaps = 4/168 (2%)
 Frame = +3

Query  174  STAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINR  353
            S A A    V+P    K TQ +INGKFV+S SGKTF T +P TE+ IA V E +  D++ 
Sbjct  11   SFATATPAKVTP----KQTQLLINGKFVNSVSGKTFDTFNPATEEKIASVQEADRADVDI  66

Query  354  AVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSEL  533
            AV AARKAFD G W +M A ER  IML+FADL++KH DELA LE  DNGKPY+ A  +++
Sbjct  67   AVKAARKAFDTGHWRRMDARERGNIMLRFADLIDKHADELAALEALDNGKPYKIAQIADI  126

Query  534  PMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            P++     YY GWADKIHG T+P  GP+      EP+GV GQIIPWNF
Sbjct  127  PLVSNTIRYYGGWADKIHGKTLPISGPYFAYQREEPVGVVGQIIPWNF  174



>ref|XP_005642981.1| aldehyde dehydrogenase [Coccomyxa subellipsoidea C-169]
 gb|EIE18437.1| aldehyde dehydrogenase [Coccomyxa subellipsoidea C-169]
Length=486

 Score =   190 bits (483),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 109/149 (73%), Gaps = 0/149 (0%)
 Frame = +3

Query  231  QHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSA  410
            Q +INGKF D++ GKTF T+DPRT + +  VAE +AED++RAV AAR+AFD GPWP+MS 
Sbjct  6    QLLINGKFEDASGGKTFETMDPRTGEPLMTVAEAQAEDVDRAVKAARQAFDHGPWPRMSG  65

Query  411  YERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHG  590
             +R  IM K A L+EK+ +ELATLE+ DNGK Y  A   ++PM V    YYAGWADKI+G
Sbjct  66   RQRGNIMHKLATLMEKNTEELATLESLDNGKAYSAAFSIDVPMAVEHLRYYAGWADKIYG  125

Query  591  LTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
             T+P DG     TL EP+GV GQIIPWNF
Sbjct  126  QTIPTDGKMQAYTLKEPLGVVGQIIPWNF  154



>ref|XP_010926057.1| PREDICTED: aldehyde dehydrogenase family 2 member C4-like [Elaeis 
guineensis]
Length=500

 Score =   190 bits (483),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/157 (56%), Positives = 114/157 (73%), Gaps = 0/157 (0%)
 Frame = +3

Query  207  PAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDE  386
            P +++K+T+  ING+FVD+ SGKTF T DPRT +VIAH+AEG+  D++ AV AAR+AFD 
Sbjct  13   PEIKIKFTKLFINGQFVDAVSGKTFETRDPRTGEVIAHIAEGDKADVDLAVEAARQAFDH  72

Query  387  GPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYA  566
            G WP+MS YER RIM+KFADL+E++++ELA L+T D GK +      ++P  V+L  YYA
Sbjct  73   GKWPRMSGYERGRIMMKFADLIEQNIEELAILDTLDAGKLFTLGKIVDIPGTVQLLRYYA  132

Query  567  GWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  677
            G ADKIHG T+         TL EPIGV G IIPWNF
Sbjct  133  GAADKIHGETLKMSREFQGYTLKEPIGVVGHIIPWNF  169



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1104504643240