BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF051J12

Length=694
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006342166.1|  PREDICTED: monosaccharide-sensing protein 2-...    364   8e-118   Solanum tuberosum [potatoes]
ref|NP_001289848.1|  monosaccharide-sensing protein 2                   364   1e-117   Solanum lycopersicum
ref|XP_009796447.1|  PREDICTED: monosaccharide-sensing protein 2-...    362   4e-117   Nicotiana sylvestris
ref|XP_011100175.1|  PREDICTED: monosaccharide-sensing protein 2-...    362   7e-117   Sesamum indicum [beniseed]
ref|XP_009595864.1|  PREDICTED: monosaccharide-sensing protein 2        362   7e-117   Nicotiana tomentosiformis
ref|XP_011074068.1|  PREDICTED: monosaccharide-sensing protein 2-...    361   1e-116   Sesamum indicum [beniseed]
ref|XP_007135975.1|  hypothetical protein PHAVU_009G007600g             359   9e-116   Phaseolus vulgaris [French bean]
ref|XP_003527273.1|  PREDICTED: monosaccharide-sensing protein 2-...    359   1e-115   Glycine max [soybeans]
gb|KJB14182.1|  hypothetical protein B456_002G113400                    353   1e-115   Gossypium raimondii
gb|KJB14183.1|  hypothetical protein B456_002G113400                    353   1e-115   Gossypium raimondii
gb|KDO85211.1|  hypothetical protein CISIN_1g004673mg                   354   1e-115   Citrus sinensis [apfelsine]
gb|KDP36756.1|  hypothetical protein JCGZ_08047                         358   2e-115   Jatropha curcas
gb|KHN33775.1|  Monosaccharide-sensing protein 2                        358   2e-115   Glycine soja [wild soybean]
ref|XP_006577928.1|  PREDICTED: monosaccharide-sensing protein 2-...    358   2e-115   Glycine max [soybeans]
emb|CDP07261.1|  unnamed protein product                                358   3e-115   Coffea canephora [robusta coffee]
ref|XP_010094525.1|  Monosaccharide-sensing protein 2                   356   1e-114   Morus notabilis
ref|XP_007018122.1|  Tonoplast monosaccharide transporter2 isoform 4    355   2e-114   
ref|XP_007018119.1|  Tonoplast monosaccharide transporter2 isoform 1    355   2e-114   
gb|KHG10189.1|  Monosaccharide-sensing 2 -like protein                  354   8e-114   Gossypium arboreum [tree cotton]
gb|KDO85208.1|  hypothetical protein CISIN_1g004673mg                   353   1e-113   Citrus sinensis [apfelsine]
ref|XP_006435423.1|  hypothetical protein CICLE_v10000400mg             353   2e-113   Citrus clementina [clementine]
ref|XP_002510716.1|  sugar transporter, putative                        353   3e-113   Ricinus communis
ref|XP_010061214.1|  PREDICTED: monosaccharide-sensing protein 2-...    352   6e-113   Eucalyptus grandis [rose gum]
gb|KJB14177.1|  hypothetical protein B456_002G113400                    352   6e-113   Gossypium raimondii
emb|CBI40753.3|  unnamed protein product                                348   3e-112   Vitis vinifera
dbj|BAK00015.1|  predicted protein                                      332   8e-112   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CAN59780.1|  hypothetical protein VITISV_024656                     348   2e-111   Vitis vinifera
ref|NP_001267873.1|  hexose transporter-like                            348   2e-111   Vitis vinifera
gb|AAX47312.1|  hexose transporter 6                                    347   5e-111   Vitis vinifera
ref|XP_002307812.1|  hypothetical protein POPTR_0005s27680g             346   8e-111   Populus trichocarpa [western balsam poplar]
ref|XP_011041174.1|  PREDICTED: monosaccharide-sensing protein 2-...    346   1e-110   Populus euphratica
ref|XP_011034826.1|  PREDICTED: monosaccharide-sensing protein 2-...    345   2e-110   Populus euphratica
gb|AIQ77649.1|  tonoplastic transporter 1                               345   2e-110   Vitis vinifera
gb|EYU43534.1|  hypothetical protein MIMGU_mgv1a001953mg                345   3e-110   Erythranthe guttata [common monkey flower]
ref|XP_002300629.1|  hypothetical protein POPTR_0002s00760g             343   9e-110   Populus trichocarpa [western balsam poplar]
emb|CBI21577.3|  unnamed protein product                                340   1e-109   Vitis vinifera
ref|XP_004500833.1|  PREDICTED: monosaccharide-sensing protein 2-...    342   2e-109   Cicer arietinum [garbanzo]
ref|XP_009397963.1|  PREDICTED: monosaccharide-sensing protein 2-...    342   3e-109   
gb|AAP54842.2|  hexose transporter, putative, expressed                 332   9e-109   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002276373.1|  PREDICTED: monosaccharide-sensing protein 2        341   1e-108   Vitis vinifera
ref|XP_008351570.1|  PREDICTED: monosaccharide-sensing protein 2-...    323   1e-108   
ref|XP_004300112.1|  PREDICTED: monosaccharide-sensing protein 2        340   1e-108   Fragaria vesca subsp. vesca
ref|XP_003603868.1|  Monosaccharide-sensing protein                     340   2e-108   Medicago truncatula
ref|XP_010909820.1|  PREDICTED: monosaccharide-sensing protein 2-...    340   2e-108   Elaeis guineensis
gb|EAY85098.1|  hypothetical protein OsI_06450                          338   3e-108   Oryza sativa Indica Group [Indian rice]
ref|XP_008373385.1|  PREDICTED: monosaccharide-sensing protein 2-...    338   1e-107   
gb|EAZ22316.1|  hypothetical protein OsJ_05971                          339   1e-107   Oryza sativa Japonica Group [Japonica rice]
emb|CDY31497.1|  BnaC05g16060D                                          334   2e-107   Brassica napus [oilseed rape]
ref|XP_010537220.1|  PREDICTED: monosaccharide-sensing protein 1-...    337   2e-107   Tarenaya hassleriana [spider flower]
ref|XP_009372620.1|  PREDICTED: monosaccharide-sensing protein 2        337   4e-107   Pyrus x bretschneideri [bai li]
gb|EMS49950.1|  Monosaccharide-sensing protein 2                        335   4e-107   Triticum urartu
ref|XP_006416357.1|  hypothetical protein EUTSA_v10006916mg             336   7e-107   Eutrema salsugineum [saltwater cress]
dbj|BAJ33724.1|  unnamed protein product                                336   8e-107   Eutrema halophilum
dbj|BAJ89532.1|  predicted protein                                      336   9e-107   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008242106.1|  PREDICTED: monosaccharide-sensing protein 2-...    336   1e-106   Prunus mume [ume]
ref|XP_010266258.1|  PREDICTED: monosaccharide-sensing protein 2 ...    333   1e-106   
ref|NP_001046359.1|  Os02g0229400                                       336   1e-106   
ref|XP_007204446.1|  hypothetical protein PRUPE_ppa026426mg             335   1e-106   Prunus persica
ref|XP_008778122.1|  PREDICTED: monosaccharide-sensing protein 2-...    335   1e-106   
ref|XP_003571780.1|  PREDICTED: monosaccharide-sensing protein 2-...    335   1e-106   Brachypodium distachyon [annual false brome]
emb|CDY29502.1|  BnaA06g14680D                                          333   2e-106   Brassica napus [oilseed rape]
gb|EMT06669.1|  Monosaccharide-sensing protein 2                        336   2e-106   
ref|XP_010539774.1|  PREDICTED: monosaccharide-sensing protein 1-...    334   3e-106   Tarenaya hassleriana [spider flower]
ref|XP_009149562.1|  PREDICTED: monosaccharide-sensing protein 1        334   3e-106   Brassica rapa
emb|CDI66586.1|  putative sugar transporter type 2a protein             334   5e-106   Saccharum hybrid cultivar R570
emb|CDI66591.1|  putative sugar transporter type 2a protein             334   5e-106   Saccharum hybrid cultivar R570
ref|XP_006647093.1|  PREDICTED: monosaccharide-sensing protein 2-...    334   6e-106   Oryza brachyantha
emb|CDY33650.1|  BnaC08g19500D                                          332   9e-106   Brassica napus [oilseed rape]
ref|XP_008237926.1|  PREDICTED: monosaccharide-sensing protein 2        333   1e-105   Prunus mume [ume]
emb|CAA90628.1|  sugar transporter                                      332   1e-105   Arabidopsis thaliana [mouse-ear cress]
gb|EMS63940.1|  Monosaccharide-sensing protein 2                        333   2e-105   Triticum urartu
ref|XP_006364349.1|  PREDICTED: monosaccharide-sensing protein 2-...    317   2e-105   
gb|EMT29091.1|  Monosaccharide-sensing protein 2                        333   2e-105   
ref|XP_002893133.1|  hypothetical protein ARALYDRAFT_472320             332   2e-105   
gb|AAD30608.1|AC007369_18  Sugar transporter                            332   2e-105   Arabidopsis thaliana [mouse-ear cress]
ref|NP_173508.1|  tonoplast monosaccharide transporter1                 332   2e-105   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010266257.1|  PREDICTED: monosaccharide-sensing protein 2 ...    332   3e-105   Nelumbo nucifera [Indian lotus]
gb|KJB79727.1|  hypothetical protein B456_013G064200                    328   3e-105   Gossypium raimondii
gb|EEC67373.1|  hypothetical protein OsI_34495                          331   4e-105   Oryza sativa Indica Group [Indian rice]
ref|XP_010063149.1|  PREDICTED: monosaccharide-sensing protein 2-...    331   5e-105   Eucalyptus grandis [rose gum]
ref|XP_010029562.1|  PREDICTED: monosaccharide-sensing protein 2-...    331   5e-105   Eucalyptus grandis [rose gum]
ref|NP_001065182.1|  Os10g0539900                                       331   6e-105   
ref|XP_002467580.1|  hypothetical protein SORBIDRAFT_01g030430          331   7e-105   Sorghum bicolor [broomcorn]
ref|XP_009390770.1|  PREDICTED: monosaccharide-sensing protein 2-...    331   7e-105   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAJ90138.1|  predicted protein                                      331   8e-105   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CAD58958.1|  hexose transporter                                     331   8e-105   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010906859.1|  PREDICTED: monosaccharide-sensing protein 2-...    325   8e-105   
ref|XP_006855646.1|  hypothetical protein AMTR_s00044p00110510          330   1e-104   
ref|XP_007142576.1|  hypothetical protein PHAVU_008G292400g             330   1e-104   Phaseolus vulgaris [French bean]
ref|XP_002520608.1|  sugar transporter, putative                        330   1e-104   Ricinus communis
ref|XP_006306868.1|  hypothetical protein CARUB_v10008415mg             330   2e-104   
ref|XP_007210337.1|  hypothetical protein PRUPE_ppa001932mg             330   2e-104   Prunus persica
ref|XP_010686712.1|  PREDICTED: monosaccharide-sensing protein 2        329   3e-104   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009110209.1|  PREDICTED: monosaccharide-sensing protein 1        328   4e-104   Brassica rapa
emb|CDX96618.1|  BnaA08g21610D                                          328   6e-104   
gb|EPS65490.1|  hypothetical protein M569_09283                         328   9e-104   Genlisea aurea
ref|XP_009401004.1|  PREDICTED: monosaccharide-sensing protein 2-...    327   1e-103   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003574265.1|  PREDICTED: monosaccharide-sensing protein 2-...    327   1e-103   Brachypodium distachyon [annual false brome]
gb|KDP47010.1|  hypothetical protein JCGZ_10737                         327   2e-103   Jatropha curcas
ref|XP_004951395.1|  PREDICTED: monosaccharide-sensing protein 2-...    327   2e-103   Setaria italica
ref|XP_010940242.1|  PREDICTED: monosaccharide-sensing protein 2-...    327   2e-103   Elaeis guineensis
gb|AJO70165.1|  tonoplast monosaccharide transporters 1                 327   3e-103   Camellia sinensis [black tea]
gb|KDO68405.1|  hypothetical protein CISIN_1g004750mg                   322   3e-103   Citrus sinensis [apfelsine]
ref|XP_007201798.1|  hypothetical protein PRUPE_ppa001957mg             326   4e-103   Prunus persica
gb|KJB79728.1|  hypothetical protein B456_013G064200                    326   4e-103   Gossypium raimondii
gb|KHG05233.1|  Monosaccharide-sensing 2 -like protein                  326   4e-103   Gossypium arboreum [tree cotton]
ref|NP_001151936.1|  LOC100285573                                       326   5e-103   Zea mays [maize]
emb|CDP14489.1|  unnamed protein product                                325   8e-103   Coffea canephora [robusta coffee]
ref|XP_011000869.1|  PREDICTED: monosaccharide-sensing protein 2-...    325   1e-102   Populus euphratica
ref|XP_010477336.1|  PREDICTED: monosaccharide-sensing protein 1        324   2e-102   Camelina sativa [gold-of-pleasure]
ref|XP_008235816.1|  PREDICTED: monosaccharide-sensing protein 2        324   3e-102   Prunus mume [ume]
ref|XP_009333794.1|  PREDICTED: monosaccharide-sensing protein 2-...    324   3e-102   
ref|XP_009763350.1|  PREDICTED: monosaccharide-sensing protein 2-...    323   5e-102   Nicotiana sylvestris
gb|KJB77474.1|  hypothetical protein B456_012G139000                    320   5e-102   Gossypium raimondii
ref|XP_008645619.1|  PREDICTED: monosaccharide-sensing protein 2-...    323   5e-102   Zea mays [maize]
ref|XP_004983796.1|  PREDICTED: monosaccharide-sensing protein 2-...    323   6e-102   Setaria italica
ref|XP_010548175.1|  PREDICTED: monosaccharide-sensing protein 2        323   6e-102   Tarenaya hassleriana [spider flower]
ref|XP_010680636.1|  PREDICTED: monosaccharide-sensing protein 2-...    323   7e-102   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006486570.1|  PREDICTED: monosaccharide-sensing protein 2-...    322   1e-101   Citrus sinensis [apfelsine]
ref|XP_010090703.1|  Monosaccharide-sensing protein 2                   322   1e-101   Morus notabilis
ref|XP_006422393.1|  hypothetical protein CICLE_v10027893mg             322   1e-101   
gb|KDO68402.1|  hypothetical protein CISIN_1g004750mg                   322   1e-101   Citrus sinensis [apfelsine]
ref|XP_009359629.1|  PREDICTED: monosaccharide-sensing protein 2-...    322   2e-101   Pyrus x bretschneideri [bai li]
ref|XP_009359631.1|  PREDICTED: monosaccharide-sensing protein 2-...    322   2e-101   
ref|XP_009359630.1|  PREDICTED: monosaccharide-sensing protein 2-...    322   3e-101   
gb|KJB12352.1|  hypothetical protein B456_002G014400                    317   3e-101   Gossypium raimondii
ref|XP_002312798.1|  transporter-related family protein                 321   3e-101   
ref|XP_007043079.1|  Tonoplast monosaccharide transporter2              321   3e-101   
ref|XP_008349018.1|  PREDICTED: monosaccharide-sensing protein 2-...    306   4e-101   
ref|XP_009608796.1|  PREDICTED: monosaccharide-sensing protein 2-...    321   5e-101   Nicotiana tomentosiformis
ref|XP_006384856.1|  transporter-related family protein                 321   5e-101   
gb|KJB77472.1|  hypothetical protein B456_012G139000                    320   7e-101   Gossypium raimondii
ref|XP_009341490.1|  PREDICTED: monosaccharide-sensing protein 2-...    320   7e-101   Pyrus x bretschneideri [bai li]
gb|AAO37640.1|  putative sugar transporter type 2a                      318   5e-100   Saccharum hybrid cultivar Q117
ref|XP_011098017.1|  PREDICTED: monosaccharide-sensing protein 2-...    317   7e-100   Sesamum indicum [beniseed]
gb|KFK34392.1|  hypothetical protein AALP_AA5G139300                    317   9e-100   Arabis alpina [alpine rockcress]
ref|XP_010066352.1|  PREDICTED: monosaccharide-sensing protein 2-...    317   9e-100   Eucalyptus grandis [rose gum]
ref|XP_006283193.1|  hypothetical protein CARUB_v10004225mg             317   1e-99    Capsella rubella
emb|CDP01766.1|  unnamed protein product                                317   1e-99    Coffea canephora [robusta coffee]
gb|KHG04801.1|  Monosaccharide-sensing protein 2                        317   1e-99    Gossypium arboreum [tree cotton]
gb|KCW64229.1|  hypothetical protein EUGRSUZ_G01880                     317   1e-99    Eucalyptus grandis [rose gum]
emb|CBI37732.3|  unnamed protein product                                315   1e-99    Vitis vinifera
ref|XP_007137297.1|  hypothetical protein PHAVU_009G115500g             317   1e-99    Phaseolus vulgaris [French bean]
gb|KJB12351.1|  hypothetical protein B456_002G014400                    317   2e-99    Gossypium raimondii
gb|KJB12354.1|  hypothetical protein B456_002G014400                    317   2e-99    Gossypium raimondii
ref|XP_002282975.1|  PREDICTED: monosaccharide-sensing protein 2        316   3e-99    Vitis vinifera
ref|XP_009392211.1|  PREDICTED: monosaccharide-sensing protein 2-...    316   3e-99    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009103100.1|  PREDICTED: monosaccharide-sensing protein 2        316   3e-99    
gb|AFP89954.1|  tonoplastic transporter 2                               316   3e-99    Vitis vinifera
emb|CDX69128.1|  BnaC01g03250D                                          314   5e-99    
ref|XP_011040809.1|  PREDICTED: monosaccharide-sensing protein 2-...    315   5e-99    Populus euphratica
ref|XP_004144248.1|  PREDICTED: monosaccharide-sensing protein 2-...    315   5e-99    Cucumis sativus [cucumbers]
emb|CDY65623.1|  BnaCnng48010D                                          313   6e-99    Brassica napus [oilseed rape]
ref|XP_009340799.1|  PREDICTED: monosaccharide-sensing protein 2-...    315   8e-99    Pyrus x bretschneideri [bai li]
ref|XP_006343319.1|  PREDICTED: monosaccharide-sensing protein 2-...    315   9e-99    Solanum tuberosum [potatoes]
gb|AIN39841.1|  hypothetical protein                                    315   9e-99    Zoysia matrella [Japanese carpet grass]
gb|KHN33643.1|  Monosaccharide-sensing protein 2                        315   1e-98    Glycine soja [wild soybean]
ref|XP_003543932.1|  PREDICTED: monosaccharide-sensing protein 2-...    315   1e-98    
ref|NP_190717.1|  tonoplast monosaccharide transporter3                 314   1e-98    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004289029.1|  PREDICTED: monosaccharide-sensing protein 2-...    315   1e-98    Fragaria vesca subsp. vesca
gb|EMT28528.1|  Monosaccharide-sensing protein 3                        309   1e-98    
ref|XP_008464819.1|  PREDICTED: monosaccharide-sensing protein 2-...    314   1e-98    Cucumis melo [Oriental melon]
emb|CAN80213.1|  hypothetical protein VITISV_042076                     314   1e-98    Vitis vinifera
ref|XP_008812559.1|  PREDICTED: monosaccharide-sensing protein 2-...    315   1e-98    Phoenix dactylifera
ref|NP_001190054.1|  tonoplast monosaccharide transporter3              314   2e-98    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010270527.1|  PREDICTED: monosaccharide-sensing protein 2        314   2e-98    Nelumbo nucifera [Indian lotus]
ref|XP_010446942.1|  PREDICTED: monosaccharide-sensing protein 2        313   3e-98    Camelina sativa [gold-of-pleasure]
ref|XP_008377843.1|  PREDICTED: monosaccharide-sensing protein 2-...    313   3e-98    
ref|XP_002877807.1|  predicted protein                                  313   3e-98    
ref|XP_010437493.1|  PREDICTED: monosaccharide-sensing protein 2-...    313   4e-98    
ref|NP_001280690.1|  monosaccharide-sensing protein 2-like              313   5e-98    Solanum lycopersicum
ref|XP_009776539.1|  PREDICTED: monosaccharide-sensing protein 2-...    313   5e-98    Nicotiana sylvestris
ref|XP_010432297.1|  PREDICTED: monosaccharide-sensing protein 2-...    313   5e-98    Camelina sativa [gold-of-pleasure]
ref|XP_010678631.1|  PREDICTED: monosaccharide-sensing protein 2-...    313   5e-98    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004139974.1|  PREDICTED: monosaccharide-sensing protein 2-...    312   1e-97    
ref|XP_009589978.1|  PREDICTED: monosaccharide-sensing protein 2-...    311   1e-97    Nicotiana tomentosiformis
ref|XP_011099908.1|  PREDICTED: monosaccharide-sensing protein 2-...    311   1e-97    Sesamum indicum [beniseed]
ref|XP_009775817.1|  PREDICTED: monosaccharide-sensing protein 2-...    311   1e-97    Nicotiana sylvestris
ref|XP_003526737.1|  PREDICTED: monosaccharide-sensing protein 2-...    311   2e-97    Glycine max [soybeans]
dbj|BAI94493.1|  sugar transporter                                      311   2e-97    Dianthus caryophyllus [carnation]
ref|XP_008448165.1|  PREDICTED: monosaccharide-sensing protein 2        311   3e-97    Cucumis melo [Oriental melon]
ref|XP_009622210.1|  PREDICTED: monosaccharide-sensing protein 2-...    310   6e-97    Nicotiana tomentosiformis
gb|KHN46863.1|  Monosaccharide-sensing protein 2                        309   9e-97    Glycine soja [wild soybean]
ref|XP_004154526.1|  PREDICTED: monosaccharide-sensing protein 2-...    310   9e-97    
ref|XP_004500684.1|  PREDICTED: monosaccharide-sensing protein 2-...    308   2e-96    
ref|XP_010690557.1|  PREDICTED: monosaccharide-sensing protein 2        308   2e-96    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003518591.1|  PREDICTED: monosaccharide-sensing protein 2-...    307   3e-96    Glycine max [soybeans]
ref|XP_008382498.1|  PREDICTED: monosaccharide-sensing protein 2-...    307   6e-96    
ref|XP_010097645.1|  Monosaccharide-sensing protein 3                   307   6e-96    Morus notabilis
ref|XP_011022133.1|  PREDICTED: monosaccharide-sensing protein 2-...    306   8e-96    Populus euphratica
ref|XP_002306419.1|  hypothetical protein POPTR_0005s10180g             306   9e-96    
gb|EYU30848.1|  hypothetical protein MIMGU_mgv1a001984mg                305   6e-95    Erythranthe guttata [common monkey flower]
ref|NP_195256.3|  monosaccharide-sensing protein 2                      302   6e-94    Arabidopsis thaliana [mouse-ear cress]
ref|NP_849565.1|  monosaccharide-sensing protein 2                      302   8e-94    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002867077.1|  hypothetical protein ARALYDRAFT_491117             301   2e-93    
gb|KJB31963.1|  hypothetical protein B456_005G216600                    300   3e-93    Gossypium raimondii
ref|XP_008786687.1|  PREDICTED: monosaccharide-sensing protein 2-...    300   4e-93    Phoenix dactylifera
gb|EAY80902.1|  hypothetical protein OsI_36080                          300   6e-93    Oryza sativa Indica Group [Indian rice]
ref|NP_001067890.1|  Os11g0475600                                       300   6e-93    
ref|XP_004978456.1|  PREDICTED: monosaccharide-sensing protein 2-...    299   6e-93    
ref|XP_004290074.1|  PREDICTED: monosaccharide-sensing protein 2        299   1e-92    Fragaria vesca subsp. vesca
ref|XP_009359632.1|  PREDICTED: monosaccharide-sensing protein 2-...    298   2e-92    Pyrus x bretschneideri [bai li]
gb|KGN49001.1|  hypothetical protein Csa_6G509700                       298   4e-92    
gb|KHG14026.1|  Monosaccharide-sensing 2 -like protein                  297   5e-92    Gossypium arboreum [tree cotton]
emb|CDY33276.1|  BnaA01g19430D                                          295   6e-92    Brassica napus [oilseed rape]
ref|XP_009148978.1|  PREDICTED: monosaccharide-sensing protein 3        296   9e-92    Brassica rapa
emb|CDY16303.1|  BnaC01g23380D                                          294   2e-91    Brassica napus [oilseed rape]
ref|XP_006412119.1|  hypothetical protein EUTSA_v10024517mg             295   2e-91    Eutrema salsugineum [saltwater cress]
ref|XP_004289030.1|  PREDICTED: monosaccharide-sensing protein 2        294   4e-91    Fragaria vesca subsp. vesca
ref|XP_004134823.1|  PREDICTED: monosaccharide-sensing protein 2-...    294   5e-91    
gb|KHN20087.1|  Monosaccharide-sensing protein 2                        294   5e-91    Glycine soja [wild soybean]
ref|XP_006292750.1|  hypothetical protein CARUB_v10018997mg             294   6e-91    
ref|XP_008242155.1|  PREDICTED: monosaccharide-sensing protein 2-...    295   6e-91    Prunus mume [ume]
ref|XP_007203009.1|  hypothetical protein PRUPE_ppa017631mg             294   8e-91    Prunus persica
ref|XP_006403910.1|  hypothetical protein EUTSA_v10011113mg             294   9e-91    Eutrema salsugineum [saltwater cress]
ref|XP_010503840.1|  PREDICTED: monosaccharide-sensing protein 3-...    293   2e-90    Camelina sativa [gold-of-pleasure]
ref|XP_008440928.1|  PREDICTED: LOW QUALITY PROTEIN: monosacchari...    293   2e-90    
ref|XP_004169167.1|  PREDICTED: LOW QUALITY PROTEIN: monosacchari...    293   2e-90    
ref|XP_010515555.1|  PREDICTED: monosaccharide-sensing protein 3        293   2e-90    Camelina sativa [gold-of-pleasure]
ref|XP_010426703.1|  PREDICTED: monosaccharide-sensing protein 3-...    293   2e-90    Camelina sativa [gold-of-pleasure]
emb|CDX78009.1|  BnaA09g32040D                                          291   3e-90    
emb|CDX73717.1|  BnaC08g22860D                                          291   4e-90    
ref|XP_009115837.1|  PREDICTED: monosaccharide-sensing protein 3        292   4e-90    Brassica rapa
gb|KDP43790.1|  hypothetical protein JCGZ_22417                         291   6e-90    Jatropha curcas
gb|EPS57524.1|  hypothetical protein M569_17293                         290   2e-89    Genlisea aurea
gb|KEH36403.1|  tonoplast monosaccharide transporter 2                  286   7e-89    Medicago truncatula
ref|XP_002532480.1|  sugar transporter, putative                        283   1e-88    
ref|XP_010029563.1|  PREDICTED: monosaccharide-sensing protein 2-...    288   1e-88    Eucalyptus grandis [rose gum]
gb|EYU40481.1|  hypothetical protein MIMGU_mgv1a001997mg                288   1e-88    Erythranthe guttata [common monkey flower]
ref|XP_003604104.1|  Monosaccharide-sensing protein                     286   8e-88    Medicago truncatula
ref|XP_003560303.1|  PREDICTED: monosaccharide-sensing protein 2-...    287   9e-88    Brachypodium distachyon [annual false brome]
ref|XP_010028861.1|  PREDICTED: LOW QUALITY PROTEIN: monosacchari...    285   1e-87    
gb|KHN19961.1|  Monosaccharide-sensing protein 2                        281   6e-86    Glycine soja [wild soybean]
gb|EYU43535.1|  hypothetical protein MIMGU_mgv1a002513mg                278   3e-85    Erythranthe guttata [common monkey flower]
gb|KJB14185.1|  hypothetical protein B456_002G113400                    278   3e-85    Gossypium raimondii
ref|XP_004954530.1|  PREDICTED: monosaccharide-sensing protein 2-...    277   1e-84    Setaria italica
ref|XP_006662557.1|  PREDICTED: monosaccharide-sensing protein 2-...    276   5e-84    
ref|XP_004964709.1|  PREDICTED: monosaccharide-sensing protein 2-...    274   3e-83    Setaria italica
ref|XP_003603869.1|  Monosaccharide-sensing protein                     273   5e-83    
gb|ACG25339.1|  hexose transporter                                      272   3e-82    Zea mays [maize]
dbj|BAK02857.1|  predicted protein                                      271   4e-82    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001147067.1|  hexose transporter                                 271   4e-82    Zea mays [maize]
ref|XP_003517121.1|  PREDICTED: monosaccharide-sensing protein 2-...    267   9e-81    
gb|KHG00737.1|  Monosaccharide-sensing 2 -like protein                  267   1e-80    Gossypium arboreum [tree cotton]
ref|XP_003537696.1|  PREDICTED: monosaccharide-sensing protein 2-...    264   2e-79    Glycine max [soybeans]
ref|XP_007158028.1|  hypothetical protein PHAVU_002G118100g             263   3e-79    Phaseolus vulgaris [French bean]
gb|KHG04802.1|  Monosaccharide-sensing protein 2                        262   4e-79    Gossypium arboreum [tree cotton]
ref|XP_007156262.1|  hypothetical protein PHAVU_003G271500g             256   5e-77    Phaseolus vulgaris [French bean]
ref|XP_003573173.1|  PREDICTED: monosaccharide-sensing protein 2-...    256   1e-76    Brachypodium distachyon [annual false brome]
gb|EMS60524.1|  Monosaccharide-sensing protein 3                        247   3e-76    Triticum urartu
ref|XP_002439068.1|  hypothetical protein SORBIDRAFT_10g031000          253   5e-75    Sorghum bicolor [broomcorn]
ref|XP_004512287.1|  PREDICTED: monosaccharide-sensing protein 2-...    252   6e-75    Cicer arietinum [garbanzo]
gb|AES95370.2|  tonoplast monosaccharide transporter 2                  249   8e-74    Medicago truncatula
ref|XP_003629095.1|  Monosaccharide-sensing protein                     247   3e-73    
ref|XP_003614108.1|  Monosaccharide-sensing protein                     247   4e-73    Medicago truncatula
ref|XP_004509464.1|  PREDICTED: monosaccharide-sensing protein 2-...    246   2e-72    Cicer arietinum [garbanzo]
dbj|BAD23011.1|  putative hexose transporter                            242   7e-72    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003548779.1|  PREDICTED: monosaccharide-sensing protein 3-...    240   7e-71    Glycine max [soybeans]
gb|AAN17390.1|  Putative sugar transporter protein                      241   7e-71    Oryza sativa Japonica Group [Japonica rice]
dbj|BAA85398.1|  unnamed protein product                                241   8e-71    Oryza sativa Japonica Group [Japonica rice]
gb|EAY88138.1|  hypothetical protein OsI_09573                          239   1e-70    Oryza sativa Indica Group [Indian rice]
gb|EAY88374.1|  hypothetical protein OsI_09831                          239   2e-70    Oryza sativa Indica Group [Indian rice]
ref|XP_006649210.1|  PREDICTED: monosaccharide-sensing protein 2-...    238   4e-70    
ref|XP_003562146.1|  PREDICTED: monosaccharide-sensing protein 2-...    238   7e-70    
ref|XP_002979533.1|  hypothetical protein SELMODRAFT_111167             237   2e-69    
ref|XP_002977746.1|  hypothetical protein SELMODRAFT_10582              237   3e-69    
ref|XP_009387331.1|  PREDICTED: monosaccharide-sensing protein 1-...    229   7e-68    
ref|XP_002986014.1|  hypothetical protein SELMODRAFT_182142             231   4e-67    Selaginella moellendorffii
ref|XP_002981894.1|  hypothetical protein SELMODRAFT_179271             230   1e-66    Selaginella moellendorffii
ref|XP_003612412.1|  Monosaccharide-sensing protein                     228   6e-66    
ref|XP_001761207.1|  predicted protein                                  220   5e-63    
ref|NP_001173250.1|  Os03g0128900                                       205   4e-62    
gb|KHN35942.1|  Monosaccharide-sensing protein 3                        214   3e-61    Glycine soja [wild soybean]
ref|XP_006653836.1|  PREDICTED: monosaccharide-sensing protein 2-...    214   6e-61    Oryza brachyantha
ref|XP_002453100.1|  hypothetical protein SORBIDRAFT_04g038460          209   2e-60    
emb|CAD58959.1|  sugar transporter                                      212   3e-60    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_001773057.1|  predicted protein                                  211   6e-60    
ref|XP_010237535.1|  PREDICTED: monosaccharide-sensing protein 2-...    206   9e-60    
ref|XP_002978337.1|  hypothetical protein SELMODRAFT_268165             210   1e-59    
ref|XP_001784511.1|  predicted protein                                  210   2e-59    
ref|XP_002970170.1|  hypothetical protein SELMODRAFT_231525             209   3e-59    
ref|XP_003577342.1|  PREDICTED: monosaccharide-sensing protein 2-...    206   2e-58    
ref|XP_002981960.1|  hypothetical protein SELMODRAFT_179172             204   1e-57    
ref|XP_002982939.1|  hypothetical protein SELMODRAFT_445340             204   1e-57    
ref|XP_010459775.1|  PREDICTED: monosaccharide-sensing protein 1-...    200   4e-56    
ref|XP_002449882.1|  hypothetical protein SORBIDRAFT_05g024860          195   5e-54    
gb|AAM94321.1|  putative sugar transporter                              195   5e-54    
ref|XP_008676723.1|  PREDICTED: uncharacterized protein LOC100272...    194   6e-54    
gb|ABA94777.1|  Sugar transporter, putative, expressed                  192   2e-53    
gb|ABA94776.1|  Sugar transporter, putative, expressed                  192   2e-53    
ref|XP_001754179.1|  predicted protein                                  192   4e-53    
gb|EEC68553.1|  hypothetical protein OsI_36866                          189   3e-52    
gb|EMS63099.1|  Monosaccharide-sensing protein 3                        189   5e-52    
gb|EMT02609.1|  Monosaccharide-sensing protein 3                        189   1e-51    
ref|XP_006663052.1|  PREDICTED: monosaccharide-sensing protein 2-...    185   1e-50    
ref|XP_004979746.1|  PREDICTED: monosaccharide-sensing protein 3-...    182   2e-49    
gb|EMT01868.1|  Monosaccharide-sensing protein 2                        177   3e-48    
gb|AGT16371.1|  hexose transporter                                      163   7e-43    
emb|CDY33275.1|  BnaA01g19420D                                          144   1e-39    
gb|AFW59276.1|  hypothetical protein ZEAMMB73_154299                    147   3e-37    
ref|XP_003533841.1|  PREDICTED: probable inositol transporter 2-l...    141   3e-35    
ref|WP_010332110.1|  major facilitator transporter                      139   8e-35    
ref|WP_012945458.1|  major facilitator transporter                      139   8e-35    
ref|WP_024123064.1|  major facilitator transporter                      139   1e-34    
emb|CDR33502.1|  putative D-xylose-proton symporter                     138   2e-34    
ref|WP_006165530.1|  sugar transporter                                  138   2e-34    
ref|WP_041017256.1|  major facilitator transporter                      137   4e-34    
ref|WP_008420814.1|  sugar transporter                                  137   4e-34    
ref|WP_044159562.1|  major facilitator transporter                      137   5e-34    
gb|KHN25361.1|  Polyol transporter 5                                    137   6e-34    
ref|XP_003607077.1|  Sorbitol-like transporter                          137   8e-34    
ref|WP_010790115.1|  Major myo-inositol transporter IolT                136   9e-34    
ref|XP_007135989.1|  hypothetical protein PHAVU_009G008900g             136   9e-34    
ref|WP_014115401.1|  major facilitator transporter                      136   1e-33    
ref|XP_003595539.1|  Carbohydrate transporter/sugar porter              137   1e-33    
gb|KDE57191.1|  major facilitator transporter                           136   1e-33    
ref|WP_015384820.1|  hypothetical protein                               136   1e-33    
ref|WP_032726992.1|  major facilitator transporter                      136   1e-33    
emb|CAB07473.1|  ywtG                                                   136   1e-33    
ref|WP_013644894.1|  major facilitator transporter                      135   1e-33    
ref|WP_015251080.1|  hypothetical protein                               136   1e-33    
ref|WP_003227903.1|  major facilitator transporter                      136   1e-33    
ref|WP_003243731.1|  major facilitator transporter                      135   1e-33    
ref|WP_038429742.1|  MULTISPECIES: major facilitator transporter        135   1e-33    
ref|WP_029318758.1|  major facilitator transporter                      135   1e-33    
ref|WP_021480749.1|  major facilitator transporter                      135   1e-33    
ref|WP_014478156.1|  major facilitator transporter                      135   1e-33    
ref|WP_042975185.1|  major facilitator transporter                      135   1e-33    
ref|WP_003326676.1|  MULTISPECIES: major facilitator transporter        135   1e-33    
gb|KFF55288.1|  major facilitator transporter                           135   1e-33    
ref|WP_041351268.1|  major facilitator transporter                      135   1e-33    
gb|KHN25431.1|  Polyol transporter 5                                    136   2e-33    
ref|WP_033884193.1|  major facilitator transporter                      135   2e-33    
ref|WP_017697351.1|  major facilitator transporter                      135   2e-33    
gb|AAY86779.1|  putative sugar transporter protein                      132   2e-33    
ref|WP_031314734.1|  major facilitator transporter                      135   2e-33    
ref|XP_006349557.1|  PREDICTED: polyol transporter 5-like               135   2e-33    
ref|WP_014665603.1|  major facilitator transporter                      135   2e-33    
ref|WP_040081624.1|  major facilitator transporter                      135   2e-33    
ref|WP_020453166.1|  MULTISPECIES: putative carbohydrate transpor...    135   2e-33    
ref|WP_007141639.1|  major facilitator transporter                      135   2e-33    
ref|WP_043926519.1|  major facilitator transporter                      135   2e-33    
ref|XP_003540961.2|  PREDICTED: polyol transporter 5-like               135   2e-33    
ref|XP_003603886.1|  Mannitol transporter                               135   2e-33    
dbj|BAI87225.1|  hypothetical protein BSNT_10227                        134   2e-33    
ref|WP_003185812.1|  MULTISPECIES: major facilitator transporter        135   2e-33    
ref|XP_005111789.1|  PREDICTED: proton myo-inositol cotransporter...    136   3e-33    
ref|WP_019715918.1|  major facilitator transporter                      135   3e-33    
ref|WP_003219605.1|  MULTISPECIES: major facilitator transporter        135   3e-33    
ref|WP_019259642.1|  major facilitator transporter                      135   3e-33    
ref|WP_024571920.1|  major facilitator transporter                      135   3e-33    
ref|WP_003235555.1|  sugar transporter family protein                   135   3e-33    
ref|WP_041333343.1|  major facilitator transporter                      135   3e-33    
gb|AAU25275.2|  Sugar transporter YwtG                                  135   3e-33    
ref|WP_011201747.1|  major facilitator transporter                      135   3e-33    
gb|AHG00573.1|  major facilitator transporter                           135   3e-33    
ref|WP_026580203.1|  major facilitator transporter                      134   4e-33    
gb|ACJ85869.1|  unknown                                                 134   4e-33    
ref|NP_188513.1|  polyol transporter 5                                  135   4e-33    
ref|WP_035337833.1|  major facilitator transporter                      134   4e-33    
ref|XP_007138452.1|  hypothetical protein PHAVU_009G210200g             135   4e-33    
ref|XP_006577924.1|  PREDICTED: polyol transporter 5-like               134   5e-33    
ref|WP_012945178.1|  major facilitator transporter                      134   5e-33    
ref|WP_026588992.1|  major facilitator transporter                      134   5e-33    
gb|AAM44082.1|  putative sorbitol transporter                           134   5e-33    
ref|XP_005454221.1|  PREDICTED: proton myo-inositol cotransporter...    135   6e-33    
ref|XP_003541068.1|  PREDICTED: polyol transporter 5-like               134   7e-33    
ref|WP_005555141.1|  sugar transporter                                  134   8e-33    
ref|XP_005454218.1|  PREDICTED: proton myo-inositol cotransporter...    135   8e-33    
ref|XP_005454219.1|  PREDICTED: proton myo-inositol cotransporter...    135   8e-33    
ref|XP_005454217.1|  PREDICTED: proton myo-inositol cotransporter...    135   8e-33    
ref|WP_039075310.1|  major facilitator transporter                      133   8e-33    
ref|XP_007200585.1|  hypothetical protein PRUPE_ppa007633mg             132   9e-33    
ref|XP_005454220.1|  PREDICTED: proton myo-inositol cotransporter...    135   9e-33    
ref|XP_004500821.1|  PREDICTED: polyol transporter 5-like               134   9e-33    
ref|WP_044333342.1|  major facilitator transporter                      133   1e-32    
ref|WP_015321733.1|  MFS transporter, sugar porter family               133   1e-32    
ref|WP_034624608.1|  major facilitator transporter                      133   1e-32    
ref|XP_009596634.1|  PREDICTED: polyol transporter 5-like               134   1e-32    
gb|EPS65606.1|  hypothetical protein M569_09171                         128   1e-32    
ref|XP_004293378.1|  PREDICTED: inositol transporter 4-like             134   1e-32    
ref|WP_010328819.1|  major facilitator transporter                      133   1e-32    
ref|WP_041115547.1|  major facilitator transporter                      133   1e-32    
ref|WP_041087948.1|  major facilitator transporter                      133   1e-32    
gb|EPS69995.1|  sugar transport protein                                 133   1e-32    
ref|WP_007109838.1|  sugar transporter                                  132   1e-32    
ref|WP_039181947.1|  major facilitator transporter                      133   2e-32    
ref|WP_034281160.1|  major facilitator transporter                      133   2e-32    
ref|XP_010254894.1|  PREDICTED: polyol transporter 5-like               133   2e-32    
ref|WP_019853934.1|  hypothetical protein                               132   2e-32    
gb|KDE28343.1|  major facilitator superfamily transporter               132   2e-32    
ref|WP_034660203.1|  major facilitator transporter                      132   2e-32    
ref|XP_002524977.1|  sugar transporter, putative                        133   2e-32    
ref|XP_005935667.1|  PREDICTED: proton myo-inositol cotransporter...    133   2e-32    
ref|XP_004564516.1|  PREDICTED: proton myo-inositol cotransporter...    134   2e-32    
ref|XP_005935661.1|  PREDICTED: proton myo-inositol cotransporter...    134   2e-32    
ref|XP_004564517.1|  PREDICTED: proton myo-inositol cotransporter...    133   2e-32    
ref|WP_024423665.1|  MULTISPECIES: major facilitator transporter        132   2e-32    
ref|WP_041815974.1|  major facilitator transporter                      132   2e-32    
ref|WP_025093928.1|  major facilitator transporter                      132   2e-32    
ref|XP_004564511.1|  PREDICTED: proton myo-inositol cotransporter...    134   2e-32    
gb|ABV63905.1|  MFS family major facilitator transporter                132   2e-32    
ref|WP_003213753.1|  major facilitator transporter                      132   2e-32    
ref|WP_012944770.1|  major facilitator transporter                      132   2e-32    
ref|WP_044140081.1|  major facilitator transporter                      132   2e-32    
ref|XP_004502238.1|  PREDICTED: inositol transporter 1-like             132   2e-32    
ref|XP_010507195.1|  PREDICTED: polyol transporter 5                    132   3e-32    
gb|KHN39768.1|  Polyol transporter 5                                    132   3e-32    
gb|KDO28356.1|  hypothetical protein SPRG_06595                         132   3e-32    
ref|XP_008289630.1|  PREDICTED: proton myo-inositol cotransporter...    133   3e-32    
ref|XP_003524151.1|  PREDICTED: probable inositol transporter 2         132   3e-32    
ref|WP_017976334.1|  hypothetical protein                               132   3e-32    
ref|XP_003601664.1|  hypothetical protein MTR_3g084110                  132   3e-32    
ref|XP_007131851.1|  hypothetical protein PHAVU_011G046700g             132   3e-32    
gb|KIL28067.1|  hypothetical protein B4133_3537                         132   3e-32    
ref|XP_008289638.1|  PREDICTED: proton myo-inositol cotransporter...    133   3e-32    
gb|EIL85661.1|  major myo-inositol transporter IolT                     132   3e-32    
ref|XP_008289622.1|  PREDICTED: proton myo-inositol cotransporter...    133   3e-32    
ref|WP_035702628.1|  major facilitator transporter                      132   3e-32    
ref|WP_026050159.1|  major facilitator transporter                      132   3e-32    
ref|WP_025208099.1|  major facilitator transporter                      132   3e-32    
ref|WP_039963088.1|  major facilitator transporter                      132   3e-32    
ref|WP_024718707.1|  MULTISPECIES: major facilitator transporter        132   3e-32    
ref|XP_008309519.1|  PREDICTED: proton myo-inositol cotransporter...    133   4e-32    
gb|KHN05290.1|  Putative inositol transporter 2                         132   4e-32    
ref|WP_034318471.1|  major facilitator transporter                      132   4e-32    
gb|KDE31071.1|  major facilitator superfamily transporter               132   4e-32    
ref|WP_040446630.1|  hypothetical protein                               132   4e-32    
ref|XP_008620170.1|  hypothetical protein SDRG_15766                    132   4e-32    
gb|EMI14151.1|  carbohydrate transporter                                132   4e-32    
ref|XP_006782410.1|  PREDICTED: proton myo-inositol cotransporter...    132   4e-32    
ref|XP_011092774.1|  PREDICTED: polyol transporter 5-like               132   4e-32    
ref|XP_003533843.1|  PREDICTED: probable inositol transporter 2-like    132   4e-32    
ref|XP_008309517.1|  PREDICTED: proton myo-inositol cotransporter...    133   5e-32    
ref|XP_007042744.1|  Polyol/monosaccharide transporter 5                132   5e-32    
ref|WP_006431848.1|  sugar transporter                                  130   5e-32    
ref|XP_009800568.1|  PREDICTED: polyol transporter 5-like               132   5e-32    
ref|XP_011037561.1|  PREDICTED: polyol transporter 5                    132   5e-32    
ref|XP_002308798.1|  sugar transporter family protein                   132   5e-32    
gb|KFK44842.1|  hypothetical protein AALP_AA1G309600                    132   5e-32    
ref|WP_026059771.1|  IolT                                               131   6e-32    
ref|XP_010465998.1|  PREDICTED: polyol transporter 5-like               132   6e-32    
ref|XP_008309518.1|  PREDICTED: proton myo-inositol cotransporter...    132   6e-32    
gb|EFH84814.1|  sugar transporter                                       131   6e-32    
ref|XP_008236795.1|  PREDICTED: polyol transporter 5-like               131   6e-32    
ref|WP_006665058.1|  sugar transporter                                  131   6e-32    
ref|WP_044155627.1|  major facilitator transporter                      131   6e-32    
ref|WP_008385733.1|  sugar transporter                                  131   7e-32    
ref|XP_010254895.1|  PREDICTED: polyol transporter 5-like               131   7e-32    
ref|XP_009602627.1|  PREDICTED: polyol transporter 5-like               131   7e-32    
ref|XP_010487804.1|  PREDICTED: polyol transporter 5-like               131   7e-32    
ref|WP_025731032.1|  major facilitator transporter                      130   8e-32    
gb|ACC61047.1|  mannitol transporter                                    130   8e-32    
ref|XP_010733779.1|  PREDICTED: proton myo-inositol cotransporter...    132   8e-32    
ref|WP_006185197.1|  sugar transporter                                  131   8e-32    
ref|XP_009766648.1|  PREDICTED: polyol transporter 5-like               131   8e-32    
ref|WP_019258501.1|  major facilitator transporter                      130   8e-32    
ref|XP_010733780.1|  PREDICTED: proton myo-inositol cotransporter...    132   9e-32    
ref|WP_038109522.1|  major facilitator transporter                      130   9e-32    
ref|XP_010733777.1|  PREDICTED: proton myo-inositol cotransporter...    132   9e-32    
gb|ELS61413.1|  putative sugar transporter                              129   1e-31    
ref|WP_008893404.1|  sugar transporter                                  130   1e-31    
gb|AAT06053.2|  sorbitol transporter                                    131   1e-31    
gb|ETI82942.1|  MFS transporter, sugar porter family protein            130   1e-31    
gb|AES71915.2|  sugar porter (SP) family MFS transporter                130   1e-31    
ref|XP_010733776.1|  PREDICTED: proton myo-inositol cotransporter...    132   1e-31    
ref|WP_022793052.1|  major facilitator transporter                      130   1e-31    
gb|KFK22027.1|  hypothetical protein AALP_AAs71925U000400               130   1e-31    
emb|CAP58707.1|  putative polyol transported protein 2                  130   1e-31    
ref|WP_010790464.1|  Major myo-inositol transporter IolT                130   1e-31    
ref|XP_010686705.1|  PREDICTED: inositol transporter 4-like isofo...    131   1e-31    
ref|XP_004148314.1|  PREDICTED: polyol transporter 5-like               130   2e-31    
ref|XP_008465477.1|  PREDICTED: polyol transporter 5-like               130   2e-31    
ref|WP_008455808.1|  sugar transporter                                  130   2e-31    
ref|WP_003326199.1|  MULTISPECIES: major facilitator transporter        130   2e-31    
gb|EKF35927.1|  major facilitator superfamily transporter               130   2e-31    
ref|WP_006639311.1|  sugar transporter YwtG                             129   2e-31    
ref|WP_014643164.1|  major facilitator transporter                      129   2e-31    
ref|XP_003631630.1|  PREDICTED: polyol transporter 5                    130   2e-31    
ref|WP_034738771.1|  major facilitator transporter                      129   2e-31    
ref|WP_024715952.1|  major facilitator transporter                      129   2e-31    
ref|XP_006858666.1|  hypothetical protein AMTR_s00066p00070660          130   2e-31    
gb|KGN44327.1|  hypothetical protein Csa_7G253820                       130   2e-31    
ref|XP_010780353.1|  PREDICTED: proton myo-inositol cotransporter...    131   2e-31    
ref|XP_010780354.1|  PREDICTED: proton myo-inositol cotransporter...    130   2e-31    
ref|XP_008444543.1|  PREDICTED: probable inositol transporter 2         130   2e-31    
gb|AAF91431.1|  putative Na+/myo-inositol symporter                     130   2e-31    
ref|WP_006110627.1|  sugar transporter                                  129   2e-31    
ref|XP_007154026.1|  hypothetical protein PHAVU_003G084800g             130   2e-31    
ref|WP_022021988.1|  sugar transporter                                  129   3e-31    
ref|WP_013879135.1|  major facilitator transporter                      129   3e-31    
ref|XP_009342008.1|  PREDICTED: putative polyol transporter 1           129   3e-31    
ref|NP_174313.1|  putative inositol transporter 2                       130   3e-31    
gb|AGY96955.1|  polyol transporter 1                                    129   3e-31    
ref|XP_009350912.1|  PREDICTED: putative polyol transporter 1           129   3e-31    
ref|WP_041907097.1|  major facilitator transporter                      129   3e-31    
ref|XP_004137560.1|  PREDICTED: probable inositol transporter 2-like    130   3e-31    
ref|WP_006826745.1|  sugar transporter                                  129   3e-31    
ref|XP_009342009.1|  PREDICTED: putative polyol transporter 1           129   3e-31    
gb|KGN63914.1|  hypothetical protein Csa_1G025940                       130   3e-31    



>ref|XP_006342166.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006342167.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Solanum 
tuberosum]
Length=737

 Score =   364 bits (935),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 182/202 (90%), Positives = 191/202 (95%), Gaps = 0/202 (0%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  266
            MNGAVLVA+AATIGNFLQGWDNATIAGAVVYIKKEL L+  +EGLVVAMSLIGATL+TTC
Sbjct  1    MNGAVLVALAATIGNFLQGWDNATIAGAVVYIKKELALDASVEGLVVAMSLIGATLVTTC  60

Query  267  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  446
            SGSIAD +GRRPMLI+SSM YFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS
Sbjct  61   SGSIADSIGRRPMLIMSSMLYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  120

Query  447  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  626
            ETAPSEIRG LNTLPQFTGSGGMFLAYCMIFGMS+ TAPSWRLMLGVLSIPSL+YF L V
Sbjct  121  ETAPSEIRGSLNTLPQFTGSGGMFLAYCMIFGMSLMTAPSWRLMLGVLSIPSLIYFVLVV  180

Query  627  FYLPESPRWLVSKGRMVXAKRV  692
             YLPESPRWLVSKGRMV AK+V
Sbjct  181  LYLPESPRWLVSKGRMVEAKQV  202



>ref|NP_001289848.1| monosaccharide-sensing protein 2 [Solanum lycopersicum]
 dbj|BAO96237.1| tonoplast monosaccharide transporter 2 [Solanum lycopersicum]
Length=738

 Score =   364 bits (935),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 181/202 (90%), Positives = 191/202 (95%), Gaps = 0/202 (0%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  266
            MNGAVLVA+AATIGNFLQGWDNATIAGAVVYIKKEL L+  +EGL+VAMSLIGATL+TTC
Sbjct  1    MNGAVLVALAATIGNFLQGWDNATIAGAVVYIKKELTLDASVEGLIVAMSLIGATLVTTC  60

Query  267  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  446
            SGSIAD +GRRPMLI+SSM YFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS
Sbjct  61   SGSIADSIGRRPMLIMSSMLYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  120

Query  447  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  626
            ETAPSEIRG LNTLPQFTGSGGMFLAYCMIFGMS+ TAPSWRLMLGVLSIPSL+YF L V
Sbjct  121  ETAPSEIRGSLNTLPQFTGSGGMFLAYCMIFGMSLMTAPSWRLMLGVLSIPSLIYFVLVV  180

Query  627  FYLPESPRWLVSKGRMVXAKRV  692
             YLPESPRWLVSKGRMV AK+V
Sbjct  181  LYLPESPRWLVSKGRMVEAKQV  202



>ref|XP_009796447.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
 ref|XP_009796448.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
 ref|XP_009796450.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
Length=738

 Score =   362 bits (930),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 180/202 (89%), Positives = 191/202 (95%), Gaps = 0/202 (0%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  266
            MNGAVLVA+AATIGNFLQGWDNATIAGAVVYIKKEL L+  +EGLVVAMSLIGATL+TTC
Sbjct  1    MNGAVLVALAATIGNFLQGWDNATIAGAVVYIKKELTLDASVEGLVVAMSLIGATLVTTC  60

Query  267  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  446
            SG I+D  GRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS
Sbjct  61   SGPISDSFGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  120

Query  447  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  626
            ETAPSEIRG LNTLPQFTGSGGMFLAYCMIFGMS+ T+PSWRLMLGVLS+PSL+YF LTV
Sbjct  121  ETAPSEIRGSLNTLPQFTGSGGMFLAYCMIFGMSLMTSPSWRLMLGVLSVPSLIYFVLTV  180

Query  627  FYLPESPRWLVSKGRMVXAKRV  692
             YLPESPRWLVSKGRM+ AK+V
Sbjct  181  LYLPESPRWLVSKGRMLEAKQV  202



>ref|XP_011100175.1| PREDICTED: monosaccharide-sensing protein 2-like [Sesamum indicum]
Length=740

 Score =   362 bits (929),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 180/202 (89%), Positives = 191/202 (95%), Gaps = 0/202 (0%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  266
            M GA LVAIAATIGNFLQGWDNATIAGAVVYIKKEL L   +EGL+VAMSLIGATLITTC
Sbjct  1    MKGAALVAIAATIGNFLQGWDNATIAGAVVYIKKELQLGAAIEGLIVAMSLIGATLITTC  60

Query  267  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  446
            SG+I+D +GRRPMLI SSMFYFLSGLIMLWSPNVYVLL+ARLLDGFGIGLAVTLVPLYIS
Sbjct  61   SGTISDLIGRRPMLISSSMFYFLSGLIMLWSPNVYVLLLARLLDGFGIGLAVTLVPLYIS  120

Query  447  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  626
            ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMS+  +PSWRLMLGVLS+PSLLYFALTV
Sbjct  121  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSLLPSPSWRLMLGVLSVPSLLYFALTV  180

Query  627  FYLPESPRWLVSKGRMVXAKRV  692
            FYLPESPRWLVSKG+M+ AKRV
Sbjct  181  FYLPESPRWLVSKGKMLEAKRV  202



>ref|XP_009595864.1| PREDICTED: monosaccharide-sensing protein 2 [Nicotiana tomentosiformis]
 ref|XP_009595865.1| PREDICTED: monosaccharide-sensing protein 2 [Nicotiana tomentosiformis]
 ref|XP_009595866.1| PREDICTED: monosaccharide-sensing protein 2 [Nicotiana tomentosiformis]
Length=738

 Score =   362 bits (929),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 179/202 (89%), Positives = 191/202 (95%), Gaps = 0/202 (0%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  266
            MNGAVLVA+AATIGNFLQGWDNATIAGAVVYIKKEL L+  +EGLVVAMSLIGATL+TTC
Sbjct  1    MNGAVLVALAATIGNFLQGWDNATIAGAVVYIKKELTLDASVEGLVVAMSLIGATLVTTC  60

Query  267  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  446
            SG+I+D  GRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS
Sbjct  61   SGTISDSFGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  120

Query  447  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  626
            ETAPSEIRG LNTLPQFTGS GMFLAYCMIFGMS+ T+PSWRLMLGVLS+PSL+YF LTV
Sbjct  121  ETAPSEIRGSLNTLPQFTGSSGMFLAYCMIFGMSLMTSPSWRLMLGVLSVPSLIYFVLTV  180

Query  627  FYLPESPRWLVSKGRMVXAKRV  692
             YLPESPRWLVSKGRM+ AK+V
Sbjct  181  LYLPESPRWLVSKGRMLEAKQV  202



>ref|XP_011074068.1| PREDICTED: monosaccharide-sensing protein 2-like [Sesamum indicum]
 ref|XP_011074069.1| PREDICTED: monosaccharide-sensing protein 2-like [Sesamum indicum]
Length=739

 Score =   361 bits (927),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 180/202 (89%), Positives = 192/202 (95%), Gaps = 0/202 (0%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  266
            MNGA LVAIAATIGNFLQGWDNATIAGAVVYIKKEL L   +EGL+VAMSLIGAT+ITTC
Sbjct  1    MNGAALVAIAATIGNFLQGWDNATIAGAVVYIKKELELGAAIEGLIVAMSLIGATVITTC  60

Query  267  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  446
            SG+I+DW+GRRPMLILSS+FYFLSGLIMLWSPNVYVLL+ARLLDGFGIGLAVTLVPLYIS
Sbjct  61   SGTISDWIGRRPMLILSSIFYFLSGLIMLWSPNVYVLLLARLLDGFGIGLAVTLVPLYIS  120

Query  447  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  626
            ETAPSEIRGLLNTLPQFTGS GMFLAYCMIFGMS+ +  SWRLMLGVLSIPSLLYFALTV
Sbjct  121  ETAPSEIRGLLNTLPQFTGSAGMFLAYCMIFGMSLGSLTSWRLMLGVLSIPSLLYFALTV  180

Query  627  FYLPESPRWLVSKGRMVXAKRV  692
            FYLPESPRWLVSKGRM+ AK+V
Sbjct  181  FYLPESPRWLVSKGRMLEAKQV  202



>ref|XP_007135975.1| hypothetical protein PHAVU_009G007600g [Phaseolus vulgaris]
 gb|ESW07969.1| hypothetical protein PHAVU_009G007600g [Phaseolus vulgaris]
Length=736

 Score =   359 bits (921),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 172/202 (85%), Positives = 192/202 (95%), Gaps = 0/202 (0%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  266
            M GAVLVAIAA+IGNFLQGWDNATIAGA+VYIKK+L L+T MEGLVVAMSLIGATLITTC
Sbjct  1    MKGAVLVAIAASIGNFLQGWDNATIAGAIVYIKKDLALQTTMEGLVVAMSLIGATLITTC  60

Query  267  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  446
            SG ++DWLGRRPMLI+SS+ YFL GL+MLWSPNVYVL +ARLLDGFGIGLAVTL+P+YIS
Sbjct  61   SGPVSDWLGRRPMLIISSLLYFLGGLVMLWSPNVYVLCLARLLDGFGIGLAVTLIPVYIS  120

Query  447  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  626
            ETAPSEIRG LNTLPQF+GSGGMFL+YCM+FGMS+T +PSWRLMLGVLSIPSLLYFALTV
Sbjct  121  ETAPSEIRGSLNTLPQFSGSGGMFLSYCMVFGMSLTPSPSWRLMLGVLSIPSLLYFALTV  180

Query  627  FYLPESPRWLVSKGRMVXAKRV  692
            F+LPESPRWLVSKGRM+ AK+V
Sbjct  181  FFLPESPRWLVSKGRMLEAKKV  202



>ref|XP_003527273.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Glycine 
max]
 ref|XP_006581130.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Glycine 
max]
Length=737

 Score =   359 bits (921),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 172/202 (85%), Positives = 192/202 (95%), Gaps = 0/202 (0%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  266
            M GAVLVAIAA+IGNFLQGWDNATIAGA+VYIKK+L LET MEGLVVAMSLIGAT+ITTC
Sbjct  1    MKGAVLVAIAASIGNFLQGWDNATIAGAIVYIKKDLALETTMEGLVVAMSLIGATVITTC  60

Query  267  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  446
            SG +ADWLGRRPM+I+SS+ YFL GL+MLWSPNVYVL +ARLLDGFGIGLAVTLVP+YIS
Sbjct  61   SGPVADWLGRRPMMIISSVLYFLGGLVMLWSPNVYVLCLARLLDGFGIGLAVTLVPVYIS  120

Query  447  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  626
            ETAPSEIRG LNTLPQF+GSGGMFL+YCM+FGMS++ APSWRLMLGVLSIPSLLYFALT+
Sbjct  121  ETAPSEIRGSLNTLPQFSGSGGMFLSYCMVFGMSLSPAPSWRLMLGVLSIPSLLYFALTI  180

Query  627  FYLPESPRWLVSKGRMVXAKRV  692
            F+LPESPRWLVSKGRM+ AK+V
Sbjct  181  FFLPESPRWLVSKGRMLEAKKV  202



>gb|KJB14182.1| hypothetical protein B456_002G113400 [Gossypium raimondii]
Length=548

 Score =   353 bits (906),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 170/202 (84%), Positives = 188/202 (93%), Gaps = 0/202 (0%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  266
            M GA  VAIAATIGNFLQGWDNATIAGA+VYIK +L L T +EGLVVAMSLIGAT ITTC
Sbjct  1    MRGAAFVAIAATIGNFLQGWDNATIAGAIVYIKNDLNLGTSVEGLVVAMSLIGATAITTC  60

Query  267  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  446
            SG+I+DW+GRRPMLI+SSM YF+SGL+MLWSPNVY+L +ARLLDGFGIGLAVTLVP+YIS
Sbjct  61   SGAISDWIGRRPMLIMSSMLYFVSGLVMLWSPNVYILCLARLLDGFGIGLAVTLVPVYIS  120

Query  447  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  626
            ETAPSEIRGLLNTLPQFTGSGGMFL+YCM+FGMS+  +PSWRLMLGVLSIPSLLYFA TV
Sbjct  121  ETAPSEIRGLLNTLPQFTGSGGMFLSYCMVFGMSLMDSPSWRLMLGVLSIPSLLYFAFTV  180

Query  627  FYLPESPRWLVSKGRMVXAKRV  692
            FYLPESPRWLVSKGRM+ AK+V
Sbjct  181  FYLPESPRWLVSKGRMLEAKQV  202



>gb|KJB14183.1| hypothetical protein B456_002G113400 [Gossypium raimondii]
Length=557

 Score =   353 bits (907),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 170/202 (84%), Positives = 188/202 (93%), Gaps = 0/202 (0%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  266
            M GA  VAIAATIGNFLQGWDNATIAGA+VYIK +L L T +EGLVVAMSLIGAT ITTC
Sbjct  1    MRGAAFVAIAATIGNFLQGWDNATIAGAIVYIKNDLNLGTSVEGLVVAMSLIGATAITTC  60

Query  267  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  446
            SG+I+DW+GRRPMLI+SSM YF+SGL+MLWSPNVY+L +ARLLDGFGIGLAVTLVP+YIS
Sbjct  61   SGAISDWIGRRPMLIMSSMLYFVSGLVMLWSPNVYILCLARLLDGFGIGLAVTLVPVYIS  120

Query  447  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  626
            ETAPSEIRGLLNTLPQFTGSGGMFL+YCM+FGMS+  +PSWRLMLGVLSIPSLLYFA TV
Sbjct  121  ETAPSEIRGLLNTLPQFTGSGGMFLSYCMVFGMSLMDSPSWRLMLGVLSIPSLLYFAFTV  180

Query  627  FYLPESPRWLVSKGRMVXAKRV  692
            FYLPESPRWLVSKGRM+ AK+V
Sbjct  181  FYLPESPRWLVSKGRMLEAKQV  202



>gb|KDO85211.1| hypothetical protein CISIN_1g004673mg [Citrus sinensis]
Length=592

 Score =   354 bits (909),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 172/202 (85%), Positives = 188/202 (93%), Gaps = 0/202 (0%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  266
            MNGA LVAIAATIGNFLQGWDNATIAGA+VYIKK+L L T +EGLVVAMSLIGAT ITTC
Sbjct  1    MNGAALVAIAATIGNFLQGWDNATIAGAIVYIKKDLNLGTTVEGLVVAMSLIGATAITTC  60

Query  267  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  446
            SG I+DWLGRRPMLILSS+ YF+SGL+MLWSPNVYVL IARLLDGFG+GLAVTLVPLYIS
Sbjct  61   SGPISDWLGRRPMLILSSVLYFVSGLVMLWSPNVYVLCIARLLDGFGVGLAVTLVPLYIS  120

Query  447  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  626
            ETAPSEIRG LNTLPQFTGSGGMFLAYCM+FGMS+  +PSWRLMLGVLSIP+LLYFA  V
Sbjct  121  ETAPSEIRGRLNTLPQFTGSGGMFLAYCMVFGMSLLASPSWRLMLGVLSIPALLYFAFAV  180

Query  627  FYLPESPRWLVSKGRMVXAKRV  692
            F+LPESPRWLVSKG+M+ AK+V
Sbjct  181  FFLPESPRWLVSKGKMLEAKQV  202



>gb|KDP36756.1| hypothetical protein JCGZ_08047 [Jatropha curcas]
Length=739

 Score =   358 bits (920),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 173/202 (86%), Positives = 193/202 (96%), Gaps = 0/202 (0%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  266
            MNGAVLVAIAA IG+FLQGWDNATIAGA+VYIK +L L+T +EGLVVAMSLIGAT ITTC
Sbjct  1    MNGAVLVAIAACIGSFLQGWDNATIAGAIVYIKDDLDLQTTVEGLVVAMSLIGATAITTC  60

Query  267  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  446
            SG+I+DWLGRRPMLI+SSM YF+SGLIM+WSPNVYVL IARLLDGF IGLAVTLVP+YIS
Sbjct  61   SGAISDWLGRRPMLIMSSMLYFVSGLIMIWSPNVYVLCIARLLDGFAIGLAVTLVPVYIS  120

Query  447  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  626
            ETAPS+IRG+LNTLPQFTGSGGMFL+YCM+FGMS+T++PSWRLMLGVLSIPSLLYFALT+
Sbjct  121  ETAPSDIRGMLNTLPQFTGSGGMFLSYCMVFGMSLTSSPSWRLMLGVLSIPSLLYFALTI  180

Query  627  FYLPESPRWLVSKGRMVXAKRV  692
            FYLPESPRWLVSKGRM+ AKRV
Sbjct  181  FYLPESPRWLVSKGRMLEAKRV  202



>gb|KHN33775.1| Monosaccharide-sensing protein 2 [Glycine soja]
Length=737

 Score =   358 bits (919),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 172/202 (85%), Positives = 192/202 (95%), Gaps = 0/202 (0%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  266
            M GAVLVAIAA+IGNFLQGWDNATIAGA+VYIKK+L L+T MEGLVVAMSLIGAT+ITTC
Sbjct  1    MKGAVLVAIAASIGNFLQGWDNATIAGAIVYIKKDLALQTTMEGLVVAMSLIGATVITTC  60

Query  267  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  446
            SG IADWLGRRPM+I+SS+ YFL GL+MLWSPNVYVL +ARLLDGFGIGLAVTLVP+YIS
Sbjct  61   SGPIADWLGRRPMMIISSVLYFLGGLVMLWSPNVYVLCLARLLDGFGIGLAVTLVPVYIS  120

Query  447  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  626
            ETAPSEIRG LNTLPQF+GSGGMFL+YCM+FGMS++ APSWRLMLGVLSIPSLLYFALT+
Sbjct  121  ETAPSEIRGSLNTLPQFSGSGGMFLSYCMVFGMSLSPAPSWRLMLGVLSIPSLLYFALTI  180

Query  627  FYLPESPRWLVSKGRMVXAKRV  692
            F+LPESPRWLVSKGRM+ AK+V
Sbjct  181  FFLPESPRWLVSKGRMLEAKKV  202



>ref|XP_006577928.1| PREDICTED: monosaccharide-sensing protein 2-like [Glycine max]
Length=738

 Score =   358 bits (919),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 172/202 (85%), Positives = 192/202 (95%), Gaps = 0/202 (0%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  266
            M GAVLVAIAA+IGNFLQGWDNATIAGA+VYIKK+L L+T MEGLVVAMSLIGAT+ITTC
Sbjct  1    MKGAVLVAIAASIGNFLQGWDNATIAGAIVYIKKDLALQTTMEGLVVAMSLIGATVITTC  60

Query  267  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  446
            SG IADWLGRRPM+I+SS+ YFL GL+MLWSPNVYVL +ARLLDGFGIGLAVTLVP+YIS
Sbjct  61   SGPIADWLGRRPMMIISSVLYFLGGLVMLWSPNVYVLCLARLLDGFGIGLAVTLVPVYIS  120

Query  447  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  626
            ETAPSEIRG LNTLPQF+GSGGMFL+YCM+FGMS++ APSWRLMLGVLSIPSLLYFALT+
Sbjct  121  ETAPSEIRGSLNTLPQFSGSGGMFLSYCMVFGMSLSPAPSWRLMLGVLSIPSLLYFALTI  180

Query  627  FYLPESPRWLVSKGRMVXAKRV  692
            F+LPESPRWLVSKGRM+ AK+V
Sbjct  181  FFLPESPRWLVSKGRMLEAKKV  202



>emb|CDP07261.1| unnamed protein product [Coffea canephora]
Length=737

 Score =   358 bits (918),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 175/202 (87%), Positives = 189/202 (94%), Gaps = 0/202 (0%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  266
            M GAV VA++AT+GNFLQGWDNATIAGAVVY+KKEL LE  +EGLVVAMSLIGATLITTC
Sbjct  1    MKGAVFVALSATVGNFLQGWDNATIAGAVVYMKKELDLEATVEGLVVAMSLIGATLITTC  60

Query  267  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  446
            SGSI+DW+GRRPMLILSS FYF SGL+MLWSPNVYVLL+ARLLDGFGIGLAVTL PLYIS
Sbjct  61   SGSISDWIGRRPMLILSSSFYFFSGLVMLWSPNVYVLLLARLLDGFGIGLAVTLTPLYIS  120

Query  447  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  626
            ETAPSEIRG LNTLPQF GS GMFLAYCMIFGMS+ T+P+WRLMLGVLSIPSL+YFALTV
Sbjct  121  ETAPSEIRGSLNTLPQFAGSAGMFLAYCMIFGMSLMTSPNWRLMLGVLSIPSLIYFALTV  180

Query  627  FYLPESPRWLVSKGRMVXAKRV  692
            FYLPESPRWLVSKGRM+ AKRV
Sbjct  181  FYLPESPRWLVSKGRMLEAKRV  202



>ref|XP_010094525.1| Monosaccharide-sensing protein 2 [Morus notabilis]
 gb|EXB56279.1| Monosaccharide-sensing protein 2 [Morus notabilis]
Length=739

 Score =   356 bits (914),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 171/202 (85%), Positives = 192/202 (95%), Gaps = 0/202 (0%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  266
            M GA LVAIAATIGNFLQGWDNATIAGA+VYIKK+LVLE+ +EGLVVAMSLIGAT ITTC
Sbjct  1    MKGAALVAIAATIGNFLQGWDNATIAGAIVYIKKDLVLESSVEGLVVAMSLIGATAITTC  60

Query  267  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  446
            SG+++DWLGRRPMLI+SS+ YF+SGL+MLWSPNVYVL IARLLDGFGIGLAVTLVP+YIS
Sbjct  61   SGAVSDWLGRRPMLIISSVLYFISGLVMLWSPNVYVLCIARLLDGFGIGLAVTLVPVYIS  120

Query  447  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  626
            ETAPS+IRGLLNTLPQFTGSGGMFL+YCM+FGMS+  +PSWRLMLGVLSIPSL+YF LTV
Sbjct  121  ETAPSDIRGLLNTLPQFTGSGGMFLSYCMVFGMSLLPSPSWRLMLGVLSIPSLIYFVLTV  180

Query  627  FYLPESPRWLVSKGRMVXAKRV  692
            FYLPESPRWLVSKG+M+ AK+V
Sbjct  181  FYLPESPRWLVSKGKMLEAKKV  202



>ref|XP_007018122.1| Tonoplast monosaccharide transporter2 isoform 4 [Theobroma cacao]
 gb|EOY15347.1| Tonoplast monosaccharide transporter2 isoform 4 [Theobroma cacao]
Length=740

 Score =   355 bits (912),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 172/202 (85%), Positives = 192/202 (95%), Gaps = 0/202 (0%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  266
            M GA LVAIAATIGNFLQGWDNATIAGA+VYIK++L L T +EGLVVAMSLIGAT+ITTC
Sbjct  1    MRGAALVAIAATIGNFLQGWDNATIAGAIVYIKEDLNLGTSVEGLVVAMSLIGATVITTC  60

Query  267  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  446
            SG+I+DWLGRRPMLI+SS+ YF+SGL+MLWSPNVYVL IARLLDGFGIGLAVTLVP+YIS
Sbjct  61   SGAISDWLGRRPMLIISSILYFVSGLVMLWSPNVYVLCIARLLDGFGIGLAVTLVPVYIS  120

Query  447  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  626
            ETAPSEIRGLLNTLPQFTGSGGMFL+YCM+FGMS+  +PSWRLMLG+LSIPSLLYFALTV
Sbjct  121  ETAPSEIRGLLNTLPQFTGSGGMFLSYCMVFGMSLMDSPSWRLMLGILSIPSLLYFALTV  180

Query  627  FYLPESPRWLVSKGRMVXAKRV  692
            FYLPESPRWLVSKG+M+ AK+V
Sbjct  181  FYLPESPRWLVSKGKMLEAKQV  202



>ref|XP_007018119.1| Tonoplast monosaccharide transporter2 isoform 1 [Theobroma cacao]
 ref|XP_007018120.1| Tonoplast monosaccharide transporter2 isoform 1 [Theobroma cacao]
 ref|XP_007018121.1| Tonoplast monosaccharide transporter2 isoform 1 [Theobroma cacao]
 gb|EOY15344.1| Tonoplast monosaccharide transporter2 isoform 1 [Theobroma cacao]
 gb|EOY15345.1| Tonoplast monosaccharide transporter2 isoform 1 [Theobroma cacao]
 gb|EOY15346.1| Tonoplast monosaccharide transporter2 isoform 1 [Theobroma cacao]
Length=739

 Score =   355 bits (912),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 172/202 (85%), Positives = 192/202 (95%), Gaps = 0/202 (0%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  266
            M GA LVAIAATIGNFLQGWDNATIAGA+VYIK++L L T +EGLVVAMSLIGAT+ITTC
Sbjct  1    MRGAALVAIAATIGNFLQGWDNATIAGAIVYIKEDLNLGTSVEGLVVAMSLIGATVITTC  60

Query  267  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  446
            SG+I+DWLGRRPMLI+SS+ YF+SGL+MLWSPNVYVL IARLLDGFGIGLAVTLVP+YIS
Sbjct  61   SGAISDWLGRRPMLIISSILYFVSGLVMLWSPNVYVLCIARLLDGFGIGLAVTLVPVYIS  120

Query  447  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  626
            ETAPSEIRGLLNTLPQFTGSGGMFL+YCM+FGMS+  +PSWRLMLG+LSIPSLLYFALTV
Sbjct  121  ETAPSEIRGLLNTLPQFTGSGGMFLSYCMVFGMSLMDSPSWRLMLGILSIPSLLYFALTV  180

Query  627  FYLPESPRWLVSKGRMVXAKRV  692
            FYLPESPRWLVSKG+M+ AK+V
Sbjct  181  FYLPESPRWLVSKGKMLEAKQV  202



>gb|KHG10189.1| Monosaccharide-sensing 2 -like protein [Gossypium arboreum]
Length=739

 Score =   354 bits (908),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 172/202 (85%), Positives = 189/202 (94%), Gaps = 0/202 (0%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  266
            M GA LVAIAATIGNFLQGWDNATIAGA+VYIK +L L T +EGLVVAMSLIGAT ITTC
Sbjct  1    MRGAALVAIAATIGNFLQGWDNATIAGAIVYIKNDLDLGTSVEGLVVAMSLIGATAITTC  60

Query  267  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  446
            SG+I+DWLGRRPMLI+SSM YF+SGL+MLWSPNVY+L +ARLLDGFGIGLAVTLVP+YIS
Sbjct  61   SGAISDWLGRRPMLIMSSMLYFVSGLVMLWSPNVYILCLARLLDGFGIGLAVTLVPVYIS  120

Query  447  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  626
            ETAPSEIRGLLNTLPQFTGSGGMFL+YCM+FGMS+  +PSWRLMLGVLSIPSLLYFA TV
Sbjct  121  ETAPSEIRGLLNTLPQFTGSGGMFLSYCMVFGMSLMDSPSWRLMLGVLSIPSLLYFAFTV  180

Query  627  FYLPESPRWLVSKGRMVXAKRV  692
            FYLPESPRWLVSKGRM+ AK+V
Sbjct  181  FYLPESPRWLVSKGRMLEAKQV  202



>gb|KDO85208.1| hypothetical protein CISIN_1g004673mg [Citrus sinensis]
Length=706

 Score =   353 bits (905),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 172/202 (85%), Positives = 188/202 (93%), Gaps = 0/202 (0%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  266
            MNGA LVAIAATIGNFLQGWDNATIAGA+VYIKK+L L T +EGLVVAMSLIGAT ITTC
Sbjct  1    MNGAALVAIAATIGNFLQGWDNATIAGAIVYIKKDLNLGTTVEGLVVAMSLIGATAITTC  60

Query  267  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  446
            SG I+DWLGRRPMLILSS+ YF+SGL+MLWSPNVYVL IARLLDGFG+GLAVTLVPLYIS
Sbjct  61   SGPISDWLGRRPMLILSSVLYFVSGLVMLWSPNVYVLCIARLLDGFGVGLAVTLVPLYIS  120

Query  447  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  626
            ETAPSEIRG LNTLPQFTGSGGMFLAYCM+FGMS+  +PSWRLMLGVLSIP+LLYFA  V
Sbjct  121  ETAPSEIRGRLNTLPQFTGSGGMFLAYCMVFGMSLLASPSWRLMLGVLSIPALLYFAFAV  180

Query  627  FYLPESPRWLVSKGRMVXAKRV  692
            F+LPESPRWLVSKG+M+ AK+V
Sbjct  181  FFLPESPRWLVSKGKMLEAKQV  202



>ref|XP_006435423.1| hypothetical protein CICLE_v10000400mg [Citrus clementina]
 ref|XP_006473839.1| PREDICTED: monosaccharide-sensing protein 2-like [Citrus sinensis]
 gb|ESR48663.1| hypothetical protein CICLE_v10000400mg [Citrus clementina]
 gb|KDO85209.1| hypothetical protein CISIN_1g004673mg [Citrus sinensis]
Length=738

 Score =   353 bits (906),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 172/202 (85%), Positives = 188/202 (93%), Gaps = 0/202 (0%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  266
            MNGA LVAIAATIGNFLQGWDNATIAGA+VYIKK+L L T +EGLVVAMSLIGAT ITTC
Sbjct  1    MNGAALVAIAATIGNFLQGWDNATIAGAIVYIKKDLNLGTTVEGLVVAMSLIGATAITTC  60

Query  267  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  446
            SG I+DWLGRRPMLILSS+ YF+SGL+MLWSPNVYVL IARLLDGFG+GLAVTLVPLYIS
Sbjct  61   SGPISDWLGRRPMLILSSVLYFVSGLVMLWSPNVYVLCIARLLDGFGVGLAVTLVPLYIS  120

Query  447  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  626
            ETAPSEIRG LNTLPQFTGSGGMFLAYCM+FGMS+  +PSWRLMLGVLSIP+LLYFA  V
Sbjct  121  ETAPSEIRGRLNTLPQFTGSGGMFLAYCMVFGMSLLASPSWRLMLGVLSIPALLYFAFAV  180

Query  627  FYLPESPRWLVSKGRMVXAKRV  692
            F+LPESPRWLVSKG+M+ AK+V
Sbjct  181  FFLPESPRWLVSKGKMLEAKQV  202



>ref|XP_002510716.1| sugar transporter, putative [Ricinus communis]
 gb|EEF52903.1| sugar transporter, putative [Ricinus communis]
Length=739

 Score =   353 bits (905),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 170/202 (84%), Positives = 191/202 (95%), Gaps = 0/202 (0%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  266
            M GAVLVAI A IG+FLQGWDNATIAGA+VYIKK+L L+T +EGLVVAMSLIGAT ITTC
Sbjct  1    MKGAVLVAITACIGSFLQGWDNATIAGAIVYIKKDLNLQTTVEGLVVAMSLIGATTITTC  60

Query  267  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  446
            SG+I+DWLGRRPMLI+SS  YF+SGLIMLWSP+VYVL IARLLDGF IGLAVTLVP+YIS
Sbjct  61   SGAISDWLGRRPMLIISSTLYFVSGLIMLWSPDVYVLCIARLLDGFAIGLAVTLVPVYIS  120

Query  447  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  626
            ETAPSEIRG+LNTLPQFTGSGGMFL+YCM+FGMS+T++PSWRLMLGVLSIPSL+YFALT+
Sbjct  121  ETAPSEIRGMLNTLPQFTGSGGMFLSYCMVFGMSLTSSPSWRLMLGVLSIPSLIYFALTI  180

Query  627  FYLPESPRWLVSKGRMVXAKRV  692
            FYLPESPRWLVSKG+M+ AKRV
Sbjct  181  FYLPESPRWLVSKGKMLEAKRV  202



>ref|XP_010061214.1| PREDICTED: monosaccharide-sensing protein 2-like [Eucalyptus 
grandis]
 gb|KCW68134.1| hypothetical protein EUGRSUZ_F01805 [Eucalyptus grandis]
Length=735

 Score =   352 bits (902),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 171/202 (85%), Positives = 191/202 (95%), Gaps = 0/202 (0%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  266
            M GAV VAIAATIGNFLQGWDNATIAGA++YIK++L L T +EGLVVAMSLIGAT+ITTC
Sbjct  1    MKGAVWVAIAATIGNFLQGWDNATIAGAIIYIKEDLDLGTTVEGLVVAMSLIGATVITTC  60

Query  267  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  446
            SG+I+DW+GRRPMLILSS+ YF+SGL+MLWSPNVYVL IARLLDGFGIGLAVTLVP+YIS
Sbjct  61   SGAISDWVGRRPMLILSSLLYFISGLVMLWSPNVYVLCIARLLDGFGIGLAVTLVPIYIS  120

Query  447  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  626
            ETAPSEIRGLLNTLPQFTGSGGMFL+YCMIFGMS+  +PSWRLMLGVLSIPS+LYF LTV
Sbjct  121  ETAPSEIRGLLNTLPQFTGSGGMFLSYCMIFGMSLLASPSWRLMLGVLSIPSILYFVLTV  180

Query  627  FYLPESPRWLVSKGRMVXAKRV  692
            FYLPESPRWLVSKG+M+ AK+V
Sbjct  181  FYLPESPRWLVSKGKMLEAKQV  202



>gb|KJB14177.1| hypothetical protein B456_002G113400 [Gossypium raimondii]
 gb|KJB14178.1| hypothetical protein B456_002G113400 [Gossypium raimondii]
 gb|KJB14179.1| hypothetical protein B456_002G113400 [Gossypium raimondii]
 gb|KJB14180.1| hypothetical protein B456_002G113400 [Gossypium raimondii]
 gb|KJB14181.1| hypothetical protein B456_002G113400 [Gossypium raimondii]
 gb|KJB14184.1| hypothetical protein B456_002G113400 [Gossypium raimondii]
Length=739

 Score =   352 bits (902),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 170/202 (84%), Positives = 188/202 (93%), Gaps = 0/202 (0%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  266
            M GA  VAIAATIGNFLQGWDNATIAGA+VYIK +L L T +EGLVVAMSLIGAT ITTC
Sbjct  1    MRGAAFVAIAATIGNFLQGWDNATIAGAIVYIKNDLNLGTSVEGLVVAMSLIGATAITTC  60

Query  267  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  446
            SG+I+DW+GRRPMLI+SSM YF+SGL+MLWSPNVY+L +ARLLDGFGIGLAVTLVP+YIS
Sbjct  61   SGAISDWIGRRPMLIMSSMLYFVSGLVMLWSPNVYILCLARLLDGFGIGLAVTLVPVYIS  120

Query  447  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  626
            ETAPSEIRGLLNTLPQFTGSGGMFL+YCM+FGMS+  +PSWRLMLGVLSIPSLLYFA TV
Sbjct  121  ETAPSEIRGLLNTLPQFTGSGGMFLSYCMVFGMSLMDSPSWRLMLGVLSIPSLLYFAFTV  180

Query  627  FYLPESPRWLVSKGRMVXAKRV  692
            FYLPESPRWLVSKGRM+ AK+V
Sbjct  181  FYLPESPRWLVSKGRMLEAKQV  202



>emb|CBI40753.3| unnamed protein product [Vitis vinifera]
Length=662

 Score =   348 bits (892),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 176/202 (87%), Positives = 195/202 (97%), Gaps = 0/202 (0%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  266
            MNGAVLVAIAA IGNFLQGWDNATIAGA+VYIKKEL LE+ +EGLVVAMSLIGATL+TTC
Sbjct  1    MNGAVLVAIAAAIGNFLQGWDNATIAGAIVYIKKELDLESTVEGLVVAMSLIGATLVTTC  60

Query  267  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  446
            SG+I+DW+GRRPMLI+SSM YF+SGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVP+YIS
Sbjct  61   SGAISDWIGRRPMLIVSSMLYFISGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPIYIS  120

Query  447  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  626
            ETAP++IRG LNTLPQFTGSGGMFL+YCM+FGMS+ ++PSWRLMLG+LSIPSLLYFALTV
Sbjct  121  ETAPADIRGSLNTLPQFTGSGGMFLSYCMVFGMSLLSSPSWRLMLGILSIPSLLYFALTV  180

Query  627  FYLPESPRWLVSKGRMVXAKRV  692
            FYLPESPRWLVSKGRMV AK+V
Sbjct  181  FYLPESPRWLVSKGRMVEAKKV  202



>dbj|BAK00015.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=236

 Score =   332 bits (852),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 164/204 (80%), Positives = 185/204 (91%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  260
            M+GA LVAIAA+IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGAT+IT
Sbjct  1    MSGAALVAIAASIGNLLQGWDNATIAGAVLYIKKEFQLENDPTVEGLIVAMSLIGATIIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG ++DW+GRRPMLILSS+ YFLSGLIMLWSPNVYVLL+ARL+DGFGIGLAVTLVPLY
Sbjct  61   TFSGPVSDWVGRRPMLILSSILYFLSGLIMLWSPNVYVLLLARLVDGFGIGLAVTLVPLY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAPSEIRG LNTLPQF+GSGGMFL+YCM+FGMS+  +P WR+MLGVLS+PSL +F L
Sbjct  121  ISETAPSEIRGRLNTLPQFSGSGGMFLSYCMVFGMSLLPSPDWRIMLGVLSVPSLFFFGL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            TVFYLPESPRWLVSKGRM  AK+V
Sbjct  181  TVFYLPESPRWLVSKGRMAEAKKV  204



>emb|CAN59780.1| hypothetical protein VITISV_024656 [Vitis vinifera]
Length=740

 Score =   348 bits (893),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 176/202 (87%), Positives = 195/202 (97%), Gaps = 0/202 (0%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  266
            MNGAVLVAIAA IGNFLQGWDNATIAGA+VYIKKEL LE+ +EGLVVAMSLIGATL+TTC
Sbjct  1    MNGAVLVAIAAAIGNFLQGWDNATIAGAIVYIKKELDLESTVEGLVVAMSLIGATLVTTC  60

Query  267  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  446
            SG+I+DW+GRRPMLI+SSM YF+SGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVP+YIS
Sbjct  61   SGAISDWIGRRPMLIVSSMLYFISGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPIYIS  120

Query  447  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  626
            ETAP++IRG LNTLPQFTGSGGMFL+YCM+FGMS+ ++PSWRLMLG+LSIPSLLYFALTV
Sbjct  121  ETAPADIRGSLNTLPQFTGSGGMFLSYCMVFGMSLLSSPSWRLMLGILSIPSLLYFALTV  180

Query  627  FYLPESPRWLVSKGRMVXAKRV  692
            FYLPESPRWLVSKGRMV AK+V
Sbjct  181  FYLPESPRWLVSKGRMVEAKKV  202



>ref|NP_001267873.1| hexose transporter-like [Vitis vinifera]
 gb|AAY40466.1| putative hexose transporter [Vitis vinifera]
 gb|ADP37147.1| putative tonoplastic monosaccharide transporter [Vitis vinifera]
Length=740

 Score =   348 bits (893),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 176/202 (87%), Positives = 195/202 (97%), Gaps = 0/202 (0%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  266
            MNGAVLVAIAA IGNFLQGWDNATIAGA+VYIKKEL LE+ +EGLVVAMSLIGATL+TTC
Sbjct  1    MNGAVLVAIAAAIGNFLQGWDNATIAGAIVYIKKELDLESTVEGLVVAMSLIGATLVTTC  60

Query  267  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  446
            SG+I+DW+GRRPMLI+SSM YF+SGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVP+YIS
Sbjct  61   SGAISDWIGRRPMLIVSSMLYFISGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPIYIS  120

Query  447  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  626
            ETAP++IRG LNTLPQFTGSGGMFL+YCM+FGMS+ ++PSWRLMLG+LSIPSLLYFALTV
Sbjct  121  ETAPADIRGSLNTLPQFTGSGGMFLSYCMVFGMSLLSSPSWRLMLGILSIPSLLYFALTV  180

Query  627  FYLPESPRWLVSKGRMVXAKRV  692
            FYLPESPRWLVSKGRMV AK+V
Sbjct  181  FYLPESPRWLVSKGRMVEAKKV  202



>gb|AAX47312.1| hexose transporter 6 [Vitis vinifera]
Length=740

 Score =   347 bits (890),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 175/202 (87%), Positives = 194/202 (96%), Gaps = 0/202 (0%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  266
            MNGAVLVAIAA IGNFLQGWDNATIAGA+VYIKKEL LE+ +EGLVVAMSLIGATL+TTC
Sbjct  1    MNGAVLVAIAAAIGNFLQGWDNATIAGAIVYIKKELDLESTVEGLVVAMSLIGATLVTTC  60

Query  267  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  446
            SG+I+DW+GRRPMLI+SSM YF+SGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVP+YIS
Sbjct  61   SGAISDWIGRRPMLIVSSMLYFISGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPIYIS  120

Query  447  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  626
            ETAP++IRG LNTLPQFTGSGGMFL+YCM+FGMS+ ++PSWRLMLG+LSIPSLLYF LTV
Sbjct  121  ETAPADIRGSLNTLPQFTGSGGMFLSYCMVFGMSLLSSPSWRLMLGILSIPSLLYFTLTV  180

Query  627  FYLPESPRWLVSKGRMVXAKRV  692
            FYLPESPRWLVSKGRMV AK+V
Sbjct  181  FYLPESPRWLVSKGRMVEAKKV  202



>ref|XP_002307812.1| hypothetical protein POPTR_0005s27680g [Populus trichocarpa]
 gb|EEE94808.1| hypothetical protein POPTR_0005s27680g [Populus trichocarpa]
Length=738

 Score =   346 bits (888),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 165/202 (82%), Positives = 185/202 (92%), Gaps = 0/202 (0%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  266
            M GA LVAIAA IGNFLQGWDNATIAGA++Y+ K+L L+  +EGLVVAMSLIGA  ITTC
Sbjct  1    MKGAALVAIAACIGNFLQGWDNATIAGAIIYVNKDLKLQASVEGLVVAMSLIGAAAITTC  60

Query  267  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  446
            SG I+DWLGRRPMLI+SS+ YF+SGL+M WSPNVYVL I RLLDGFGIGLAVTLVP+YIS
Sbjct  61   SGPISDWLGRRPMLIISSILYFVSGLVMFWSPNVYVLCIGRLLDGFGIGLAVTLVPVYIS  120

Query  447  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  626
            ETAPS+IRG+LNTLPQF GSGGMFL+YCMIFGMS+T +PSWRLMLG+LSIPSLLYFALTV
Sbjct  121  ETAPSDIRGMLNTLPQFAGSGGMFLSYCMIFGMSLTASPSWRLMLGILSIPSLLYFALTV  180

Query  627  FYLPESPRWLVSKGRMVXAKRV  692
            FYLPESPRWLVSKG+M+ AKRV
Sbjct  181  FYLPESPRWLVSKGKMLEAKRV  202



>ref|XP_011041174.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
Length=740

 Score =   346 bits (887),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 165/202 (82%), Positives = 185/202 (92%), Gaps = 0/202 (0%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  266
            M GA LVAIAA IGNFLQGWDNATIAGA++Y+ K+L L+  +EGLVVAMSLIGA  ITTC
Sbjct  1    MKGAALVAIAACIGNFLQGWDNATIAGAIIYVNKDLKLQASVEGLVVAMSLIGAAAITTC  60

Query  267  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  446
            SG I+DWLGRRPMLI+SS+ YF+SGL+M WSPNVYVL I RLLDGFGIGLAVTLVP+YIS
Sbjct  61   SGPISDWLGRRPMLIISSVLYFVSGLVMFWSPNVYVLCIGRLLDGFGIGLAVTLVPVYIS  120

Query  447  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  626
            ETAPS+IRG+LNTLPQF GSGGMFL+YCMIFGMS+T +PSWRLMLG+LSIPSLLYFALTV
Sbjct  121  ETAPSDIRGMLNTLPQFAGSGGMFLSYCMIFGMSLTASPSWRLMLGILSIPSLLYFALTV  180

Query  627  FYLPESPRWLVSKGRMVXAKRV  692
            FYLPESPRWLVSKG+M+ AKRV
Sbjct  181  FYLPESPRWLVSKGKMLEAKRV  202



>ref|XP_011034826.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
 ref|XP_011034827.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
 ref|XP_011034828.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
 ref|XP_011034829.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
Length=738

 Score =   345 bits (886),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 163/202 (81%), Positives = 187/202 (93%), Gaps = 0/202 (0%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  266
            M GA LVAIAA +GNFLQGWDNATIAGAV+Y+KK+L L++ +EGLVVAMSLIGA  ITTC
Sbjct  1    MKGASLVAIAACVGNFLQGWDNATIAGAVIYVKKDLKLQSSVEGLVVAMSLIGAAAITTC  60

Query  267  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  446
            SGSI+DW+GRRPMLI SS+ YF+SGL+M WSPNVYVL I RLLDGFG+GLAVTLVPLYIS
Sbjct  61   SGSISDWIGRRPMLISSSILYFVSGLVMFWSPNVYVLCIGRLLDGFGVGLAVTLVPLYIS  120

Query  447  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  626
            ETAPS+IRG+LNTLPQF GSGGMFL+YCM+FGMS+TT+PSWR+MLG+LSIPSLLYF LTV
Sbjct  121  ETAPSDIRGMLNTLPQFAGSGGMFLSYCMVFGMSLTTSPSWRMMLGILSIPSLLYFVLTV  180

Query  627  FYLPESPRWLVSKGRMVXAKRV  692
            FYLPESPRWLVSKG+M+ AK+V
Sbjct  181  FYLPESPRWLVSKGKMLEAKQV  202



>gb|AIQ77649.1| tonoplastic transporter 1 [Vitis vinifera]
Length=740

 Score =   345 bits (885),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 175/202 (87%), Positives = 194/202 (96%), Gaps = 0/202 (0%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  266
            MNGAVLVAIAA IGNFLQGW NATIAGA+VYIKKEL LE+ +EGLVVAMSLIGATL+TTC
Sbjct  1    MNGAVLVAIAAAIGNFLQGWGNATIAGAIVYIKKELDLESTVEGLVVAMSLIGATLVTTC  60

Query  267  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  446
            SG+I+DW+GRRPMLI+SSM YF+SGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVP+YIS
Sbjct  61   SGAISDWIGRRPMLIVSSMLYFISGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPIYIS  120

Query  447  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  626
            ETAP++IRG LNTLPQFTGSGGMFL+YCM+FGMS+ ++PSWRLMLG+LSIPSLLYFALTV
Sbjct  121  ETAPADIRGSLNTLPQFTGSGGMFLSYCMVFGMSLLSSPSWRLMLGILSIPSLLYFALTV  180

Query  627  FYLPESPRWLVSKGRMVXAKRV  692
            FYLPESPRWLVSKGRMV AK+V
Sbjct  181  FYLPESPRWLVSKGRMVKAKKV  202



>gb|EYU43534.1| hypothetical protein MIMGU_mgv1a001953mg [Erythranthe guttata]
Length=734

 Score =   345 bits (884),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 179/202 (89%), Positives = 191/202 (95%), Gaps = 0/202 (0%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  266
            MNGA L+AIAATIGNFLQGWDNATIAGAVVYIKKEL L   +EGL+VAMSLIGATLITTC
Sbjct  1    MNGAALIAIAATIGNFLQGWDNATIAGAVVYIKKELELGAAIEGLIVAMSLIGATLITTC  60

Query  267  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  446
            SG+I+D +GRRPMLI SSMFYFLSGLIMLWSPNVYVLL+ARLLDGFGIGLAVTLVPLYIS
Sbjct  61   SGTISDSIGRRPMLIASSMFYFLSGLIMLWSPNVYVLLLARLLDGFGIGLAVTLVPLYIS  120

Query  447  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  626
            ETAPSEIRGLLNTLPQFTGSGGMFLAYCM+F MS+  +PSWRLMLGVLSIPSLLYFALTV
Sbjct  121  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMVFSMSLAASPSWRLMLGVLSIPSLLYFALTV  180

Query  627  FYLPESPRWLVSKGRMVXAKRV  692
            FYLPESPRWLVSKG+M+ AKRV
Sbjct  181  FYLPESPRWLVSKGKMLEAKRV  202



>ref|XP_002300629.1| hypothetical protein POPTR_0002s00760g [Populus trichocarpa]
 gb|EEE79902.1| hypothetical protein POPTR_0002s00760g [Populus trichocarpa]
Length=738

 Score =   343 bits (881),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 161/202 (80%), Positives = 186/202 (92%), Gaps = 0/202 (0%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  266
            M GA LVAIAA +GNFLQGWDNATIAGAV+Y+KK+L L++ +EGLVVAMSLIGA  ITTC
Sbjct  1    MKGASLVAIAACVGNFLQGWDNATIAGAVIYVKKDLKLQSSVEGLVVAMSLIGAAAITTC  60

Query  267  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  446
            SG I+DW+GRRPMLI SS+ YF+SGL+M WSPNVYVL I RLLDGFG+GLAVTL+PLYIS
Sbjct  61   SGPISDWIGRRPMLISSSILYFVSGLVMFWSPNVYVLCIGRLLDGFGVGLAVTLIPLYIS  120

Query  447  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  626
            ETAPS+IRG+LNTLPQF GSGGMFL+YCM+FGMS+TT+PSWR+MLG+LSIPSLLYF LTV
Sbjct  121  ETAPSDIRGMLNTLPQFAGSGGMFLSYCMVFGMSLTTSPSWRMMLGILSIPSLLYFVLTV  180

Query  627  FYLPESPRWLVSKGRMVXAKRV  692
            FYLPESPRWLVSKG+M+ AK+V
Sbjct  181  FYLPESPRWLVSKGKMLEAKQV  202



>emb|CBI21577.3| unnamed protein product [Vitis vinifera]
Length=627

 Score =   340 bits (872),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 170/204 (83%), Positives = 186/204 (91%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            MNGAVLVAI A IGN LQGWDNATIAGAV+YIK+E  L+T   +EGL+VAMSLIGAT IT
Sbjct  1    MNGAVLVAITAAIGNLLQGWDNATIAGAVLYIKREFHLQTEPTIEGLIVAMSLIGATAIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG +ADWLGRRPMLI+SS+ YFLSGL+MLWSPNVYVLL+ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TFSGPVADWLGRRPMLIISSVLYFLSGLVMLWSPNVYVLLLARLLDGFGIGLAVTLVPVY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAPSEIRGLLNTLPQFTGSGGMFL+YCM+F MS+  +P WRLMLGVLSIPSLLYFAL
Sbjct  121  ISETAPSEIRGLLNTLPQFTGSGGMFLSYCMVFWMSLMDSPKWRLMLGVLSIPSLLYFAL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            TVFYLPESPRWLVSKGRM  AK+V
Sbjct  181  TVFYLPESPRWLVSKGRMAEAKQV  204



>ref|XP_004500833.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Cicer 
arietinum]
 ref|XP_004500834.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Cicer 
arietinum]
Length=736

 Score =   342 bits (878),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 162/202 (80%), Positives = 186/202 (92%), Gaps = 0/202 (0%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  266
            M GAV VAI A+IGNFLQGWDNATIAGA++YIKK+L L T MEGLVVAMSLIGAT+ITTC
Sbjct  1    MKGAVFVAIVASIGNFLQGWDNATIAGAILYIKKDLALHTTMEGLVVAMSLIGATVITTC  60

Query  267  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  446
            SG I+DWLGRRPM+I+SS+ YFL  L+MLWSPNVYVL +ARLLDGFGIGLAVTLVP+YIS
Sbjct  61   SGPISDWLGRRPMMIISSVLYFLGSLVMLWSPNVYVLCLARLLDGFGIGLAVTLVPVYIS  120

Query  447  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  626
            ETAPS+IRG LNTLPQF+GSGGMFL+YCM+FGMS+T +PSWR+MLG+LSIPSL YF LTV
Sbjct  121  ETAPSDIRGSLNTLPQFSGSGGMFLSYCMVFGMSLTVSPSWRVMLGILSIPSLFYFILTV  180

Query  627  FYLPESPRWLVSKGRMVXAKRV  692
            F+LPESPRWLVSKG+M+ AK+V
Sbjct  181  FFLPESPRWLVSKGKMLEAKKV  202



>ref|XP_009397963.1| PREDICTED: monosaccharide-sensing protein 2-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009397964.1| PREDICTED: monosaccharide-sensing protein 2-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009397965.1| PREDICTED: monosaccharide-sensing protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=738

 Score =   342 bits (877),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 188/204 (92%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M GA LVAI A+IGN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGAT+IT
Sbjct  1    MQGAALVAIVASIGNLLQGWDNATIAGAVLYIKKEFKLESEPTIEGLIVAMSLIGATIIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG+++DW+GRRPMLI+SS+ YFLSGL+MLWSPNVYVLL+ARL+DGFGIGLAVTLVP+Y
Sbjct  61   TFSGAVSDWVGRRPMLIISSVLYFLSGLVMLWSPNVYVLLLARLIDGFGIGLAVTLVPVY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAPSEIRGLLNTLPQF+GSGGMFL+YCM+FGMS+   P WR+MLGVLSIPSLLYFAL
Sbjct  121  ISETAPSEIRGLLNTLPQFSGSGGMFLSYCMVFGMSLMDNPHWRVMLGVLSIPSLLYFAL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            TVF+LPESPRWLVSKGRMV AKRV
Sbjct  181  TVFFLPESPRWLVSKGRMVEAKRV  204



>gb|AAP54842.2| hexose transporter, putative, expressed [Oryza sativa Japonica 
Group]
Length=445

 Score =   332 bits (851),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 161/204 (79%), Positives = 186/204 (91%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M GAVLVAIAA+IGN LQGWDNATIAGAV+YIKKE  L++   +EGL+VAMSLIGAT+IT
Sbjct  1    MAGAVLVAIAASIGNLLQGWDNATIAGAVLYIKKEFNLQSEPLIEGLIVAMSLIGATIIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG++AD  GRRPMLI S++ YF+SGL+MLW+PNVYVLL+ARL+DGFGIGLAVTLVPLY
Sbjct  61   TFSGAVADSFGRRPMLIASAVLYFVSGLVMLWAPNVYVLLLARLIDGFGIGLAVTLVPLY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP++IRGLLNTLPQF+GSGGMFL+YCM+FGMS+   P WR+MLGVLSIPSL+YFAL
Sbjct  121  ISETAPTDIRGLLNTLPQFSGSGGMFLSYCMVFGMSLMPQPDWRIMLGVLSIPSLIYFAL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            T+FYLPESPRWLVSKGRM  AKRV
Sbjct  181  TIFYLPESPRWLVSKGRMAEAKRV  204



>ref|XP_002276373.1| PREDICTED: monosaccharide-sensing protein 2 [Vitis vinifera]
 gb|ADP37149.1| putative tonoplastic monosaccharide transporter [Vitis vinifera]
Length=742

 Score =   341 bits (874),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 170/204 (83%), Positives = 186/204 (91%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            MNGAVLVAI A IGN LQGWDNATIAGAV+YIK+E  L+T   +EGL+VAMSLIGAT IT
Sbjct  1    MNGAVLVAITAAIGNLLQGWDNATIAGAVLYIKREFHLQTEPTIEGLIVAMSLIGATAIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG +ADWLGRRPMLI+SS+ YFLSGL+MLWSPNVYVLL+ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TFSGPVADWLGRRPMLIISSVLYFLSGLVMLWSPNVYVLLLARLLDGFGIGLAVTLVPVY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAPSEIRGLLNTLPQFTGSGGMFL+YCM+F MS+  +P WRLMLGVLSIPSLLYFAL
Sbjct  121  ISETAPSEIRGLLNTLPQFTGSGGMFLSYCMVFWMSLMDSPKWRLMLGVLSIPSLLYFAL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            TVFYLPESPRWLVSKGRM  AK+V
Sbjct  181  TVFYLPESPRWLVSKGRMAEAKQV  204



>ref|XP_008351570.1| PREDICTED: monosaccharide-sensing protein 2-like [Malus domestica]
Length=216

 Score =   323 bits (829),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 164/204 (80%), Positives = 190/204 (93%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M+GAVLVA+AA IGN LQGWDNATIA +V+YIK+E  LE+   +EGL+VAMSLIGAT++T
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAASVLYIKREFNLESEPAVEGLIVAMSLIGATVVT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
             CSG++ADWLGRRPMLI+SS+FYFLSG++MLWSPNVY+LL+ARLLDGFGIGLAVTLVPLY
Sbjct  61   FCSGAVADWLGRRPMLIISSVFYFLSGIVMLWSPNVYILLLARLLDGFGIGLAVTLVPLY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRG LNTLPQFTGSGGMFL+YCM+FGMS+T +PSWRLMLGVLSIPSL+YF L
Sbjct  121  ISETAPPEIRGSLNTLPQFTGSGGMFLSYCMVFGMSLTESPSWRLMLGVLSIPSLVYFVL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            TVF+LPESPRWLVSKGRM+ AK+V
Sbjct  181  TVFFLPESPRWLVSKGRMLEAKQV  204



>ref|XP_004300112.1| PREDICTED: monosaccharide-sensing protein 2 [Fragaria vesca subsp. 
vesca]
 ref|XP_011465026.1| PREDICTED: monosaccharide-sensing protein 2 [Fragaria vesca subsp. 
vesca]
Length=738

 Score =   340 bits (873),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 164/202 (81%), Positives = 185/202 (92%), Gaps = 0/202 (0%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  266
            M GAV VAIAATIGNFLQGWDNATIAGA+VYI  +  L++ +EGLVVAMSLIGAT+ITTC
Sbjct  1    MKGAVFVAIAATIGNFLQGWDNATIAGAIVYITDDFALDSSVEGLVVAMSLIGATVITTC  60

Query  267  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  446
            SG+++DWLGRRPMLI SS+ YF+SGL+MLWSPNVYVL IARLLDGFGIGLAVTLVP+YIS
Sbjct  61   SGAVSDWLGRRPMLITSSVLYFVSGLVMLWSPNVYVLCIARLLDGFGIGLAVTLVPVYIS  120

Query  447  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  626
            ETAPS+IRG LNTLPQF GSGGMFL+YCM+FGMS+  +PSWRLMLGVLSI SL+YF LTV
Sbjct  121  ETAPSDIRGSLNTLPQFLGSGGMFLSYCMVFGMSLLASPSWRLMLGVLSILSLIYFVLTV  180

Query  627  FYLPESPRWLVSKGRMVXAKRV  692
            FYLPESPRWLVSKGRM+ AK+V
Sbjct  181  FYLPESPRWLVSKGRMLEAKKV  202



>ref|XP_003603868.1| Monosaccharide-sensing protein [Medicago truncatula]
 gb|AES74119.1| tonoplast monosaccharide transporter 2 [Medicago truncatula]
Length=730

 Score =   340 bits (872),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 162/202 (80%), Positives = 188/202 (93%), Gaps = 0/202 (0%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  266
            M GAVLVAIAA+IGNFLQGWDNATIAG+++YIKK+L L+T MEGLVVAMSLIGAT+ITTC
Sbjct  1    MKGAVLVAIAASIGNFLQGWDNATIAGSILYIKKDLALQTTMEGLVVAMSLIGATVITTC  60

Query  267  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  446
            SG I+DWLGRRPM+I+SS+ YFL  L+MLWSPNVYVL +ARLLDGFGIGLAVTLVP+YIS
Sbjct  61   SGPISDWLGRRPMMIISSVLYFLGSLVMLWSPNVYVLCLARLLDGFGIGLAVTLVPVYIS  120

Query  447  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  626
            ETAPS+IRG LNTLPQF+GSGGMFL+YCM+F MS++ +PSWR+MLGVLSIPSL YF LTV
Sbjct  121  ETAPSDIRGSLNTLPQFSGSGGMFLSYCMVFVMSLSPSPSWRIMLGVLSIPSLFYFLLTV  180

Query  627  FYLPESPRWLVSKGRMVXAKRV  692
            F+LPESPRWLVSKG+M+ AK+V
Sbjct  181  FFLPESPRWLVSKGKMLEAKKV  202



>ref|XP_010909820.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
 ref|XP_010909821.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
 ref|XP_010909822.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
 ref|XP_010909823.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
 ref|XP_010909824.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
 ref|XP_010909825.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
 ref|XP_010909826.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
 ref|XP_010909827.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
 ref|XP_010909828.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
 ref|XP_010909829.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
Length=747

 Score =   340 bits (873),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 165/203 (81%), Positives = 189/203 (93%), Gaps = 2/203 (1%)
 Frame = +3

Query  90   NGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLITT  263
             GAVLVAIAA+IGN LQGWDNATIAGAV+YIKKE  LET   +EGL+VAMSLIGAT+ITT
Sbjct  3    RGAVLVAIAASIGNLLQGWDNATIAGAVLYIKKEFKLETEPTVEGLIVAMSLIGATIITT  62

Query  264  CSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYI  443
             SG+++DW+GRRP+LILSS+ YFLSGL+MLWSPNV++LL+ARL+DGFGIGLAVTLVPLYI
Sbjct  63   FSGAVSDWIGRRPILILSSVLYFLSGLVMLWSPNVHILLLARLIDGFGIGLAVTLVPLYI  122

Query  444  SETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALT  623
            SETAP EIRGLLNTLPQF+GSGGMFL+YCM+FGMS+ + P WRLMLGVLSIPSL+YFALT
Sbjct  123  SETAPPEIRGLLNTLPQFSGSGGMFLSYCMVFGMSLMSNPDWRLMLGVLSIPSLVYFALT  182

Query  624  VFYLPESPRWLVSKGRMVXAKRV  692
            +FYLPESPRWLVSKGRMV AK+V
Sbjct  183  IFYLPESPRWLVSKGRMVEAKKV  205



>gb|EAY85098.1| hypothetical protein OsI_06450 [Oryza sativa Indica Group]
Length=689

 Score =   338 bits (868),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 169/229 (74%), Positives = 197/229 (86%), Gaps = 3/229 (1%)
 Frame = +3

Query  15   GTTDLSFTGACSSY*L-ELDSGLLRMNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKE  191
            G+   SF+   S + L   D   ++M+GA LVAIAA+IGN LQGWDNATIAGAV+YIKKE
Sbjct  5    GSGSCSFSSPLSPFVLTRRDRRGVKMSGAALVAIAASIGNLLQGWDNATIAGAVLYIKKE  64

Query  192  LVLETY--MEGLVVAMSLIGATLITTCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPN  365
              LE+   +EGL+VAMSLIGAT+ITT SG ++DW+GRRPMLILSS+ YFLS LIMLWSPN
Sbjct  65   FKLESEPTVEGLIVAMSLIGATIITTFSGPVSDWIGRRPMLILSSILYFLSSLIMLWSPN  124

Query  366  VYVLLIARLLDGFGIGLAVTLVPLYISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGM  545
            VYVLL+ARL+DGFGIGLAVTLVPLYISETAPSEIRGLLNTLPQF+GSGGMFL+YCM+FGM
Sbjct  125  VYVLLLARLIDGFGIGLAVTLVPLYISETAPSEIRGLLNTLPQFSGSGGMFLSYCMVFGM  184

Query  546  SVTTAPSWRLMLGVLSIPSLLYFALTVFYLPESPRWLVSKGRMVXAKRV  692
            S+  +P WR+MLGVL+IPSL +F LT+FYLPESPRWLVSKGRM  AK+V
Sbjct  185  SLLPSPDWRIMLGVLAIPSLFFFGLTIFYLPESPRWLVSKGRMAEAKKV  233



>ref|XP_008373385.1| PREDICTED: monosaccharide-sensing protein 2-like [Malus domestica]
Length=739

 Score =   338 bits (867),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 164/201 (82%), Positives = 184/201 (92%), Gaps = 0/201 (0%)
 Frame = +3

Query  90   NGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTCS  269
             GAVLVAIAATIGN LQGWDNATIAGA+VYI KE  L + +EGLVVAMSLIGAT+ITTCS
Sbjct  3    KGAVLVAIAATIGNLLQGWDNATIAGAIVYITKEFDLGSSLEGLVVAMSLIGATIITTCS  62

Query  270  GSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYISE  449
            G+I+DW+GRRPMLI SS+FYF+SGL+M+WSPNVYVL IARLLDGFGIGLAVTL+PLYISE
Sbjct  63   GAISDWIGRRPMLIASSVFYFVSGLVMVWSPNVYVLCIARLLDGFGIGLAVTLIPLYISE  122

Query  450  TAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTVF  629
            TAP +IRG LNTLPQF GSGG+FL+YCM+FGMS+  +PSWRLMLGVLSIPSL+YF LTVF
Sbjct  123  TAPPDIRGSLNTLPQFLGSGGLFLSYCMVFGMSLMDSPSWRLMLGVLSIPSLIYFGLTVF  182

Query  630  YLPESPRWLVSKGRMVXAKRV  692
            YLPESPRWLVSKGRM+ AK V
Sbjct  183  YLPESPRWLVSKGRMLEAKIV  203



>gb|EAZ22316.1| hypothetical protein OsJ_05971 [Oryza sativa Japonica Group]
Length=775

 Score =   339 bits (869),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 169/229 (74%), Positives = 197/229 (86%), Gaps = 3/229 (1%)
 Frame = +3

Query  15   GTTDLSFTGACSSY*L-ELDSGLLRMNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKE  191
            G+   SF+   S + L   D   ++M+GA LVAIAA+IGN LQGWDNATIAGAV+YIKKE
Sbjct  5    GSGSCSFSSPLSPFVLTRRDRRGVKMSGAALVAIAASIGNLLQGWDNATIAGAVLYIKKE  64

Query  192  LVLETY--MEGLVVAMSLIGATLITTCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPN  365
              LE+   +EGL+VAMSLIGAT+ITT SG ++DW+GRRPMLILSS+ YFLS LIMLWSPN
Sbjct  65   FKLESEPTVEGLIVAMSLIGATIITTFSGPVSDWIGRRPMLILSSILYFLSSLIMLWSPN  124

Query  366  VYVLLIARLLDGFGIGLAVTLVPLYISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGM  545
            VYVLL+ARL+DGFGIGLAVTLVPLYISETAPSEIRGLLNTLPQF+GSGGMFL+YCM+FGM
Sbjct  125  VYVLLLARLIDGFGIGLAVTLVPLYISETAPSEIRGLLNTLPQFSGSGGMFLSYCMVFGM  184

Query  546  SVTTAPSWRLMLGVLSIPSLLYFALTVFYLPESPRWLVSKGRMVXAKRV  692
            S+  +P WR+MLGVL+IPSL +F LT+FYLPESPRWLVSKGRM  AK+V
Sbjct  185  SLLPSPDWRIMLGVLAIPSLFFFGLTIFYLPESPRWLVSKGRMAEAKKV  233



>emb|CDY31497.1| BnaC05g16060D [Brassica napus]
Length=632

 Score =   334 bits (857),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 163/202 (81%), Positives = 181/202 (90%), Gaps = 0/202 (0%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  266
            M GA LVA+AATIGNFLQGWDNATIAGA+VYI K++ L T ++GLVVAMSLIGAT+ITTC
Sbjct  1    MKGATLVALAATIGNFLQGWDNATIAGAMVYINKDMNLATSVQGLVVAMSLIGATVITTC  60

Query  267  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  446
            SG I+DWLGRRPMLIL+S+ YFLSGLIMLWSPNVYVL +ARLLDGFG GLAVTLVP+YIS
Sbjct  61   SGPISDWLGRRPMLILASVMYFLSGLIMLWSPNVYVLCLARLLDGFGAGLAVTLVPVYIS  120

Query  447  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  626
            ETAP EIRG LNTLPQF GSGGMFL+YCM+F MS++ APSWR MLGVLSIPSL+Y   TV
Sbjct  121  ETAPPEIRGQLNTLPQFLGSGGMFLSYCMVFTMSLSDAPSWRAMLGVLSIPSLVYLLFTV  180

Query  627  FYLPESPRWLVSKGRMVXAKRV  692
            FYLPESPRWLVSKGRM  AK+V
Sbjct  181  FYLPESPRWLVSKGRMDEAKKV  202



>ref|XP_010537220.1| PREDICTED: monosaccharide-sensing protein 1-like [Tarenaya hassleriana]
 ref|XP_010537221.1| PREDICTED: monosaccharide-sensing protein 1-like [Tarenaya hassleriana]
 ref|XP_010537222.1| PREDICTED: monosaccharide-sensing protein 1-like [Tarenaya hassleriana]
Length=735

 Score =   337 bits (865),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 162/202 (80%), Positives = 182/202 (90%), Gaps = 0/202 (0%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  266
            M GA LVA+AATIGNFLQGWDNATIAGA+VYIK ++ L T ++GLVVAMSLIGAT ITTC
Sbjct  1    MKGAALVALAATIGNFLQGWDNATIAGAMVYIKNDMNLATSVQGLVVAMSLIGATAITTC  60

Query  267  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  446
            SG I+DWLGRRPMLI SS+ YF+SGLIM+WSPNVYVL +ARLLDGFGIGLAVTLVPLYIS
Sbjct  61   SGPISDWLGRRPMLIFSSILYFISGLIMVWSPNVYVLCLARLLDGFGIGLAVTLVPLYIS  120

Query  447  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  626
            ETAP EIRG LNTLPQF GSGGMFL+YCM+FGMS++ +PSWR MLGVLS+PSLLY A  +
Sbjct  121  ETAPPEIRGQLNTLPQFMGSGGMFLSYCMVFGMSLSASPSWRGMLGVLSVPSLLYLAFAM  180

Query  627  FYLPESPRWLVSKGRMVXAKRV  692
            FYLPESPRWLVSKG+MV AK+V
Sbjct  181  FYLPESPRWLVSKGKMVEAKKV  202



>ref|XP_009372620.1| PREDICTED: monosaccharide-sensing protein 2 [Pyrus x bretschneideri]
Length=739

 Score =   337 bits (863),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 163/201 (81%), Positives = 183/201 (91%), Gaps = 0/201 (0%)
 Frame = +3

Query  90   NGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTCS  269
             GAVLVA+AATIGN LQGWDNATIAGA+VYI ++  L + +EGLVVAMSLIGAT ITTCS
Sbjct  3    KGAVLVAVAATIGNLLQGWDNATIAGAIVYITEDFSLGSSLEGLVVAMSLIGATFITTCS  62

Query  270  GSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYISE  449
            G+I+DW+GRRPMLI SS+FYF+SGL+M+WSPNVYVL IARLLDGFGIGLAVTLVPLYISE
Sbjct  63   GAISDWIGRRPMLIASSVFYFVSGLVMVWSPNVYVLCIARLLDGFGIGLAVTLVPLYISE  122

Query  450  TAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTVF  629
            TAP +IRG LNTLPQF GSGGMFL+YCM+FGMS+  +PSWRLMLGVLSIPSL+YF LTVF
Sbjct  123  TAPPDIRGSLNTLPQFLGSGGMFLSYCMVFGMSLMDSPSWRLMLGVLSIPSLIYFGLTVF  182

Query  630  YLPESPRWLVSKGRMVXAKRV  692
            YLPESPRWLVSKGRM+ AK V
Sbjct  183  YLPESPRWLVSKGRMLEAKIV  203



>gb|EMS49950.1| Monosaccharide-sensing protein 2 [Triticum urartu]
Length=686

 Score =   335 bits (859),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 164/204 (80%), Positives = 185/204 (91%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M+GA LVAIAA+IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGAT+IT
Sbjct  1    MSGAALVAIAASIGNLLQGWDNATIAGAVLYIKKEFQLENNPTVEGLIVAMSLIGATIIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG ++DW+GRRPMLILSS+ YFLSGLIMLWSPNVYVLL+ARL+DGFGIGLAVTLVPLY
Sbjct  61   TFSGPVSDWVGRRPMLILSSLLYFLSGLIMLWSPNVYVLLLARLVDGFGIGLAVTLVPLY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAPSEIRG LNTLPQF+GSGGMFL+YCM+FGMS+  +P WR+MLGVLS+PSL +F L
Sbjct  121  ISETAPSEIRGRLNTLPQFSGSGGMFLSYCMVFGMSLLPSPDWRIMLGVLSVPSLFFFIL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            TVFYLPESPRWLVSKGRM  AK+V
Sbjct  181  TVFYLPESPRWLVSKGRMAEAKKV  204



>ref|XP_006416357.1| hypothetical protein EUTSA_v10006916mg [Eutrema salsugineum]
 ref|XP_006416358.1| hypothetical protein EUTSA_v10006916mg [Eutrema salsugineum]
 gb|ESQ34710.1| hypothetical protein EUTSA_v10006916mg [Eutrema salsugineum]
 gb|ESQ34711.1| hypothetical protein EUTSA_v10006916mg [Eutrema salsugineum]
Length=733

 Score =   336 bits (861),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 165/202 (82%), Positives = 181/202 (90%), Gaps = 0/202 (0%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  266
            M GA LVA+AATIGNFLQGWDNATIAGA+VYI K++ L T ++GLVVAMSLIGAT+ITTC
Sbjct  1    MKGATLVALAATIGNFLQGWDNATIAGAMVYINKDMNLPTSVQGLVVAMSLIGATVITTC  60

Query  267  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  446
            SG I+DWLGRRPMLILSS+ YFLSGLIMLWSPNVYVL +ARLLDGFG GLAVTLVP+YIS
Sbjct  61   SGPISDWLGRRPMLILSSIMYFLSGLIMLWSPNVYVLCLARLLDGFGAGLAVTLVPVYIS  120

Query  447  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  626
            ETAP EIRG LNTLPQF GSGGMFL+YCM+F MS++ APSWR MLGVLSIPSL+Y   TV
Sbjct  121  ETAPPEIRGQLNTLPQFLGSGGMFLSYCMVFAMSLSDAPSWRGMLGVLSIPSLVYLFFTV  180

Query  627  FYLPESPRWLVSKGRMVXAKRV  692
            FYLPESPRWLVSKGRM  AKRV
Sbjct  181  FYLPESPRWLVSKGRMDEAKRV  202



>dbj|BAJ33724.1| unnamed protein product [Thellungiella halophila]
Length=733

 Score =   336 bits (861),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 165/202 (82%), Positives = 181/202 (90%), Gaps = 0/202 (0%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  266
            M GA LVA+AATIGNFLQGWDNATIAGA+VYI K++ L T ++GLVVAMSLIGAT+ITTC
Sbjct  1    MKGATLVALAATIGNFLQGWDNATIAGAMVYINKDMNLPTSVQGLVVAMSLIGATVITTC  60

Query  267  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  446
            SG I+DWLGRRPMLILSS+ YFLSGLIMLWSPNVYVL +ARLLDGFG GLAVTLVP+YIS
Sbjct  61   SGPISDWLGRRPMLILSSIMYFLSGLIMLWSPNVYVLCLARLLDGFGAGLAVTLVPVYIS  120

Query  447  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  626
            ETAP EIRG LNTLPQF GSGGMFL+YCM+F MS++ APSWR MLGVLSIPSL+Y   TV
Sbjct  121  ETAPPEIRGQLNTLPQFLGSGGMFLSYCMVFAMSLSDAPSWRGMLGVLSIPSLVYLFFTV  180

Query  627  FYLPESPRWLVSKGRMVXAKRV  692
            FYLPESPRWLVSKGRM  AKRV
Sbjct  181  FYLPESPRWLVSKGRMDEAKRV  202



>dbj|BAJ89532.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=744

 Score =   336 bits (861),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 164/204 (80%), Positives = 185/204 (91%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  260
            M+GA LVAIAA+IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGAT+IT
Sbjct  1    MSGAALVAIAASIGNLLQGWDNATIAGAVLYIKKEFQLENDPTVEGLIVAMSLIGATIIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG ++DW+GRRPMLILSS+ YFLSGLIMLWSPNVYVLL+ARL+DGFGIGLAVTLVPLY
Sbjct  61   TFSGPVSDWVGRRPMLILSSILYFLSGLIMLWSPNVYVLLLARLVDGFGIGLAVTLVPLY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAPSEIRG LNTLPQF+GSGGMFL+YCM+FGMS+  +P WR+MLGVLS+PSL +F L
Sbjct  121  ISETAPSEIRGRLNTLPQFSGSGGMFLSYCMVFGMSLLPSPDWRIMLGVLSVPSLFFFGL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            TVFYLPESPRWLVSKGRM  AK+V
Sbjct  181  TVFYLPESPRWLVSKGRMAEAKKV  204



>ref|XP_008242106.1| PREDICTED: monosaccharide-sensing protein 2-like [Prunus mume]
Length=742

 Score =   336 bits (861),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 166/202 (82%), Positives = 186/202 (92%), Gaps = 2/202 (1%)
 Frame = +3

Query  93   GAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLITTC  266
            G+VLVAIAATIGN LQGWDNATIAGAV+YIK+E  LET   +EGL+VAMSLIGAT+ITT 
Sbjct  3    GSVLVAIAATIGNLLQGWDNATIAGAVLYIKREFKLETQPTIEGLIVAMSLIGATVITTF  62

Query  267  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  446
            SG ++D LGRRPMLI+SS+ YFLSGL+MLW+PNVYVLL+ARLLDGFGIGLAVTLVP+YIS
Sbjct  63   SGPVSDSLGRRPMLIISSVLYFLSGLVMLWAPNVYVLLLARLLDGFGIGLAVTLVPVYIS  122

Query  447  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  626
            ETAP EIRGLLNTLPQFTGSGGMF++YCM+F MS+  AP+WRLMLGVLSIPSLLYFALTV
Sbjct  123  ETAPPEIRGLLNTLPQFTGSGGMFMSYCMVFSMSLMEAPNWRLMLGVLSIPSLLYFALTV  182

Query  627  FYLPESPRWLVSKGRMVXAKRV  692
            FYLPESPRWLVSKGRM  AK+V
Sbjct  183  FYLPESPRWLVSKGRMAEAKQV  204



>ref|XP_010266258.1| PREDICTED: monosaccharide-sensing protein 2 isoform X2 [Nelumbo 
nucifera]
Length=653

 Score =   333 bits (854),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 190/204 (93%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M GAV VAIAA +GN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGAT+IT
Sbjct  1    MKGAVFVAIAAAVGNLLQGWDNATIAGAVLYIKKEFQLESEPTIEGLIVAMSLIGATIIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            TCSG ++DWLGRRPMLI+SS+ YF+SGLIM WSPNVY+LL+ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TCSGPVSDWLGRRPMLIISSVLYFVSGLIMFWSPNVYILLLARLLDGFGIGLAVTLVPVY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAPSEIRGLLNTLPQFTGSGGMFL+YCM+FGMS+T +PSWRLMLGVLSIPS++YFAL
Sbjct  121  ISETAPSEIRGLLNTLPQFTGSGGMFLSYCMVFGMSLTDSPSWRLMLGVLSIPSVVYFAL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            T+F+LPESPRWLVSKG+M+ AKRV
Sbjct  181  TIFFLPESPRWLVSKGKMLEAKRV  204



>ref|NP_001046359.1| Os02g0229400 [Oryza sativa Japonica Group]
 dbj|BAD26163.1| putative hexose transporter [Oryza sativa Japonica Group]
 dbj|BAF08273.1| Os02g0229400 [Oryza sativa Japonica Group]
 gb|ADG21983.1| tonoplast monosaccharide transporter 2 [Oryza sativa Japonica 
Group]
Length=746

 Score =   336 bits (861),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 163/204 (80%), Positives = 186/204 (91%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M+GA LVAIAA+IGN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGAT+IT
Sbjct  1    MSGAALVAIAASIGNLLQGWDNATIAGAVLYIKKEFKLESEPTVEGLIVAMSLIGATIIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG ++DW+GRRPMLILSS+ YFLS LIMLWSPNVYVLL+ARL+DGFGIGLAVTLVPLY
Sbjct  61   TFSGPVSDWIGRRPMLILSSILYFLSSLIMLWSPNVYVLLLARLIDGFGIGLAVTLVPLY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAPSEIRGLLNTLPQF+GSGGMFL+YCM+FGMS+  +P WR+MLGVL+IPSL +F L
Sbjct  121  ISETAPSEIRGLLNTLPQFSGSGGMFLSYCMVFGMSLLPSPDWRIMLGVLAIPSLFFFGL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            T+FYLPESPRWLVSKGRM  AK+V
Sbjct  181  TIFYLPESPRWLVSKGRMAEAKKV  204



>ref|XP_007204446.1| hypothetical protein PRUPE_ppa026426mg [Prunus persica]
 gb|EMJ05645.1| hypothetical protein PRUPE_ppa026426mg [Prunus persica]
Length=742

 Score =   335 bits (860),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 166/202 (82%), Positives = 186/202 (92%), Gaps = 2/202 (1%)
 Frame = +3

Query  93   GAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLITTC  266
            G+VLVAIAATIGN LQGWDNATIAGAV+YIK+E  LET   +EGL+VAMSLIGAT+ITT 
Sbjct  3    GSVLVAIAATIGNLLQGWDNATIAGAVLYIKREFKLETQPTIEGLIVAMSLIGATVITTF  62

Query  267  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  446
            SG ++D LGRRPMLI+SS+ YFLSGL+MLW+PNVYVLL+ARLLDGFGIGLAVTLVP+YIS
Sbjct  63   SGPVSDSLGRRPMLIISSVLYFLSGLVMLWAPNVYVLLLARLLDGFGIGLAVTLVPVYIS  122

Query  447  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  626
            ETAP EIRGLLNTLPQFTGSGGMF++YCM+F MS+  AP+WRLMLGVLSIPSLLYFALTV
Sbjct  123  ETAPPEIRGLLNTLPQFTGSGGMFMSYCMVFSMSLMEAPNWRLMLGVLSIPSLLYFALTV  182

Query  627  FYLPESPRWLVSKGRMVXAKRV  692
            FYLPESPRWLVSKGRM  AK+V
Sbjct  183  FYLPESPRWLVSKGRMAEAKQV  204



>ref|XP_008778122.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008778123.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008778124.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008778125.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008778126.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
Length=747

 Score =   335 bits (860),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 163/204 (80%), Positives = 188/204 (92%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M GAVLVAI A+IGN LQGWDNATIAGAV+YIKKE  LET   +EGL+VAMSLIGAT+IT
Sbjct  2    MQGAVLVAIVASIGNLLQGWDNATIAGAVLYIKKEFKLETEPTIEGLIVAMSLIGATIIT  61

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG+++D +GRRP+LILSS+ YFLSGL+MLWSPNVY+LL+ARL+DGFGIGLAVTLVP+Y
Sbjct  62   TFSGAVSDCIGRRPILILSSVLYFLSGLVMLWSPNVYILLLARLIDGFGIGLAVTLVPVY  121

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRGLLNTLPQF+GSGGMFL+YCM+FGMS+ ++P WRLMLGVLSIPSL+Y AL
Sbjct  122  ISETAPPEIRGLLNTLPQFSGSGGMFLSYCMVFGMSLMSSPDWRLMLGVLSIPSLVYLAL  181

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            TVFYLPESPRWLVSKGRMV AK++
Sbjct  182  TVFYLPESPRWLVSKGRMVEAKKI  205



>ref|XP_003571780.1| PREDICTED: monosaccharide-sensing protein 2-like [Brachypodium 
distachyon]
Length=749

 Score =   335 bits (860),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 163/206 (79%), Positives = 186/206 (90%), Gaps = 2/206 (1%)
 Frame = +3

Query  81   LRMNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATL  254
            ++M+GA LVAIAA+IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGAT+
Sbjct  3    VKMSGAALVAIAASIGNLLQGWDNATIAGAVLYIKKEFKLENDPTLEGLIVAMSLIGATI  62

Query  255  ITTCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVP  434
            ITT SG ++DW+GRRPMLILSS+ YF SGLIMLWSPNVYVLL+ARL+DGFGIGLAVTLVP
Sbjct  63   ITTFSGPVSDWVGRRPMLILSSILYFFSGLIMLWSPNVYVLLLARLVDGFGIGLAVTLVP  122

Query  435  LYISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYF  614
            LYISETAPSEIRG LNTLPQF+GSGGMFL+YCM+FGMS+   P WR+MLGVLS+PSL++F
Sbjct  123  LYISETAPSEIRGQLNTLPQFSGSGGMFLSYCMVFGMSLLPLPDWRIMLGVLSVPSLVFF  182

Query  615  ALTVFYLPESPRWLVSKGRMVXAKRV  692
             LTVFYLPESPRWLVSKGRM  AK+V
Sbjct  183  GLTVFYLPESPRWLVSKGRMAEAKKV  208



>emb|CDY29502.1| BnaA06g14680D [Brassica napus]
Length=659

 Score =   333 bits (853),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 163/202 (81%), Positives = 181/202 (90%), Gaps = 0/202 (0%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  266
            M GA LVA+AATIGNFLQGWDNATIAGA+VYI K++ L T ++GLVVAMSLIGAT+ITTC
Sbjct  1    MKGATLVALAATIGNFLQGWDNATIAGAMVYINKDMNLATSVQGLVVAMSLIGATVITTC  60

Query  267  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  446
            SG I+DWLGRRPMLIL+S+ YFLSGLIMLWSPNVYVL +ARLLDGFG GLAVTLVP+YIS
Sbjct  61   SGPISDWLGRRPMLILASVMYFLSGLIMLWSPNVYVLCLARLLDGFGAGLAVTLVPVYIS  120

Query  447  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  626
            ETAP EIRG LNTLPQF GSGGMFL+YCM+F MS++ APSWR MLGVLSIPSL+Y   TV
Sbjct  121  ETAPPEIRGQLNTLPQFLGSGGMFLSYCMVFTMSLSDAPSWRAMLGVLSIPSLVYLLFTV  180

Query  627  FYLPESPRWLVSKGRMVXAKRV  692
            FYLPESPRWLVSKGRM  AK+V
Sbjct  181  FYLPESPRWLVSKGRMDEAKKV  202



>gb|EMT06669.1| Monosaccharide-sensing protein 2 [Aegilops tauschii]
Length=787

 Score =   336 bits (861),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 165/208 (79%), Positives = 187/208 (90%), Gaps = 2/208 (1%)
 Frame = +3

Query  75   GLLRMNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGA  248
            G  +M+GA LVAIAA+IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGA
Sbjct  40   GGKKMSGAALVAIAASIGNLLQGWDNATIAGAVLYIKKEFQLENNPTVEGLIVAMSLIGA  99

Query  249  TLITTCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTL  428
            T+ITT SG ++DW+GRRPMLILSS+ YFLSGLIMLWSPNVYVLL+ARL+DGFGIGLAVTL
Sbjct  100  TIITTFSGPVSDWVGRRPMLILSSLLYFLSGLIMLWSPNVYVLLLARLVDGFGIGLAVTL  159

Query  429  VPLYISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLL  608
            VPLYISETAPSEIRG LNTLPQF+GSGGMFL+YCM+FGMS+  +P WR+MLGVLS+PSL 
Sbjct  160  VPLYISETAPSEIRGRLNTLPQFSGSGGMFLSYCMVFGMSLLPSPDWRIMLGVLSVPSLF  219

Query  609  YFALTVFYLPESPRWLVSKGRMVXAKRV  692
            +F LTVFYLPESPRWLVSKGRM  AK+V
Sbjct  220  FFVLTVFYLPESPRWLVSKGRMAEAKKV  247



>ref|XP_010539774.1| PREDICTED: monosaccharide-sensing protein 1-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010539775.1| PREDICTED: monosaccharide-sensing protein 1-like isoform X2 [Tarenaya 
hassleriana]
Length=723

 Score =   334 bits (856),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 162/202 (80%), Positives = 179/202 (89%), Gaps = 0/202 (0%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  266
            M GA LVA+AATIGNFLQGWDNATIAGA+VYIK E+ L T ++GLVVAMSLIGAT ITTC
Sbjct  1    MKGAALVALAATIGNFLQGWDNATIAGAMVYIKNEMNLATSVQGLVVAMSLIGATAITTC  60

Query  267  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  446
            SG I DWLGRRPMLI SS+ YF+SGLIMLWSPNVYVL +ARLLDGFGIGLAVTL+P+YIS
Sbjct  61   SGPITDWLGRRPMLIFSSILYFISGLIMLWSPNVYVLCLARLLDGFGIGLAVTLIPVYIS  120

Query  447  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  626
            ETAP EIRG LNTLPQF GSGGMFL+YCM+F MS++ +PSWR MLGVLSIPS+LY A  V
Sbjct  121  ETAPPEIRGQLNTLPQFMGSGGMFLSYCMVFAMSLSESPSWRGMLGVLSIPSVLYLAFAV  180

Query  627  FYLPESPRWLVSKGRMVXAKRV  692
            FYLPESPRWLVSKGRM+ AK V
Sbjct  181  FYLPESPRWLVSKGRMLEAKTV  202



>ref|XP_009149562.1| PREDICTED: monosaccharide-sensing protein 1 [Brassica rapa]
 ref|XP_009149563.1| PREDICTED: monosaccharide-sensing protein 1 [Brassica rapa]
Length=721

 Score =   334 bits (856),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 163/202 (81%), Positives = 181/202 (90%), Gaps = 0/202 (0%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  266
            M GA LVA+AATIGNFLQGWDNATIAGA+VYI K++ L T ++GLVVAMSLIGAT+ITTC
Sbjct  1    MKGATLVALAATIGNFLQGWDNATIAGAMVYINKDMNLATSVQGLVVAMSLIGATVITTC  60

Query  267  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  446
            SG I+DWLGRRPMLIL+S+ YFLSGLIMLWSPNVYVL +ARLLDGFG GLAVTLVP+YIS
Sbjct  61   SGPISDWLGRRPMLILASVMYFLSGLIMLWSPNVYVLCLARLLDGFGAGLAVTLVPVYIS  120

Query  447  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  626
            ETAP EIRG LNTLPQF GSGGMFL+YCM+F MS++ APSWR MLGVLSIPSL+Y   TV
Sbjct  121  ETAPPEIRGQLNTLPQFLGSGGMFLSYCMVFTMSLSDAPSWRAMLGVLSIPSLVYLLFTV  180

Query  627  FYLPESPRWLVSKGRMVXAKRV  692
            FYLPESPRWLVSKGRM  AK+V
Sbjct  181  FYLPESPRWLVSKGRMDEAKKV  202



>emb|CDI66586.1| putative sugar transporter type 2a protein [Saccharum hybrid 
cultivar R570]
 emb|CDI66607.1| putative sugar transporter type 2a protein [Saccharum hybrid 
cultivar R570]
Length=745

 Score =   334 bits (856),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 163/204 (80%), Positives = 185/204 (91%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  260
            M+GAVLVAIAA+IGN LQGWDNATIAGAV+YIKKE  L  E  +EGL+VAMSLIGAT+IT
Sbjct  1    MSGAVLVAIAASIGNLLQGWDNATIAGAVLYIKKEFQLQSEPTVEGLIVAMSLIGATIIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG ++DW+GRRPMLILSS+ YFLS LIMLWSPNVYVLL+ARL+DGFGIGLAVTLVPLY
Sbjct  61   TFSGPVSDWIGRRPMLILSSVLYFLSSLIMLWSPNVYVLLLARLVDGFGIGLAVTLVPLY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRGLLNTLPQF+GSGGMFL+YCM+FGMS+  +P WR+MLGVL+IPSL +F L
Sbjct  121  ISETAPPEIRGLLNTLPQFSGSGGMFLSYCMVFGMSLLPSPDWRIMLGVLAIPSLFFFGL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            T+FYLPESPRWLVSKGRM  AK+V
Sbjct  181  TIFYLPESPRWLVSKGRMAEAKKV  204



>emb|CDI66591.1| putative sugar transporter type 2a protein [Saccharum hybrid 
cultivar R570]
Length=745

 Score =   334 bits (856),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 163/204 (80%), Positives = 185/204 (91%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  260
            M+GAVLVAIAA+IGN LQGWDNATIAGAV+YIKKE  L  E  +EGL+VAMSLIGAT+IT
Sbjct  1    MSGAVLVAIAASIGNLLQGWDNATIAGAVLYIKKEFQLQSEPTVEGLIVAMSLIGATIIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG ++DW+GRRPMLILSS+ YFLS LIMLWSPNVYVLL+ARL+DGFGIGLAVTLVPLY
Sbjct  61   TFSGPVSDWIGRRPMLILSSVLYFLSSLIMLWSPNVYVLLLARLVDGFGIGLAVTLVPLY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRGLLNTLPQF+GSGGMFL+YCM+FGMS+  +P WR+MLGVL+IPSL +F L
Sbjct  121  ISETAPPEIRGLLNTLPQFSGSGGMFLSYCMVFGMSLLPSPDWRIMLGVLAIPSLFFFGL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            T+FYLPESPRWLVSKGRM  AK+V
Sbjct  181  TIFYLPESPRWLVSKGRMAEAKKV  204



>ref|XP_006647093.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Oryza 
brachyantha]
 ref|XP_006647094.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Oryza 
brachyantha]
Length=746

 Score =   334 bits (856),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 162/204 (79%), Positives = 185/204 (91%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M+GA LVAIAA+IGN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGAT+IT
Sbjct  1    MSGAALVAIAASIGNLLQGWDNATIAGAVLYIKKEFNLESEPTVEGLIVAMSLIGATIIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG ++DW+GRRPMLILSS+ YFL  LIMLWSPNVYVLL+ARL+DGFGIGLAVTLVPLY
Sbjct  61   TFSGPVSDWIGRRPMLILSSILYFLGSLIMLWSPNVYVLLLARLIDGFGIGLAVTLVPLY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAPSEIRGLLNTLPQF+GSGGMFL+YCM+FGMS+  +P WR+MLGVL+IPSL +F L
Sbjct  121  ISETAPSEIRGLLNTLPQFSGSGGMFLSYCMVFGMSLLPSPDWRIMLGVLAIPSLFFFGL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            T+FYLPESPRWLVSKGRM  AK+V
Sbjct  181  TIFYLPESPRWLVSKGRMAEAKKV  204



>emb|CDY33650.1| BnaC08g19500D [Brassica napus]
Length=697

 Score =   332 bits (851),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 164/202 (81%), Positives = 180/202 (89%), Gaps = 0/202 (0%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  266
            M GA LVA+AATIGNFLQGWDNATIAGA+VYI K++ L T ++GLVVAMSLIGAT+ITTC
Sbjct  1    MKGATLVALAATIGNFLQGWDNATIAGAMVYINKDMNLPTSVQGLVVAMSLIGATVITTC  60

Query  267  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  446
            SG I+DWLGRRPMLILSS+ YFLSGLIM WSPNVYVL +ARLLDGFG GLAVTLVP+YIS
Sbjct  61   SGPISDWLGRRPMLILSSVMYFLSGLIMWWSPNVYVLCLARLLDGFGAGLAVTLVPVYIS  120

Query  447  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  626
            ETAP EIRG LNTLPQF GSGGMFL+YCM+F MS++ APSWR MLGVLSIPSL+Y   TV
Sbjct  121  ETAPPEIRGQLNTLPQFLGSGGMFLSYCMVFTMSLSEAPSWRGMLGVLSIPSLVYLFFTV  180

Query  627  FYLPESPRWLVSKGRMVXAKRV  692
            FYLPESPRWLVSKGRM  AKRV
Sbjct  181  FYLPESPRWLVSKGRMDEAKRV  202



>ref|XP_008237926.1| PREDICTED: monosaccharide-sensing protein 2 [Prunus mume]
Length=739

 Score =   333 bits (853),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 158/202 (78%), Positives = 185/202 (92%), Gaps = 0/202 (0%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  266
            M  A++VAIAATIGN LQGWDNATIAGA+VYI ++  L + +EGLVVAMSLIGAT ITTC
Sbjct  1    MRSAMMVAIAATIGNLLQGWDNATIAGAIVYITEDFDLGSSLEGLVVAMSLIGATAITTC  60

Query  267  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  446
            SG+I+DW+GR+PMLI SS+ YF+SGL+M+WSPNVYVL IARLLDGFGIGLAVTLVPLYIS
Sbjct  61   SGAISDWIGRKPMLIASSVLYFVSGLVMVWSPNVYVLCIARLLDGFGIGLAVTLVPLYIS  120

Query  447  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  626
            ETAP++IRG LNTLPQF GSGGMFL+YCM+FGMS+  +P+WRLMLGV+SIPS++YFALTV
Sbjct  121  ETAPADIRGSLNTLPQFLGSGGMFLSYCMVFGMSLMNSPNWRLMLGVISIPSIIYFALTV  180

Query  627  FYLPESPRWLVSKGRMVXAKRV  692
            FYLPESPRWLVSKGRM+ AK+V
Sbjct  181  FYLPESPRWLVSKGRMLEAKKV  202



>emb|CAA90628.1| sugar transporter [Arabidopsis thaliana]
Length=734

 Score =   332 bits (852),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 164/202 (81%), Positives = 180/202 (89%), Gaps = 0/202 (0%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  266
            M GA LVA+AATIGNFLQGWDNATIAGA+VYI K+L L T ++GLVVAMSLIGAT+ITTC
Sbjct  1    MKGATLVALAATIGNFLQGWDNATIAGAMVYINKDLNLPTSVQGLVVAMSLIGATVITTC  60

Query  267  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  446
            SG I+DWLGRRPMLILSS+ YF+ GLIMLWSPNVYVL  ARLL+GFG GLAVTLVP+YIS
Sbjct  61   SGPISDWLGRRPMLILSSVMYFVCGLIMLWSPNVYVLCFARLLNGFGAGLAVTLVPVYIS  120

Query  447  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  626
            ETAP EIRG LNTLPQF GSGGMFL+YCM+F MS++ +PSWR MLGVLSIPSLLY  LTV
Sbjct  121  ETAPPEIRGQLNTLPQFLGSGGMFLSYCMVFTMSLSDSPSWRAMLGVLSIPSLLYLFLTV  180

Query  627  FYLPESPRWLVSKGRMVXAKRV  692
            FYLPESPRWLVSKGRM  AKRV
Sbjct  181  FYLPESPRWLVSKGRMDEAKRV  202



>gb|EMS63940.1| Monosaccharide-sensing protein 2 [Triticum urartu]
Length=743

 Score =   333 bits (853),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 163/204 (80%), Positives = 187/204 (92%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M+GAVLVAIAA+IGN LQGWDNATIAGAV+YIKKE  LET   +EGL+VAMSLIGAT+IT
Sbjct  1    MSGAVLVAIAASIGNLLQGWDNATIAGAVLYIKKEFSLETQPLIEGLIVAMSLIGATVIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG++AD +GRRP+LI SS+ YF+SGL+MLW+PNVYVLL+ARL+DGFGIGLAVTLVPLY
Sbjct  61   TFSGAVADAVGRRPLLIASSVLYFVSGLVMLWAPNVYVLLLARLIDGFGIGLAVTLVPLY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP++IRGLLNTLPQF+GSGGMFL+YCM+F MS+   P WR+MLGVLSIPSL+YFAL
Sbjct  121  ISETAPTDIRGLLNTLPQFSGSGGMFLSYCMVFTMSLMPQPDWRIMLGVLSIPSLMYFAL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            TVFYLPESPRWLVSKGRM  AKRV
Sbjct  181  TVFYLPESPRWLVSKGRMAEAKRV  204



>ref|XP_006364349.1| PREDICTED: monosaccharide-sensing protein 2-like [Solanum tuberosum]
Length=257

 Score =   317 bits (813),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 159/204 (78%), Positives = 187/204 (92%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M+GAVLVA+AA IG+FLQGWDNATIAG+++YIKKE  LET   MEGL+VAMSL+GA L+T
Sbjct  1    MSGAVLVAVAAAIGSFLQGWDNATIAGSILYIKKEFNLETQPTMEGLIVAMSLVGAVLMT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            TCSG+IADWLGRRP+LI SS+ YF+SGL+MLWSPN+YVLL+ARLL+GFG+GLAVTLVP+Y
Sbjct  61   TCSGAIADWLGRRPLLITSSVLYFVSGLVMLWSPNIYVLLLARLLNGFGVGLAVTLVPIY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRGLLNTLPQFTG  GMF +YCM+FGMS+ ++P+WRLMLGVLSIPS+LYF L
Sbjct  121  ISETAPPEIRGLLNTLPQFTGCVGMFFSYCMVFGMSLMSSPTWRLMLGVLSIPSILYFIL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            T+FY PESPRWLVSKGRM+ AKRV
Sbjct  181  TIFYFPESPRWLVSKGRMLDAKRV  204



>gb|EMT29091.1| Monosaccharide-sensing protein 2 [Aegilops tauschii]
Length=743

 Score =   333 bits (853),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 163/204 (80%), Positives = 187/204 (92%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M+GAVLVAIAA+IGN LQGWDNATIAGAV+YIKKE  LET   +EGL+VAMSLIGAT+IT
Sbjct  1    MSGAVLVAIAASIGNLLQGWDNATIAGAVLYIKKEFSLETQPLIEGLIVAMSLIGATVIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG++AD +GRRP+LI SS+ YF+SGL+MLW+PNVYVLL+ARL+DGFGIGLAVTLVPLY
Sbjct  61   TFSGAVADAVGRRPLLIASSVLYFVSGLVMLWAPNVYVLLLARLIDGFGIGLAVTLVPLY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP++IRGLLNTLPQF+GSGGMFL+YCM+F MS+   P WR+MLGVLSIPSL+YFAL
Sbjct  121  ISETAPTDIRGLLNTLPQFSGSGGMFLSYCMVFTMSLMPQPDWRIMLGVLSIPSLMYFAL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            TVFYLPESPRWLVSKGRM  AKRV
Sbjct  181  TVFYLPESPRWLVSKGRMAEAKRV  204



>ref|XP_002893133.1| hypothetical protein ARALYDRAFT_472320 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69392.1| hypothetical protein ARALYDRAFT_472320 [Arabidopsis lyrata subsp. 
lyrata]
Length=735

 Score =   332 bits (851),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 164/202 (81%), Positives = 180/202 (89%), Gaps = 0/202 (0%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  266
            M GA LVA+AATIGNFLQGWDNATIAGA+VYI K+L L T ++GLVVAMSLIGAT+ITTC
Sbjct  1    MKGATLVALAATIGNFLQGWDNATIAGAMVYINKDLNLPTSVQGLVVAMSLIGATVITTC  60

Query  267  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  446
            SG I+DWLGRRPMLILSS+ YF+ GLIMLWSPNVYVL  ARLL+GFG GLAVTLVP+YIS
Sbjct  61   SGPISDWLGRRPMLILSSVMYFVCGLIMLWSPNVYVLCFARLLNGFGAGLAVTLVPVYIS  120

Query  447  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  626
            ETAP EIRG LNTLPQF GSGGMFL+YCM+F MS++ +PSWR MLGVLSIPSLLY  LTV
Sbjct  121  ETAPPEIRGQLNTLPQFLGSGGMFLSYCMVFTMSLSDSPSWRAMLGVLSIPSLLYLFLTV  180

Query  627  FYLPESPRWLVSKGRMVXAKRV  692
            FYLPESPRWLVSKGRM  AKRV
Sbjct  181  FYLPESPRWLVSKGRMDEAKRV  202



>gb|AAD30608.1|AC007369_18 Sugar transporter [Arabidopsis thaliana]
Length=734

 Score =   332 bits (851),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 164/202 (81%), Positives = 180/202 (89%), Gaps = 0/202 (0%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  266
            M GA LVA+AATIGNFLQGWDNATIAGA+VYI K+L L T ++GLVVAMSLIGAT+ITTC
Sbjct  1    MKGATLVALAATIGNFLQGWDNATIAGAMVYINKDLNLPTSVQGLVVAMSLIGATVITTC  60

Query  267  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  446
            SG I+DWLGRRPMLILSS+ YF+ GLIMLWSPNVYVL  ARLL+GFG GLAVTLVP+YIS
Sbjct  61   SGPISDWLGRRPMLILSSVMYFVCGLIMLWSPNVYVLCFARLLNGFGAGLAVTLVPVYIS  120

Query  447  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  626
            ETAP EIRG LNTLPQF GSGGMFL+YCM+F MS++ +PSWR MLGVLSIPSLLY  LTV
Sbjct  121  ETAPPEIRGQLNTLPQFLGSGGMFLSYCMVFTMSLSDSPSWRAMLGVLSIPSLLYLFLTV  180

Query  627  FYLPESPRWLVSKGRMVXAKRV  692
            FYLPESPRWLVSKGRM  AKRV
Sbjct  181  FYLPESPRWLVSKGRMDEAKRV  202



>ref|NP_173508.1| tonoplast monosaccharide transporter1 [Arabidopsis thaliana]
 sp|Q96290.2|MSSP1_ARATH RecName: Full=Monosaccharide-sensing protein 1; AltName: Full=Monosaccharide 
transporter 1; AltName: Full=Sugar transporter 
MSSP1; AltName: Full=Sugar transporter MT1 [Arabidopsis thaliana]
 gb|AAF80627.1|AC069251_20 F2D10.36 [Arabidopsis thaliana]
 gb|AEE30030.1| tonoplast monosaccharide transporter1 [Arabidopsis thaliana]
Length=734

 Score =   332 bits (851),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 164/202 (81%), Positives = 180/202 (89%), Gaps = 0/202 (0%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  266
            M GA LVA+AATIGNFLQGWDNATIAGA+VYI K+L L T ++GLVVAMSLIGAT+ITTC
Sbjct  1    MKGATLVALAATIGNFLQGWDNATIAGAMVYINKDLNLPTSVQGLVVAMSLIGATVITTC  60

Query  267  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  446
            SG I+DWLGRRPMLILSS+ YF+ GLIMLWSPNVYVL  ARLL+GFG GLAVTLVP+YIS
Sbjct  61   SGPISDWLGRRPMLILSSVMYFVCGLIMLWSPNVYVLCFARLLNGFGAGLAVTLVPVYIS  120

Query  447  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  626
            ETAP EIRG LNTLPQF GSGGMFL+YCM+F MS++ +PSWR MLGVLSIPSLLY  LTV
Sbjct  121  ETAPPEIRGQLNTLPQFLGSGGMFLSYCMVFTMSLSDSPSWRAMLGVLSIPSLLYLFLTV  180

Query  627  FYLPESPRWLVSKGRMVXAKRV  692
            FYLPESPRWLVSKGRM  AKRV
Sbjct  181  FYLPESPRWLVSKGRMDEAKRV  202



>ref|XP_010266257.1| PREDICTED: monosaccharide-sensing protein 2 isoform X1 [Nelumbo 
nucifera]
Length=742

 Score =   332 bits (851),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 190/204 (93%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M GAV VAIAA +GN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGAT+IT
Sbjct  1    MKGAVFVAIAAAVGNLLQGWDNATIAGAVLYIKKEFQLESEPTIEGLIVAMSLIGATIIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            TCSG ++DWLGRRPMLI+SS+ YF+SGLIM WSPNVY+LL+ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TCSGPVSDWLGRRPMLIISSVLYFVSGLIMFWSPNVYILLLARLLDGFGIGLAVTLVPVY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAPSEIRGLLNTLPQFTGSGGMFL+YCM+FGMS+T +PSWRLMLGVLSIPS++YFAL
Sbjct  121  ISETAPSEIRGLLNTLPQFTGSGGMFLSYCMVFGMSLTDSPSWRLMLGVLSIPSVVYFAL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            T+F+LPESPRWLVSKG+M+ AKRV
Sbjct  181  TIFFLPESPRWLVSKGKMLEAKRV  204



>gb|KJB79727.1| hypothetical protein B456_013G064200 [Gossypium raimondii]
Length=592

 Score =   328 bits (840),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 185/204 (91%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  260
            MNGAVLVA+AA IGN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGAT IT
Sbjct  1    MNGAVLVALAAAIGNMLQGWDNATIAGAVLYIKKEFKLESAPTIEGLIVAMSLIGATCIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            TCSG I+DWLGRRPMLI+SS+ YFLSGL+M+WSPNVY+LL+ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TCSGGISDWLGRRPMLIISSVLYFLSGLVMVWSPNVYILLLARLLDGFGIGLAVTLVPVY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRGLLNTLPQFTGS GMFL+YCM+FGMS++  PSWRLMLGVLSIPSL YF L
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSIGMFLSYCMVFGMSLSELPSWRLMLGVLSIPSLAYFGL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            TVFYLPESPRWLVSKGRM  AK V
Sbjct  181  TVFYLPESPRWLVSKGRMNEAKAV  204



>gb|EEC67373.1| hypothetical protein OsI_34495 [Oryza sativa Indica Group]
Length=718

 Score =   331 bits (848),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 162/204 (79%), Positives = 185/204 (91%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  260
            M GAVLVAIAA+IGN LQGWDNATIAGAV+YIKKE  L  E  +EGL+VAMSLIGAT+IT
Sbjct  1    MAGAVLVAIAASIGNLLQGWDNATIAGAVLYIKKEFNLQSEPLIEGLIVAMSLIGATIIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG++AD  GRRPMLI S++ YF+SGL+MLW+PNVYVLL+ARL+DGFGIGLAVTLVPLY
Sbjct  61   TFSGAVADSFGRRPMLIASAVLYFVSGLVMLWAPNVYVLLLARLIDGFGIGLAVTLVPLY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP++IRGLLNTLPQF+GSGGMFL+YCM+FGMS+   P WR+MLGVLSIPSL+YFAL
Sbjct  121  ISETAPTDIRGLLNTLPQFSGSGGMFLSYCMVFGMSLMPQPDWRIMLGVLSIPSLIYFAL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            T+FYLPESPRWLVSKGRM  AKRV
Sbjct  181  TIFYLPESPRWLVSKGRMAEAKRV  204



>ref|XP_010063149.1| PREDICTED: monosaccharide-sensing protein 2-like [Eucalyptus 
grandis]
 gb|KCW70342.1| hypothetical protein EUGRSUZ_F03585 [Eucalyptus grandis]
Length=740

 Score =   331 bits (849),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 158/202 (78%), Positives = 184/202 (91%), Gaps = 0/202 (0%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  266
            M GAV VA+AATIGNFLQGWDNATIAG +VYIK++L L + +EGLVVAMSLIGAT+ITT 
Sbjct  1    MRGAVFVALAATIGNFLQGWDNATIAGGIVYIKEDLDLGSTVEGLVVAMSLIGATVITTS  60

Query  267  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  446
            SG I+DWLGRRPMLI+SS+ YF+ GL+MLWSPNVYVL + RLLDGFGIGLAVTLVPLYIS
Sbjct  61   SGPISDWLGRRPMLIMSSILYFIGGLVMLWSPNVYVLCLGRLLDGFGIGLAVTLVPLYIS  120

Query  447  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  626
            ETAP ++RGLLNTLPQFTGSGGMFLAYCMIFGMS++ +P+WR+MLGVLSIPS++YF   V
Sbjct  121  ETAPPDVRGLLNTLPQFTGSGGMFLAYCMIFGMSLSDSPNWRIMLGVLSIPSVIYFLFMV  180

Query  627  FYLPESPRWLVSKGRMVXAKRV  692
            F+LPESPRWLVSKG+M+ AK+V
Sbjct  181  FFLPESPRWLVSKGKMMEAKKV  202



>ref|XP_010029562.1| PREDICTED: monosaccharide-sensing protein 2-like [Eucalyptus 
grandis]
 gb|KCW56480.1| hypothetical protein EUGRSUZ_I02208 [Eucalyptus grandis]
Length=731

 Score =   331 bits (849),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 159/204 (78%), Positives = 185/204 (91%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M GAVLVA+AATIGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGAT+IT
Sbjct  1    MRGAVLVAVAATIGNLLQGWDNATIAGAVLYIKKEFDLEGQPTIEGLIVAMSLIGATVIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG ++D +GRRPM+I+SS+ YFLSGL+MLW+PNVYVLL+ARLLDGFGIGLAVTL+P+Y
Sbjct  61   TFSGPVSDSIGRRPMMIISSILYFLSGLVMLWAPNVYVLLLARLLDGFGIGLAVTLIPVY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRGLLNTLPQFTGSGGMFL+YCM+FGMS+  +PSWRLMLGVLS+PSL+Y  L
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSGGMFLSYCMVFGMSLMDSPSWRLMLGVLSVPSLVYIGL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            T+F+LPESPRWLVSKGRM+ A +V
Sbjct  181  TIFFLPESPRWLVSKGRMIEANKV  204



>ref|NP_001065182.1| Os10g0539900 [Oryza sativa Japonica Group]
 gb|AAG46115.1|AC073166_13 putative sugar transporter [Oryza sativa Japonica Group]
 gb|ABB47937.2| hexose transporter, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF27096.1| Os10g0539900 [Oryza sativa Japonica Group]
 gb|EAZ16837.1| hypothetical protein OsJ_32308 [Oryza sativa Japonica Group]
 gb|ADG21982.1| tonoplast monosaccharide transporter 1 [Oryza sativa Japonica 
Group]
Length=740

 Score =   331 bits (849),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 162/204 (79%), Positives = 185/204 (91%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  260
            M GAVLVAIAA+IGN LQGWDNATIAGAV+YIKKE  L  E  +EGL+VAMSLIGAT+IT
Sbjct  1    MAGAVLVAIAASIGNLLQGWDNATIAGAVLYIKKEFNLQSEPLIEGLIVAMSLIGATIIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG++AD  GRRPMLI S++ YF+SGL+MLW+PNVYVLL+ARL+DGFGIGLAVTLVPLY
Sbjct  61   TFSGAVADSFGRRPMLIASAVLYFVSGLVMLWAPNVYVLLLARLIDGFGIGLAVTLVPLY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP++IRGLLNTLPQF+GSGGMFL+YCM+FGMS+   P WR+MLGVLSIPSL+YFAL
Sbjct  121  ISETAPTDIRGLLNTLPQFSGSGGMFLSYCMVFGMSLMPQPDWRIMLGVLSIPSLIYFAL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            T+FYLPESPRWLVSKGRM  AKRV
Sbjct  181  TIFYLPESPRWLVSKGRMAEAKRV  204



>ref|XP_002467580.1| hypothetical protein SORBIDRAFT_01g030430 [Sorghum bicolor]
 gb|EER94578.1| hypothetical protein SORBIDRAFT_01g030430 [Sorghum bicolor]
Length=740

 Score =   331 bits (848),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 162/204 (79%), Positives = 185/204 (91%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  260
            M GAVLVAIAA+IGN LQGWDNATIAGAV+YIKKE  L  E  +EGL+VAMSLIGAT+IT
Sbjct  1    MGGAVLVAIAASIGNLLQGWDNATIAGAVLYIKKEFNLQSEPLIEGLIVAMSLIGATVIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG++AD +GRRPMLI S++ YF+SGL+MLW+PNVYVLL+ARL+DGFGIGLAVTLVPLY
Sbjct  61   TFSGAVADSVGRRPMLIASAILYFVSGLVMLWAPNVYVLLLARLIDGFGIGLAVTLVPLY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP++IRGLLNTLPQF+GSGGMFL+YCM+FGMS+   P WRLMLGVLSIPSL+YF L
Sbjct  121  ISETAPTDIRGLLNTLPQFSGSGGMFLSYCMVFGMSLMPTPDWRLMLGVLSIPSLIYFGL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            T+FYLPESPRWLVSKGRM  AKRV
Sbjct  181  TIFYLPESPRWLVSKGRMAEAKRV  204



>ref|XP_009390770.1| PREDICTED: monosaccharide-sensing protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=741

 Score =   331 bits (848),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 161/204 (79%), Positives = 186/204 (91%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M GAVLVA+AA+IGN LQGWDNATIAGAV+YIKKE  LET   MEGL+VAMSLIGAT+IT
Sbjct  1    MRGAVLVAVAASIGNLLQGWDNATIAGAVLYIKKEFKLETQPTMEGLIVAMSLIGATIIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG+++D +GRRPMLI+SS+ YF+SGL+MLWSPNVYVLL+ARL+DGFGIGLAVTLVP+Y
Sbjct  61   TFSGAVSDMVGRRPMLIISSVLYFVSGLVMLWSPNVYVLLLARLIDGFGIGLAVTLVPVY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAPSEIRGLLNTLPQF+GSGGMFL+YCM+FGMS+   P WR+MLGVL +PSLLYF L
Sbjct  121  ISETAPSEIRGLLNTLPQFSGSGGMFLSYCMVFGMSLMANPDWRVMLGVLFVPSLLYFLL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            T+FY+PESPRWLVSKGRM+ AK V
Sbjct  181  TMFYMPESPRWLVSKGRMLEAKLV  204



>dbj|BAJ90138.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=743

 Score =   331 bits (848),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 162/203 (80%), Positives = 186/203 (92%), Gaps = 2/203 (1%)
 Frame = +3

Query  90   NGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLITT  263
            +GAVLVAIAA+IGN LQGWDNATIAGAV+YIKKE  LET   +EGL+VAMSLIGAT+ITT
Sbjct  3    SGAVLVAIAASIGNLLQGWDNATIAGAVLYIKKEFSLETQPLIEGLIVAMSLIGATVITT  62

Query  264  CSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYI  443
             SG++AD +GRRP+LI SS+ YF+SGL+MLW+PNVYVLL+ARL+DGFGIGLAVTLVPLYI
Sbjct  63   FSGAVADAVGRRPLLIASSVLYFVSGLVMLWAPNVYVLLLARLIDGFGIGLAVTLVPLYI  122

Query  444  SETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALT  623
            SETAP++IRGLLNTLPQF+GSGGMFL+YCM+F MS+   P WR+MLGVLSIPSL+YFALT
Sbjct  123  SETAPTDIRGLLNTLPQFSGSGGMFLSYCMVFTMSLMPQPDWRIMLGVLSIPSLMYFALT  182

Query  624  VFYLPESPRWLVSKGRMVXAKRV  692
            VFYLPESPRWLVSKGRM  AKRV
Sbjct  183  VFYLPESPRWLVSKGRMAEAKRV  205



>emb|CAD58958.1| hexose transporter [Hordeum vulgare subsp. vulgare]
Length=743

 Score =   331 bits (848),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 162/203 (80%), Positives = 186/203 (92%), Gaps = 2/203 (1%)
 Frame = +3

Query  90   NGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLITT  263
            +GAVLVAIAA+IGN LQGWDNATIAGAV+YIKKE  LET   +EGL+VAMSLIGAT+ITT
Sbjct  3    SGAVLVAIAASIGNLLQGWDNATIAGAVLYIKKEFSLETQPLIEGLIVAMSLIGATVITT  62

Query  264  CSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYI  443
             SG++AD +GRRP+LI SS+ YF+SGL+MLW+PNVYVLL+ARL+DGFGIGLAVTLVPLYI
Sbjct  63   FSGAVADAVGRRPLLIASSVLYFVSGLVMLWAPNVYVLLLARLIDGFGIGLAVTLVPLYI  122

Query  444  SETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALT  623
            SETAP++IRGLLNTLPQF+GSGGMFL+YCM+F MS+   P WR+MLGVLSIPSL+YFALT
Sbjct  123  SETAPTDIRGLLNTLPQFSGSGGMFLSYCMVFTMSLMPQPDWRIMLGVLSIPSLMYFALT  182

Query  624  VFYLPESPRWLVSKGRMVXAKRV  692
            VFYLPESPRWLVSKGRM  AKRV
Sbjct  183  VFYLPESPRWLVSKGRMAEAKRV  205



>ref|XP_010906859.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
Length=549

 Score =   325 bits (834),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 154/204 (75%), Positives = 186/204 (91%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M GAVLVA+AATIGN LQGWDN+TIAGAV++IK+E  LE+   +EGL++AMSLIGAT+IT
Sbjct  1    MRGAVLVALAATIGNLLQGWDNSTIAGAVLFIKREFQLESEPTIEGLIIAMSLIGATIIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG+++DW GRRPMLI +++F FLSGL+MLWSPNVY+LL+ARL++GFG+GLAVTLVP+Y
Sbjct  61   TFSGAVSDWFGRRPMLIAAAVFTFLSGLVMLWSPNVYILLLARLINGFGVGLAVTLVPIY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRGLLNTLPQF+GSGGMFL+YCM+F MS+ + P WR+MLGVLSIPSL+Y AL
Sbjct  121  ISETAPPEIRGLLNTLPQFSGSGGMFLSYCMVFVMSLMSNPDWRVMLGVLSIPSLIYLAL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            T+FYLPESPRWLVSKGRMV AK+V
Sbjct  181  TIFYLPESPRWLVSKGRMVEAKKV  204



>ref|XP_006855646.1| hypothetical protein AMTR_s00044p00110510 [Amborella trichopoda]
 gb|ERN17113.1| hypothetical protein AMTR_s00044p00110510 [Amborella trichopoda]
Length=743

 Score =   330 bits (847),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 162/204 (79%), Positives = 183/204 (90%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  260
            M GAVLVAIAA+IGN LQGWDNATIA AV+YIK+E  L  E  +EGL+VAMSLIGAT+IT
Sbjct  1    MRGAVLVAIAASIGNLLQGWDNATIAAAVLYIKEEFDLDNEPTLEGLIVAMSLIGATIIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            TCSG I+DW+GRRPMLI SS+ YF+S LIM WSPNVYVLL+ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TCSGPISDWIGRRPMLIFSSILYFVSALIMFWSPNVYVLLLARLLDGFGIGLAVTLVPVY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP+EIRGLLNTLPQF+GSGGMF+ YCM+FGMS+   PSWR+MLGVL IPSL YFAL
Sbjct  121  ISETAPAEIRGLLNTLPQFSGSGGMFVTYCMVFGMSLMANPSWRVMLGVLFIPSLFYFAL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            T+FYLPESPRWLVSKGRM+ AK+V
Sbjct  181  TLFYLPESPRWLVSKGRMLEAKQV  204



>ref|XP_007142576.1| hypothetical protein PHAVU_008G292400g [Phaseolus vulgaris]
 gb|ESW14570.1| hypothetical protein PHAVU_008G292400g [Phaseolus vulgaris]
Length=732

 Score =   330 bits (846),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 189/204 (93%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M+GAVLVA+AA IGNFLQGWDNATIAG+++YIK+E  LE+   +EGL+VAMSLIGAT++T
Sbjct  1    MSGAVLVALAAAIGNFLQGWDNATIAGSILYIKREFQLESEPTIEGLIVAMSLIGATVVT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            TCSG I+DWLGRRPMLI+SSM YFLS L+MLWSPNVY+LL ARLLDGFGIGLAVTLVPLY
Sbjct  61   TCSGPISDWLGRRPMLIISSMLYFLSSLVMLWSPNVYILLFARLLDGFGIGLAVTLVPLY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP+EIRGLLNTLPQFTGS GMF +YCM+F MS+T APSWRLMLGVLSIPSL+YFAL
Sbjct  121  ISETAPTEIRGLLNTLPQFTGSAGMFFSYCMVFAMSLTPAPSWRLMLGVLSIPSLVYFAL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            T+F+LPESPRWLVSKGRMV AK+V
Sbjct  181  TLFFLPESPRWLVSKGRMVEAKKV  204



>ref|XP_002520608.1| sugar transporter, putative [Ricinus communis]
 gb|EEF41781.1| sugar transporter, putative [Ricinus communis]
Length=740

 Score =   330 bits (847),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 191/204 (94%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M+GAVLVA+AA +GN LQGWDNATIAGAV+YIK+E  LE+   +EGL+VA SLIGATLIT
Sbjct  1    MSGAVLVAVAAAVGNLLQGWDNATIAGAVLYIKREFNLESEPTIEGLIVATSLIGATLIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            TCSG+I+DWLGRRPMLI+SS+ YFLSG++MLWSPNVY+LL+ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TCSGAISDWLGRRPMLIISSVLYFLSGVVMLWSPNVYILLLARLLDGFGIGLAVTLVPVY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRGLLNTLPQFTGSGGMFL+YCM+FGMS+TTAPSWRLMLGVL IPSL+Y AL
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSGGMFLSYCMVFGMSLTTAPSWRLMLGVLFIPSLIYLAL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            T+FYLPESPRWLVSKGRM+ AKRV
Sbjct  181  TLFYLPESPRWLVSKGRMLEAKRV  204



>ref|XP_006306868.1| hypothetical protein CARUB_v10008415mg [Capsella rubella]
 ref|XP_006306869.1| hypothetical protein CARUB_v10008415mg [Capsella rubella]
 ref|XP_006306870.1| hypothetical protein CARUB_v10008415mg [Capsella rubella]
 gb|EOA39766.1| hypothetical protein CARUB_v10008415mg [Capsella rubella]
 gb|EOA39767.1| hypothetical protein CARUB_v10008415mg [Capsella rubella]
 gb|EOA39768.1| hypothetical protein CARUB_v10008415mg [Capsella rubella]
Length=736

 Score =   330 bits (846),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 162/202 (80%), Positives = 180/202 (89%), Gaps = 0/202 (0%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  266
            M GA LVA+AATIGNFLQGWDNATIAGA+VYI K+L L T ++GLVVAMSLIGAT+ITTC
Sbjct  1    MKGATLVALAATIGNFLQGWDNATIAGAMVYINKDLNLPTSVQGLVVAMSLIGATVITTC  60

Query  267  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  446
            SG I+DWLGRRPMLILSS+ YF+ GLIMLWSPNVYVL  ARLL+GFG GLAVTLVP+YIS
Sbjct  61   SGPISDWLGRRPMLILSSVMYFVCGLIMLWSPNVYVLCFARLLNGFGAGLAVTLVPVYIS  120

Query  447  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  626
            ETAP EIRG LNTLPQF GSGGMFL+YCM+F MS++ +PSWR MLGVLSIPSL+Y  L+V
Sbjct  121  ETAPPEIRGQLNTLPQFLGSGGMFLSYCMVFTMSLSDSPSWRGMLGVLSIPSLVYLCLSV  180

Query  627  FYLPESPRWLVSKGRMVXAKRV  692
            FYLPESPRWLVSKGRM  AKRV
Sbjct  181  FYLPESPRWLVSKGRMDEAKRV  202



>ref|XP_007210337.1| hypothetical protein PRUPE_ppa001932mg [Prunus persica]
 ref|XP_007210338.1| hypothetical protein PRUPE_ppa001932mg [Prunus persica]
 gb|EMJ11536.1| hypothetical protein PRUPE_ppa001932mg [Prunus persica]
 gb|EMJ11537.1| hypothetical protein PRUPE_ppa001932mg [Prunus persica]
Length=739

 Score =   330 bits (845),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 159/202 (79%), Positives = 184/202 (91%), Gaps = 0/202 (0%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  266
            M GAV+VAIAATIGN LQGWDNATIAGA+VYI ++  L + +EGLVVAMSLIGAT ITTC
Sbjct  1    MRGAVMVAIAATIGNLLQGWDNATIAGAIVYITEDFDLGSSLEGLVVAMSLIGATAITTC  60

Query  267  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  446
            SG I+D +GR+PMLI SS+ YF+SGL+M+WSPNVYVL IARLLDGFGIGLAVTLVPLYIS
Sbjct  61   SGVISDSIGRKPMLIASSVLYFVSGLVMVWSPNVYVLCIARLLDGFGIGLAVTLVPLYIS  120

Query  447  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  626
            ETAP++IRG LNTLPQF GSGGMFL+YCM+FGMS+  +P+WRLMLGVLSIPS+++FALTV
Sbjct  121  ETAPADIRGSLNTLPQFLGSGGMFLSYCMVFGMSLMNSPNWRLMLGVLSIPSIIFFALTV  180

Query  627  FYLPESPRWLVSKGRMVXAKRV  692
            FYLPESPRWLVSKGRM+ AK+V
Sbjct  181  FYLPESPRWLVSKGRMLEAKKV  202



>ref|XP_010686712.1| PREDICTED: monosaccharide-sensing protein 2 [Beta vulgaris subsp. 
vulgaris]
Length=735

 Score =   329 bits (844),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 157/202 (78%), Positives = 181/202 (90%), Gaps = 0/202 (0%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  266
            M GAVLVA+AATIGNFLQGWDNATIAG+++YIKKEL L T MEGLVVAMSLIGAT+ITTC
Sbjct  1    MKGAVLVALAATIGNFLQGWDNATIAGSILYIKKELELSTAMEGLVVAMSLIGATVITTC  60

Query  267  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  446
            SG+++D +GRRP+L+LS+  YF+  L+MLWSPNVY+LL+ARLLDGFGIGLAVTLVP+YIS
Sbjct  61   SGAVSDAVGRRPLLMLSASLYFIGSLVMLWSPNVYILLLARLLDGFGIGLAVTLVPVYIS  120

Query  447  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  626
            ET+P EIRGLLNTLPQFTGSGGMFL+YCMIFGMS+  +PSWR+MLGVL IPS+ Y     
Sbjct  121  ETSPPEIRGLLNTLPQFTGSGGMFLSYCMIFGMSLMASPSWRIMLGVLGIPSVFYLLFAF  180

Query  627  FYLPESPRWLVSKGRMVXAKRV  692
            FYLPESPRWLVSKGRM  AK+V
Sbjct  181  FYLPESPRWLVSKGRMSEAKKV  202



>ref|XP_009110209.1| PREDICTED: monosaccharide-sensing protein 1 [Brassica rapa]
Length=726

 Score =   328 bits (842),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 162/202 (80%), Positives = 180/202 (89%), Gaps = 0/202 (0%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  266
            M GA LVA+AATIGNFLQGWDNATIAGA+VYI K++ L T ++GLVVAMSLIGAT+ITTC
Sbjct  1    MKGATLVALAATIGNFLQGWDNATIAGAMVYINKDMNLPTSVQGLVVAMSLIGATVITTC  60

Query  267  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  446
            SG I+DWLGRRPMLILSS+ YFLSGLIM WSP+VYVL +ARLLDGFG GLAVTLVP+YIS
Sbjct  61   SGPISDWLGRRPMLILSSVMYFLSGLIMWWSPSVYVLCLARLLDGFGAGLAVTLVPVYIS  120

Query  447  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  626
            ETAP EIRG LNTLPQF GSGGMFL+YCM+F MS++ APSWR MLGVLSIPSL+Y   TV
Sbjct  121  ETAPPEIRGQLNTLPQFLGSGGMFLSYCMVFTMSLSEAPSWRGMLGVLSIPSLVYLFFTV  180

Query  627  FYLPESPRWLVSKGRMVXAKRV  692
            FYLPESPRWLVSKGRM  AK+V
Sbjct  181  FYLPESPRWLVSKGRMDEAKKV  202



>emb|CDX96618.1| BnaA08g21610D [Brassica napus]
Length=725

 Score =   328 bits (841),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 162/202 (80%), Positives = 180/202 (89%), Gaps = 0/202 (0%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  266
            M GA LVA+AATIGNFLQGWDNATIAGA+VYI K++ L T ++GLVVAMSLIGAT+ITTC
Sbjct  1    MKGATLVALAATIGNFLQGWDNATIAGAMVYINKDMNLPTSVQGLVVAMSLIGATVITTC  60

Query  267  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  446
            SG I+DWLGRRPMLILSS+ YFLSGLIM WSP+VYVL +ARLLDGFG GLAVTLVP+YIS
Sbjct  61   SGPISDWLGRRPMLILSSVMYFLSGLIMWWSPSVYVLCLARLLDGFGAGLAVTLVPVYIS  120

Query  447  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  626
            ETAP EIRG LNTLPQF GSGGMFL+YCM+F MS++ APSWR MLGVLSIPSL+Y   TV
Sbjct  121  ETAPPEIRGQLNTLPQFLGSGGMFLSYCMVFTMSLSEAPSWRGMLGVLSIPSLVYLFFTV  180

Query  627  FYLPESPRWLVSKGRMVXAKRV  692
            FYLPESPRWLVSKGRM  AK+V
Sbjct  181  FYLPESPRWLVSKGRMDEAKKV  202



>gb|EPS65490.1| hypothetical protein M569_09283 [Genlisea aurea]
Length=734

 Score =   328 bits (840),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 168/202 (83%), Positives = 185/202 (92%), Gaps = 0/202 (0%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  266
            M GA LVAIAA IGNFLQGWDNATIA AVVYIK+E  L   +EGLVVA SLIGAT+ITTC
Sbjct  1    MKGAALVAIAAAIGNFLQGWDNATIAAAVVYIKREEHLGASVEGLVVATSLIGATVITTC  60

Query  267  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  446
            SG+I+D +GRRPML+LSS+FYF+ GLIMLWSPNVY+LL+ARLLDGFGIGLAVTLVPLYIS
Sbjct  61   SGTISDAVGRRPMLVLSSVFYFIGGLIMLWSPNVYILLLARLLDGFGIGLAVTLVPLYIS  120

Query  447  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  626
            ETAPS+IRGLLNTLPQFTGSGGMFL+YCMIFGMS++ +PSWRLMLGVLSIPSLLYF LTV
Sbjct  121  ETAPSDIRGLLNTLPQFTGSGGMFLSYCMIFGMSLSPSPSWRLMLGVLSIPSLLYFVLTV  180

Query  627  FYLPESPRWLVSKGRMVXAKRV  692
             +LPESPRWLVSKGRM  AKRV
Sbjct  181  LFLPESPRWLVSKGRMAEAKRV  202



>ref|XP_009401004.1| PREDICTED: monosaccharide-sensing protein 2-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009401005.1| PREDICTED: monosaccharide-sensing protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=738

 Score =   327 bits (839),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 159/204 (78%), Positives = 184/204 (90%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  260
            M GAVLVAIAA+IGN LQGWDNATIAG+++YIKKE  L  E  +EGL+VAMSLIGAT+IT
Sbjct  1    MRGAVLVAIAASIGNLLQGWDNATIAGSILYIKKEFKLDSEPTIEGLIVAMSLIGATIIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG ++DW+GRRPMLI+SS+ YFLSGL+MLWSPNVYVLL+ARL+DGFGIGLAVTLVP+Y
Sbjct  61   TFSGPVSDWVGRRPMLIISSILYFLSGLVMLWSPNVYVLLLARLIDGFGIGLAVTLVPVY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRG LNTLPQF+GSGGMF++YCM+F MS+     WR+MLGVLSIPSLLYFAL
Sbjct  121  ISETAPPEIRGSLNTLPQFSGSGGMFISYCMVFAMSLMVNSDWRVMLGVLSIPSLLYFAL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            T+F+LPESPRWLVSKGRMV AK+V
Sbjct  181  TIFFLPESPRWLVSKGRMVEAKQV  204



>ref|XP_003574265.1| PREDICTED: monosaccharide-sensing protein 2-like [Brachypodium 
distachyon]
Length=741

 Score =   327 bits (839),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 160/204 (78%), Positives = 187/204 (92%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M+GAVLVAIAA+IGN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGAT+IT
Sbjct  1    MSGAVLVAIAASIGNLLQGWDNATIAGAVLYIKKEFSLESQPLIEGLIVAMSLIGATVIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG++AD +GRRP+LI S++ YF+SGL+MLW+P+VYVLL+ARL+DGFGIGLAVTLVPLY
Sbjct  61   TFSGAVADAVGRRPLLIASAVLYFVSGLVMLWAPSVYVLLLARLIDGFGIGLAVTLVPLY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP++IRGLLNTLPQF+GSGGMFL+YCM+F MS+   P WR+MLGVLSIPSL+YFAL
Sbjct  121  ISETAPTDIRGLLNTLPQFSGSGGMFLSYCMVFTMSLMPQPDWRIMLGVLSIPSLIYFAL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            TVFYLPESPRWLVSKGRM  AKRV
Sbjct  181  TVFYLPESPRWLVSKGRMAEAKRV  204



>gb|KDP47010.1| hypothetical protein JCGZ_10737 [Jatropha curcas]
Length=740

 Score =   327 bits (839),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 164/204 (80%), Positives = 188/204 (92%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M+GAVLVA+ A +GN LQGWDNATIAGAV+YIK+E  LE+   +EGL+VAMSLIGATLIT
Sbjct  1    MSGAVLVAVVAAVGNLLQGWDNATIAGAVLYIKREFQLESEPTIEGLIVAMSLIGATLIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            TCSG+I+DWLGRRPMLI+SS+ Y +SG++M WSPNVYVLL+ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TCSGAISDWLGRRPMLIISSVLYCVSGIVMFWSPNVYVLLLARLLDGFGIGLAVTLVPVY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRGLLNTLPQFTGSGGMFL+YCM+FGMS+T APSWRLMLGVLSIPS+ Y AL
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSGGMFLSYCMVFGMSLTKAPSWRLMLGVLSIPSVAYLAL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            T+FYLPESPRWLVSKGRM+ AK+V
Sbjct  181  TIFYLPESPRWLVSKGRMLEAKKV  204



>ref|XP_004951395.1| PREDICTED: monosaccharide-sensing protein 2-like [Setaria italica]
Length=745

 Score =   327 bits (839),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 161/204 (79%), Positives = 183/204 (90%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  260
            M+GAVLVAIAA+IGN LQGWDNATIAGAV+YIKKE  L  E  +EGL+VAMSLIGAT+IT
Sbjct  1    MSGAVLVAIAASIGNLLQGWDNATIAGAVLYIKKEFNLQSEPTVEGLIVAMSLIGATIIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG ++D +GRRPMLILSS+ YF S LIMLWSPNVYVLL+ARL+DGFGIGLAVTLVPLY
Sbjct  61   TFSGPVSDLIGRRPMLILSSILYFCSSLIMLWSPNVYVLLLARLVDGFGIGLAVTLVPLY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRGLLNTLPQF+GSGGMFL+YCM+FGMS+  +P WR+MLGVL+IPSL +F L
Sbjct  121  ISETAPPEIRGLLNTLPQFSGSGGMFLSYCMVFGMSLLPSPDWRIMLGVLAIPSLFFFGL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            T+FYLPESPRWLVSKGRM  AK+V
Sbjct  181  TIFYLPESPRWLVSKGRMAEAKKV  204



>ref|XP_010940242.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
Length=745

 Score =   327 bits (838),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 159/204 (78%), Positives = 182/204 (89%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M GA LVAIAA+IGN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGAT+IT
Sbjct  1    MRGAALVAIAASIGNLLQGWDNATIAGAVLYIKKEFNLESEPTIEGLIVAMSLIGATIIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
              SG+I+DW GRRPMLI+SS+FYF SGL+MLWSPNVY+LL+ARL+DGFG+GLAVTLVP+Y
Sbjct  61   MFSGAISDWGGRRPMLIVSSIFYFFSGLVMLWSPNVYILLLARLIDGFGVGLAVTLVPVY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRGLLNTLPQFTGS GMFL+YCM+FGMS+     WR+MLGVLSIPSL YFAL
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSAGMFLSYCMVFGMSLMVQHDWRVMLGVLSIPSLFYFAL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            T+F+LPESPRWLVSKGRM  AK+V
Sbjct  181  TIFFLPESPRWLVSKGRMTEAKQV  204



>gb|AJO70165.1| tonoplast monosaccharide transporters 1 [Camellia sinensis]
Length=736

 Score =   327 bits (837),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 155/189 (82%), Positives = 178/189 (94%), Gaps = 0/189 (0%)
 Frame = +3

Query  126  GNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTCSGSIADWLGRRPM  305
            GNFLQGWDNATIAGA+VYIK++L LET +EGLVVAMSLIGATL+TTCSG I+D +GRRPM
Sbjct  14   GNFLQGWDNATIAGAIVYIKEDLSLETTIEGLVVAMSLIGATLVTTCSGPISDLIGRRPM  73

Query  306  LILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYISETAPSEIRGLLNT  485
            LI+SSMFYF+SGL+MLWSPNVYVLL+ARL+DGFGIGLAVTLVP+YISETAP++IRGLLNT
Sbjct  74   LIMSSMFYFVSGLVMLWSPNVYVLLVARLIDGFGIGLAVTLVPVYISETAPADIRGLLNT  133

Query  486  LPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTVFYLPESPRWLVSK  665
             PQF GS  MFLAYCMIFGMS+ T+P+WR+MLGVLSIPSL+YFAL +FYLPESPRWLVSK
Sbjct  134  FPQFAGSFAMFLAYCMIFGMSLMTSPNWRVMLGVLSIPSLVYFALAIFYLPESPRWLVSK  193

Query  666  GRMVXAKRV  692
            GRM+ AK+V
Sbjct  194  GRMLEAKQV  202



>gb|KDO68405.1| hypothetical protein CISIN_1g004750mg [Citrus sinensis]
Length=560

 Score =   322 bits (824),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 157/190 (83%), Positives = 174/190 (92%), Gaps = 2/190 (1%)
 Frame = +3

Query  129  NFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLITTCSGSIADWLGRRP  302
            N LQGWDNATIAGAV+YIK+E  LET   +EGL+VAMSLIGAT ITTCSG+IADWLGRRP
Sbjct  15   NLLQGWDNATIAGAVLYIKREFHLETEPTIEGLIVAMSLIGATCITTCSGAIADWLGRRP  74

Query  303  MLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYISETAPSEIRGLLN  482
            MLI+SS+ YF+ GL+MLWSPNVYVLL+ARLLDGFGIGLAVTLVP+YISETAP EIRGLLN
Sbjct  75   MLIVSSVLYFIGGLVMLWSPNVYVLLLARLLDGFGIGLAVTLVPIYISETAPPEIRGLLN  134

Query  483  TLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTVFYLPESPRWLVS  662
            TLPQFTG  GMFLAYCM+FGMS+ TAPSWRLMLGVL IPSL+YF LT+FYLPESPRWLVS
Sbjct  135  TLPQFTGCVGMFLAYCMVFGMSLMTAPSWRLMLGVLFIPSLIYFVLTIFYLPESPRWLVS  194

Query  663  KGRMVXAKRV  692
            KGRM+ AK+V
Sbjct  195  KGRMLEAKKV  204



>ref|XP_007201798.1| hypothetical protein PRUPE_ppa001957mg [Prunus persica]
 ref|XP_007201799.1| hypothetical protein PRUPE_ppa001957mg [Prunus persica]
 ref|XP_007201800.1| hypothetical protein PRUPE_ppa001957mg [Prunus persica]
 gb|EMJ02997.1| hypothetical protein PRUPE_ppa001957mg [Prunus persica]
 gb|EMJ02998.1| hypothetical protein PRUPE_ppa001957mg [Prunus persica]
 gb|EMJ02999.1| hypothetical protein PRUPE_ppa001957mg [Prunus persica]
Length=736

 Score =   326 bits (836),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 164/204 (80%), Positives = 187/204 (92%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M+GAVLVA+ A IGN LQGWDNATIA +V+YIKKE  LE+   +EGL+VAMSLIGATLIT
Sbjct  1    MSGAVLVAVVAAIGNLLQGWDNATIAASVLYIKKEFKLESEPAVEGLIVAMSLIGATLIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            TCSG+IADWLGRRP+LI+SS+ YF SG++MLW+PNVY+LL+ARLLDGFGIGL VTLVPLY
Sbjct  61   TCSGAIADWLGRRPVLIISSVLYFFSGIVMLWAPNVYILLLARLLDGFGIGLVVTLVPLY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRG LNTLPQFTGSGGMFL+YCM+FGMS+T +PSWRLMLGVLSIPSL+YFAL
Sbjct  121  ISETAPPEIRGSLNTLPQFTGSGGMFLSYCMVFGMSLTKSPSWRLMLGVLSIPSLVYFAL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            TVF+LPESPRWLVSKGRM+ AK V
Sbjct  181  TVFFLPESPRWLVSKGRMLEAKHV  204



>gb|KJB79728.1| hypothetical protein B456_013G064200 [Gossypium raimondii]
Length=739

 Score =   326 bits (836),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 185/204 (91%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  260
            MNGAVLVA+AA IGN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGAT IT
Sbjct  1    MNGAVLVALAAAIGNMLQGWDNATIAGAVLYIKKEFKLESAPTIEGLIVAMSLIGATCIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            TCSG I+DWLGRRPMLI+SS+ YFLSGL+M+WSPNVY+LL+ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TCSGGISDWLGRRPMLIISSVLYFLSGLVMVWSPNVYILLLARLLDGFGIGLAVTLVPVY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRGLLNTLPQFTGS GMFL+YCM+FGMS++  PSWRLMLGVLSIPSL YF L
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSIGMFLSYCMVFGMSLSELPSWRLMLGVLSIPSLAYFGL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            TVFYLPESPRWLVSKGRM  AK V
Sbjct  181  TVFYLPESPRWLVSKGRMNEAKAV  204



>gb|KHG05233.1| Monosaccharide-sensing 2 -like protein [Gossypium arboreum]
Length=739

 Score =   326 bits (836),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 185/204 (91%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  260
            MNGAVLVA+AA IGN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGAT IT
Sbjct  1    MNGAVLVALAAAIGNMLQGWDNATIAGAVLYIKKEFKLESAPTIEGLIVAMSLIGATCIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            TCSG I+DWLGRRPMLI+SS+ YFLSGL+M+WSPNVY+LL+ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TCSGGISDWLGRRPMLIISSVLYFLSGLVMVWSPNVYILLLARLLDGFGIGLAVTLVPVY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRGLLNTLPQFTGS GMFL+YCM+FGMS++  PSWRLMLGVLSIPSL YF L
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSIGMFLSYCMVFGMSLSELPSWRLMLGVLSIPSLAYFGL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            TVFYLPESPRWLVSKGRM  AK V
Sbjct  181  TVFYLPESPRWLVSKGRMNEAKAV  204



>ref|NP_001151936.1| LOC100285573 [Zea mays]
 ref|XP_008680244.1| PREDICTED: LOC100285573 isoform X1 [Zea mays]
 gb|ACG45075.1| hexose transporter [Zea mays]
 tpg|DAA46098.1| TPA: hexose transporter isoform 1 [Zea mays]
 tpg|DAA46099.1| TPA: hexose transporter isoform 2 [Zea mays]
Length=747

 Score =   326 bits (836),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 159/204 (78%), Positives = 184/204 (90%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  260
            M GAV+VAIAA+IGN LQGWDNATIAGAV+YIKKE  L  E  +EGL+VAMSLIGAT+IT
Sbjct  1    MGGAVMVAIAASIGNLLQGWDNATIAGAVLYIKKEFNLQSEPLIEGLIVAMSLIGATVIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG+ AD +GRRPML+ S++ YF+SGL+MLW+P+VY+LL+ARL+DGFGIGLAVTLVPLY
Sbjct  61   TFSGAAADCVGRRPMLVASAVLYFVSGLVMLWAPSVYILLLARLIDGFGIGLAVTLVPLY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP++IRGLLNTLPQF+GSGGMFL+YCM+FGMS+   P WRLMLGVLSIPSL+YF L
Sbjct  121  ISETAPTDIRGLLNTLPQFSGSGGMFLSYCMVFGMSLMPKPDWRLMLGVLSIPSLIYFGL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            TVFYLPESPRWLVSKGRM  AKRV
Sbjct  181  TVFYLPESPRWLVSKGRMAEAKRV  204



>emb|CDP14489.1| unnamed protein product [Coffea canephora]
Length=742

 Score =   325 bits (834),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 158/204 (77%), Positives = 185/204 (91%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  260
            M+GAVLVAI ATIGN LQGWDNATIAGAV++IK+EL LE+   +EGL+VAMSLIGA L+T
Sbjct  1    MSGAVLVAIGATIGNLLQGWDNATIAGAVLFIKRELKLESDPTVEGLIVAMSLIGAVLVT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T +G +ADWLGRRPMLI+SS+ YF+SGL+M WSPNVYVLL+ RLLDGFG+GLAVTLVP+Y
Sbjct  61   TFAGGVADWLGRRPMLIVSSVLYFVSGLVMFWSPNVYVLLLGRLLDGFGVGLAVTLVPIY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISET+P EIRGLLNTLPQF GS GMFL+YCM+FGMS+T++PSWRLMLGVLSIPS+ YFA+
Sbjct  121  ISETSPPEIRGLLNTLPQFCGSLGMFLSYCMVFGMSLTSSPSWRLMLGVLSIPSIAYFAV  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
             V YLPESPRWLVSKGRM+ AK+V
Sbjct  181  AVLYLPESPRWLVSKGRMIEAKQV  204



>ref|XP_011000869.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
 ref|XP_011000870.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
 ref|XP_011000871.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
Length=740

 Score =   325 bits (833),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 164/204 (80%), Positives = 188/204 (92%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            MNGAVLVA+AA IGN LQGWDNATIAGAV+YIK+E  LE+   +EGL+VA SL+GATLIT
Sbjct  1    MNGAVLVAVAAAIGNLLQGWDNATIAGAVLYIKREFHLESEPTIEGLIVATSLVGATLIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            TCSG I+DWLGRRP+LI+SS+ YF+SGL+MLWSPNVYVLL+ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TCSGPISDWLGRRPLLIISSILYFVSGLVMLWSPNVYVLLLARLLDGFGIGLAVTLVPVY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRGLLNTLPQFTGSGGMFL+YCM+FGMS+  APSWR+MLGVL IPS++YF L
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSGGMFLSYCMVFGMSLMEAPSWRVMLGVLFIPSIIYFLL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            TVF+LPESPRWLVSKGRM+ AK+V
Sbjct  181  TVFFLPESPRWLVSKGRMLEAKKV  204



>ref|XP_010477336.1| PREDICTED: monosaccharide-sensing protein 1 [Camelina sativa]
 ref|XP_010477338.1| PREDICTED: monosaccharide-sensing protein 1 [Camelina sativa]
Length=734

 Score =   324 bits (831),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 159/202 (79%), Positives = 179/202 (89%), Gaps = 0/202 (0%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  266
            M GA LVA+AATIGNFLQGWDNATIAGA+VYI  +L L T ++GLVVAMSLIGAT+ITTC
Sbjct  1    MKGATLVALAATIGNFLQGWDNATIAGAMVYINNDLNLPTSVQGLVVAMSLIGATVITTC  60

Query  267  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  446
            SG I+DWLGRRPMLILSS+ YF+ GLIMLWSPNVYVL  ARLL+GFG GLAVTLVP+YIS
Sbjct  61   SGPISDWLGRRPMLILSSVMYFVCGLIMLWSPNVYVLCFARLLNGFGAGLAVTLVPVYIS  120

Query  447  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  626
            ETAP EIRG LNTLPQF GSGGMFL+YCM+F MS++ +PSWR MLGVLSIPSL+Y  L+V
Sbjct  121  ETAPPEIRGQLNTLPQFLGSGGMFLSYCMVFTMSLSDSPSWRGMLGVLSIPSLVYLFLSV  180

Query  627  FYLPESPRWLVSKGRMVXAKRV  692
            F+LPESPRWLVSKGRM  AK+V
Sbjct  181  FFLPESPRWLVSKGRMDEAKKV  202



>ref|XP_008235816.1| PREDICTED: monosaccharide-sensing protein 2 [Prunus mume]
 ref|XP_008235817.1| PREDICTED: monosaccharide-sensing protein 2 [Prunus mume]
Length=736

 Score =   324 bits (830),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 164/204 (80%), Positives = 188/204 (92%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M+GAVLVA+AA IGN LQGWDNATIA +V+YIKKE  LE+   +EGL+VAMSLIGATLIT
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAASVLYIKKEFKLESDPAVEGLIVAMSLIGATLIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            TC+G+IADWLGRRP+LI+SS+ YFLSG++MLW+PNVY+LL+ARLLDGFGIGL VTLVPLY
Sbjct  61   TCAGAIADWLGRRPVLIISSVLYFLSGIVMLWAPNVYILLLARLLDGFGIGLVVTLVPLY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRG LNTLPQFTGSGGMFL+YCM+FGMS+T  PSWRLMLG+LSIPSL+YFAL
Sbjct  121  ISETAPPEIRGSLNTLPQFTGSGGMFLSYCMVFGMSLTKLPSWRLMLGILSIPSLVYFAL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            TVF+LPESPRWLVSKGRM+ AK V
Sbjct  181  TVFFLPESPRWLVSKGRMLEAKHV  204



>ref|XP_009333794.1| PREDICTED: monosaccharide-sensing protein 2-like [Pyrus x bretschneideri]
Length=736

 Score =   324 bits (830),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 163/204 (80%), Positives = 189/204 (93%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M+GAVLVA+AA IGN LQGWDNATIA +V+YIK+E  LE+   +EGL+VAMSLIGAT++T
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAASVLYIKREFNLESEPAVEGLIVAMSLIGATVVT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
             CSG++ADWLGRRPMLI+SS+ YFLSG++MLWSPNVY+LL+ARLLDGFGIGLAVTLVPLY
Sbjct  61   FCSGAVADWLGRRPMLIISSVLYFLSGIVMLWSPNVYILLLARLLDGFGIGLAVTLVPLY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRG LNTLPQFTGSGGMFL+YCM+FGMS+T +PSWRLMLGVLSIPSL+YF L
Sbjct  121  ISETAPPEIRGSLNTLPQFTGSGGMFLSYCMVFGMSLTESPSWRLMLGVLSIPSLVYFVL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            TVF+LPESPRWLVSKGRM+ AK+V
Sbjct  181  TVFFLPESPRWLVSKGRMLEAKQV  204



>ref|XP_009763350.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
 ref|XP_009763351.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
 ref|XP_009763352.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
Length=734

 Score =   323 bits (829),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 163/204 (80%), Positives = 187/204 (92%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M+GAVLVA+AA IG+FLQGWDNATIAG ++YIKKE  LET   MEGL+V+MSLIGA LIT
Sbjct  1    MSGAVLVAVAAAIGSFLQGWDNATIAGGILYIKKEFKLETQPTMEGLIVSMSLIGAVLIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            TCSG+IADWLGRRP+LI SS+ YF+SGL+MLWSPNVYVLL+ARLLDGFG+GLAVTLVP+Y
Sbjct  61   TCSGAIADWLGRRPLLITSSVLYFISGLVMLWSPNVYVLLLARLLDGFGVGLAVTLVPIY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRGLLNTLPQFTG  GMF +YCM+FGMS+ ++P+WRLMLGVLSIPS+LYF L
Sbjct  121  ISETAPPEIRGLLNTLPQFTGCLGMFFSYCMVFGMSLKSSPTWRLMLGVLSIPSVLYFVL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            T+FYLPESPRWLVSKGRM+ AKRV
Sbjct  181  TIFYLPESPRWLVSKGRMLDAKRV  204



>gb|KJB77474.1| hypothetical protein B456_012G139000 [Gossypium raimondii]
Length=629

 Score =   320 bits (821),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 161/204 (79%), Positives = 187/204 (92%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M+GAVLVA+AA IGN LQGWDNATIAGAV+YIK+E  LE+   +EGL+VAMSLIGAT IT
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAGAVLYIKREFSLESEPTIEGLIVAMSLIGATCIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            TCSG I+DWLGRRPMLI+SS+ Y +SGL+MLWSPNVY+LL+ARLLDGFG+GLAVTLVP+Y
Sbjct  61   TCSGGISDWLGRRPMLIISSVLYCVSGLVMLWSPNVYILLLARLLDGFGVGLAVTLVPVY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRGLLNTLPQFTGS GMFL+YCM+FGMS++  P+WRLMLGVLSIPSL+YF L
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSIGMFLSYCMVFGMSLSELPNWRLMLGVLSIPSLIYFIL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            T+F+LPESPRWLVSKGRM+ AK+V
Sbjct  181  TIFFLPESPRWLVSKGRMIEAKKV  204



>ref|XP_008645619.1| PREDICTED: monosaccharide-sensing protein 2-like [Zea mays]
 ref|XP_008645620.1| PREDICTED: monosaccharide-sensing protein 2-like [Zea mays]
 gb|AFW59275.1| LOW QUALITY PROTEIN: hypothetical protein ZEAMMB73_154299 [Zea 
mays]
 gb|AFW71237.1| hypothetical protein ZEAMMB73_210614 [Zea mays]
Length=745

 Score =   323 bits (829),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 157/204 (77%), Positives = 182/204 (89%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  260
            M+GAVLVAI A+IGN LQGWDNATIA AV+YIKKE  L  E  +EGL+V+MSLIGAT++T
Sbjct  1    MSGAVLVAIVASIGNLLQGWDNATIAAAVLYIKKEFQLQNEPTVEGLIVSMSLIGATIVT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG ++D +GRRPMLILSS+ YF SGLIMLWSPNVYVLL+AR +DGFGIGLAVTLVPLY
Sbjct  61   TFSGPLSDSIGRRPMLILSSILYFFSGLIMLWSPNVYVLLLARFVDGFGIGLAVTLVPLY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISE APSEIRGLLNTLPQF+GSGGMFL+YCM+FGMS++ +P WR+MLGVL+IPSL +F L
Sbjct  121  ISEIAPSEIRGLLNTLPQFSGSGGMFLSYCMVFGMSLSPSPDWRIMLGVLAIPSLFFFGL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            T+FYLPESPRWLVSKGRM  AK+V
Sbjct  181  TIFYLPESPRWLVSKGRMAEAKKV  204



>ref|XP_004983796.1| PREDICTED: monosaccharide-sensing protein 2-like [Setaria italica]
Length=739

 Score =   323 bits (828),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 159/204 (78%), Positives = 183/204 (90%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  260
            M GAVLVAIAA+IGN LQGWDNATIAGAV+YIKKE  L  E  +EGL+VAMSL GAT++T
Sbjct  1    MGGAVLVAIAASIGNLLQGWDNATIAGAVLYIKKEFNLQSEPLIEGLIVAMSLFGATVVT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG++AD +GRRPMLI S++ YF+SGL MLW+P+VYVLL+ARL+DG GIGLAVTLVPLY
Sbjct  61   TFSGALADSIGRRPMLIASAVLYFVSGLFMLWAPSVYVLLLARLIDGLGIGLAVTLVPLY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP++IRGLLNTLPQF+GSGGMFL+YCM+FGMS+   P WR+MLGVLSIPSL+YFAL
Sbjct  121  ISETAPTDIRGLLNTLPQFSGSGGMFLSYCMVFGMSLLPKPDWRIMLGVLSIPSLIYFAL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            TVFYLPESPRWLVSKGRM  AKRV
Sbjct  181  TVFYLPESPRWLVSKGRMAEAKRV  204



>ref|XP_010548175.1| PREDICTED: monosaccharide-sensing protein 2 [Tarenaya hassleriana]
 ref|XP_010548176.1| PREDICTED: monosaccharide-sensing protein 2 [Tarenaya hassleriana]
 ref|XP_010548177.1| PREDICTED: monosaccharide-sensing protein 2 [Tarenaya hassleriana]
 ref|XP_010548178.1| PREDICTED: monosaccharide-sensing protein 2 [Tarenaya hassleriana]
Length=742

 Score =   323 bits (828),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 165/204 (81%), Positives = 186/204 (91%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M+GAVLVA+AA IGNFLQGWDNATIAGAV+YIKKE  LE+   +EGL+VA SLIGATLIT
Sbjct  1    MSGAVLVAVAAAIGNFLQGWDNATIAGAVLYIKKEFDLESEPTIEGLIVATSLIGATLIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            TCSG I+DWLGRRPMLI+SS+ YF+  L MLWSPNVYVLL+ RLLDGFG+GLAVTLVP+Y
Sbjct  61   TCSGGISDWLGRRPMLIISSVLYFVGALTMLWSPNVYVLLLGRLLDGFGVGLAVTLVPVY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAPSEIRGLLNTLPQFTGSGGMF++YCM+FGMS+  +PSWRLMLGVL IPSLLY AL
Sbjct  121  ISETAPSEIRGLLNTLPQFTGSGGMFISYCMVFGMSLMQSPSWRLMLGVLFIPSLLYSAL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            T+F+LPESPRWLVSKGRM+ AKRV
Sbjct  181  TIFFLPESPRWLVSKGRMLEAKRV  204



>ref|XP_010680636.1| PREDICTED: monosaccharide-sensing protein 2-like [Beta vulgaris 
subsp. vulgaris]
Length=728

 Score =   323 bits (827),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 157/204 (77%), Positives = 179/204 (88%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M GAV  A+AAT+GN LQGWDNATIAGAV+YIK+E  LET   +EGL+VAMSLIGAT+IT
Sbjct  1    MRGAVFAALAATMGNLLQGWDNATIAGAVIYIKREFSLETQPTLEGLIVAMSLIGATVIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG ++D +GRRPMLI+SS+ YFL GL+MLWSPNVYVLL+ RLLDGFG+GLAVTLVP+Y
Sbjct  61   TFSGPVSDSVGRRPMLIISSILYFLGGLVMLWSPNVYVLLLGRLLDGFGVGLAVTLVPVY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRG LNTLPQFTGSGGMFL+YCM+FGMS+  AP WRLMLGV+SIPSLLY  L
Sbjct  121  ISETAPPEIRGQLNTLPQFTGSGGMFLSYCMVFGMSLMEAPRWRLMLGVISIPSLLYLGL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
             VFYLPESPRWLVSKG+M  AK+V
Sbjct  181  MVFYLPESPRWLVSKGKMHEAKKV  204



>ref|XP_006486570.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Citrus 
sinensis]
 ref|XP_006486571.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Citrus 
sinensis]
Length=732

 Score =   322 bits (826),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 157/190 (83%), Positives = 174/190 (92%), Gaps = 2/190 (1%)
 Frame = +3

Query  129  NFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLITTCSGSIADWLGRRP  302
            N LQGWDNATIAGAV+YIK+E  LET   +EGL+VAMSLIGAT ITTCSG+IADWLGRRP
Sbjct  15   NLLQGWDNATIAGAVLYIKREFHLETEPTIEGLIVAMSLIGATCITTCSGAIADWLGRRP  74

Query  303  MLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYISETAPSEIRGLLN  482
            MLI+SS+ YF+ GL+MLWSPNVYVLL+ARLLDGFGIGLAVTLVP+YISETAP EIRGLLN
Sbjct  75   MLIISSVLYFIGGLVMLWSPNVYVLLLARLLDGFGIGLAVTLVPIYISETAPPEIRGLLN  134

Query  483  TLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTVFYLPESPRWLVS  662
            TLPQFTG  GMFLAYCM+FGMS+ TAPSWRLMLGVL IPSL+YF LT+FYLPESPRWLVS
Sbjct  135  TLPQFTGCVGMFLAYCMVFGMSLMTAPSWRLMLGVLFIPSLIYFVLTIFYLPESPRWLVS  194

Query  663  KGRMVXAKRV  692
            KGRM+ AK+V
Sbjct  195  KGRMLEAKKV  204



>ref|XP_010090703.1| Monosaccharide-sensing protein 2 [Morus notabilis]
 gb|EXB40422.1| Monosaccharide-sensing protein 2 [Morus notabilis]
Length=740

 Score =   322 bits (826),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 163/204 (80%), Positives = 188/204 (92%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M+GAVLVAIAA +GN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VA SLIGATLIT
Sbjct  1    MSGAVLVAIAAAVGNLLQGWDNATIAGAVLYIKKEFHLESQPTLEGLIVATSLIGATLIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            TCSG+IADWLGRRP+LI+SS+ YFLSG++MLWSPNVY LL+ARLLDGFG+GLAVTLVP+Y
Sbjct  61   TCSGAIADWLGRRPLLIISSILYFLSGILMLWSPNVYFLLLARLLDGFGVGLAVTLVPVY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRGLLNTLPQF GSGGMFL+YCM+FGMS++ +P+WRLMLGVLSIPS++YF  
Sbjct  121  ISETAPPEIRGLLNTLPQFAGSGGMFLSYCMVFGMSLSESPNWRLMLGVLSIPSVIYFLF  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            TVFYLPESPRWLVSKGRM+ AK+V
Sbjct  181  TVFYLPESPRWLVSKGRMLEAKKV  204



>ref|XP_006422393.1| hypothetical protein CICLE_v10027893mg [Citrus clementina]
 gb|ESR35633.1| hypothetical protein CICLE_v10027893mg [Citrus clementina]
Length=732

 Score =   322 bits (825),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 157/190 (83%), Positives = 174/190 (92%), Gaps = 2/190 (1%)
 Frame = +3

Query  129  NFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLITTCSGSIADWLGRRP  302
            N LQGWDNATIAGAV+YIK+E  LET   +EGL+VAMSLIGAT ITTCSG+IADWLGRRP
Sbjct  15   NLLQGWDNATIAGAVLYIKREFHLETEPTIEGLIVAMSLIGATCITTCSGAIADWLGRRP  74

Query  303  MLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYISETAPSEIRGLLN  482
            MLI+SS+ YF+ GL+MLWSPNVYVLL+ARLLDGFGIGLAVTLVP+YISETAP EIRGLLN
Sbjct  75   MLIVSSVLYFIGGLVMLWSPNVYVLLLARLLDGFGIGLAVTLVPIYISETAPPEIRGLLN  134

Query  483  TLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTVFYLPESPRWLVS  662
            TLPQFTG  GMFLAYCM+FGMS+ TAPSWRLMLGVL IPSL+YF LT+FYLPESPRWLVS
Sbjct  135  TLPQFTGCVGMFLAYCMVFGMSLMTAPSWRLMLGVLFIPSLIYFVLTIFYLPESPRWLVS  194

Query  663  KGRMVXAKRV  692
            KGRM+ AK+V
Sbjct  195  KGRMLEAKKV  204



>gb|KDO68402.1| hypothetical protein CISIN_1g004750mg [Citrus sinensis]
 gb|KDO68403.1| hypothetical protein CISIN_1g004750mg [Citrus sinensis]
 gb|KDO68404.1| hypothetical protein CISIN_1g004750mg [Citrus sinensis]
Length=732

 Score =   322 bits (825),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 157/190 (83%), Positives = 174/190 (92%), Gaps = 2/190 (1%)
 Frame = +3

Query  129  NFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLITTCSGSIADWLGRRP  302
            N LQGWDNATIAGAV+YIK+E  LET   +EGL+VAMSLIGAT ITTCSG+IADWLGRRP
Sbjct  15   NLLQGWDNATIAGAVLYIKREFHLETEPTIEGLIVAMSLIGATCITTCSGAIADWLGRRP  74

Query  303  MLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYISETAPSEIRGLLN  482
            MLI+SS+ YF+ GL+MLWSPNVYVLL+ARLLDGFGIGLAVTLVP+YISETAP EIRGLLN
Sbjct  75   MLIVSSVLYFIGGLVMLWSPNVYVLLLARLLDGFGIGLAVTLVPIYISETAPPEIRGLLN  134

Query  483  TLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTVFYLPESPRWLVS  662
            TLPQFTG  GMFLAYCM+FGMS+ TAPSWRLMLGVL IPSL+YF LT+FYLPESPRWLVS
Sbjct  135  TLPQFTGCVGMFLAYCMVFGMSLMTAPSWRLMLGVLFIPSLIYFVLTIFYLPESPRWLVS  194

Query  663  KGRMVXAKRV  692
            KGRM+ AK+V
Sbjct  195  KGRMLEAKKV  204



>ref|XP_009359629.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Pyrus 
x bretschneideri]
Length=753

 Score =   322 bits (825),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 184/204 (90%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M GAV VAIAA IGN LQGWDNATIAGAV+YIK+E  LE+   +EGL+VAMSLIGAT+IT
Sbjct  1    MRGAVFVAIAAAIGNLLQGWDNATIAGAVLYIKREFKLESQPTIEGLIVAMSLIGATVIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG ++D LGRRPMLI+SS+ YFLSGL+MLW+PNVYVLL+ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TFSGPVSDSLGRRPMLIISSVLYFLSGLVMLWAPNVYVLLLARLLDGFGIGLAVTLVPVY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRGLLNTLPQFTGSGGMF +YCM+FGMS+  APSWRLMLGVLSIPSLLYF L
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSGGMFFSYCMVFGMSLMDAPSWRLMLGVLSIPSLLYFGL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            TVFYLPESPRWLVSKGRM  AK+V
Sbjct  181  TVFYLPESPRWLVSKGRMAEAKKV  204



>ref|XP_009359631.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X3 [Pyrus 
x bretschneideri]
Length=742

 Score =   322 bits (824),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 184/204 (90%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M GAV VAIAA IGN LQGWDNATIAGAV+YIK+E  LE+   +EGL+VAMSLIGAT+IT
Sbjct  1    MRGAVFVAIAAAIGNLLQGWDNATIAGAVLYIKREFKLESQPTIEGLIVAMSLIGATVIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG ++D LGRRPMLI+SS+ YFLSGL+MLW+PNVYVLL+ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TFSGPVSDSLGRRPMLIISSVLYFLSGLVMLWAPNVYVLLLARLLDGFGIGLAVTLVPVY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRGLLNTLPQFTGSGGMF +YCM+FGMS+  APSWRLMLGVLSIPSLLYF L
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSGGMFFSYCMVFGMSLMDAPSWRLMLGVLSIPSLLYFGL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            TVFYLPESPRWLVSKGRM  AK+V
Sbjct  181  TVFYLPESPRWLVSKGRMAEAKKV  204



>ref|XP_009359630.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Pyrus 
x bretschneideri]
Length=743

 Score =   322 bits (824),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 184/204 (90%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M GAV VAIAA IGN LQGWDNATIAGAV+YIK+E  LE+   +EGL+VAMSLIGAT+IT
Sbjct  1    MRGAVFVAIAAAIGNLLQGWDNATIAGAVLYIKREFKLESQPTIEGLIVAMSLIGATVIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG ++D LGRRPMLI+SS+ YFLSGL+MLW+PNVYVLL+ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TFSGPVSDSLGRRPMLIISSVLYFLSGLVMLWAPNVYVLLLARLLDGFGIGLAVTLVPVY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRGLLNTLPQFTGSGGMF +YCM+FGMS+  APSWRLMLGVLSIPSLLYF L
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSGGMFFSYCMVFGMSLMDAPSWRLMLGVLSIPSLLYFGL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            TVFYLPESPRWLVSKGRM  AK+V
Sbjct  181  TVFYLPESPRWLVSKGRMAEAKKV  204



>gb|KJB12352.1| hypothetical protein B456_002G014400 [Gossypium raimondii]
Length=592

 Score =   317 bits (813),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 158/204 (77%), Positives = 187/204 (92%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M GAVLVA+AA IGNFLQGWD ATIAGAV+Y+K+E  LE+   +EGL++AMSLIGAT IT
Sbjct  1    MGGAVLVAVAAAIGNFLQGWDTATIAGAVLYVKREFKLESEPTIEGLIIAMSLIGATCIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            TCSG I+DWLGRRP+LI+SS+FYFLSG++M+WSPNVY+LL+ RL+DGFG+GLAVTLVP+Y
Sbjct  61   TCSGYISDWLGRRPLLIISSVFYFLSGIVMIWSPNVYILLLGRLMDGFGVGLAVTLVPVY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRGLLNTLP+FTGS GMFL+YCM+FGMS++T P+WRLMLGVLSIPSL+YFAL
Sbjct  121  ISETAPPEIRGLLNTLPEFTGSIGMFLSYCMVFGMSLSTIPNWRLMLGVLSIPSLVYFAL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            TVF+LPESPRWLVSKGRM  A +V
Sbjct  181  TVFFLPESPRWLVSKGRMCEAIKV  204



>ref|XP_002312798.1| transporter-related family protein [Populus trichocarpa]
 gb|EEE86753.1| transporter-related family protein [Populus trichocarpa]
Length=740

 Score =   321 bits (823),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 163/204 (80%), Positives = 187/204 (92%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            MNGAVLVA+AA IGN LQGWDNATIAGAV+YIK+E  LE+   +EGL+VA SL+GATLIT
Sbjct  1    MNGAVLVAVAAAIGNLLQGWDNATIAGAVLYIKREFHLESEPTIEGLIVATSLVGATLIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            TCSG I+D LGRRP+LI+SS+ YF+SGL+MLWSPNVYVLL+ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TCSGPISDCLGRRPLLIISSILYFVSGLVMLWSPNVYVLLLARLLDGFGIGLAVTLVPVY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRGLLNTLPQFTGSGGMFL+YCM+FGMS+  APSWR+MLGVL IPS++YF L
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSGGMFLSYCMVFGMSLMEAPSWRVMLGVLFIPSIIYFLL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            TVF+LPESPRWLVSKGRM+ AK+V
Sbjct  181  TVFFLPESPRWLVSKGRMLEAKKV  204



>ref|XP_007043079.1| Tonoplast monosaccharide transporter2 [Theobroma cacao]
 gb|EOX98910.1| Tonoplast monosaccharide transporter2 [Theobroma cacao]
Length=739

 Score =   321 bits (823),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 164/204 (80%), Positives = 185/204 (91%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  260
            M+GAVLVA+AA IGN LQGWDNATIAGAV+YIKKE  LE+   MEGL+VAMSLIGAT IT
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAGAVLYIKKEFKLESDPTMEGLIVAMSLIGATCIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            TCSG I+DWLGRRPMLI+SS+ Y +SGL+MLWSPNVY+LL+ARLLDGFG+GLAVTLVP+Y
Sbjct  61   TCSGGISDWLGRRPMLIISSVLYIISGLVMLWSPNVYILLLARLLDGFGVGLAVTLVPVY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRGLLNTLPQFTGS GMFL+YCM+FGMS+ T P+WRLMLGVL IPS +YFAL
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSIGMFLSYCMVFGMSLMTLPNWRLMLGVLFIPSFIYFAL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            TVF+LPESPRWLVSKGRM  AK+V
Sbjct  181  TVFFLPESPRWLVSKGRMSEAKKV  204



>ref|XP_008349018.1| PREDICTED: monosaccharide-sensing protein 2-like [Malus domestica]
Length=254

 Score =   306 bits (783),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 155/204 (76%), Positives = 184/204 (90%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M+GAVLVA+AA IGN LQGWDNATIA +V+YIK+E  LE+   +EGL+VAMSLIGAT++T
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAASVLYIKREFNLESEPAVEGLIVAMSLIGATVVT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
             CSG++ADWLGRRP LI+SS+ YFLSGL+MLWSPNVY+LL+ARLLDGFGIGL VT+VPLY
Sbjct  61   FCSGAVADWLGRRPTLIVSSVLYFLSGLVMLWSPNVYILLLARLLDGFGIGLVVTVVPLY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRG LNT PQF GSGGMFL+YCM+FGMS+T + SWRLMLG+LSIPSL+YF L
Sbjct  121  ISETAPPEIRGSLNTXPQFLGSGGMFLSYCMVFGMSLTDSASWRLMLGILSIPSLVYFVL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            TVF+LPESPRWLVS+G+M+ AK+V
Sbjct  181  TVFFLPESPRWLVSRGQMLEAKQV  204



>ref|XP_009608796.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana tomentosiformis]
 ref|XP_009608797.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana tomentosiformis]
 ref|XP_009608798.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana tomentosiformis]
Length=734

 Score =   321 bits (822),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 162/204 (79%), Positives = 186/204 (91%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M+GAVLVA+AA IG+FLQGWDNATIAG ++YIKKE  LET   MEGL+V+MSLIGA LIT
Sbjct  1    MSGAVLVAVAAAIGSFLQGWDNATIAGGILYIKKEFKLETQPTMEGLIVSMSLIGAVLIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            TCSG+IADWLGRRP+LI SS+ YF+SGL+MLWSPNVYVLL+ARLLDGFG+GLAV LVP+Y
Sbjct  61   TCSGAIADWLGRRPLLITSSVLYFVSGLVMLWSPNVYVLLLARLLDGFGVGLAVILVPIY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRGLLNTLPQFTG  GMF +YCM+FGMS+ ++P+WRLMLGVLSIPS+LYF L
Sbjct  121  ISETAPPEIRGLLNTLPQFTGCLGMFFSYCMVFGMSLMSSPTWRLMLGVLSIPSILYFVL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            T+FYLPESPRWLVSKGRM+ AKRV
Sbjct  181  TIFYLPESPRWLVSKGRMLDAKRV  204



>ref|XP_006384856.1| transporter-related family protein [Populus trichocarpa]
 gb|ERP62653.1| transporter-related family protein [Populus trichocarpa]
Length=739

 Score =   321 bits (822),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 164/204 (80%), Positives = 188/204 (92%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M+GAVLVA+AA IGN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSL+GATLIT
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAGAVLYIKKEFHLESEPAIEGLIVAMSLVGATLIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
             CSG I+D LGRRP+LI+SS+ YF+SGLIMLWSPNVYVLL+ARLLDGFGIGL+VTL+P+Y
Sbjct  61   MCSGPISDLLGRRPLLIISSVLYFVSGLIMLWSPNVYVLLLARLLDGFGIGLSVTLIPVY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAPSEIRGLLNTLPQFTGSGGMFL+YCM+FGMS+  APSWRLMLGVL IPS++YF L
Sbjct  121  ISETAPSEIRGLLNTLPQFTGSGGMFLSYCMVFGMSLMEAPSWRLMLGVLFIPSIIYFLL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            TVF+LPESPRWLVSKGRM+ AK+V
Sbjct  181  TVFFLPESPRWLVSKGRMLEAKKV  204



>gb|KJB77472.1| hypothetical protein B456_012G139000 [Gossypium raimondii]
 gb|KJB77475.1| hypothetical protein B456_012G139000 [Gossypium raimondii]
Length=740

 Score =   320 bits (821),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 161/204 (79%), Positives = 187/204 (92%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M+GAVLVA+AA IGN LQGWDNATIAGAV+YIK+E  LE+   +EGL+VAMSLIGAT IT
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAGAVLYIKREFSLESEPTIEGLIVAMSLIGATCIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            TCSG I+DWLGRRPMLI+SS+ Y +SGL+MLWSPNVY+LL+ARLLDGFG+GLAVTLVP+Y
Sbjct  61   TCSGGISDWLGRRPMLIISSVLYCVSGLVMLWSPNVYILLLARLLDGFGVGLAVTLVPVY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRGLLNTLPQFTGS GMFL+YCM+FGMS++  P+WRLMLGVLSIPSL+YF L
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSIGMFLSYCMVFGMSLSELPNWRLMLGVLSIPSLIYFIL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            T+F+LPESPRWLVSKGRM+ AK+V
Sbjct  181  TIFFLPESPRWLVSKGRMIEAKKV  204



>ref|XP_009341490.1| PREDICTED: monosaccharide-sensing protein 2-like [Pyrus x bretschneideri]
Length=736

 Score =   320 bits (821),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 161/204 (79%), Positives = 188/204 (92%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M+GAVLVA+AA IGN LQGWDNATIA +V+YIK+E  LE+   +EGL+VAMSLIGAT++T
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAASVLYIKREFNLESEPAVEGLIVAMSLIGATVVT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
             CSG++ADWLGRRPMLI+SS+ YFLSG++MLWSPNVY+LL+ARLLDGFGIGLAVTLVPLY
Sbjct  61   FCSGAVADWLGRRPMLIISSVLYFLSGIVMLWSPNVYILLLARLLDGFGIGLAVTLVPLY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRG LNTLPQFTGSGGMFL+YCM+FGMS+  +PSWRLMLGVLSIPS++YF L
Sbjct  121  ISETAPPEIRGSLNTLPQFTGSGGMFLSYCMVFGMSLMESPSWRLMLGVLSIPSIVYFVL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            TVF+LPESPRWLVSKGRM+ AK+V
Sbjct  181  TVFFLPESPRWLVSKGRMLEAKQV  204



>gb|AAO37640.1| putative sugar transporter type 2a [Saccharum hybrid cultivar 
Q117]
Length=745

 Score =   318 bits (816),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 153/204 (75%), Positives = 182/204 (89%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M+GA LVAI A+IGN LQGWDNATI+ A++YIKKE  LE+   +EGL+VAMSLIGAT+IT
Sbjct  1    MSGAALVAIVASIGNLLQGWDNATISAALLYIKKEFKLESEPTVEGLIVAMSLIGATIIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG ++DW+GR PMLILSS+ YF+S LIMLWSPNVYVLL+ARL++GFG+GLAVTLVPLY
Sbjct  61   TFSGPVSDWIGRLPMLILSSVLYFVSSLIMLWSPNVYVLLLARLINGFGVGLAVTLVPLY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRGLLNTLPQF+GSGGMFL+YCM+FGMS+  +P WR+MLGVL++PSL +F L
Sbjct  121  ISETAPPEIRGLLNTLPQFSGSGGMFLSYCMVFGMSLLPSPDWRIMLGVLALPSLFFFGL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            T+FYLPESPRWLVSKGRM  AK+V
Sbjct  181  TIFYLPESPRWLVSKGRMAEAKKV  204



>ref|XP_011098017.1| PREDICTED: monosaccharide-sensing protein 2-like [Sesamum indicum]
 ref|XP_011098018.1| PREDICTED: monosaccharide-sensing protein 2-like [Sesamum indicum]
 ref|XP_011098019.1| PREDICTED: monosaccharide-sensing protein 2-like [Sesamum indicum]
Length=711

 Score =   317 bits (812),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 162/204 (79%), Positives = 185/204 (91%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M GAVLVAIAA IGN LQGWDNATIAG+V+YIK+E  L+    +EGL+VAMSLIGAT+IT
Sbjct  1    MRGAVLVAIAAAIGNMLQGWDNATIAGSVLYIKREFDLQRQPTIEGLIVAMSLIGATVIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG ++DWLGRRPMLI+SS+ YFLSGL+MLW+PNVYVLL+ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TFSGPVSDWLGRRPMLIISSVLYFLSGLVMLWAPNVYVLLLARLLDGFGIGLAVTLVPVY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRGLLNTLPQFTGS GMFL+YCM+FGMS+T +PSWRLMLGVLSIPS++YF L
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSAGMFLSYCMVFGMSLTNSPSWRLMLGVLSIPSMIYFVL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
             VF+LPESPRWLVSKG+M  AKRV
Sbjct  181  AVFFLPESPRWLVSKGKMKEAKRV  204



>gb|KFK34392.1| hypothetical protein AALP_AA5G139300 [Arabis alpina]
Length=739

 Score =   317 bits (813),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 156/204 (76%), Positives = 177/204 (87%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  260
            M   VLVA+AA IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGATLIT
Sbjct  1    MRSVVLVALAAAIGNMLQGWDNATIAGAVIYIKKEFHLEKEPKIEGLIVAMSLIGATLIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG ++D +GRR MLILSS+ YF+S ++M WSPNVYVLL+ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TFSGPVSDRVGRRSMLILSSLLYFVSSIVMFWSPNVYVLLLARLLDGFGIGLAVTLVPIY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAPSEIRGLLNT PQF GSGGMFL+YC++FGMS+  APSWRLMLGVLSIPS+LYF L
Sbjct  121  ISETAPSEIRGLLNTFPQFCGSGGMFLSYCLVFGMSLQEAPSWRLMLGVLSIPSILYFVL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
              F+LPESPRWLVSKGRM  A++V
Sbjct  181  AAFFLPESPRWLVSKGRMEEARQV  204



>ref|XP_010066352.1| PREDICTED: monosaccharide-sensing protein 2-like [Eucalyptus 
grandis]
 ref|XP_010066353.1| PREDICTED: monosaccharide-sensing protein 2-like [Eucalyptus 
grandis]
 ref|XP_010066354.1| PREDICTED: monosaccharide-sensing protein 2-like [Eucalyptus 
grandis]
 ref|XP_010066355.1| PREDICTED: monosaccharide-sensing protein 2-like [Eucalyptus 
grandis]
 gb|KCW64228.1| hypothetical protein EUGRSUZ_G01880 [Eucalyptus grandis]
Length=740

 Score =   317 bits (813),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 158/204 (77%), Positives = 183/204 (90%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M+GAV VA+AA +GN LQGWDNATIAGAV+YIK+E  LE+   +EGL+VAMSLIGATL+T
Sbjct  1    MSGAVWVAVAAAVGNLLQGWDNATIAGAVLYIKREFDLESEPALEGLIVAMSLIGATLVT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            TCSG+IADWLGRRP+LI+SS+FYF  GL+MLWSPNVYVLL+AR LDG G+GLAVTLVPLY
Sbjct  61   TCSGAIADWLGRRPLLIISSVFYFAGGLVMLWSPNVYVLLLARFLDGLGVGLAVTLVPLY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRG LNTLPQFTGS GMF++YCM+FGMS+  +PSWRLMLGVLS+PSL+YF L
Sbjct  121  ISETAPPEIRGTLNTLPQFTGSAGMFMSYCMVFGMSLMESPSWRLMLGVLSVPSLIYFVL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
             VF+LPESPRWLVSKGRM  AK+V
Sbjct  181  MVFFLPESPRWLVSKGRMHEAKKV  204



>ref|XP_006283193.1| hypothetical protein CARUB_v10004225mg [Capsella rubella]
 ref|XP_006283194.1| hypothetical protein CARUB_v10004225mg [Capsella rubella]
 gb|EOA16091.1| hypothetical protein CARUB_v10004225mg [Capsella rubella]
 gb|EOA16092.1| hypothetical protein CARUB_v10004225mg [Capsella rubella]
Length=740

 Score =   317 bits (813),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 162/204 (79%), Positives = 184/204 (90%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M+GAVLVA+AA +GN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGATLIT
Sbjct  1    MSGAVLVAVAAAVGNLLQGWDNATIAGAVLYIKKEFNLESNPSVEGLIVAMSLIGATLIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            TCSG +ADWLGRRPMLILSS+ YF+  L+MLWSPNVYVLL+ RLLDGFG+GL VTLVP+Y
Sbjct  61   TCSGGVADWLGRRPMLILSSILYFVGSLVMLWSPNVYVLLLGRLLDGFGVGLVVTLVPIY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRGLLNTLPQFTGSGGMFL+YCM+FGMS+  +PSWRLMLGVL  PSL++F L
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSGGMFLSYCMVFGMSLMPSPSWRLMLGVLFAPSLIFFFL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            TVF+LPESPRWLVSKGRM+ AKRV
Sbjct  181  TVFFLPESPRWLVSKGRMLEAKRV  204



>emb|CDP01766.1| unnamed protein product [Coffea canephora]
Length=724

 Score =   317 bits (812),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 159/204 (78%), Positives = 185/204 (91%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M GAVLVAIAA +GNF+QGWDNATIAG+V+YIK+E  L+T   +EGL+VAMSLIGAT+IT
Sbjct  1    MRGAVLVAIAAVVGNFVQGWDNATIAGSVLYIKREFNLQTQPTVEGLIVAMSLIGATVIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SGS+ADWLGRRPML++SS+ YFL GL+MLW+PNVYVLL+ RLLDGFG+GLAVTLVPLY
Sbjct  61   TFSGSVADWLGRRPMLVISSVLYFLGGLVMLWAPNVYVLLLGRLLDGFGVGLAVTLVPLY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP+EIRGLLNTLPQF GS GMFL+YCM+FGMS+  +PSWRLMLG+LSIPSL YFAL
Sbjct  121  ISETAPTEIRGLLNTLPQFAGSAGMFLSYCMVFGMSLQDSPSWRLMLGILSIPSLAYFAL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
             VF+LPESPRWLVSKG+M  AK+V
Sbjct  181  AVFFLPESPRWLVSKGQMQEAKKV  204



>gb|KHG04801.1| Monosaccharide-sensing protein 2 [Gossypium arboreum]
 gb|KHG22589.1| Monosaccharide-sensing protein 2 [Gossypium arboreum]
Length=740

 Score =   317 bits (813),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 160/204 (78%), Positives = 185/204 (91%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M+GAVLVA+AA IGN LQGWDNATIAGAV+YIK+E  LE+   +EGL+VAMSLIGAT IT
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAGAVLYIKREFSLESEPTIEGLIVAMSLIGATCIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            TCSG I+DWLGRRPMLI+SS+ Y +SGL+MLWSPNVY+LL+ARLLDGFG+GLAVTLVP+Y
Sbjct  61   TCSGGISDWLGRRPMLIISSVLYCVSGLVMLWSPNVYILLLARLLDGFGVGLAVTLVPVY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRGLLNTLPQFTGS GMF +YCM+FGMS++  P+WRLMLGVLSIPSL+YF L
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSIGMFFSYCMVFGMSLSELPNWRLMLGVLSIPSLIYFIL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            T+F+LPESPRWLVSKGRM  AK+V
Sbjct  181  TIFFLPESPRWLVSKGRMSEAKKV  204



>gb|KCW64229.1| hypothetical protein EUGRSUZ_G01880 [Eucalyptus grandis]
Length=739

 Score =   317 bits (813),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 158/204 (77%), Positives = 183/204 (90%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M+GAV VA+AA +GN LQGWDNATIAGAV+YIK+E  LE+   +EGL+VAMSLIGATL+T
Sbjct  1    MSGAVWVAVAAAVGNLLQGWDNATIAGAVLYIKREFDLESEPALEGLIVAMSLIGATLVT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            TCSG+IADWLGRRP+LI+SS+FYF  GL+MLWSPNVYVLL+AR LDG G+GLAVTLVPLY
Sbjct  61   TCSGAIADWLGRRPLLIISSVFYFAGGLVMLWSPNVYVLLLARFLDGLGVGLAVTLVPLY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRG LNTLPQFTGS GMF++YCM+FGMS+  +PSWRLMLGVLS+PSL+YF L
Sbjct  121  ISETAPPEIRGTLNTLPQFTGSAGMFMSYCMVFGMSLMESPSWRLMLGVLSVPSLIYFVL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
             VF+LPESPRWLVSKGRM  AK+V
Sbjct  181  MVFFLPESPRWLVSKGRMHEAKKV  204



>emb|CBI37732.3| unnamed protein product [Vitis vinifera]
Length=644

 Score =   315 bits (807),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 163/204 (80%), Positives = 186/204 (91%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  260
            M+GAVLVAIAA +GN LQGWDNATIAGAV+YIKKE  L  E  +EGL+VAMSLIGAT IT
Sbjct  1    MSGAVLVAIAAAVGNLLQGWDNATIAGAVLYIKKEFNLQGEPTVEGLIVAMSLIGATFIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG+++DWLGRRPMLI+SS+FYF+SGL+MLWSPNVYVLL+ARLLDGFG+GL+VT+VP+Y
Sbjct  61   TISGAVSDWLGRRPMLIISSLFYFVSGLVMLWSPNVYVLLLARLLDGFGVGLSVTIVPVY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAPSEIRGLLNTLPQFTGS GMFL+YCM+FGMS+  +PSWRLMLGVL IPSL+Y AL
Sbjct  121  ISETAPSEIRGLLNTLPQFTGSVGMFLSYCMVFGMSLMNSPSWRLMLGVLFIPSLVYLAL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            TVF LPESPRWLVSKGRM+ AK V
Sbjct  181  TVFLLPESPRWLVSKGRMLEAKHV  204



>ref|XP_007137297.1| hypothetical protein PHAVU_009G115500g [Phaseolus vulgaris]
 gb|ESW09291.1| hypothetical protein PHAVU_009G115500g [Phaseolus vulgaris]
Length=739

 Score =   317 bits (813),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 159/204 (78%), Positives = 187/204 (92%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M+GA+LVA+AA IGN LQGWDNATIAG+++YIK+E  LE+   +EGL+VAMSLIGAT++T
Sbjct  1    MSGAILVAVAAAIGNLLQGWDNATIAGSILYIKREFQLESQPTVEGLIVAMSLIGATVVT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            TCSG+++D LGRRPMLI+SS+ YF+S L+MLWSPNVY+LL ARLLDG GIGLAVTLVPLY
Sbjct  61   TCSGALSDLLGRRPMLIISSLLYFVSSLVMLWSPNVYILLFARLLDGLGIGLAVTLVPLY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRGLLNTLPQFTGS GMF +YCM+FGMS+T APSWRLMLGVLSIPSL+YFAL
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSAGMFFSYCMVFGMSLTKAPSWRLMLGVLSIPSLIYFAL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            T+F+LPESPRWLVSKGRM+ AK+V
Sbjct  181  TLFFLPESPRWLVSKGRMLEAKKV  204



>gb|KJB12351.1| hypothetical protein B456_002G014400 [Gossypium raimondii]
 gb|KJB12353.1| hypothetical protein B456_002G014400 [Gossypium raimondii]
Length=734

 Score =   317 bits (811),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 158/204 (77%), Positives = 187/204 (92%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M GAVLVA+AA IGNFLQGWD ATIAGAV+Y+K+E  LE+   +EGL++AMSLIGAT IT
Sbjct  1    MGGAVLVAVAAAIGNFLQGWDTATIAGAVLYVKREFKLESEPTIEGLIIAMSLIGATCIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            TCSG I+DWLGRRP+LI+SS+FYFLSG++M+WSPNVY+LL+ RL+DGFG+GLAVTLVP+Y
Sbjct  61   TCSGYISDWLGRRPLLIISSVFYFLSGIVMIWSPNVYILLLGRLMDGFGVGLAVTLVPVY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRGLLNTLP+FTGS GMFL+YCM+FGMS++T P+WRLMLGVLSIPSL+YFAL
Sbjct  121  ISETAPPEIRGLLNTLPEFTGSIGMFLSYCMVFGMSLSTIPNWRLMLGVLSIPSLVYFAL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            TVF+LPESPRWLVSKGRM  A +V
Sbjct  181  TVFFLPESPRWLVSKGRMCEAIKV  204



>gb|KJB12354.1| hypothetical protein B456_002G014400 [Gossypium raimondii]
Length=758

 Score =   317 bits (813),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 158/204 (77%), Positives = 187/204 (92%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M GAVLVA+AA IGNFLQGWD ATIAGAV+Y+K+E  LE+   +EGL++AMSLIGAT IT
Sbjct  25   MGGAVLVAVAAAIGNFLQGWDTATIAGAVLYVKREFKLESEPTIEGLIIAMSLIGATCIT  84

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            TCSG I+DWLGRRP+LI+SS+FYFLSG++M+WSPNVY+LL+ RL+DGFG+GLAVTLVP+Y
Sbjct  85   TCSGYISDWLGRRPLLIISSVFYFLSGIVMIWSPNVYILLLGRLMDGFGVGLAVTLVPVY  144

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRGLLNTLP+FTGS GMFL+YCM+FGMS++T P+WRLMLGVLSIPSL+YFAL
Sbjct  145  ISETAPPEIRGLLNTLPEFTGSIGMFLSYCMVFGMSLSTIPNWRLMLGVLSIPSLVYFAL  204

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            TVF+LPESPRWLVSKGRM  A +V
Sbjct  205  TVFFLPESPRWLVSKGRMCEAIKV  228



>ref|XP_002282975.1| PREDICTED: monosaccharide-sensing protein 2 [Vitis vinifera]
 gb|ADP37148.1| putative tonoplastic monosaccharide transporter [Vitis vinifera]
Length=739

 Score =   316 bits (810),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 163/204 (80%), Positives = 186/204 (91%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  260
            M+GAVLVAIAA +GN LQGWDNATIAGAV+YIKKE  L  E  +EGL+VAMSLIGAT IT
Sbjct  1    MSGAVLVAIAAAVGNLLQGWDNATIAGAVLYIKKEFNLQGEPTVEGLIVAMSLIGATFIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG+++DWLGRRPMLI+SS+FYF+SGL+MLWSPNVYVLL+ARLLDGFG+GL+VT+VP+Y
Sbjct  61   TISGAVSDWLGRRPMLIISSLFYFVSGLVMLWSPNVYVLLLARLLDGFGVGLSVTIVPVY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAPSEIRGLLNTLPQFTGS GMFL+YCM+FGMS+  +PSWRLMLGVL IPSL+Y AL
Sbjct  121  ISETAPSEIRGLLNTLPQFTGSVGMFLSYCMVFGMSLMNSPSWRLMLGVLFIPSLVYLAL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            TVF LPESPRWLVSKGRM+ AK V
Sbjct  181  TVFLLPESPRWLVSKGRMLEAKHV  204



>ref|XP_009392211.1| PREDICTED: monosaccharide-sensing protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=732

 Score =   316 bits (810),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 162/204 (79%), Positives = 184/204 (90%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M GAVLVAIAA IGN LQGWDNATIAGAV+YIK+E  LE    +EGL+VAMSLIGAT+IT
Sbjct  1    MQGAVLVAIAAAIGNMLQGWDNATIAGAVLYIKREFKLEGQPTIEGLIVAMSLIGATVIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG+++DW+GRRPMLI+SS+ YF+SGLIM WSPNVY+LL+ARL+DGFGIGLAVTLVP+Y
Sbjct  61   TFSGAVSDWIGRRPMLIISSVLYFISGLIMFWSPNVYMLLLARLIDGFGIGLAVTLVPVY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAPSEIRGLLNTLPQFTGSGGMFL+YCM+F MS+   P WRLMLGVLS+PSLLYF L
Sbjct  121  ISETAPSEIRGLLNTLPQFTGSGGMFLSYCMVFAMSLNIRPDWRLMLGVLSVPSLLYFVL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            TVF+LPESPRWLVSKGRM  AK+V
Sbjct  181  TVFFLPESPRWLVSKGRMKEAKQV  204



>ref|XP_009103100.1| PREDICTED: monosaccharide-sensing protein 2 [Brassica rapa]
 ref|XP_009103156.1| PREDICTED: monosaccharide-sensing protein 2 [Brassica rapa]
 emb|CDX75492.1| BnaA01g02100D [Brassica napus]
Length=740

 Score =   316 bits (810),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 162/204 (79%), Positives = 184/204 (90%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M+GAVLVA+AA IGN LQGWDNATIAGAV+YIKKE  LE+   MEGL+VAMSLIGATLIT
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAGAVLYIKKEFHLESNPSMEGLIVAMSLIGATLIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG +ADWLGRRPMLILSS+ YF+  L+MLWSPNVYVLL+ RLLDGFG+GL VTLVP+Y
Sbjct  61   TWSGGVADWLGRRPMLILSSVLYFVGSLVMLWSPNVYVLLLGRLLDGFGVGLVVTLVPIY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRGLLNTLPQFTGSGGMFL+YCM+FGMS+  +PSWRLMLGVL +PSL++F L
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSGGMFLSYCMVFGMSLMPSPSWRLMLGVLFVPSLVFFFL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            T+F+LPESPRWLVSKGRM+ AKRV
Sbjct  181  TIFFLPESPRWLVSKGRMLEAKRV  204



>gb|AFP89954.1| tonoplastic transporter 2 [Vitis vinifera]
Length=739

 Score =   316 bits (810),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 163/204 (80%), Positives = 186/204 (91%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  260
            M+GAVLVAIAA +GN LQGWDNATIAGAV+YIKKE  L  E  +EGL+VAMSLIGAT IT
Sbjct  1    MSGAVLVAIAAAVGNLLQGWDNATIAGAVLYIKKEFNLQGEPTVEGLIVAMSLIGATFIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG+++DWLGRRPMLI+SS+FYF+SGL+MLWSPNVYVLL+ARLLDGFG+GL+VT+VP+Y
Sbjct  61   TISGAVSDWLGRRPMLIISSLFYFVSGLVMLWSPNVYVLLLARLLDGFGVGLSVTIVPVY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAPSEIRGLLNTLPQFTGS GMFL+YCM+FGMS+  +PSWRLMLGVL IPSL+Y AL
Sbjct  121  ISETAPSEIRGLLNTLPQFTGSVGMFLSYCMVFGMSLMNSPSWRLMLGVLFIPSLVYLAL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            TVF LPESPRWLVSKGRM+ AK V
Sbjct  181  TVFLLPESPRWLVSKGRMLEAKHV  204



>emb|CDX69128.1| BnaC01g03250D [Brassica napus]
Length=683

 Score =   314 bits (805),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 161/204 (79%), Positives = 183/204 (90%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M+GAVLVA+AA IGN LQGWDNATIAGAV+YIKKE  LE+   MEGL+VAMSLIGATLIT
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAGAVLYIKKEFHLESNPSMEGLIVAMSLIGATLIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG +ADWLGRRPMLILSS+ YF+  L+MLWSPNVYVLL+ RLLDGFG+GL VTLVP+Y
Sbjct  61   TWSGGVADWLGRRPMLILSSVLYFVGSLVMLWSPNVYVLLLGRLLDGFGVGLVVTLVPIY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRGLLNTLPQF GSGGMFL+YCM+FGMS+  +PSWRLMLGVL +PSL++F L
Sbjct  121  ISETAPPEIRGLLNTLPQFAGSGGMFLSYCMVFGMSLMPSPSWRLMLGVLFVPSLVFFFL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            T+F+LPESPRWLVSKGRM+ AKRV
Sbjct  181  TIFFLPESPRWLVSKGRMLEAKRV  204



>ref|XP_011040809.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
 ref|XP_011040810.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
 ref|XP_011040811.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
Length=738

 Score =   315 bits (808),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 162/204 (79%), Positives = 186/204 (91%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M+GAVLVA+AA +GN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSL+GATLIT
Sbjct  1    MSGAVLVAVAAAVGNLLQGWDNATIAGAVLYIKKEFHLESEPAIEGLIVAMSLVGATLIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
             CSG I+D LGRRP+LI+SS+ YF+SGLIMLWSPNV VLL+ARLLDGFGIGLAVTL+P+Y
Sbjct  61   MCSGPISDMLGRRPLLIISSVLYFISGLIMLWSPNVSVLLLARLLDGFGIGLAVTLIPVY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRGLLNTLPQFTGSGGMFL+YCM+FGMS+  APSWRLMLGVL IPS++YF L
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSGGMFLSYCMVFGMSLMEAPSWRLMLGVLFIPSIIYFLL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            TVF+LPESPRWLVSKGRM+ AK+V
Sbjct  181  TVFFLPESPRWLVSKGRMLEAKKV  204



>ref|XP_004144248.1| PREDICTED: monosaccharide-sensing protein 2-like [Cucumis sativus]
 ref|XP_004171132.1| PREDICTED: monosaccharide-sensing protein 2-like [Cucumis sativus]
 gb|KGN47521.1| hypothetical protein Csa_6G355400 [Cucumis sativus]
Length=729

 Score =   315 bits (808),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 162/202 (80%), Positives = 189/202 (94%), Gaps = 0/202 (0%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  266
            M GAVLVA+AA++GNFLQGWDNATIAGA+VYIKK++VL + +EGL+VA+SLIGAT+ITTC
Sbjct  1    MKGAVLVALAASVGNFLQGWDNATIAGAMVYIKKDMVLNSSVEGLIVAISLIGATIITTC  60

Query  267  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  446
            SG ++DW+GRRPMLILSS+ Y LSGLIMLWSPNV VL IARLLDGFGIGLAVTLVP+YIS
Sbjct  61   SGPVSDWVGRRPMLILSSLLYILSGLIMLWSPNVLVLCIARLLDGFGIGLAVTLVPVYIS  120

Query  447  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  626
            ETAPSEIRGLLNTLPQFTGSGGMF++YCM+F MS++ + SWRLMLGVLSIPS+LYF LTV
Sbjct  121  ETAPSEIRGLLNTLPQFTGSGGMFISYCMVFYMSLSVSTSWRLMLGVLSIPSVLYFILTV  180

Query  627  FYLPESPRWLVSKGRMVXAKRV  692
            F+LPESPRWLVSKG+M+ AK+V
Sbjct  181  FFLPESPRWLVSKGKMLEAKKV  202



>emb|CDY65623.1| BnaCnng48010D [Brassica napus]
Length=675

 Score =   313 bits (803),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 161/204 (79%), Positives = 183/204 (90%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M+GAVLVA+AA IGN LQGWDNATIAGAV+YIKKE  LE+   MEGL+VAMSLIGATLIT
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAGAVLYIKKEFHLESNPSMEGLIVAMSLIGATLIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG +ADWLGRRPMLILSS+ YF+  L+MLWSPNVYVLL+ RLLDGFG+GL VTLVP+Y
Sbjct  61   TWSGGVADWLGRRPMLILSSVLYFVGSLVMLWSPNVYVLLLGRLLDGFGVGLVVTLVPIY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRGLLNTLPQF GSGGMFL+YCM+FGMS+  +PSWRLMLGVL +PSL++F L
Sbjct  121  ISETAPPEIRGLLNTLPQFAGSGGMFLSYCMVFGMSLMPSPSWRLMLGVLFVPSLVFFFL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            T+F+LPESPRWLVSKGRM+ AKRV
Sbjct  181  TIFFLPESPRWLVSKGRMLEAKRV  204



>ref|XP_009340799.1| PREDICTED: monosaccharide-sensing protein 2-like [Pyrus x bretschneideri]
 ref|XP_009340800.1| PREDICTED: monosaccharide-sensing protein 2-like [Pyrus x bretschneideri]
Length=736

 Score =   315 bits (807),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 160/204 (78%), Positives = 185/204 (91%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M+GAVLVA+AA IGN LQGWDNATIA +V+YIK+E  LE+   MEGL+VAMSLIGAT++T
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAASVLYIKREFNLESEPAMEGLIVAMSLIGATVVT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
             CSG++ADWLGRRP LI+SS+ YFLSGL+MLWSPNVY+LL+ARLLDGFGIGLAVTLVPLY
Sbjct  61   FCSGAVADWLGRRPTLIVSSVLYFLSGLVMLWSPNVYILLLARLLDGFGIGLAVTLVPLY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRG LNTLPQF GSGGMFL+YCM+FGMS+T + SWRLMLG+LSIPSL+Y  L
Sbjct  121  ISETAPPEIRGSLNTLPQFLGSGGMFLSYCMVFGMSLTESASWRLMLGILSIPSLVYIIL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            TVF+LPESPRWLVSKGRM+ AK+V
Sbjct  181  TVFFLPESPRWLVSKGRMLEAKQV  204



>ref|XP_006343319.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006343320.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Solanum 
tuberosum]
Length=722

 Score =   315 bits (806),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 163/204 (80%), Positives = 183/204 (90%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M GAVL+A+AA IGN LQGWDNATIAG+V+YIKKE  L+T   MEGL+VAMSLIGAT+IT
Sbjct  1    MRGAVLIALAAAIGNMLQGWDNATIAGSVLYIKKEFNLQTQPTMEGLIVAMSLIGATVIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG ++D LGRRPMLI+SS+ YFLSGL+MLW+PNVYVLL+ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TFSGPVSDMLGRRPMLIISSVLYFLSGLVMLWAPNVYVLLLARLLDGFGIGLAVTLVPVY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRG LNT PQFTGS GMFL+YCM+FGMS+T APSWRLMLGVLSIPSL YF L
Sbjct  121  ISETAPPEIRGQLNTFPQFTGSLGMFLSYCMVFGMSLTQAPSWRLMLGVLSIPSLAYFFL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            T+FYLPESPRWLVSKGRM  AK+V
Sbjct  181  TLFYLPESPRWLVSKGRMKEAKQV  204



>gb|AIN39841.1| hypothetical protein [Zoysia matrella]
Length=744

 Score =   315 bits (807),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 150/193 (78%), Positives = 175/193 (91%), Gaps = 2/193 (1%)
 Frame = +3

Query  120  TIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLITTCSGSIADWLG  293
            +IGN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGAT+ITT SG ++DW+G
Sbjct  12   SIGNLLQGWDNATIAGAVLYIKKEFKLESEPTVEGLIVAMSLIGATIITTFSGPVSDWIG  71

Query  294  RRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYISETAPSEIRG  473
            RRPMLILSS+ YF+S LIMLWSPNVYVLL+ARL+DGFGIGLAVTLVPLYISETAP EIRG
Sbjct  72   RRPMLILSSVLYFVSSLIMLWSPNVYVLLLARLIDGFGIGLAVTLVPLYISETAPPEIRG  131

Query  474  LLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTVFYLPESPRW  653
            LLNTLPQF+GSGGMFL+YCM+FGMS+  +P WR+MLGVL++PSL +F LT+F+LPESPRW
Sbjct  132  LLNTLPQFSGSGGMFLSYCMVFGMSLLPSPDWRIMLGVLAVPSLFFFGLTIFFLPESPRW  191

Query  654  LVSKGRMVXAKRV  692
            LVSKGRM  AK+V
Sbjct  192  LVSKGRMAEAKKV  204



>gb|KHN33643.1| Monosaccharide-sensing protein 2 [Glycine soja]
Length=734

 Score =   315 bits (806),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 159/204 (78%), Positives = 185/204 (91%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  260
            M+GAVLVA+AA IGN LQGWDNATIAG+++YIK+E  L  E  +EGL+VAMSLIGAT++T
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAGSILYIKREFQLQSEPTVEGLIVAMSLIGATVVT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            TCSG+++D LGRRPMLI+SSM YF+S L+MLWSPNVY+LL ARLLDG GIGLAVTLVPLY
Sbjct  61   TCSGALSDLLGRRPMLIISSMLYFVSSLVMLWSPNVYILLFARLLDGLGIGLAVTLVPLY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAPSEIRGLLNTLPQFTGS GMF +YCM+FGMS+  APSWR+MLGVLSIPSL+YFAL
Sbjct  121  ISETAPSEIRGLLNTLPQFTGSAGMFFSYCMVFGMSLMKAPSWRIMLGVLSIPSLIYFAL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            T+ +LPESPRWLVSKGRM+ AK+V
Sbjct  181  TLLFLPESPRWLVSKGRMLEAKKV  204



>ref|XP_003543932.1| PREDICTED: monosaccharide-sensing protein 2-like [Glycine max]
Length=734

 Score =   315 bits (806),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 159/204 (78%), Positives = 185/204 (91%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  260
            M+GAVLVA+AA IGN LQGWDNATIAG+++YIK+E  L  E  +EGL+VAMSLIGAT++T
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAGSILYIKREFQLQSEPTVEGLIVAMSLIGATVVT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            TCSG+++D LGRRPMLI+SSM YF+S L+MLWSPNVY+LL ARLLDG GIGLAVTLVPLY
Sbjct  61   TCSGALSDLLGRRPMLIISSMLYFVSSLVMLWSPNVYILLFARLLDGLGIGLAVTLVPLY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAPSEIRGLLNTLPQFTGS GMF +YCM+FGMS+  APSWR+MLGVLSIPSL+YFAL
Sbjct  121  ISETAPSEIRGLLNTLPQFTGSAGMFFSYCMVFGMSLMKAPSWRIMLGVLSIPSLIYFAL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            T+ +LPESPRWLVSKGRM+ AK+V
Sbjct  181  TLLFLPESPRWLVSKGRMLEAKKV  204



>ref|NP_190717.1| tonoplast monosaccharide transporter3 [Arabidopsis thaliana]
 sp|Q9SD00.1|MSSP3_ARATH RecName: Full=Monosaccharide-sensing protein 3; AltName: Full=Sugar 
transporter MSSP3 [Arabidopsis thaliana]
 emb|CAB63013.1| sugar transporter-like protein [Arabidopsis thaliana]
 emb|CAD58693.1| monosaccharide sensing protein 3 [Arabidopsis thaliana]
 gb|AEE78798.1| tonoplast monosaccharide transporter3 [Arabidopsis thaliana]
Length=729

 Score =   314 bits (805),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 155/204 (76%), Positives = 175/204 (86%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  260
            M   VLVA+AA IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGATLIT
Sbjct  1    MRSVVLVALAAAIGNMLQGWDNATIAGAVIYIKKEFHLEKEPKIEGLIVAMSLIGATLIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG ++D +GRR MLILSS+ YFLS ++M WSPNVYVLL ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TFSGPVSDKVGRRSMLILSSVLYFLSSIVMFWSPNVYVLLFARLLDGFGIGLAVTLVPIY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAPSEIRGLLNT PQF GSGGMFL+YC++FGMS+  +PSWRLMLGVLSIPS+ YF L
Sbjct  121  ISETAPSEIRGLLNTFPQFCGSGGMFLSYCLVFGMSLQESPSWRLMLGVLSIPSIAYFVL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
              F+LPESPRWLVSKGRM  A++V
Sbjct  181  AAFFLPESPRWLVSKGRMDEARQV  204



>ref|XP_004289029.1| PREDICTED: monosaccharide-sensing protein 2-like [Fragaria vesca 
subsp. vesca]
 ref|XP_011461449.1| PREDICTED: monosaccharide-sensing protein 2-like [Fragaria vesca 
subsp. vesca]
Length=760

 Score =   315 bits (807),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 155/191 (81%), Positives = 172/191 (90%), Gaps = 2/191 (1%)
 Frame = +3

Query  126  GNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLITTCSGSIADWLGRR  299
            GN LQGWDNATIAGAV+YIKKE  LET   +EGL+VAMSLIGAT+ITT SG ++D LGRR
Sbjct  14   GNLLQGWDNATIAGAVLYIKKEFKLETQPTIEGLIVAMSLIGATVITTFSGPVSDSLGRR  73

Query  300  PMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYISETAPSEIRGLL  479
            PMLI+SS+ YFLSGL+MLW+PNVYVLL+ARLLDGFGIGLAVTLVP+YISETAP +IRGLL
Sbjct  74   PMLIISSVLYFLSGLVMLWAPNVYVLLLARLLDGFGIGLAVTLVPVYISETAPPDIRGLL  133

Query  480  NTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTVFYLPESPRWLV  659
            NTLPQFTGSGGMF +YCM+F MS+  APSWRLMLGVLSIPSL+YFALTV YLPESPRWLV
Sbjct  134  NTLPQFTGSGGMFFSYCMVFTMSLKEAPSWRLMLGVLSIPSLVYFALTVLYLPESPRWLV  193

Query  660  SKGRMVXAKRV  692
            SKGRM  AK V
Sbjct  194  SKGRMAEAKTV  204



>gb|EMT28528.1| Monosaccharide-sensing protein 3 [Aegilops tauschii]
Length=531

 Score =   309 bits (791),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 157/204 (77%), Positives = 174/204 (85%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M GAVLVAI A IGN LQG DNATIAGAV+YIK+E  LET   +EGLVVA SLIGAT+IT
Sbjct  1    MRGAVLVAITAAIGNMLQGVDNATIAGAVMYIKREFHLETQPAVEGLVVATSLIGATIIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG +AD +GRRPMLI SS+ YFL GL+MLWSPNVYVLLIARL+DGFG+GLAVTLVP+Y
Sbjct  61   TFSGPVADIVGRRPMLIASSLLYFLGGLVMLWSPNVYVLLIARLIDGFGVGLAVTLVPVY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRGLLNT PQFTGS GMF+AYCMIF M++   PSWR MLGVL+ PSL+Y AL
Sbjct  121  ISETAPPEIRGLLNTFPQFTGSAGMFMAYCMIFTMTLHPGPSWRTMLGVLAGPSLIYLAL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            TVFYLPESPRWLVSKGRM  A+ V
Sbjct  181  TVFYLPESPRWLVSKGRMKEARVV  204



>ref|XP_008464819.1| PREDICTED: monosaccharide-sensing protein 2-like [Cucumis melo]
 ref|XP_008464820.1| PREDICTED: monosaccharide-sensing protein 2-like [Cucumis melo]
 ref|XP_008464821.1| PREDICTED: monosaccharide-sensing protein 2-like [Cucumis melo]
 ref|XP_008464822.1| PREDICTED: monosaccharide-sensing protein 2-like [Cucumis melo]
Length=729

 Score =   314 bits (805),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 161/202 (80%), Positives = 189/202 (94%), Gaps = 0/202 (0%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  266
            M GA+LVA+AA++GNFLQGWDNATIAGA+VYIKK++VL + +EGL+VA+SLIGAT+ITTC
Sbjct  1    MKGALLVALAASVGNFLQGWDNATIAGAMVYIKKDMVLNSSVEGLIVAISLIGATIITTC  60

Query  267  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  446
            SG ++DW+GRRPMLILSS+ Y LSGLIMLWSPNV VL IARLLDGFGIGLAVTLVP+YIS
Sbjct  61   SGPVSDWVGRRPMLILSSLLYILSGLIMLWSPNVLVLCIARLLDGFGIGLAVTLVPVYIS  120

Query  447  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  626
            ETAPSEIRGLLNTLPQFTGSGGMF++YCM+F MS++ + SWRLMLGVLSIPS+LYF LTV
Sbjct  121  ETAPSEIRGLLNTLPQFTGSGGMFISYCMVFYMSLSVSTSWRLMLGVLSIPSVLYFILTV  180

Query  627  FYLPESPRWLVSKGRMVXAKRV  692
            F+LPESPRWLVSKG+M+ AK+V
Sbjct  181  FFLPESPRWLVSKGKMLEAKKV  202



>emb|CAN80213.1| hypothetical protein VITISV_042076 [Vitis vinifera]
Length=739

 Score =   314 bits (805),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 162/204 (79%), Positives = 185/204 (91%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  260
            M+GAVLVAIAA +GN LQGWDNATIAGAV+YIKKE  L  E  +EGL+VAMSLIGAT IT
Sbjct  1    MSGAVLVAIAAAVGNLLQGWDNATIAGAVLYIKKEFNLQGEPTVEGLIVAMSLIGATFIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG+++DWLGRRPMLI+SS+FYF+SGL+MLWSPNVYVLL+ARLLDGFG+GL+VT+VP+Y
Sbjct  61   TISGAVSDWLGRRPMLIISSLFYFVSGLVMLWSPNVYVLLLARLLDGFGVGLSVTIVPVY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAPSEIRGLLNTLPQFTGS GMFL+YCM+FGMS+  +PSWRLMLGVL IPSL+Y  L
Sbjct  121  ISETAPSEIRGLLNTLPQFTGSVGMFLSYCMVFGMSLMNSPSWRLMLGVLFIPSLVYLXL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            TVF LPESPRWLVSKGRM+ AK V
Sbjct  181  TVFLLPESPRWLVSKGRMLEAKHV  204



>ref|XP_008812559.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008812567.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008812574.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008812580.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
Length=745

 Score =   315 bits (806),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 156/204 (76%), Positives = 179/204 (88%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M GAVLVAIAA+IGN LQGWDNATIA AV+YIK+E  LE+   MEGL+VAMSLIGA +IT
Sbjct  1    MRGAVLVAIAASIGNLLQGWDNATIAVAVLYIKREFNLESEPTMEGLIVAMSLIGAMIIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
              SG+I+DW GRRPMLI+SS+FY  SGL+MLWSPNV +LL+ARL+DGFG+GLAVTLVP+Y
Sbjct  61   MFSGAISDWGGRRPMLIVSSIFYLFSGLVMLWSPNVCILLLARLIDGFGVGLAVTLVPVY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRGLLNTLPQFTGS GMFL+YCM FGMS+     WR+MLGVLSIPSL YFAL
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSAGMFLSYCMAFGMSLMVQHDWRVMLGVLSIPSLFYFAL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            T+F+LPESPRWLVSKGRM+ AK+V
Sbjct  181  TIFFLPESPRWLVSKGRMMEAKQV  204



>ref|NP_001190054.1| tonoplast monosaccharide transporter3 [Arabidopsis thaliana]
 gb|AEE78799.1| tonoplast monosaccharide transporter3 [Arabidopsis thaliana]
Length=737

 Score =   314 bits (805),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 155/204 (76%), Positives = 175/204 (86%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  260
            M   VLVA+AA IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGATLIT
Sbjct  1    MRSVVLVALAAAIGNMLQGWDNATIAGAVIYIKKEFHLEKEPKIEGLIVAMSLIGATLIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG ++D +GRR MLILSS+ YFLS ++M WSPNVYVLL ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TFSGPVSDKVGRRSMLILSSVLYFLSSIVMFWSPNVYVLLFARLLDGFGIGLAVTLVPIY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAPSEIRGLLNT PQF GSGGMFL+YC++FGMS+  +PSWRLMLGVLSIPS+ YF L
Sbjct  121  ISETAPSEIRGLLNTFPQFCGSGGMFLSYCLVFGMSLQESPSWRLMLGVLSIPSIAYFVL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
              F+LPESPRWLVSKGRM  A++V
Sbjct  181  AAFFLPESPRWLVSKGRMDEARQV  204



>ref|XP_010270527.1| PREDICTED: monosaccharide-sensing protein 2 [Nelumbo nucifera]
 ref|XP_010270528.1| PREDICTED: monosaccharide-sensing protein 2 [Nelumbo nucifera]
Length=740

 Score =   314 bits (804),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 158/204 (77%), Positives = 184/204 (90%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M GAVLVA+AA IGN LQGWDNATIAG+++YIK+E  LE+   +EGL+VAMSLIGAT IT
Sbjct  1    MRGAVLVAVAAAIGNLLQGWDNATIAGSILYIKREFKLESEPTIEGLIVAMSLIGATFIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG ++DWLGRRPM+I+SS+ YF+S +IMLWSPNVYVLL+ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TFSGPVSDWLGRRPMMIISSVLYFISSIIMLWSPNVYVLLLARLLDGFGIGLAVTLVPVY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRGLLNTLPQFTGSGGMF +YCM+FGMS+  +PSWRLMLGVLSIPS+ YFAL
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSGGMFFSYCMVFGMSLRDSPSWRLMLGVLSIPSVAYFAL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            T+F+LPESPRWLVSKG+M+ AK V
Sbjct  181  TIFFLPESPRWLVSKGKMLEAKCV  204



>ref|XP_010446942.1| PREDICTED: monosaccharide-sensing protein 2 [Camelina sativa]
 ref|XP_010446943.1| PREDICTED: monosaccharide-sensing protein 2 [Camelina sativa]
 ref|XP_010446944.1| PREDICTED: monosaccharide-sensing protein 2 [Camelina sativa]
Length=739

 Score =   313 bits (803),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 160/204 (78%), Positives = 184/204 (90%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M+GAVLVA+AA +GN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGATLIT
Sbjct  1    MSGAVLVAVAAAVGNLLQGWDNATIAGAVLYIKKEFNLESNPSVEGLIVAMSLIGATLIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            TCSG +AD LGRRPMLILSS+ YF+  L+MLWSPNVYVLL+ RLLDGFG+G+ VTLVP+Y
Sbjct  61   TCSGGVADLLGRRPMLILSSILYFVGSLVMLWSPNVYVLLLGRLLDGFGVGIVVTLVPIY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRGLLNTLPQFTGSGGMFL+YCM+FGMS+  +P+WRLMLGVL IPSL++F L
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSGGMFLSYCMVFGMSLMPSPNWRLMLGVLFIPSLIFFFL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            TVF+LPESPRWLVSKGRM+ AKRV
Sbjct  181  TVFFLPESPRWLVSKGRMLEAKRV  204



>ref|XP_008377843.1| PREDICTED: monosaccharide-sensing protein 2-like [Malus domestica]
 ref|XP_008377844.1| PREDICTED: monosaccharide-sensing protein 2-like [Malus domestica]
Length=736

 Score =   313 bits (803),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 159/204 (78%), Positives = 185/204 (91%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M+GAVLVA+AA IGN LQGWDNATIA +V+YIK+E  LE+   +EGL+VAMSLIGAT++T
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAASVLYIKREFNLESEXAVEGLIVAMSLIGATVVT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
             CSG++ADWLGRRPMLI+SS+FYFLSG++MLW    Y+LL+AR LDGFGIGLAVTLVPLY
Sbjct  61   FCSGAVADWLGRRPMLIISSVFYFLSGIVMLWXXXXYILLLARXLDGFGIGLAVTLVPLY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRG LNTLPQFTGSGGMFL+YCM+FGMS+T +PSWRLMLGVLSIPSL+YF L
Sbjct  121  ISETAPPEIRGSLNTLPQFTGSGGMFLSYCMVFGMSLTESPSWRLMLGVLSIPSLVYFVL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            TVF+LPESPRWLVSKGRM+ AK+V
Sbjct  181  TVFFLPESPRWLVSKGRMLEAKQV  204



>ref|XP_002877807.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54066.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=730

 Score =   313 bits (803),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 154/204 (75%), Positives = 174/204 (85%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  260
            M   V VA+AA IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGATLIT
Sbjct  1    MRSVVFVALAAAIGNMLQGWDNATIAGAVIYIKKEFHLEKEPKIEGLIVAMSLIGATLIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG ++D +GRR MLILSS+ YFLS ++M WSPNVYVLL ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TFSGPVSDKVGRRSMLILSSVLYFLSSIVMFWSPNVYVLLFARLLDGFGIGLAVTLVPIY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAPSEIRGLLNT PQF GSGGMFL+YC++FGMS+  +PSWRLMLGVLSIPS+ YF L
Sbjct  121  ISETAPSEIRGLLNTFPQFCGSGGMFLSYCLVFGMSLQESPSWRLMLGVLSIPSIAYFVL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
              F+LPESPRWLVSKGRM  A++V
Sbjct  181  AAFFLPESPRWLVSKGRMDEARQV  204



>ref|XP_010437493.1| PREDICTED: monosaccharide-sensing protein 2-like [Camelina sativa]
Length=739

 Score =   313 bits (802),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 160/204 (78%), Positives = 184/204 (90%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M+GAVLVA+AA +GN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGATLIT
Sbjct  1    MSGAVLVAVAAAVGNLLQGWDNATIAGAVLYIKKEFNLESNPSVEGLIVAMSLIGATLIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            TCSG +AD LGRRPMLILSS+ YF+  L+MLWSPNVYVLL+ RLLDGFG+G+ VTLVP+Y
Sbjct  61   TCSGGVADLLGRRPMLILSSILYFVGSLVMLWSPNVYVLLLGRLLDGFGVGIVVTLVPIY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRGLLNTLPQFTGSGGMFL+YCM+FGMS+  +P+WRLMLGVL IPSL++F L
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSGGMFLSYCMVFGMSLMPSPNWRLMLGVLFIPSLIFFFL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            TVF+LPESPRWLVSKGRM+ AKRV
Sbjct  181  TVFFLPESPRWLVSKGRMLEAKRV  204



>ref|NP_001280690.1| monosaccharide-sensing protein 2-like [Solanum lycopersicum]
 dbj|BAO96236.1| tonoplast monosaccharide transporter 1 [Solanum lycopersicum]
Length=725

 Score =   313 bits (801),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 162/204 (79%), Positives = 182/204 (89%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M GAVL+A+AA IGN LQGWDNATIAG+V+YIKKE  L+T   MEGL+VAMSLIGAT+IT
Sbjct  1    MRGAVLIALAAAIGNMLQGWDNATIAGSVLYIKKEFNLQTQPTMEGLIVAMSLIGATVIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG ++D LGRRPMLI+SS+ YFLSGL+MLW+PNVYVLL+ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TFSGPVSDMLGRRPMLIISSVLYFLSGLVMLWAPNVYVLLLARLLDGFGIGLAVTLVPVY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRG LNT PQFTGS GMFL+YCM+FGMS+T APSWRLMLGVLSIPSL YF L
Sbjct  121  ISETAPPEIRGQLNTFPQFTGSLGMFLSYCMVFGMSLTQAPSWRLMLGVLSIPSLAYFFL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
             +FYLPESPRWLVSKGRM  AK+V
Sbjct  181  ALFYLPESPRWLVSKGRMKEAKQV  204



>ref|XP_009776539.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
 ref|XP_009776540.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
Length=722

 Score =   313 bits (801),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 160/204 (78%), Positives = 183/204 (90%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M+GAV+VA+AA IGN LQGWDNATIAGAV+YIKKE  L+T   +EGL+VAMSLIGAT+IT
Sbjct  1    MSGAVVVALAAAIGNLLQGWDNATIAGAVLYIKKEFNLQTQPTIEGLIVAMSLIGATVIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SGS++D  GRRPMLI+SS+FYFLSGL+MLW+PNVYVLL+ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TFSGSVSDMFGRRPMLIISSVFYFLSGLVMLWAPNVYVLLLARLLDGFGIGLAVTLVPVY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRG LNT PQFTG  GMFL+YCM+FG+S+T +PSWRLMLGVLSIPSL YF L
Sbjct  121  ISETAPPEIRGRLNTFPQFTGCVGMFLSYCMVFGVSLTQSPSWRLMLGVLSIPSLAYFFL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
             +FYLPESPRWLVSKGRM  AK+V
Sbjct  181  ALFYLPESPRWLVSKGRMKEAKQV  204



>ref|XP_010432297.1| PREDICTED: monosaccharide-sensing protein 2-like [Camelina sativa]
 ref|XP_010432298.1| PREDICTED: monosaccharide-sensing protein 2-like [Camelina sativa]
Length=739

 Score =   313 bits (802),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 160/204 (78%), Positives = 183/204 (90%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M+GAVLVA+AA +GN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGATLIT
Sbjct  1    MSGAVLVAVAAAVGNLLQGWDNATIAGAVLYIKKEFNLESNPSVEGLIVAMSLIGATLIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            TCSG +AD LGRRPMLILSS  YF+  L+MLWSPNVYVLL+ RLLDGFG+G+ VTLVP+Y
Sbjct  61   TCSGGVADLLGRRPMLILSSFLYFVGSLVMLWSPNVYVLLLGRLLDGFGVGIVVTLVPIY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRGLLNTLPQFTGSGGMFL+YCM+FGMS+  +P+WRLMLGVL IPSL++F L
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSGGMFLSYCMVFGMSLMPSPNWRLMLGVLFIPSLIFFFL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            TVF+LPESPRWLVSKGRM+ AKRV
Sbjct  181  TVFFLPESPRWLVSKGRMLEAKRV  204



>ref|XP_010678631.1| PREDICTED: monosaccharide-sensing protein 2-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010678632.1| PREDICTED: monosaccharide-sensing protein 2-like [Beta vulgaris 
subsp. vulgaris]
Length=735

 Score =   313 bits (801),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 156/204 (76%), Positives = 178/204 (87%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M+ AVLVAIAAT+G+ L GWDNATIAGAV+YIKKE  LE+   +EGL+VA S+IGATLIT
Sbjct  1    MSAAVLVAIAATVGDLLYGWDNATIAGAVLYIKKEFNLESSPTLEGLIVATSIIGATLIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            TCSG IAD LGRRPM+I+SS+ +F+S LIMLWSPNVYVLL  RLLDGFG GLAVTL PLY
Sbjct  61   TCSGPIADRLGRRPMMIISSVCFFVSALIMLWSPNVYVLLFGRLLDGFGSGLAVTLGPLY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP++IRG LNTLPQFTGSGGMFLAYCM+FGMS+   PSWRLMLG+L +PS +YF L
Sbjct  121  ISETAPTDIRGSLNTLPQFTGSGGMFLAYCMVFGMSLMETPSWRLMLGILFVPSTVYFLL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            TVF+LPESPRWLVSKGRM  AK+V
Sbjct  181  TVFFLPESPRWLVSKGRMNEAKKV  204



>ref|XP_004139974.1| PREDICTED: monosaccharide-sensing protein 2-like [Cucumis sativus]
 gb|KGN46648.1| hypothetical protein Csa_6G118280 [Cucumis sativus]
Length=733

 Score =   312 bits (799),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 158/204 (77%), Positives = 184/204 (90%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M+G+VLVA+AA +GNFLQGWDNATIAGAV+YIKKE  LE+   +EGL+VA SLIGAT+IT
Sbjct  1    MSGSVLVAVAAAVGNFLQGWDNATIAGAVLYIKKEFNLESSPTVEGLIVATSLIGATVIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            TCSG+I+DWLGRR +LILSS+ YF+ G+IMLWSPNVY+LL+ RLLDGFGIGLAVTLVP+Y
Sbjct  61   TCSGAISDWLGRRLLLILSSVLYFIGGIIMLWSPNVYILLLGRLLDGFGIGLAVTLVPVY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRG LNTLPQFTGS GMF +YCM+FGMS+  +PSWRLMLGVL IPSL+Y AL
Sbjct  121  ISETAPPEIRGSLNTLPQFTGSAGMFFSYCMVFGMSLMESPSWRLMLGVLFIPSLIYLAL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            T+F+LPESPRWLVSKGRM+ AKRV
Sbjct  181  TIFFLPESPRWLVSKGRMLEAKRV  204



>ref|XP_009589978.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana tomentosiformis]
 ref|XP_009589979.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana tomentosiformis]
Length=721

 Score =   311 bits (798),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 161/204 (79%), Positives = 182/204 (89%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M+GAVL+A+AA IGN LQGWDNATIAG+V+YIKKE  L+T   MEGL+VAMSLIGAT+IT
Sbjct  1    MSGAVLIALAAAIGNLLQGWDNATIAGSVLYIKKEFNLQTQPTMEGLIVAMSLIGATVIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG ++D LGRRPMLI+SS+ YFLSGL+MLWSPNVYVLL+ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TFSGPVSDMLGRRPMLIISSVLYFLSGLVMLWSPNVYVLLLARLLDGFGIGLAVTLVPVY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRG LNT PQFTG  GMFL+YCM+FGMS+T +PSWRLMLGVLSIPSL YF  
Sbjct  121  ISETAPPEIRGQLNTFPQFTGCVGMFLSYCMVFGMSLTPSPSWRLMLGVLSIPSLAYFFF  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            T+FYLPESPRWLVSKGRM  AK+V
Sbjct  181  TLFYLPESPRWLVSKGRMKEAKQV  204



>ref|XP_011099908.1| PREDICTED: monosaccharide-sensing protein 2-like [Sesamum indicum]
 ref|XP_011099909.1| PREDICTED: monosaccharide-sensing protein 2-like [Sesamum indicum]
Length=709

 Score =   311 bits (797),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 159/204 (78%), Positives = 182/204 (89%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  260
            M GAVLVAIAA IGN LQGWDNATIAGAV+YIK+E  L  E  +EGL+VAMSLIGAT+IT
Sbjct  1    MRGAVLVAIAAAIGNLLQGWDNATIAGAVLYIKREFHLQSEPTIEGLIVAMSLIGATVIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            TCSG ++DWLGRRPMLILSS+ Y LSGL+MLWSPNV VLL+ARL+DGFGIGLAVTLVP+Y
Sbjct  61   TCSGPVSDWLGRRPMLILSSVLYCLSGLVMLWSPNVSVLLLARLMDGFGIGLAVTLVPVY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRGLLNTLPQFTG+ GMF++YCM+F MS+  +PSWRLMLGVLSIPSL+YFAL
Sbjct  121  ISETAPPEIRGLLNTLPQFTGAAGMFMSYCMVFAMSLKDSPSWRLMLGVLSIPSLIYFAL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
             + +LPESPRWLVSKG+M  AK+V
Sbjct  181  AILFLPESPRWLVSKGKMKEAKQV  204



>ref|XP_009775817.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
 ref|XP_009775879.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
 ref|XP_009775941.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
Length=721

 Score =   311 bits (798),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 161/204 (79%), Positives = 182/204 (89%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M+GAVL+A+AA IGN LQGWDNATIAG+V+YIKKE  L+T   MEGL+VAMSLIGAT+IT
Sbjct  1    MSGAVLIALAAAIGNLLQGWDNATIAGSVLYIKKEFNLQTQPTMEGLIVAMSLIGATVIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG ++D LGRRPMLI+SS+ YFLSGL+MLWSPNVYVLL+ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TFSGPVSDMLGRRPMLIISSVLYFLSGLVMLWSPNVYVLLLARLLDGFGIGLAVTLVPVY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRG LNT PQFTG  GMFL+YCM+FGMS+T +PSWRLMLGVLSIPSL YF  
Sbjct  121  ISETAPPEIRGQLNTFPQFTGCVGMFLSYCMVFGMSLTPSPSWRLMLGVLSIPSLAYFFF  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            T+FYLPESPRWLVSKGRM  AK+V
Sbjct  181  TLFYLPESPRWLVSKGRMKEAKQV  204



>ref|XP_003526737.1| PREDICTED: monosaccharide-sensing protein 2-like isoform 1 [Glycine 
max]
Length=738

 Score =   311 bits (797),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 158/204 (77%), Positives = 184/204 (90%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M+GAVLVA+AA IGN LQGWDNATIAG+++YIKKE  LE    +EGL+VAMSLIGAT++T
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAGSILYIKKEFQLENEPTVEGLIVAMSLIGATVVT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            TCSG+++D LGRRPMLI+SSM YF+S L+MLWSPNVY+LL ARLLDG GIGLAVTLVPLY
Sbjct  61   TCSGALSDLLGRRPMLIISSMLYFVSSLVMLWSPNVYILLFARLLDGLGIGLAVTLVPLY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRGLLNTLPQFTGS GMF +YCM+FGMS+  APSWR+MLGVLSIPSL++FAL
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSLGMFFSYCMVFGMSLMKAPSWRIMLGVLSIPSLIFFAL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            T+ +LPESPRWLVSKGRM+ AK+V
Sbjct  181  TLLFLPESPRWLVSKGRMLEAKKV  204



>dbj|BAI94493.1| sugar transporter [Dianthus caryophyllus]
Length=733

 Score =   311 bits (797),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 150/204 (74%), Positives = 182/204 (89%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  260
            M+GAV VAIAATIGNFLQGWDNATIAGAV+YIKKE  LE+   MEG+++AM+LIG+T+IT
Sbjct  1    MSGAVWVAIAATIGNFLQGWDNATIAGAVLYIKKEFHLESDPKMEGILLAMALIGSTIIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            TCSGS++DWLGRR M+I S++ + +S +IMLWSPN+YVLL+ARL+DGFG GLAVTLVPLY
Sbjct  61   TCSGSVSDWLGRRLMMISSAICFIVSAVIMLWSPNIYVLLLARLVDGFGGGLAVTLVPLY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP+E RGLLNT+PQF  + GMFL+YCM+FGMS+  +PSWRLMLGVL +PS+LY AL
Sbjct  121  ISETAPTETRGLLNTVPQFAVAAGMFLSYCMVFGMSLAESPSWRLMLGVLLVPSVLYLAL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            ++ YLPESPRWLVSKGRMV AK+V
Sbjct  181  SILYLPESPRWLVSKGRMVEAKKV  204



>ref|XP_008448165.1| PREDICTED: monosaccharide-sensing protein 2 [Cucumis melo]
 ref|XP_008448166.1| PREDICTED: monosaccharide-sensing protein 2 [Cucumis melo]
 ref|XP_008448167.1| PREDICTED: monosaccharide-sensing protein 2 [Cucumis melo]
 ref|XP_008448168.1| PREDICTED: monosaccharide-sensing protein 2 [Cucumis melo]
 ref|XP_008448169.1| PREDICTED: monosaccharide-sensing protein 2 [Cucumis melo]
 ref|XP_008448170.1| PREDICTED: monosaccharide-sensing protein 2 [Cucumis melo]
 ref|XP_008448171.1| PREDICTED: monosaccharide-sensing protein 2 [Cucumis melo]
Length=733

 Score =   311 bits (796),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 157/204 (77%), Positives = 183/204 (90%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M+G+VLVA+AA +GNFLQGWDNATIAGAV+YIKKE  LE+   +EGL+VA SLIGAT+IT
Sbjct  1    MSGSVLVAVAAAVGNFLQGWDNATIAGAVLYIKKEFNLESSPTVEGLIVATSLIGATVIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            TCSG+I+DWLGRR +LI SS+ YF+ G+IMLWSPNVY+LL+ RLLDGFGIGLAVTLVP+Y
Sbjct  61   TCSGAISDWLGRRLLLIFSSVLYFIGGIIMLWSPNVYILLLGRLLDGFGIGLAVTLVPVY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRG LNTLPQFTGS GMF +YCM+FGMS+  +PSWRLMLGVL IPSL+Y AL
Sbjct  121  ISETAPPEIRGSLNTLPQFTGSAGMFFSYCMVFGMSLMESPSWRLMLGVLFIPSLIYLAL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            T+F+LPESPRWLVSKGRM+ AKRV
Sbjct  181  TIFFLPESPRWLVSKGRMLEAKRV  204



>ref|XP_009622210.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana tomentosiformis]
 ref|XP_009622211.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana tomentosiformis]
 ref|XP_009622212.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana tomentosiformis]
Length=722

 Score =   310 bits (793),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 160/204 (78%), Positives = 182/204 (89%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M+GAVLVA+AA IGN LQGWDNATIAGAV+YIKKE  L+T   +EGL+VAMSLIGAT+IT
Sbjct  1    MSGAVLVALAAAIGNLLQGWDNATIAGAVLYIKKEFNLQTQPTIEGLIVAMSLIGATVIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG ++D LGRRPMLI+SS+ YFLSGL+MLW+PNVYVLL+ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TFSGPVSDMLGRRPMLIISSVLYFLSGLVMLWAPNVYVLLLARLLDGFGIGLAVTLVPVY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRG LNT PQFTG  GMFL+YCM+FG+S+T +PSWRLMLGVLSIPSL YF L
Sbjct  121  ISETAPPEIRGRLNTFPQFTGCVGMFLSYCMVFGVSLTQSPSWRLMLGVLSIPSLAYFFL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
             +FYLPESPRWLVSKGRM  AK+V
Sbjct  181  ALFYLPESPRWLVSKGRMKEAKQV  204



>gb|KHN46863.1| Monosaccharide-sensing protein 2 [Glycine soja]
Length=717

 Score =   309 bits (792),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 156/204 (76%), Positives = 183/204 (90%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  260
            M+GAVLVA+AA IGN LQGWDNATIAG+++YIK+E  L  E  +EGL+VAMSLIGAT++T
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAGSILYIKREFNLQSEPTIEGLIVAMSLIGATVVT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            TCSG ++D LGRRPMLI+SS+ YF+  L+MLWSPNVY+LL ARLLDG GIGLAVTLVPLY
Sbjct  61   TCSGPLSDLLGRRPMLIISSILYFVGSLVMLWSPNVYILLFARLLDGLGIGLAVTLVPLY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRGLLNTLPQFTGS GMF +YCM+F +S+T AP+WRLMLGVLSIPSL+YFAL
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSAGMFFSYCMVFAISLTKAPNWRLMLGVLSIPSLIYFAL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            T+F+LPESPRWLVSKGRM+ AK+V
Sbjct  181  TLFFLPESPRWLVSKGRMLEAKKV  204



>ref|XP_004154526.1| PREDICTED: monosaccharide-sensing protein 2-like [Cucumis sativus]
Length=733

 Score =   310 bits (793),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 157/204 (77%), Positives = 183/204 (90%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M+G+VLVA+AA +GN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VA SLIGAT+IT
Sbjct  1    MSGSVLVAVAAAVGNLLQGWDNATIAGAVLYIKKEFNLESSPTVEGLIVATSLIGATVIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            TCSG+I+DWLGRR +LILSS+ YF+ G+IMLWSPNVY+LL+ RLLDGFGIGLAVTLVP+Y
Sbjct  61   TCSGAISDWLGRRLLLILSSVLYFIGGIIMLWSPNVYILLLGRLLDGFGIGLAVTLVPVY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRG LNTLPQFTGS GMF +YCM+FGMS+  +PSWRLMLGVL IPSL+Y AL
Sbjct  121  ISETAPPEIRGSLNTLPQFTGSAGMFFSYCMVFGMSLMESPSWRLMLGVLFIPSLIYLAL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            T+F+LPESPRWLVSKGRM+ AKRV
Sbjct  181  TIFFLPESPRWLVSKGRMLEAKRV  204



>ref|XP_004500684.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Cicer 
arietinum]
 ref|XP_004500685.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Cicer 
arietinum]
Length=740

 Score =   308 bits (790),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 156/204 (76%), Positives = 182/204 (89%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M+GAV+VA+AA IGN LQGWDNATIAG+++YIKKE  LE    +EGL+VAMSLIGAT++T
Sbjct  1    MSGAVIVAVAAAIGNLLQGWDNATIAGSILYIKKEFQLENEPTVEGLIVAMSLIGATVVT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            TCSG+++D LGRRPMLI+SS+ YF+S L+M WSPNVY+LL ARLLDG GIGLAVTLVPLY
Sbjct  61   TCSGALSDLLGRRPMLIISSVLYFVSSLVMFWSPNVYILLFARLLDGLGIGLAVTLVPLY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISE AP EIRGLLNTLPQFTGS GMF +YCM+FGMS+T +PSWRLMLGVLSIPSL+YFAL
Sbjct  121  ISEIAPPEIRGLLNTLPQFTGSAGMFFSYCMVFGMSLTKSPSWRLMLGVLSIPSLIYFAL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            T+  LPESPRWLVSKGRM+ AK+V
Sbjct  181  TILLLPESPRWLVSKGRMLEAKKV  204



>ref|XP_010690557.1| PREDICTED: monosaccharide-sensing protein 2 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010690558.1| PREDICTED: monosaccharide-sensing protein 2 [Beta vulgaris subsp. 
vulgaris]
Length=739

 Score =   308 bits (790),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 159/204 (78%), Positives = 180/204 (88%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLE--TYMEGLVVAMSLIGATLIT  260
            M+GAVLVAIAA +GN LQGWDNATIAGAV+YIKKE  LE    MEGL+VAMSLIGAT+IT
Sbjct  1    MSGAVLVAIAAAVGNLLQGWDNATIAGAVLYIKKEFNLEGAPTMEGLIVAMSLIGATIIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            TCSG ++D  GRRPM+I+SS+ +F S LIMLWSPNVYVLL+ RLLDGFG GLAVTLVPLY
Sbjct  61   TCSGPVSDRFGRRPMMIISSICFFFSALIMLWSPNVYVLLLGRLLDGFGSGLAVTLVPLY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP++IRG LNTLPQFTGSGGMF+AYCM+FGMS+   PSWRLMLG+L +PS LYFAL
Sbjct  121  ISETAPTDIRGSLNTLPQFTGSGGMFVAYCMVFGMSLMEKPSWRLMLGILVVPSALYFAL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            TVF+LPESPRWLVSKGRM  AK+V
Sbjct  181  TVFFLPESPRWLVSKGRMNEAKKV  204



>ref|XP_003518591.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Glycine 
max]
 ref|XP_006575765.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Glycine 
max]
 ref|XP_006575766.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X3 [Glycine 
max]
 gb|KHN29885.1| Monosaccharide-sensing protein 2 [Glycine soja]
Length=711

 Score =   307 bits (787),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 147/190 (77%), Positives = 171/190 (90%), Gaps = 2/190 (1%)
 Frame = +3

Query  129  NFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLITTCSGSIADWLGRRP  302
            N LQGWDNATIAG+++YIK+E  L  E  +EGL+VAMSLIGAT++TTCSG ++D+LGRRP
Sbjct  17   NLLQGWDNATIAGSILYIKREFNLQSEPTIEGLIVAMSLIGATVVTTCSGPLSDFLGRRP  76

Query  303  MLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYISETAPSEIRGLLN  482
            MLI+SS+ YF S L+MLWSPNVY+LL ARLLDG GIGLAVTLVPLYISETAP EIRGLLN
Sbjct  77   MLIISSVLYFASSLVMLWSPNVYILLFARLLDGLGIGLAVTLVPLYISETAPPEIRGLLN  136

Query  483  TLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTVFYLPESPRWLVS  662
            TLPQFTGS GMF +YCM+F MS+T AP+WRLMLGVLSIPSL+YFALT+F+LPESPRWLVS
Sbjct  137  TLPQFTGSAGMFFSYCMVFAMSLTKAPNWRLMLGVLSIPSLIYFALTLFFLPESPRWLVS  196

Query  663  KGRMVXAKRV  692
            KGRM+ AK+V
Sbjct  197  KGRMLEAKKV  206



>ref|XP_008382498.1| PREDICTED: monosaccharide-sensing protein 2-like [Malus domestica]
 ref|XP_008382499.1| PREDICTED: monosaccharide-sensing protein 2-like [Malus domestica]
Length=736

 Score =   307 bits (787),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 156/204 (76%), Positives = 183/204 (90%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M+GAVLVA+AA IGN LQGWDNATIA +V+YIK+E  LE+   +EGL+VAMSLIGAT++T
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAASVLYIKREFNLESEPAVEGLIVAMSLIGATVVT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
             CSG++ADWLGRRP LI+SS+ YFLSGL+MLWSPNVY+LL+ARLLDGFGIGL VT+VPLY
Sbjct  61   FCSGAVADWLGRRPTLIVSSVLYFLSGLVMLWSPNVYILLLARLLDGFGIGLVVTVVPLY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRG LNTLPQF GSGGMFL+YCM+FGMS+T + SWRLMLG+LSIPSL+YF L
Sbjct  121  ISETAPPEIRGSLNTLPQFLGSGGMFLSYCMVFGMSLTDSASWRLMLGILSIPSLVYFVL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            TVF+LPESPRWLVS G M+ AK+V
Sbjct  181  TVFFLPESPRWLVSXGXMLEAKQV  204



>ref|XP_010097645.1| Monosaccharide-sensing protein 3 [Morus notabilis]
 gb|EXB70345.1| Monosaccharide-sensing protein 3 [Morus notabilis]
Length=737

 Score =   307 bits (787),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 155/204 (76%), Positives = 179/204 (88%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M GAV VAI A IGN LQGWDN+ IAG+++YIKKE  LE    +EGL++A SLIG TLIT
Sbjct  1    MKGAVAVAIVAAIGNLLQGWDNSVIAGSLLYIKKEFNLERKPTLEGLIIATSLIGGTLIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG ++D +GRRPMLI+SS+ +F SGL+MLW+PNVY+LL+ARLLDGFG GLAVTLVP+Y
Sbjct  61   TVSGPVSDRVGRRPMLIMSSVLFFFSGLVMLWAPNVYMLLVARLLDGFGTGLAVTLVPVY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRG LNTLPQFTGSGGMFL+YCM+FGMS+  +PSWRLMLGVLSIPSL+YFAL
Sbjct  121  ISETAPPEIRGTLNTLPQFTGSGGMFLSYCMVFGMSLVKSPSWRLMLGVLSIPSLVYFAL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            TVFYLPESPRWLVSKGRMV AK+V
Sbjct  181  TVFYLPESPRWLVSKGRMVEAKQV  204



>ref|XP_011022133.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
 ref|XP_011022134.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
Length=719

 Score =   306 bits (785),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 147/204 (72%), Positives = 181/204 (89%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M GAVLVA+AAT+GN LQGWDN+TIAG++ YIK+EL L++   +EGL+VAMS+IG T IT
Sbjct  1    MRGAVLVALAATVGNLLQGWDNSTIAGSIPYIKEELNLQSQPAVEGLIVAMSIIGGTTIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG+++D  GRRPMLI+SS+ Y LS +I+LW+PNVYVLL+ARLLDGFG+GLAVTLVPLY
Sbjct  61   TFSGTVSDIFGRRPMLIMSSILYLLSSIIILWAPNVYVLLLARLLDGFGVGLAVTLVPLY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAPSE+RG LNTLPQF GSGGMFL+YCM+F MS+  +PSWRLMLG LSIP+++Y AL
Sbjct  121  ISETAPSEMRGQLNTLPQFMGSGGMFLSYCMVFFMSMMDSPSWRLMLGTLSIPAVIYLAL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            T+F+LPESPRWLVSKG+M+ AK+V
Sbjct  181  TLFFLPESPRWLVSKGKMIEAKQV  204



>ref|XP_002306419.1| hypothetical protein POPTR_0005s10180g [Populus trichocarpa]
 gb|EEE93415.1| hypothetical protein POPTR_0005s10180g [Populus trichocarpa]
Length=719

 Score =   306 bits (785),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 147/204 (72%), Positives = 181/204 (89%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M GAVLVA+AAT+GN LQGWDN+TIAG++ YIK+EL L++   +EGL+VAMS+IG T IT
Sbjct  1    MRGAVLVALAATVGNLLQGWDNSTIAGSIPYIKEELNLQSQPAVEGLIVAMSIIGGTTIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG+++D  GRRPMLI+SS+ Y LS +I+LW+PNVYVLL+ARLLDGFG+GLAVTLVPLY
Sbjct  61   TFSGTVSDIFGRRPMLIMSSILYLLSSIIILWAPNVYVLLLARLLDGFGVGLAVTLVPLY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAPSE+RG LNTLPQF GSGGMFL+YCM+F MS+  +PSWRLMLG LSIP+++Y AL
Sbjct  121  ISETAPSEMRGQLNTLPQFMGSGGMFLSYCMVFFMSMMDSPSWRLMLGTLSIPAVIYLAL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            T+F+LPESPRWLVSKG+M+ AK+V
Sbjct  181  TLFFLPESPRWLVSKGKMIEAKQV  204



>gb|EYU30848.1| hypothetical protein MIMGU_mgv1a001984mg [Erythranthe guttata]
Length=730

 Score =   305 bits (780),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 157/204 (77%), Positives = 181/204 (89%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M GAVLVAIAA IGN LQGWDNATIAGAV+YIK+E  L++   +EGL+VAMSLIGAT+IT
Sbjct  1    MRGAVLVAIAAAIGNLLQGWDNATIAGAVLYIKREFDLQSQPKIEGLIVAMSLIGATVIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG ++DWLGRRPMLI SS+ YFLSGL+MLW+PNV +LL+ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TFSGPVSDWLGRRPMLIASSILYFLSGLVMLWAPNVEILLLARLLDGFGIGLAVTLVPVY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRGLLNTLPQFTGS GMFL+YCM+FGMS+  +PSWRLMLGVLS PS++YF L
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSVGMFLSYCMVFGMSLMDSPSWRLMLGVLSAPSIVYFVL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
             V +LPESPRWLVSKG+M  AK+V
Sbjct  181  AVLFLPESPRWLVSKGKMREAKKV  204



>ref|NP_195256.3| monosaccharide-sensing protein 2 [Arabidopsis thaliana]
 ref|NP_001154287.1| monosaccharide-sensing protein 2 [Arabidopsis thaliana]
 sp|Q8LPQ8.2|MSSP2_ARATH RecName: Full=Monosaccharide-sensing protein 2; AltName: Full=Sugar 
transporter MSSP2 [Arabidopsis thaliana]
 emb|CAA18739.1| putative sugar transporter protein [Arabidopsis thaliana]
 emb|CAB80247.1| putative sugar transporter protein [Arabidopsis thaliana]
 emb|CAD58692.1| monosaccharide sensing protein 2 [Arabidopsis thaliana]
 gb|AEE86494.1| monosaccharide-sensing protein 2 [Arabidopsis thaliana]
 gb|AEE86495.1| monosaccharide-sensing protein 2 [Arabidopsis thaliana]
Length=729

 Score =   302 bits (773),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 164/204 (80%), Positives = 185/204 (91%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M+GAVLVAIAA +GN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGATLIT
Sbjct  1    MSGAVLVAIAAAVGNLLQGWDNATIAGAVLYIKKEFNLESNPSVEGLIVAMSLIGATLIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            TCSG +ADWLGRRPMLILSS+ YF+  L+MLWSPNVYVLL+ RLLDGFG+GL VTLVP+Y
Sbjct  61   TCSGGVADWLGRRPMLILSSILYFVGSLVMLWSPNVYVLLLGRLLDGFGVGLVVTLVPIY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRGLLNTLPQFTGSGGMFL+YCM+FGMS+  +PSWRLMLGVL IPSL++F L
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSGGMFLSYCMVFGMSLMPSPSWRLMLGVLFIPSLVFFFL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            TVF+LPESPRWLVSKGRM+ AKRV
Sbjct  181  TVFFLPESPRWLVSKGRMLEAKRV  204



>ref|NP_849565.1| monosaccharide-sensing protein 2 [Arabidopsis thaliana]
 ref|NP_001190923.1| monosaccharide-sensing protein 2 [Arabidopsis thaliana]
 gb|AAM19835.1| AT4g35300/F23E12_140 [Arabidopsis thaliana]
 gb|AEE86493.1| monosaccharide-sensing protein 2 [Arabidopsis thaliana]
 gb|AEE86497.1| monosaccharide-sensing protein 2 [Arabidopsis thaliana]
Length=739

 Score =   302 bits (773),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 164/204 (80%), Positives = 185/204 (91%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M+GAVLVAIAA +GN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGATLIT
Sbjct  1    MSGAVLVAIAAAVGNLLQGWDNATIAGAVLYIKKEFNLESNPSVEGLIVAMSLIGATLIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            TCSG +ADWLGRRPMLILSS+ YF+  L+MLWSPNVYVLL+ RLLDGFG+GL VTLVP+Y
Sbjct  61   TCSGGVADWLGRRPMLILSSILYFVGSLVMLWSPNVYVLLLGRLLDGFGVGLVVTLVPIY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRGLLNTLPQFTGSGGMFL+YCM+FGMS+  +PSWRLMLGVL IPSL++F L
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSGGMFLSYCMVFGMSLMPSPSWRLMLGVLFIPSLVFFFL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            TVF+LPESPRWLVSKGRM+ AKRV
Sbjct  181  TVFFLPESPRWLVSKGRMLEAKRV  204



>ref|XP_002867077.1| hypothetical protein ARALYDRAFT_491117 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43336.1| hypothetical protein ARALYDRAFT_491117 [Arabidopsis lyrata subsp. 
lyrata]
Length=739

 Score =   301 bits (770),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 163/204 (80%), Positives = 185/204 (91%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M+GAVLVAIAA +GN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGATLIT
Sbjct  1    MSGAVLVAIAAAVGNLLQGWDNATIAGAVLYIKKEFNLESNPSVEGLIVAMSLIGATLIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            TCSG +ADWLGRRPMLILSS+ YF+  L+MLWSPNVYVLL+ RLLDGFG+GL VTLVP+Y
Sbjct  61   TCSGGVADWLGRRPMLILSSILYFVGSLVMLWSPNVYVLLLGRLLDGFGVGLVVTLVPIY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRGLLNTLPQFTGSGGMFL+YCM+FGMS+  +PSWRLMLGVL IPSL++F L
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSGGMFLSYCMVFGMSLMPSPSWRLMLGVLFIPSLVFFFL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            TVF+LPESPRWLVS+GRM+ AKRV
Sbjct  181  TVFFLPESPRWLVSRGRMLEAKRV  204



>gb|KJB31963.1| hypothetical protein B456_005G216600 [Gossypium raimondii]
 gb|KJB31964.1| hypothetical protein B456_005G216600 [Gossypium raimondii]
 gb|KJB31965.1| hypothetical protein B456_005G216600 [Gossypium raimondii]
 gb|KJB31966.1| hypothetical protein B456_005G216600 [Gossypium raimondii]
 gb|KJB31967.1| hypothetical protein B456_005G216600 [Gossypium raimondii]
Length=737

 Score =   300 bits (769),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 156/204 (76%), Positives = 183/204 (90%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M+GAVLVA+ ATIGN LQGWD+ATIAGAV+YIKKE  LE+   +EGL+VAMSLIGAT IT
Sbjct  1    MSGAVLVALTATIGNLLQGWDSATIAGAVMYIKKEFKLESEPAIEGLIVAMSLIGATCIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            TCSGS++DWLGRRP+LI+SS+ YFLSG++MLW+PNV  LL+ARLLDG GIGLAVTL+P+Y
Sbjct  61   TCSGSLSDWLGRRPILIISSLLYFLSGIVMLWAPNVPTLLLARLLDGLGIGLAVTLIPIY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRG LNTLP F+G  GMFL+YCM+FGMS+TT P+WRLMLGVLSIPSL+Y AL
Sbjct  121  ISETAPPEIRGFLNTLPLFSGCLGMFLSYCMVFGMSLTTLPNWRLMLGVLSIPSLVYLAL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            TVF+LPESPRWLVSKGRM  A++V
Sbjct  181  TVFFLPESPRWLVSKGRMSEARKV  204



>ref|XP_008786687.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008786688.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008786689.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008786690.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
Length=744

 Score =   300 bits (768),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 153/204 (75%), Positives = 185/204 (91%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  260
            M GAVLVAIAA IG+ LQGWD+AT+AGAV+YI +E  LE    +EGL+VAMSLIGAT+IT
Sbjct  1    MQGAVLVAIAAAIGSLLQGWDSATMAGAVLYINREFKLEADPTIEGLIVAMSLIGATIIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            + SG+++DW+GRRP+LI++++  FLSGL+MLWSPNVY+LL+ARL+ GFG+G+AVTLVP+Y
Sbjct  61   SFSGALSDWVGRRPVLIVAAVLTFLSGLVMLWSPNVYILLLARLIYGFGVGIAVTLVPVY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAPSEIRGLLNTLPQF GSGGMFL+YC++FGMS+ + P WRLMLGVLSIPSL+YFAL
Sbjct  121  ISETAPSEIRGLLNTLPQFCGSGGMFLSYCVVFGMSLMSNPDWRLMLGVLSIPSLIYFAL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            TVFYLPESPRWLVSKGRMV AK+V
Sbjct  181  TVFYLPESPRWLVSKGRMVEAKKV  204



>gb|EAY80902.1| hypothetical protein OsI_36080 [Oryza sativa Indica Group]
Length=763

 Score =   300 bits (769),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 154/204 (75%), Positives = 180/204 (88%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M GAVLVA+AA IGN+LQGWDNATIAGAV+YIK+E  LET   +EGLVVAMSLIGAT+IT
Sbjct  1    MRGAVLVAVAAAIGNYLQGWDNATIAGAVLYIKREFALETQPAVEGLVVAMSLIGATIIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG ++D +GRRPMLI SS+ YF  GLIMLWSPNVYVLL+ARL+DGFG+GLAVTLVP+Y
Sbjct  61   TFSGPVSDLVGRRPMLIASSLLYFAGGLIMLWSPNVYVLLLARLVDGFGVGLAVTLVPVY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISET+P EIRG LNTLPQFTGSGGMF++YCMIF M+++ +P+WR+MLGVL +PSLLY  +
Sbjct  121  ISETSPPEIRGRLNTLPQFTGSGGMFMSYCMIFAMTLSPSPNWRIMLGVLFVPSLLYLFV  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            TVFYLPESPRWLVSKGRM  A+ V
Sbjct  181  TVFYLPESPRWLVSKGRMKEARVV  204



>ref|NP_001067890.1| Os11g0475600 [Oryza sativa Japonica Group]
 gb|ABA93553.1| hexose transporter, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF28253.1| Os11g0475600 [Oryza sativa Japonica Group]
 gb|EAZ18344.1| hypothetical protein OsJ_33873 [Oryza sativa Japonica Group]
 dbj|BAH00841.1| unnamed protein product [Oryza sativa Japonica Group]
Length=757

 Score =   300 bits (768),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 154/204 (75%), Positives = 180/204 (88%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M GAVLVA+AA IGN+LQGWDNATIAGAV+YIK+E  LET   +EGLVVAMSLIGAT+IT
Sbjct  1    MRGAVLVAVAAAIGNYLQGWDNATIAGAVLYIKREFALETQPAVEGLVVAMSLIGATIIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG ++D +GRRPMLI SS+ YF  GLIMLWSPNVYVLL+ARL+DGFG+GLAVTLVP+Y
Sbjct  61   TFSGPVSDLVGRRPMLIASSLLYFAGGLIMLWSPNVYVLLLARLVDGFGVGLAVTLVPVY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISET+P EIRG LNTLPQFTGSGGMF++YCMIF M+++ +P+WR+MLGVL +PSLLY  +
Sbjct  121  ISETSPPEIRGRLNTLPQFTGSGGMFMSYCMIFAMTLSPSPNWRIMLGVLFVPSLLYLFV  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            TVFYLPESPRWLVSKGRM  A+ V
Sbjct  181  TVFYLPESPRWLVSKGRMKEARVV  204



>ref|XP_004978456.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Setaria 
italica]
 ref|XP_004978457.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Setaria 
italica]
 ref|XP_004978458.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X3 [Setaria 
italica]
Length=710

 Score =   299 bits (765),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 152/204 (75%), Positives = 180/204 (88%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  260
            M GAVLVA+AA IGN LQGWDNATIAGAV+YIKKE  L  E  +EGL+VA SLIGAT +T
Sbjct  1    MGGAVLVAVAAAIGNLLQGWDNATIAGAVLYIKKEFNLQSEPLIEGLIVATSLIGATAVT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T +G++AD +GRRP+LI S++ YF+SGL+MLW+P+VYVLL+ARL+DG GIGLA+T+VPLY
Sbjct  61   TIAGAVADSIGRRPVLIASAVLYFVSGLVMLWAPSVYVLLLARLIDGLGIGLALTIVPLY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP+EIRG LNTLPQF  +GGMFL+YCM+FGMS+   P+WR+MLGVLSIPSL+YFAL
Sbjct  121  ISETAPTEIRGSLNTLPQFNATGGMFLSYCMVFGMSLFPKPNWRIMLGVLSIPSLIYFAL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
             VFYLPESPRWLVSKGRMV AKRV
Sbjct  181  AVFYLPESPRWLVSKGRMVEAKRV  204



>ref|XP_004290074.1| PREDICTED: monosaccharide-sensing protein 2 [Fragaria vesca subsp. 
vesca]
 ref|XP_011458100.1| PREDICTED: monosaccharide-sensing protein 2 [Fragaria vesca subsp. 
vesca]
Length=740

 Score =   299 bits (765),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 161/204 (79%), Positives = 188/204 (92%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M+GAVLVAIAA +GN LQGWDNATIA +V+YIK+E  LE+   +EGL+VAMSLIGATL+T
Sbjct  1    MSGAVLVAIAAAVGNLLQGWDNATIAASVLYIKREFNLESQPAVEGLIVAMSLIGATLVT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            TCSG++ADW+GRRPMLI+SS+ YFLSG++MLWSPNVY+LL+ARLLDG GIGLAVTLVPLY
Sbjct  61   TCSGAVADWIGRRPMLIISSVLYFLSGIVMLWSPNVYILLLARLLDGLGIGLAVTLVPLY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRG LNTLPQF GSGGMFL+YCM+F +S+T APSWRLMLGVLSIPSL+YFAL
Sbjct  121  ISETAPPEIRGSLNTLPQFAGSGGMFLSYCMVFVLSLTEAPSWRLMLGVLSIPSLVYFAL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            T+F+LPESPRWLVSKGRM+ AK+V
Sbjct  181  TLFFLPESPRWLVSKGRMLEAKKV  204



>ref|XP_009359632.1| PREDICTED: monosaccharide-sensing protein 2-like [Pyrus x bretschneideri]
Length=736

 Score =   298 bits (764),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 154/204 (75%), Positives = 174/204 (85%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M GAV VA+AA IGN LQGWDN+ IAG+VVYIKKE  LE+    EGL+ A SLIGAT IT
Sbjct  1    MRGAVFVAVAAAIGNLLQGWDNSVIAGSVVYIKKEFELESEPTFEGLIAASSLIGATFIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG  +DWLGRR MLI+SS+ +F+SGL+ML SPNVYVLL ARLLDGFG GLAVTLVP Y
Sbjct  61   TFSGPASDWLGRRTMLIISSVLFFISGLVMLLSPNVYVLLFARLLDGFGTGLAVTLVPAY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISE AP +IRG LNTLPQFTGSGGMFL+YCM+FGMS+   P+WRLMLGV+SIPSLLYFAL
Sbjct  121  ISEIAPPDIRGRLNTLPQFTGSGGMFLSYCMVFGMSLMDLPNWRLMLGVVSIPSLLYFAL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            TVFYLPESPRWLVSKGR++ AK+V
Sbjct  181  TVFYLPESPRWLVSKGRILEAKQV  204



>gb|KGN49001.1| hypothetical protein Csa_6G509700 [Cucumis sativus]
Length=768

 Score =   298 bits (763),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 155/206 (75%), Positives = 181/206 (88%), Gaps = 2/206 (1%)
 Frame = +3

Query  81   LRMNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLE--TYMEGLVVAMSLIGATL  254
            LRM GAVLVAIAA IGN LQGWDNATIAGAV+YIKKE  LE     EGL+VAMSLIGAT+
Sbjct  45   LRMRGAVLVAIAAAIGNLLQGWDNATIAGAVMYIKKEFKLEGDPTTEGLIVAMSLIGATV  104

Query  255  ITTCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVP  434
            ITT SG ++D +GRRP++I SS+ YF SGL+MLW+P+V+VLL+ARLLDGFG+GLAVTLVP
Sbjct  105  ITTFSGPLSDSVGRRPLMIASSILYFTSGLVMLWAPDVHVLLLARLLDGFGVGLAVTLVP  164

Query  435  LYISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYF  614
            +YISETAP+EIRGLLNTLPQFTGS GMFL+YCM+FGMS+T +PSWR MLG+L +PSL+Y 
Sbjct  165  VYISETAPAEIRGLLNTLPQFTGSIGMFLSYCMVFGMSLTKSPSWRTMLGLLFMPSLIYL  224

Query  615  ALTVFYLPESPRWLVSKGRMVXAKRV  692
             LTV +LPESPRWLVSKGRM  AK+V
Sbjct  225  VLTVMFLPESPRWLVSKGRMNEAKKV  250



>gb|KHG14026.1| Monosaccharide-sensing 2 -like protein [Gossypium arboreum]
Length=737

 Score =   297 bits (761),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 155/204 (76%), Positives = 182/204 (89%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M+GAVLVA+ ATIGN LQGWD+ATIAGAV+YIKKE  LE+   +EGL+VAMSLIGAT IT
Sbjct  1    MSGAVLVALTATIGNLLQGWDSATIAGAVMYIKKEFKLESEPAIEGLIVAMSLIGATCIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            TCSGS++DWLGRRP+LI+SS+ Y LSG++MLW+PNV  LL+ARLLDG GIGLAVTL+P+Y
Sbjct  61   TCSGSMSDWLGRRPILIISSLLYCLSGIVMLWAPNVPTLLLARLLDGLGIGLAVTLIPIY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRG LNTLP F+G  GMFL+YCM+FGMS+TT P+WRLMLGVLSIPSL+Y AL
Sbjct  121  ISETAPPEIRGFLNTLPLFSGCLGMFLSYCMVFGMSLTTLPNWRLMLGVLSIPSLVYLAL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            TVF+LPESPRWLVSKGRM  A++V
Sbjct  181  TVFFLPESPRWLVSKGRMSEARKV  204



>emb|CDY33276.1| BnaA01g19430D [Brassica napus]
Length=668

 Score =   295 bits (756),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 155/204 (76%), Positives = 176/204 (86%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  260
            M   VLVA+AA IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGAT+IT
Sbjct  1    MRSVVLVALAAAIGNMLQGWDNATIAGAVIYIKKEFHLEKEPKIEGLIVAMSLIGATMIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG ++D +GRR MLILSS+ YFLS ++M WSPNVYVLL ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TFSGPVSDRVGRRSMLILSSLLYFLSSIVMFWSPNVYVLLFARLLDGFGIGLAVTLVPIY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAPSEIRGLLNT PQF GSGGMFL+YC++FGMS+  +PSWRLMLGVLSIPS+LYF L
Sbjct  121  ISETAPSEIRGLLNTFPQFCGSGGMFLSYCLVFGMSLQESPSWRLMLGVLSIPSILYFVL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
              F+LPESPRWLVSKGRM  A++V
Sbjct  181  AAFFLPESPRWLVSKGRMEEARQV  204



>ref|XP_009148978.1| PREDICTED: monosaccharide-sensing protein 3 [Brassica rapa]
Length=741

 Score =   296 bits (759),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 155/204 (76%), Positives = 176/204 (86%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  260
            M   VLVA+AA IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGAT+IT
Sbjct  1    MRSVVLVALAAAIGNMLQGWDNATIAGAVIYIKKEFHLEKEPKIEGLIVAMSLIGATMIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG ++D +GRR MLILSS+ YFLS ++M WSPNVYVLL ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TFSGPVSDRVGRRSMLILSSLLYFLSSIVMFWSPNVYVLLFARLLDGFGIGLAVTLVPIY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAPSEIRGLLNT PQF GSGGMFL+YC++FGMS+  +PSWRLMLGVLSIPS+LYF L
Sbjct  121  ISETAPSEIRGLLNTFPQFCGSGGMFLSYCLVFGMSLQESPSWRLMLGVLSIPSILYFVL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
              F+LPESPRWLVSKGRM  A++V
Sbjct  181  AAFFLPESPRWLVSKGRMEEARQV  204



>emb|CDY16303.1| BnaC01g23380D [Brassica napus]
Length=670

 Score =   294 bits (752),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 154/204 (75%), Positives = 175/204 (86%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  260
            M   VLVA+ A IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGAT+IT
Sbjct  1    MRSVVLVALTAAIGNMLQGWDNATIAGAVIYIKKEFHLEKEPKIEGLIVAMSLIGATMIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG ++D +GRR MLILSS+ YFLS ++M WSPNVYVLL ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TFSGPVSDRVGRRSMLILSSLLYFLSSIVMFWSPNVYVLLFARLLDGFGIGLAVTLVPIY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAPSEIRGLLNT PQF GSGGMFL+YC++FGMS+  +PSWRLMLGVLSIPS+LYF L
Sbjct  121  ISETAPSEIRGLLNTFPQFCGSGGMFLSYCLVFGMSLQESPSWRLMLGVLSIPSILYFVL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
              F+LPESPRWLVSKGRM  A++V
Sbjct  181  AAFFLPESPRWLVSKGRMEEARQV  204



>ref|XP_006412119.1| hypothetical protein EUTSA_v10024517mg [Eutrema salsugineum]
 ref|XP_006412120.1| hypothetical protein EUTSA_v10024517mg [Eutrema salsugineum]
 ref|XP_006412121.1| hypothetical protein EUTSA_v10024517mg [Eutrema salsugineum]
 gb|ESQ53572.1| hypothetical protein EUTSA_v10024517mg [Eutrema salsugineum]
 gb|ESQ53573.1| hypothetical protein EUTSA_v10024517mg [Eutrema salsugineum]
 gb|ESQ53574.1| hypothetical protein EUTSA_v10024517mg [Eutrema salsugineum]
Length=734

 Score =   295 bits (756),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 159/204 (78%), Positives = 183/204 (90%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M+GAVLVA+AA +GN LQGWDNATIAGAV+YIKKE  LE+   MEGL+VAMSLIGATLIT
Sbjct  1    MSGAVLVAVAAAVGNLLQGWDNATIAGAVLYIKKEFHLESNPSMEGLIVAMSLIGATLIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG +ADWLGRRPMLILSS+ YF+  L+MLWSPNVYVLL+ RLLDGFG+G+ VTLVP+Y
Sbjct  61   TWSGGVADWLGRRPMLILSSVLYFVGSLVMLWSPNVYVLLLGRLLDGFGVGIVVTLVPIY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRG LNTLPQFTGSGGMFL+YCM+FGMS+  +PSWRLMLGVL +PS+++F L
Sbjct  121  ISETAPPEIRGSLNTLPQFTGSGGMFLSYCMVFGMSLMPSPSWRLMLGVLFVPSIVFFFL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            TVF+LPESPRWLVSKGRM+ AKRV
Sbjct  181  TVFFLPESPRWLVSKGRMLEAKRV  204



>ref|XP_004289030.1| PREDICTED: monosaccharide-sensing protein 2 [Fragaria vesca subsp. 
vesca]
Length=714

 Score =   294 bits (753),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 151/204 (74%), Positives = 172/204 (84%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M GAV VA+AA IGN LQGWDN+ IAG+V+YIKKE  LE+    EGL+VA SLIGAT+IT
Sbjct  1    MRGAVYVAVAAAIGNMLQGWDNSVIAGSVLYIKKEFSLESKPTFEGLIVATSLIGATVIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG  +DWLGRR MLI+SS+ +FLSGL+MLWSPNVYVLL ARLLDGFG GLAVTLVP Y
Sbjct  61   TFSGPASDWLGRRTMLIMSSLLFFLSGLVMLWSPNVYVLLYARLLDGFGTGLAVTLVPAY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISE AP +IRG LNTLPQFTGS GMFL+YCM+FGMS+   P+WR+MLGVLSIPSL Y  L
Sbjct  121  ISEIAPPDIRGTLNTLPQFTGSAGMFLSYCMVFGMSLMDTPNWRMMLGVLSIPSLAYLVL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            TV YLPESPRWLVSKGR++ AK+V
Sbjct  181  TVLYLPESPRWLVSKGRILEAKQV  204



>ref|XP_004134823.1| PREDICTED: monosaccharide-sensing protein 2-like [Cucumis sativus]
Length=722

 Score =   294 bits (753),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 153/204 (75%), Positives = 179/204 (88%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLE--TYMEGLVVAMSLIGATLIT  260
            M GAVLVAIAA IGN LQGWDNATIAGAV+YIKKE  LE     EGL+VAMSLIGAT+IT
Sbjct  1    MRGAVLVAIAAAIGNLLQGWDNATIAGAVMYIKKEFKLEGDPTTEGLIVAMSLIGATVIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG ++D +GRRP++I SS+ YF SGL+MLW+P+V+VLL+ARLLDGFG+GLAVTLVP+Y
Sbjct  61   TFSGPLSDSVGRRPLMIASSILYFTSGLVMLWAPDVHVLLLARLLDGFGVGLAVTLVPVY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP+EIRGLLNTLPQFTGS GMFL+YCM+FGMS+T +PSWR MLG+L +PSL+Y  L
Sbjct  121  ISETAPAEIRGLLNTLPQFTGSIGMFLSYCMVFGMSLTKSPSWRTMLGLLFMPSLIYLVL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            TV +LPESPRWLVSKGRM  AK+V
Sbjct  181  TVMFLPESPRWLVSKGRMNEAKKV  204



>gb|KHN20087.1| Monosaccharide-sensing protein 2 [Glycine soja]
Length=712

 Score =   294 bits (752),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 149/202 (74%), Positives = 165/202 (82%), Gaps = 25/202 (12%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  266
            M GAVLVAIAA+IGNFLQGWDNATIAGA+VYIKK+L LET MEGLVVAMSLIGAT+ITTC
Sbjct  1    MKGAVLVAIAASIGNFLQGWDNATIAGAIVYIKKDLALETTMEGLVVAMSLIGATVITTC  60

Query  267  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  446
            SG +ADW                              LI+RLLDGFGIGLAVTLVP+YIS
Sbjct  61   SGPVADWTHDDN-------------------------LISRLLDGFGIGLAVTLVPVYIS  95

Query  447  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  626
            ETAPSEIRG LNTLPQF+GSGGMFL+YCM+FGMS++ APSWRLMLGVLSIPSLLYFALT+
Sbjct  96   ETAPSEIRGSLNTLPQFSGSGGMFLSYCMVFGMSLSPAPSWRLMLGVLSIPSLLYFALTI  155

Query  627  FYLPESPRWLVSKGRMVXAKRV  692
            F+LPESPRWLVSKGRM+ AK+V
Sbjct  156  FFLPESPRWLVSKGRMLEAKKV  177



>ref|XP_006292750.1| hypothetical protein CARUB_v10018997mg [Capsella rubella]
 gb|EOA25648.1| hypothetical protein CARUB_v10018997mg [Capsella rubella]
Length=729

 Score =   294 bits (753),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 155/204 (76%), Positives = 175/204 (86%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  260
            M   VLVA+AA IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGATLIT
Sbjct  1    MRSVVLVALAAAIGNMLQGWDNATIAGAVIYIKKEFHLEKEPKIEGLIVAMSLIGATLIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG ++D +GRR MLILSS+ YFLS ++M WSPNVYVLL ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TFSGPVSDKVGRRSMLILSSLLYFLSSIVMFWSPNVYVLLFARLLDGFGIGLAVTLVPIY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAPSEIRGLLNT PQF GSGGMFL+YC++FGMS+  +PSWRLMLGVLSIPS+ YF L
Sbjct  121  ISETAPSEIRGLLNTFPQFCGSGGMFLSYCLVFGMSLQESPSWRLMLGVLSIPSIAYFVL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
              F+LPESPRWLVSKGRM  A++V
Sbjct  181  AAFFLPESPRWLVSKGRMDEARQV  204



>ref|XP_008242155.1| PREDICTED: monosaccharide-sensing protein 2-like [Prunus mume]
Length=738

 Score =   295 bits (754),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 151/204 (74%), Positives = 173/204 (85%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M GAV VA+AA +GN LQGWDN+ IAG+V YIKKE  LE+    EGL+VA SLIGAT IT
Sbjct  1    MRGAVFVAVAAAVGNLLQGWDNSVIAGSVHYIKKEFELESQPTFEGLIVATSLIGATFIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG  +DWLGRR MLI+SS  +F+SGL+ML SPNVYVLL ARLLDGFG GLAVTLVP Y
Sbjct  61   TFSGPASDWLGRRTMLIISSALFFISGLVMLLSPNVYVLLFARLLDGFGTGLAVTLVPAY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISE AP +IRG LNTLPQFTGSGGMFL+YCM+FGMS+  +PSWRLMLGV+SIPSL+YF+L
Sbjct  121  ISEIAPPDIRGTLNTLPQFTGSGGMFLSYCMVFGMSLMDSPSWRLMLGVVSIPSLVYFSL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
             VFYLPESPRWLVSKGR++ AK+V
Sbjct  181  AVFYLPESPRWLVSKGRILEAKQV  204



>ref|XP_007203009.1| hypothetical protein PRUPE_ppa017631mg [Prunus persica]
 gb|EMJ04208.1| hypothetical protein PRUPE_ppa017631mg [Prunus persica]
Length=738

 Score =   294 bits (752),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 151/204 (74%), Positives = 173/204 (85%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M GAV VA+AA +GN LQGWDN+ IAG+V YIKKE  LE+    EGL+VA SLIGAT IT
Sbjct  1    MRGAVFVAVAAAVGNLLQGWDNSVIAGSVHYIKKEFELESQPTFEGLIVATSLIGATFIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG  +DWLGRR MLI+SS  +F+SGL+ML SPNVYVLL ARLLDGFG GLAVTLVP Y
Sbjct  61   TFSGPASDWLGRRTMLIISSALFFISGLVMLLSPNVYVLLFARLLDGFGTGLAVTLVPAY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISE AP +IRG LNTLPQFTGSGGMFL+YCM+FGMS+  +PSWRLMLGV+SIPSL+YF+L
Sbjct  121  ISEIAPPDIRGTLNTLPQFTGSGGMFLSYCMVFGMSMMDSPSWRLMLGVVSIPSLVYFSL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
             VFYLPESPRWLVSKGR++ AK+V
Sbjct  181  AVFYLPESPRWLVSKGRILEAKQV  204



>ref|XP_006403910.1| hypothetical protein EUTSA_v10011113mg [Eutrema salsugineum]
 gb|ESQ45363.1| hypothetical protein EUTSA_v10011113mg [Eutrema salsugineum]
Length=739

 Score =   294 bits (752),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 153/204 (75%), Positives = 175/204 (86%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  260
            M   VLVA+AA IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGATLIT
Sbjct  1    MQSVVLVALAAAIGNMLQGWDNATIAGAVIYIKKEFHLEKEPKIEGLIVAMSLIGATLIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG ++D +GRR ML+LSS+ YFLS ++M WSPNVYVLL ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TFSGPVSDRVGRRSMLVLSSLLYFLSSIVMFWSPNVYVLLFARLLDGFGIGLAVTLVPIY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAPSEIRGLLNT PQF GSGGMFL+YC++F MS+  +PSWRLMLGVLSIPS++YF L
Sbjct  121  ISETAPSEIRGLLNTFPQFCGSGGMFLSYCLVFAMSLQESPSWRLMLGVLSIPSIIYFVL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
              F+LPESPRWLVSKGRM  A++V
Sbjct  181  AAFFLPESPRWLVSKGRMDEARQV  204



>ref|XP_010503840.1| PREDICTED: monosaccharide-sensing protein 3-like [Camelina sativa]
Length=740

 Score =   293 bits (751),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 154/204 (75%), Positives = 175/204 (86%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  260
            M   VLVA+AA IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGAT+IT
Sbjct  1    MRSVVLVALAAAIGNMLQGWDNATIAGAVIYIKKEFHLEKEPKIEGLIVAMSLIGATMIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG ++D +GRR MLILSS+ YFLS ++M WSPNVYVLL ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TFSGPVSDKVGRRSMLILSSLLYFLSSIVMFWSPNVYVLLFARLLDGFGIGLAVTLVPIY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAPSEIRGLLNT PQF GSGGMFL+YC++FGMS+  +PSWRLMLGVLSIPS+ YF L
Sbjct  121  ISETAPSEIRGLLNTFPQFCGSGGMFLSYCLVFGMSLEASPSWRLMLGVLSIPSIAYFVL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
              F+LPESPRWLVSKGRM  A++V
Sbjct  181  AAFFLPESPRWLVSKGRMNKARQV  204



>ref|XP_008440928.1| PREDICTED: LOW QUALITY PROTEIN: monosaccharide-sensing protein 
2 [Cucumis melo]
Length=725

 Score =   293 bits (749),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 151/204 (74%), Positives = 179/204 (88%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLE--TYMEGLVVAMSLIGATLIT  260
            M GAVLVAIAA IGN LQGWDNATIAGAV+YIKKE  LE     EGL+VAMSLIGAT+IT
Sbjct  1    MRGAVLVAIAAAIGNLLQGWDNATIAGAVMYIKKEFKLEGDPTTEGLIVAMSLIGATVIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG ++D +GRRP++I SS+ YF SGL+MLW+P+V++LL+ARLLDGFG+GLAVTLVP+Y
Sbjct  61   TFSGPLSDSVGRRPLMITSSILYFTSGLVMLWAPDVHILLLARLLDGFGVGLAVTLVPVY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP+EIRGLLNTLPQFTGS GMFL+YCM+FGMS+T +PSWR+MLG+L +PSL+Y  L
Sbjct  121  ISETAPAEIRGLLNTLPQFTGSIGMFLSYCMVFGMSLTKSPSWRMMLGLLFMPSLIYLVL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            T  +LPESPRWLVSKGRM  AK+V
Sbjct  181  TFMFLPESPRWLVSKGRMNEAKKV  204



>ref|XP_004169167.1| PREDICTED: LOW QUALITY PROTEIN: monosaccharide-sensing protein 
2-like [Cucumis sativus]
Length=722

 Score =   293 bits (749),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 152/204 (75%), Positives = 178/204 (87%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLE--TYMEGLVVAMSLIGATLIT  260
            M GAVLVAIAA IGN LQGWDNATIAGAV+YIKKE  LE     EGL+VAMSLIGAT+IT
Sbjct  1    MRGAVLVAIAAAIGNLLQGWDNATIAGAVMYIKKEFKLEGDPTTEGLIVAMSLIGATVIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG ++D +GRRP++I SS+ YF SGL+MLW+P+V+VLL+ARLLDGFG+GLAVTLVP+Y
Sbjct  61   TFSGPLSDSVGRRPLMIASSILYFTSGLVMLWAPDVHVLLLARLLDGFGVGLAVTLVPVY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP+EIRGLLNTLPQFTGS GMF +YCM+FGMS+T +PSWR MLG+L +PSL+Y  L
Sbjct  121  ISETAPAEIRGLLNTLPQFTGSIGMFXSYCMVFGMSLTKSPSWRTMLGLLFMPSLIYLVL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            TV +LPESPRWLVSKGRM  AK+V
Sbjct  181  TVMFLPESPRWLVSKGRMNEAKKV  204



>ref|XP_010515555.1| PREDICTED: monosaccharide-sensing protein 3 [Camelina sativa]
Length=738

 Score =   293 bits (750),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 154/204 (75%), Positives = 175/204 (86%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  260
            M   VLVA+AA IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGAT+IT
Sbjct  1    MRSVVLVALAAAIGNMLQGWDNATIAGAVIYIKKEFHLEKEPKIEGLIVAMSLIGATMIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG ++D +GRR MLILSS+ YFLS ++M WSPNVYVLL ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TFSGPVSDKVGRRSMLILSSLLYFLSSIVMFWSPNVYVLLFARLLDGFGIGLAVTLVPIY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAPSEIRGLLNT PQF GSGGMFL+YC++FGMS+  +PSWRLMLGVLSIPS+ YF L
Sbjct  121  ISETAPSEIRGLLNTFPQFCGSGGMFLSYCLVFGMSLEASPSWRLMLGVLSIPSIAYFVL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
              F+LPESPRWLVSKGRM  A++V
Sbjct  181  AAFFLPESPRWLVSKGRMNEARQV  204



>ref|XP_010426703.1| PREDICTED: monosaccharide-sensing protein 3-like [Camelina sativa]
Length=738

 Score =   293 bits (749),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 154/204 (75%), Positives = 175/204 (86%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  260
            M   VLVA+AA IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGAT+IT
Sbjct  1    MRSVVLVALAAAIGNMLQGWDNATIAGAVIYIKKEFHLEKEPKIEGLIVAMSLIGATMIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG ++D +GRR MLILSS+ YFLS ++M WSPNVYVLL ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TFSGPVSDKVGRRSMLILSSLLYFLSSIVMFWSPNVYVLLFARLLDGFGIGLAVTLVPIY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAPSEIRGLLNT PQF GSGGMFL+YC++FGMS+  +PSWRLMLGVLSIPS+ YF L
Sbjct  121  ISETAPSEIRGLLNTFPQFCGSGGMFLSYCLVFGMSLEASPSWRLMLGVLSIPSIAYFVL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
              F+LPESPRWLVSKGRM  A++V
Sbjct  181  AAFFLPESPRWLVSKGRMNEARQV  204



>emb|CDX78009.1| BnaA09g32040D [Brassica napus]
Length=669

 Score =   291 bits (744),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 153/204 (75%), Positives = 175/204 (86%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  260
            M   VLV++AA IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGAT+IT
Sbjct  1    MRSVVLVSLAAAIGNMLQGWDNATIAGAVIYIKKEFHLEKEPKIEGLIVAMSLIGATMIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG ++D +GRR MLILSS+ YFLS ++M WSPNVYVLL ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TFSGPVSDKVGRRSMLILSSLLYFLSSIVMFWSPNVYVLLFARLLDGFGIGLAVTLVPIY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAPSEIRGLLNT PQF GSGGMFL+YC++FGMS+  +PSWRLMLGVLSIPS+LYF L
Sbjct  121  ISETAPSEIRGLLNTFPQFCGSGGMFLSYCLVFGMSLQKSPSWRLMLGVLSIPSVLYFLL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
              F+LPESPRWL SKGRM  A++V
Sbjct  181  AAFFLPESPRWLASKGRMEEARQV  204



>emb|CDX73717.1| BnaC08g22860D [Brassica napus]
Length=681

 Score =   291 bits (744),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 154/204 (75%), Positives = 175/204 (86%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  260
            M   VLV++AA IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGAT+IT
Sbjct  1    MRSVVLVSLAAAIGNMLQGWDNATIAGAVIYIKKEFHLEKEPKIEGLIVAMSLIGATMIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG ++D +GRR MLILSS+ YFLS L+M WSPNVYVLL ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TFSGPVSDKVGRRSMLILSSLLYFLSSLVMFWSPNVYVLLFARLLDGFGIGLAVTLVPIY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAPSEIRGLLNT PQF GSGGMFL+YC++FGMS+  +PSWRLMLGVLSIPS+LYF L
Sbjct  121  ISETAPSEIRGLLNTFPQFCGSGGMFLSYCLVFGMSLQESPSWRLMLGVLSIPSVLYFIL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
              F+LPESPRWL SKGRM  A++V
Sbjct  181  AAFFLPESPRWLASKGRMEEARQV  204



>ref|XP_009115837.1| PREDICTED: monosaccharide-sensing protein 3 [Brassica rapa]
Length=731

 Score =   292 bits (747),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 153/204 (75%), Positives = 175/204 (86%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  260
            M   VLV++AA IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGAT+IT
Sbjct  1    MRSVVLVSLAAAIGNMLQGWDNATIAGAVIYIKKEFHLEKEPKIEGLIVAMSLIGATMIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG ++D +GRR MLILSS+ YFLS ++M WSPNVYVLL ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TFSGPVSDKVGRRSMLILSSLLYFLSSIVMFWSPNVYVLLFARLLDGFGIGLAVTLVPIY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAPSEIRGLLNT PQF GSGGMFL+YC++FGMS+  +PSWRLMLGVLSIPS+LYF L
Sbjct  121  ISETAPSEIRGLLNTFPQFCGSGGMFLSYCLVFGMSLQKSPSWRLMLGVLSIPSVLYFLL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
              F+LPESPRWL SKGRM  A++V
Sbjct  181  AAFFLPESPRWLASKGRMEEARQV  204



>gb|KDP43790.1| hypothetical protein JCGZ_22417 [Jatropha curcas]
Length=729

 Score =   291 bits (746),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 144/204 (71%), Positives = 177/204 (87%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M GAVLVA+AA +GN LQGWDN+TIAG+++YIKKE  L+T   MEGL+ AMSLIGAT+IT
Sbjct  1    MRGAVLVALAAAVGNMLQGWDNSTIAGSLLYIKKEFNLQTQPTMEGLIAAMSLIGATIIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG ++D  GRRP++I+S++ YFLSGL+M W+PNVYVLL+ RLL+GFGIGLAVT+VP+Y
Sbjct  61   TFSGPVSDIYGRRPLMIISAIMYFLSGLVMFWAPNVYVLLLGRLLNGFGIGLAVTIVPVY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAPSEIRG LNT PQF GSGGMF++YCM+FGMS+  +P WR+MLGVLSIPS+ Y  L
Sbjct  121  ISETAPSEIRGQLNTFPQFMGSGGMFVSYCMVFGMSLMDSPKWRVMLGVLSIPSIAYLVL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            T+FYLPESPRWLVSKG+M  AK++
Sbjct  181  TIFYLPESPRWLVSKGKMSQAKQI  204



>gb|EPS57524.1| hypothetical protein M569_17293, partial [Genlisea aurea]
Length=693

 Score =   290 bits (741),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 149/204 (73%), Positives = 176/204 (86%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M GAVLVAIAA +GN LQGWDNATIAGAV+Y+K+E  LE+   +EGL+VA SLIGAT IT
Sbjct  1    MKGAVLVAIAAAVGNLLQGWDNATIAGAVLYVKREFHLESQPTVEGLIVATSLIGATFIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG  +D  GRRPML+LSS+ YF+SG++MLW+P+V +LL+ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TISGPASDSFGRRPMLLLSSILYFVSGIVMLWAPSVEILLLARLLDGFGIGLAVTLVPVY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRG LNTLPQFTGS GMFL+YCM+F MS+  +PSWRLMLG+LS+PS++YF L
Sbjct  121  ISETAPPEIRGTLNTLPQFTGSVGMFLSYCMVFTMSLMDSPSWRLMLGILSLPSVVYFFL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
             VF+LPESPRWLVSKGRM  AK V
Sbjct  181  AVFFLPESPRWLVSKGRMKEAKHV  204



>gb|KEH36403.1| tonoplast monosaccharide transporter 2 [Medicago truncatula]
Length=645

 Score =   286 bits (733),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 154/204 (75%), Positives = 179/204 (88%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  260
            M+GAV+VA+AA IGN LQGWDNATIAG+++YIK+E  L  E  +EGL+VAMSLIGAT++T
Sbjct  1    MSGAVIVAVAAAIGNLLQGWDNATIAGSILYIKREFQLQSEPTVEGLIVAMSLIGATVVT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            TCSG+++D  GRRPMLI+SS+ YFLS L+M WSPNVY+LL ARLLDG GIGLAVTLVPLY
Sbjct  61   TCSGALSDLFGRRPMLIISSLLYFLSSLVMFWSPNVYILLFARLLDGLGIGLAVTLVPLY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISE AP EIRG LNTLPQF GS GMF +YCM+FGMS+T APSWRLMLGVLSIPSL+YFAL
Sbjct  121  ISEIAPPEIRGSLNTLPQFAGSAGMFFSYCMVFGMSLTKAPSWRLMLGVLSIPSLIYFAL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            T+  LPESPRWLVSKGRM+ AK+V
Sbjct  181  TLLLLPESPRWLVSKGRMLEAKKV  204



>ref|XP_002532480.1| sugar transporter, putative [Ricinus communis]
 gb|EEF29904.1| sugar transporter, putative [Ricinus communis]
Length=536

 Score =   283 bits (725),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 140/204 (69%), Positives = 176/204 (86%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M GAVLVA+AA +GN LQGWDNATIAG+++YIK+E  L+T   MEGL+ A++LIGAT+IT
Sbjct  1    MRGAVLVALAAAVGNMLQGWDNATIAGSLLYIKREFNLQTQPTMEGLIAAVALIGATIIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
              +G ++D LGRRPMLI+S++ YFLSGL+M+W+PNVY+L++ R+LDGFG GLAVTLVP+Y
Sbjct  61   IFTGPVSDLLGRRPMLIISAIMYFLSGLVMVWAPNVYILILGRVLDGFGTGLAVTLVPVY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRG LNT PQF GSGGMF++YCM+FGMS+   P+WRLMLGVLSIPS+ Y AL
Sbjct  121  ISETAPPEIRGQLNTFPQFMGSGGMFVSYCMVFGMSLMDTPNWRLMLGVLSIPSIGYLAL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            T+ +LPESPRWLVSKG+M  A++V
Sbjct  181  TILFLPESPRWLVSKGKMREARQV  204



>ref|XP_010029563.1| PREDICTED: monosaccharide-sensing protein 2-like [Eucalyptus 
grandis]
 gb|KCW56481.1| hypothetical protein EUGRSUZ_I02209 [Eucalyptus grandis]
Length=738

 Score =   288 bits (738),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 140/204 (69%), Positives = 170/204 (83%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M GAVLVAIAATIG  LQGWD +TIAG+V+YIK E  L+    +EGL+VAMSLIG+T IT
Sbjct  1    MRGAVLVAIAATIGTMLQGWDGSTIAGSVLYIKGEFDLQEQPTIEGLIVAMSLIGSTAIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG ++D LGRRPM+I+ S+  F S LIMLW+PNVYVLL+ RL  GFGIG+A+TLVP+Y
Sbjct  61   TFSGPLSDSLGRRPMMIICSVLSFASALIMLWAPNVYVLLLGRLFSGFGIGIAITLVPIY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAPSEIRG LNT+PQF  S GMFL+YC++FG+S+  +PSWRLMLG  S+PSL+YF L
Sbjct  121  ISETAPSEIRGQLNTIPQFANSSGMFLSYCLVFGVSLMESPSWRLMLGFFSLPSLIYFLL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            TVF+LPESPRWLV+KGRM  A++V
Sbjct  181  TVFFLPESPRWLVTKGRMNEARQV  204



>gb|EYU40481.1| hypothetical protein MIMGU_mgv1a001997mg [Erythranthe guttata]
Length=728

 Score =   288 bits (737),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 164/191 (86%), Gaps = 2/191 (1%)
 Frame = +3

Query  126  GNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLITTCSGSIADWLGRR  299
            GN LQGWDNAT+AGA++YIKKE   E    MEGL VAMSLIGATLIT CSG I+DWLGRR
Sbjct  14   GNLLQGWDNATMAGAIIYIKKEFEWENEPTMEGLSVAMSLIGATLITLCSGGISDWLGRR  73

Query  300  PMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYISETAPSEIRGLL  479
            PMLI+SSMFYF+SG++MLWSPNVY LL ARLLDGFGIGLAVT VPLYISE +P EIRG+L
Sbjct  74   PMLIVSSMFYFVSGVLMLWSPNVYSLLCARLLDGFGIGLAVTFVPLYISEMSPPEIRGVL  133

Query  480  NTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTVFYLPESPRWLV  659
            +TL QFT S G+FL+Y  +F MS+T + SWRLMLGVL  PSL+YFALT+FYLPESPRWL+
Sbjct  134  STLSQFTYSSGIFLSYSFVFCMSLTESSSWRLMLGVLFAPSLIYFALTLFYLPESPRWLM  193

Query  660  SKGRMVXAKRV  692
            SKGR++ A++V
Sbjct  194  SKGRVLEARQV  204



>ref|XP_003604104.1| Monosaccharide-sensing protein [Medicago truncatula]
 gb|AES74355.1| tonoplast monosaccharide transporter 2 [Medicago truncatula]
Length=744

 Score =   286 bits (732),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 154/204 (75%), Positives = 179/204 (88%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  260
            M+GAV+VA+AA IGN LQGWDNATIAG+++YIK+E  L  E  +EGL+VAMSLIGAT++T
Sbjct  1    MSGAVIVAVAAAIGNLLQGWDNATIAGSILYIKREFQLQSEPTVEGLIVAMSLIGATVVT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            TCSG+++D  GRRPMLI+SS+ YFLS L+M WSPNVY+LL ARLLDG GIGLAVTLVPLY
Sbjct  61   TCSGALSDLFGRRPMLIISSLLYFLSSLVMFWSPNVYILLFARLLDGLGIGLAVTLVPLY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISE AP EIRG LNTLPQF GS GMF +YCM+FGMS+T APSWRLMLGVLSIPSL+YFAL
Sbjct  121  ISEIAPPEIRGSLNTLPQFAGSAGMFFSYCMVFGMSLTKAPSWRLMLGVLSIPSLIYFAL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            T+  LPESPRWLVSKGRM+ AK+V
Sbjct  181  TLLLLPESPRWLVSKGRMLEAKKV  204



>ref|XP_003560303.1| PREDICTED: monosaccharide-sensing protein 2-like [Brachypodium 
distachyon]
Length=770

 Score =   287 bits (734),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 155/204 (76%), Positives = 175/204 (86%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M GAVLVAIAA IGN LQGWDNATIAGAV+YIK+E  LET+  +EGLVVA SLIGAT+IT
Sbjct  1    MRGAVLVAIAAAIGNLLQGWDNATIAGAVLYIKREFHLETHPAIEGLVVATSLIGATIIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG +AD +GRRPMLI SS+ YFL GLIMLWSPNVYVLL+ARL+DGFG+GLAVTLVP+Y
Sbjct  61   TFSGPVADMVGRRPMLIASSILYFLGGLIMLWSPNVYVLLLARLVDGFGVGLAVTLVPVY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRGLLNTLPQFTGS GM ++Y MIF M++   PSWR+MLGVL  PSL+Y  L
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSWGMCMSYTMIFVMTLKADPSWRIMLGVLFAPSLVYLVL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            TVF+LPESPRWLVSKGRM  A+ V
Sbjct  181  TVFFLPESPRWLVSKGRMKEARVV  204



>ref|XP_010028861.1| PREDICTED: LOW QUALITY PROTEIN: monosaccharide-sensing protein 
2 [Eucalyptus grandis]
Length=730

 Score =   285 bits (730),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 135/204 (66%), Positives = 173/204 (85%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M+ AVL+A+ A  GN LQGWDNATIAGA++YIK+E  LE+   +EGL+VA+SL+GA L+T
Sbjct  1    MSRAVLIAVVAAFGNLLQGWDNATIAGAILYIKREFHLESEPAVEGLIVAISLLGAILVT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            TCSG++AD +GRRPML++SS FY +SGL+M WSPN+Y LL+AR + GFG+GL VTLVPLY
Sbjct  61   TCSGAMADCIGRRPMLVMSSHFYLISGLLMFWSPNLYALLLARFVGGFGVGLTVTLVPLY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            +SE AP EIRGLLNTLPQF+GS GMF++Y ++FG+S+  +PSWRLMLGVLSIPSL+Y  +
Sbjct  121  VSELAPPEIRGLLNTLPQFSGSCGMFVSYSLVFGLSLMHSPSWRLMLGVLSIPSLVYVXV  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
             +  LPESPRWLVSKGR++ AK+V
Sbjct  181  AILLLPESPRWLVSKGRVLEAKKV  204



>gb|KHN19961.1| Monosaccharide-sensing protein 2 [Glycine soja]
Length=723

 Score =   281 bits (719),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 136/178 (76%), Positives = 160/178 (90%), Gaps = 2/178 (1%)
 Frame = +3

Query  165  GAVVYIKKELVLETY--MEGLVVAMSLIGATLITTCSGSIADWLGRRPMLILSSMFYFLS  338
            G+++YIKKE  LE    +EGL+VAMSLIGAT++TTCSG+++D LGRRPMLI+SSM YF+S
Sbjct  14   GSIMYIKKEFQLENEPTVEGLIVAMSLIGATVVTTCSGALSDLLGRRPMLIISSMLYFVS  73

Query  339  GLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYISETAPSEIRGLLNTLPQFTGSGGMF  518
             L+MLWSPNVY+LL ARLLDG GIGLAVTLVPLYISETAP EIRGLLNTLPQFTGS GMF
Sbjct  74   SLVMLWSPNVYILLFARLLDGLGIGLAVTLVPLYISETAPPEIRGLLNTLPQFTGSLGMF  133

Query  519  LAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTVFYLPESPRWLVSKGRMVXAKRV  692
             +YCM+FGMS+  APSWR+MLGVLSIPSL++FALT+ +LPESPRWLVSKGRM+ AK+V
Sbjct  134  FSYCMVFGMSLMKAPSWRIMLGVLSIPSLIFFALTLLFLPESPRWLVSKGRMLEAKKV  191



>gb|EYU43535.1| hypothetical protein MIMGU_mgv1a002513mg [Erythranthe guttata]
Length=665

 Score =   278 bits (711),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 135/154 (88%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = +3

Query  231  MSLIGATLITTCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGI  410
            MSLIGAT+ITTCSG+I+D +GRRPMLI+SSMFYFLSG+IMLWSPNVYVLL+ARLLDGFGI
Sbjct  1    MSLIGATVITTCSGTISDSVGRRPMLIVSSMFYFLSGIIMLWSPNVYVLLLARLLDGFGI  60

Query  411  GLAVTLVPLYISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVL  590
            GLAVTLVPLYISETAPSEIRG LNTLPQF GSGGMFLAYCM+F MS+  +PSWRLMLGVL
Sbjct  61   GLAVTLVPLYISETAPSEIRGQLNTLPQFLGSGGMFLAYCMVFSMSLLPSPSWRLMLGVL  120

Query  591  SIPSLLYFALTVFYLPESPRWLVSKGRMVXAKRV  692
            SIPSLLYFA TVFYLPESPRWLVSKGRMV A+RV
Sbjct  121  SIPSLLYFAFTVFYLPESPRWLVSKGRMVEARRV  154



>gb|KJB14185.1| hypothetical protein B456_002G113400 [Gossypium raimondii]
Length=691

 Score =   278 bits (712),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 132/154 (86%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = +3

Query  231  MSLIGATLITTCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGI  410
            MSLIGAT ITTCSG+I+DW+GRRPMLI+SSM YF+SGL+MLWSPNVY+L +ARLLDGFGI
Sbjct  1    MSLIGATAITTCSGAISDWIGRRPMLIMSSMLYFVSGLVMLWSPNVYILCLARLLDGFGI  60

Query  411  GLAVTLVPLYISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVL  590
            GLAVTLVP+YISETAPSEIRGLLNTLPQFTGSGGMFL+YCM+FGMS+  +PSWRLMLGVL
Sbjct  61   GLAVTLVPVYISETAPSEIRGLLNTLPQFTGSGGMFLSYCMVFGMSLMDSPSWRLMLGVL  120

Query  591  SIPSLLYFALTVFYLPESPRWLVSKGRMVXAKRV  692
            SIPSLLYFA TVFYLPESPRWLVSKGRM+ AK+V
Sbjct  121  SIPSLLYFAFTVFYLPESPRWLVSKGRMLEAKQV  154



>ref|XP_004954530.1| PREDICTED: monosaccharide-sensing protein 2-like [Setaria italica]
Length=707

 Score =   277 bits (709),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 153/204 (75%), Positives = 174/204 (85%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M GAVLVAIAA IGN LQGWDNATIAGAV+YIK+E  LE +  MEGLVVA SLIGAT+IT
Sbjct  1    MRGAVLVAIAAAIGNMLQGWDNATIAGAVLYIKREFHLEAHPAMEGLVVATSLIGATVIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG ++D +GRRPMLI SS+ YF +GL+MLWSPNV+VLL++RL+DGF IGLAVTLVP+Y
Sbjct  61   TFSGPVSDSVGRRPMLIASSLLYFAAGLLMLWSPNVHVLLLSRLVDGFAIGLAVTLVPVY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRGLLNTLPQFTGSGGMFL+YCM+F M++   P WRLMLGVLS+ SL Y  L
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSGGMFLSYCMVFAMTLAPQPDWRLMLGVLSLLSLAYLLL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            TV YLPESPRWLVSKGRM  A+ V
Sbjct  181  TVLYLPESPRWLVSKGRMKEARAV  204



>ref|XP_006662557.1| PREDICTED: monosaccharide-sensing protein 2-like [Oryza brachyantha]
Length=717

 Score =   276 bits (705),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 134/177 (76%), Positives = 159/177 (90%), Gaps = 2/177 (1%)
 Frame = +3

Query  168  AVVYIKKELVL--ETYMEGLVVAMSLIGATLITTCSGSIADWLGRRPMLILSSMFYFLSG  341
            AV+YIKKE  L  E  +EGL+VAMSLIGAT++T+  G +AD +GRRPMLI S++ YF+SG
Sbjct  4    AVLYIKKEFNLQSEPLIEGLIVAMSLIGATVVTSFCGVVADSVGRRPMLIASAVLYFVSG  63

Query  342  LIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYISETAPSEIRGLLNTLPQFTGSGGMFL  521
            L+MLW+P+VYVLL+ARL+DGFGIGLAVTLVP+YISET+PS+IRGLLNTLPQF+GSGGMFL
Sbjct  64   LVMLWAPSVYVLLLARLIDGFGIGLAVTLVPMYISETSPSDIRGLLNTLPQFSGSGGMFL  123

Query  522  AYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTVFYLPESPRWLVSKGRMVXAKRV  692
            +YCM+FGMS+   P WR+MLGVLSIPS +YFALTVFYLPESPRWLVSKGRMV AKRV
Sbjct  124  SYCMVFGMSLMPQPEWRVMLGVLSIPSFIYFALTVFYLPESPRWLVSKGRMVEAKRV  180



>ref|XP_004964709.1| PREDICTED: monosaccharide-sensing protein 2-like [Setaria italica]
Length=748

 Score =   274 bits (701),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 153/204 (75%), Positives = 174/204 (85%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M GAVLVAIAA IGN LQGWDNATIAGAV+YIK+E  LET   +EGLVVA SLIGAT+IT
Sbjct  1    MQGAVLVAIAAAIGNMLQGWDNATIAGAVLYIKREFHLETQPALEGLVVATSLIGATIIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG ++D +GRRPMLI SS+ YF  GLIM+WSPNV VLL+ARL+DGFG+GLAVTLVP+Y
Sbjct  61   TFSGPVSDNVGRRPMLIASSLLYFAGGLIMMWSPNVVVLLLARLVDGFGVGLAVTLVPVY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRGLLNTLPQFTGS GMF +YCMIF M++  +PSWR MLGVLS+PSL Y AL
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSFGMFFSYCMIFYMTLAPSPSWRFMLGVLSLPSLAYLAL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            TV YLPESPRWLV+KGRM  A+ +
Sbjct  181  TVLYLPESPRWLVTKGRMKEARAI  204



>ref|XP_003603869.1| Monosaccharide-sensing protein [Medicago truncatula]
Length=689

 Score =   273 bits (697),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 130/161 (81%), Positives = 150/161 (93%), Gaps = 0/161 (0%)
 Frame = +3

Query  210  MEGLVVAMSLIGATLITTCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIAR  389
            MEGLVVAMSLIGAT+ITTCSG I+DWLGRRPM+I+SS+ YFL  L+MLWSPNVYVL +AR
Sbjct  1    MEGLVVAMSLIGATVITTCSGPISDWLGRRPMMIISSVLYFLGSLVMLWSPNVYVLCLAR  60

Query  390  LLDGFGIGLAVTLVPLYISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSW  569
            LLDGFGIGLAVTLVP+YISETAPS+IRG LNTLPQF+GSGGMFL+YCM+F MS++ +PSW
Sbjct  61   LLDGFGIGLAVTLVPVYISETAPSDIRGSLNTLPQFSGSGGMFLSYCMVFVMSLSPSPSW  120

Query  570  RLMLGVLSIPSLLYFALTVFYLPESPRWLVSKGRMVXAKRV  692
            R+MLGVLSIPSL YF LTVF+LPESPRWLVSKG+M+ AK+V
Sbjct  121  RIMLGVLSIPSLFYFLLTVFFLPESPRWLVSKGKMLEAKKV  161



>gb|ACG25339.1| hexose transporter [Zea mays]
Length=763

 Score =   272 bits (695),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 145/204 (71%), Positives = 169/204 (83%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  260
            M GAVLVAIAA IGN LQG DNA IA AV+YIK+E  LET   +EG+VVA SL GAT++T
Sbjct  1    MQGAVLVAIAAAIGNLLQGLDNAAIAAAVLYIKREFHLETDPALEGVVVATSLFGATIVT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
              SG ++D +GRRPMLI+SS+ YF  GL+MLWSP+V VLL+ARL+DGFG+GLAVTLVP+Y
Sbjct  61   IFSGPVSDVIGRRPMLIVSSLLYFAGGLLMLWSPSVPVLLVARLVDGFGVGLAVTLVPVY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRG LNTLPQ TGS GMFL+YCMIF M++  +PSWR MLGVLS+PSL Y AL
Sbjct  121  ISETAPPEIRGFLNTLPQLTGSLGMFLSYCMIFYMTLGDSPSWRFMLGVLSVPSLAYLAL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            TV YLPESPRWLVSKGRM  A+ +
Sbjct  181  TVLYLPESPRWLVSKGRMKEARAI  204



>dbj|BAK02857.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=729

 Score =   271 bits (693),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 138/204 (68%), Positives = 172/204 (84%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  260
            M GA LVA+AA +GN LQGWDNATIAG+++YIK++  L+    ++GLVVA SLIGATLIT
Sbjct  1    MRGAALVALAAALGNMLQGWDNATIAGSLLYIKRDFGLDAQPALQGLVVATSLIGATLIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SG ++D +GRRPML+ SS+ Y L+GL+MLWSP V VLL+ARL+DGF +GLAVTLVP+Y
Sbjct  61   TFSGPLSDHVGRRPMLVASSLLYALAGLLMLWSPTVGVLLLARLVDGFAVGLAVTLVPVY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP E+RGLL+TLPQ TGS GMFL+YCM+F M++  +P+WRLM+GVL +PSLLY A+
Sbjct  121  ISETAPPEVRGLLSTLPQLTGSTGMFLSYCMVFAMTLAPSPNWRLMMGVLVLPSLLYVAV  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
             VF+LPESPRWLVSKGRM  A+ V
Sbjct  181  AVFFLPESPRWLVSKGRMKEARTV  204



>ref|NP_001147067.1| hexose transporter [Zea mays]
 gb|ACN33422.1| unknown [Zea mays]
 gb|AFW69612.1| hexose transporter [Zea mays]
Length=763

 Score =   271 bits (694),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 145/204 (71%), Positives = 169/204 (83%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  260
            M GAVLVAIAA IGN LQG DNA IA AV+YIK+E  LET   +EG+VVA SL GAT++T
Sbjct  1    MQGAVLVAIAAAIGNLLQGLDNAAIAAAVLYIKREFHLETDPALEGVVVATSLFGATIVT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
              SG ++D +GRRPMLI+SS+ YF  GL+MLWSP+V VLL+ARL+DGFG+GLAVTLVP+Y
Sbjct  61   IFSGPVSDVIGRRPMLIVSSLLYFAGGLLMLWSPSVPVLLVARLVDGFGVGLAVTLVPVY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP EIRG LNTLPQ TGS GMFL+YCMIF M++  +PSWR MLGVLS+PSL Y AL
Sbjct  121  ISETAPPEIRGFLNTLPQLTGSLGMFLSYCMIFYMTLGDSPSWRFMLGVLSVPSLAYLAL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
            TV YLPESPRWLVSKGRM  A+ +
Sbjct  181  TVLYLPESPRWLVSKGRMKEARAI  204



>ref|XP_003517121.1| PREDICTED: monosaccharide-sensing protein 2-like [Glycine max]
Length=722

 Score =   267 bits (683),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 127/198 (64%), Positives = 163/198 (82%), Gaps = 0/198 (0%)
 Frame = +3

Query  99   VLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTCSGSI  278
            V+VAIAAT+GN L GWD++TIA  + YIKKE VL+  +EGL+V+MS I  T++T  SG++
Sbjct  5    VIVAIAATLGNLLMGWDSSTIAAGMTYIKKEFVLDATLEGLIVSMSFIIGTVVTIFSGTV  64

Query  279  ADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYISETAP  458
             D +GRRPMLI SS+ +FLSGL+MLW+PNV ++L+AR++DG  I LAVTL PLYISE AP
Sbjct  65   CDLVGRRPMLITSSIMFFLSGLVMLWAPNVVIVLLARIIDGVAIALAVTLTPLYISEVAP  124

Query  459  SEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTVFYLP  638
            ++IRG LNTL QF  SGGMFLAY ++F MS++ +PSWRLMLGV+ IP++ YF L VFYLP
Sbjct  125  ADIRGQLNTLTQFACSGGMFLAYILVFSMSLSDSPSWRLMLGVIFIPAVAYFLLAVFYLP  184

Query  639  ESPRWLVSKGRMVXAKRV  692
            ESPRWLVSKGR++ A+RV
Sbjct  185  ESPRWLVSKGRLLEAERV  202



>gb|KHG00737.1| Monosaccharide-sensing 2 -like protein [Gossypium arboreum]
Length=726

 Score =   267 bits (683),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 134/202 (66%), Positives = 155/202 (77%), Gaps = 35/202 (17%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  266
            M G VLVA+AA IGNFLQGWD ATIAG                                 
Sbjct  30   MGGPVLVAVAAAIGNFLQGWDTATIAGY--------------------------------  57

Query  267  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  446
               I+DWLGRRP+LI+SS+FYFLSG++M+WSPNVY+LL+ RL+DGFG+GLAVTLVP+YIS
Sbjct  58   ---ISDWLGRRPLLIISSVFYFLSGIVMIWSPNVYILLLGRLMDGFGVGLAVTLVPVYIS  114

Query  447  ETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTV  626
            ETAP EIRGLLNTLPQFTGS GMFL+YCM+FGMS++T P+WRLMLGVLSIPSL+YFALTV
Sbjct  115  ETAPPEIRGLLNTLPQFTGSIGMFLSYCMVFGMSLSTIPNWRLMLGVLSIPSLVYFALTV  174

Query  627  FYLPESPRWLVSKGRMVXAKRV  692
            F+LPESPRWLVSKGRM  A +V
Sbjct  175  FFLPESPRWLVSKGRMCEAIKV  196



>ref|XP_003537696.1| PREDICTED: monosaccharide-sensing protein 2-like [Glycine max]
 gb|KHN41803.1| Monosaccharide-sensing protein 3 [Glycine soja]
Length=722

 Score =   264 bits (674),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 125/198 (63%), Positives = 162/198 (82%), Gaps = 0/198 (0%)
 Frame = +3

Query  99   VLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTCSGSI  278
            V+VAIAAT+GN L GWD++TIA  + YIKKE VL+  +EGL+V+MS I  T++T  SG++
Sbjct  5    VIVAIAATLGNLLMGWDSSTIAAGMTYIKKEFVLDATLEGLIVSMSFITGTIVTLFSGTV  64

Query  279  ADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYISETAP  458
            +D +GRRPMLI SS+ +FLSGL+MLW+PNV ++L+AR++DG  I LAVTL PLYISE AP
Sbjct  65   SDLVGRRPMLITSSIMFFLSGLVMLWAPNVVIVLLARIIDGVAIALAVTLTPLYISEVAP  124

Query  459  SEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTVFYLP  638
            ++IRG LNTL QF  SGGMF AY ++F MS++ +PSWRLMLGV+ IP++ YF L VFYLP
Sbjct  125  ADIRGQLNTLTQFACSGGMFFAYILVFSMSLSDSPSWRLMLGVIFIPAIAYFLLAVFYLP  184

Query  639  ESPRWLVSKGRMVXAKRV  692
            ESPRWLVSKGR++ A+ V
Sbjct  185  ESPRWLVSKGRLLEAEIV  202



>ref|XP_007158028.1| hypothetical protein PHAVU_002G118100g [Phaseolus vulgaris]
 gb|ESW30022.1| hypothetical protein PHAVU_002G118100g [Phaseolus vulgaris]
Length=720

 Score =   263 bits (672),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 125/198 (63%), Positives = 161/198 (81%), Gaps = 0/198 (0%)
 Frame = +3

Query  99   VLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTCSGSI  278
            V+VA+AATIGN L GWD++TIA  + YIKK+ +L+  +EGL+V+MS I  T++T  SG++
Sbjct  5    VIVALAATIGNLLMGWDSSTIAAGMTYIKKDFILDATIEGLIVSMSFITGTVVTIFSGAV  64

Query  279  ADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYISETAP  458
            +D +GRRPMLI SS+ +FLSGLIM W+PNV V+L+AR+++G  I LAVTL PLYISE AP
Sbjct  65   SDMVGRRPMLITSSVMFFLSGLIMFWAPNVAVILVARIVNGVAIALAVTLNPLYISEVAP  124

Query  459  SEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTVFYLP  638
            ++IRG LNT  QF  SGGM LAY M+F MS+T +PSWRLMLGV+SIP++ Y  L VFYLP
Sbjct  125  ADIRGQLNTFTQFACSGGMLLAYIMVFSMSLTDSPSWRLMLGVISIPAVAYILLAVFYLP  184

Query  639  ESPRWLVSKGRMVXAKRV  692
            ESPRWLVSKGR++ A+RV
Sbjct  185  ESPRWLVSKGRLLEAERV  202



>gb|KHG04802.1| Monosaccharide-sensing protein 2 [Gossypium arboreum]
 gb|KHG22590.1| Monosaccharide-sensing protein 2 [Gossypium arboreum]
Length=690

 Score =   262 bits (670),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = +3

Query  231  MSLIGATLITTCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGI  410
            MSLIGAT ITTCSG I+DWLGRRPMLI+SS+ Y +SGL+MLWSPNVY+LL+ARLLDGFG+
Sbjct  1    MSLIGATCITTCSGGISDWLGRRPMLIISSVLYCVSGLVMLWSPNVYILLLARLLDGFGV  60

Query  411  GLAVTLVPLYISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVL  590
            GLAVTLVP+YISETAP EIRGLLNTLPQFTGS GMF +YCM+FGMS++  P+WRLMLGVL
Sbjct  61   GLAVTLVPVYISETAPPEIRGLLNTLPQFTGSIGMFFSYCMVFGMSLSELPNWRLMLGVL  120

Query  591  SIPSLLYFALTVFYLPESPRWLVSKGRMVXAKRV  692
            SIPSL+YF LT+F+LPESPRWLVSKGRM  AK+V
Sbjct  121  SIPSLIYFILTIFFLPESPRWLVSKGRMSEAKKV  154



>ref|XP_007156262.1| hypothetical protein PHAVU_003G271500g [Phaseolus vulgaris]
 gb|ESW28256.1| hypothetical protein PHAVU_003G271500g [Phaseolus vulgaris]
Length=687

 Score =   256 bits (655),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 125/204 (61%), Positives = 160/204 (78%), Gaps = 2/204 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  260
            M   V+VAIAAT+GN L GWD++TIAG + YIKKE  LET   +EGL+++ S +  T++T
Sbjct  1    MREVVIVAIAATVGNVLVGWDSSTIAGGMSYIKKEFKLETDPTLEGLIMSTSFLTGTVVT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
              SG++ D LGRRPMLI++S  +FLSGL+MLW+PNV V+L +RLL+G  + LA+TL PLY
Sbjct  61   IFSGTVCDMLGRRPMLIVASTMFFLSGLVMLWAPNVTVILFSRLLNGIALALAITLTPLY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISE +P +IRG LNTLPQF+ SGGMFLAY M+F +S+  +PSWR ML V+SIPS+ YF L
Sbjct  121  ISEISPPDIRGTLNTLPQFSCSGGMFLAYIMVFSLSLVDSPSWRAMLAVVSIPSVAYFFL  180

Query  621  TVFYLPESPRWLVSKGRMVXAKRV  692
             VFYLPESP WLVSKGR+  AK+V
Sbjct  181  AVFYLPESPPWLVSKGRVTEAKKV  204



>ref|XP_003573173.1| PREDICTED: monosaccharide-sensing protein 2-like [Brachypodium 
distachyon]
Length=709

 Score =   256 bits (654),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 122/190 (64%), Positives = 158/190 (83%), Gaps = 2/190 (1%)
 Frame = +3

Query  129  NFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLITTCSGSIADWLGRRP  302
            N LQGWDNATIAG+++YIK+E  LE +  +EGLVVA SLIGAT++TT SG ++D +GRRP
Sbjct  16   NMLQGWDNATIAGSLLYIKREFRLEGHPALEGLVVATSLIGATVVTTFSGPLSDSVGRRP  75

Query  303  MLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYISETAPSEIRGLLN  482
            ML+ SS+ Y L+GL+MLWSPNV +LL++RL+ G  +GLAVTLVP+YISETAP+E RG LN
Sbjct  76   MLVASSLLYALAGLLMLWSPNVQLLLLSRLVGGLAVGLAVTLVPVYISETAPAETRGRLN  135

Query  483  TLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFALTVFYLPESPRWLVS  662
            TLPQ TGS GMFL YC +F ++++++P WRLMLGV+ +P+LLY  + V++LPESPRWLVS
Sbjct  136  TLPQLTGSAGMFLGYCFVFAVTLSSSPDWRLMLGVVFLPALLYVGVAVWFLPESPRWLVS  195

Query  663  KGRMVXAKRV  692
            KGRM  A+ V
Sbjct  196  KGRMKEAREV  205



>gb|EMS60524.1| Monosaccharide-sensing protein 3 [Triticum urartu]
Length=407

 Score =   247 bits (631),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 125/193 (65%), Positives = 163/193 (84%), Gaps = 2/193 (1%)
 Frame = +3

Query  87   MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  260
            M GA LVA+AA +GN LQGWDNATIAG+++YIK++  L  +  ++GLVVA SLIGATLIT
Sbjct  1    MRGAALVALAAALGNMLQGWDNATIAGSLLYIKRDFGLHGQPALQGLVVATSLIGATLIT  60

Query  261  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  440
            T SGS++D +GRRPML+ SS+ Y L+G++MLWSP V VLL+ARL+ GF +GLAVTL+P+Y
Sbjct  61   TFSGSLSDRVGRRPMLVASSLLYTLAGMLMLWSPTVGVLLLARLVGGFAVGLAVTLIPVY  120

Query  441  ISETAPSEIRGLLNTLPQFTGSGGMFLAYCMIFGMSVTTAPSWRLMLGVLSIPSLLYFAL  620
            ISETAP E+RGLL+TLPQ TGS GMFLAYCM+F M++  +P+WR+M+GVL +PSL+Y A+
Sbjct  121  ISETAPPEVRGLLSTLPQLTGSTGMFLAYCMVFAMTLAPSPNWRVMMGVLVLPSLVYVAV  180

Query  621  TVFYLPESPRWLV  659
             + +LPESPRWL+
Sbjct  181  AMLFLPESPRWLI  193



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1171852487340