BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF051C08

Length=677
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_008452860.1|  PREDICTED: transcription initiation factor T...    384   5e-126   Cucumis melo [Oriental melon]
ref|XP_009795607.1|  PREDICTED: transcription initiation factor T...    375   5e-126   Nicotiana sylvestris
ref|XP_009795606.1|  PREDICTED: transcription initiation factor T...    375   5e-126   Nicotiana sylvestris
ref|XP_004145505.1|  PREDICTED: transcription initiation factor T...    383   8e-126   Cucumis sativus [cucumbers]
ref|XP_007011731.1|  TBP-associated factor 5 isoform 2                  379   2e-125   
ref|XP_009626036.1|  PREDICTED: transcription initiation factor T...    378   3e-125   
ref|XP_003631761.1|  PREDICTED: transcription initiation factor T...    380   1e-124   Vitis vinifera
ref|XP_009626034.1|  PREDICTED: transcription initiation factor T...    380   1e-124   
ref|XP_009626035.1|  PREDICTED: transcription initiation factor T...    379   2e-124   
ref|XP_002324907.2|  hypothetical protein POPTR_0018s02430g             379   3e-124   
ref|XP_011036669.1|  PREDICTED: transcription initiation factor T...    379   3e-124   Populus euphratica
ref|XP_007011730.1|  TBP-associated factor 5 isoform 1                  380   3e-124   
ref|XP_011036668.1|  PREDICTED: transcription initiation factor T...    379   3e-124   Populus euphratica
ref|XP_006353658.1|  PREDICTED: transcription initiation factor T...    379   4e-124   Solanum tuberosum [potatoes]
ref|XP_007225152.1|  hypothetical protein PRUPE_ppa002437mg             378   5e-124   Prunus persica
gb|EYU40594.1|  hypothetical protein MIMGU_mgv1a002477mg                377   1e-123   Erythranthe guttata [common monkey flower]
ref|XP_008220685.1|  PREDICTED: transcription initiation factor T...    377   1e-123   Prunus mume [ume]
gb|KDP33523.1|  hypothetical protein JCGZ_07094                         377   2e-123   Jatropha curcas
ref|XP_002515435.1|  protein with unknown function                      376   3e-123   Ricinus communis
ref|XP_008377658.1|  PREDICTED: transcription initiation factor T...    376   4e-123   
emb|CDP05651.1|  unnamed protein product                                375   7e-123   Coffea canephora [robusta coffee]
ref|XP_011459607.1|  PREDICTED: transcription initiation factor T...    374   1e-122   Fragaria vesca subsp. vesca
ref|XP_004291953.1|  PREDICTED: transcription initiation factor T...    374   1e-122   Fragaria vesca subsp. vesca
ref|XP_010906860.1|  PREDICTED: transcription initiation factor T...    373   5e-122   Elaeis guineensis
ref|XP_010906861.1|  PREDICTED: transcription initiation factor T...    372   6e-122   Elaeis guineensis
ref|XP_004241800.1|  PREDICTED: transcription initiation factor T...    373   7e-122   Solanum lycopersicum
ref|XP_010275775.1|  PREDICTED: transcription initiation factor T...    372   1e-121   Nelumbo nucifera [Indian lotus]
gb|KJB07683.1|  hypothetical protein B456_001G037500                    371   3e-121   Gossypium raimondii
gb|KHG10775.1|  Transcription initiation factor TFIID subunit 5         370   3e-121   Gossypium arboreum [tree cotton]
ref|XP_011031464.1|  PREDICTED: transcription initiation factor T...    371   5e-121   Populus euphratica
ref|XP_008790671.1|  PREDICTED: transcription initiation factor T...    370   6e-121   Phoenix dactylifera
ref|XP_002309672.1|  hypothetical protein POPTR_0006s27930g             370   6e-121   Populus trichocarpa [western balsam poplar]
ref|XP_008790670.1|  PREDICTED: transcription initiation factor T...    370   6e-121   Phoenix dactylifera
ref|XP_008790668.1|  PREDICTED: transcription initiation factor T...    370   6e-121   Phoenix dactylifera
ref|XP_008790669.1|  PREDICTED: transcription initiation factor T...    370   7e-121   Phoenix dactylifera
gb|KHG15465.1|  Transcription initiation factor TFIID subunit 5         369   2e-120   Gossypium arboreum [tree cotton]
ref|XP_006450297.1|  hypothetical protein CICLE_v100076131mg            367   2e-120   
ref|XP_006483465.1|  PREDICTED: transcription initiation factor T...    369   3e-120   Citrus sinensis [apfelsine]
ref|XP_006483464.1|  PREDICTED: transcription initiation factor T...    369   4e-120   
gb|KHN07025.1|  Transcription initiation factor TFIID subunit 5         367   7e-120   Glycine soja [wild soybean]
ref|XP_003526182.1|  PREDICTED: transcription initiation factor T...    367   7e-120   Glycine max [soybeans]
gb|EPS72043.1|  hypothetical protein M569_02713                         364   1e-118   Genlisea aurea
ref|XP_010541564.1|  PREDICTED: transcription initiation factor T...    364   2e-118   Tarenaya hassleriana [spider flower]
ref|XP_006601207.1|  PREDICTED: transcription initiation factor T...    363   2e-118   Glycine max [soybeans]
ref|XP_007136950.1|  hypothetical protein PHAVU_009G087600g             363   2e-118   Phaseolus vulgaris [French bean]
gb|AES73552.2|  TBP-associated factor 5                                 363   3e-118   Medicago truncatula
ref|XP_011082979.1|  PREDICTED: transcription initiation factor T...    363   5e-118   
ref|XP_006857198.1|  hypothetical protein AMTR_s00065p00194240          362   9e-118   
ref|XP_003603301.1|  Transcription initiation factor TFIID subunit      363   1e-117   
ref|XP_004965721.1|  PREDICTED: transcription initiation factor T...    361   2e-117   Setaria italica
dbj|BAJ91235.1|  predicted protein                                      353   4e-117   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010048886.1|  PREDICTED: transcription initiation factor T...    360   5e-117   Eucalyptus grandis [rose gum]
ref|XP_010048885.1|  PREDICTED: transcription initiation factor T...    360   5e-117   Eucalyptus grandis [rose gum]
ref|XP_009111656.1|  PREDICTED: transcription initiation factor T...    360   5e-117   Brassica rapa
ref|XP_010048884.1|  PREDICTED: transcription initiation factor T...    360   6e-117   Eucalyptus grandis [rose gum]
emb|CDY19814.1|  BnaA09g04670D                                          360   6e-117   Brassica napus [oilseed rape]
ref|XP_006656305.1|  PREDICTED: transcription initiation factor T...    359   6e-117   Oryza brachyantha
ref|NP_001059147.2|  Os07g0205200                                       347   7e-117   
ref|XP_003522395.1|  PREDICTED: transcription initiation factor T...    359   1e-116   Glycine max [soybeans]
ref|XP_009363759.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    359   1e-116   
ref|NP_197897.3|  TBP-associated factor 5                               359   2e-116   Arabidopsis thaliana [mouse-ear cress]
gb|EMT24964.1|  hypothetical protein F775_02895                         352   2e-116   
ref|XP_010691970.1|  PREDICTED: transcription initiation factor T...    358   3e-116   Beta vulgaris subsp. vulgaris [field beet]
gb|ACN31367.1|  unknown                                                 345   3e-116   Zea mays [maize]
ref|XP_003549326.1|  PREDICTED: transcription initiation factor T...    357   4e-116   Glycine max [soybeans]
emb|CDX87098.1|  BnaC09g04130D                                          358   4e-116   
ref|XP_007161096.1|  hypothetical protein PHAVU_001G042300g             357   4e-116   Phaseolus vulgaris [French bean]
ref|XP_006394764.1|  hypothetical protein EUTSA_v10003767mg             358   5e-116   Eutrema salsugineum [saltwater cress]
gb|KCW81292.1|  hypothetical protein EUGRSUZ_C02661                     360   6e-116   Eucalyptus grandis [rose gum]
ref|XP_009411258.1|  PREDICTED: transcription initiation factor T...    356   1e-115   Musa acuminata subsp. malaccensis [pisang utan]
gb|KCW81291.1|  hypothetical protein EUGRSUZ_C02661                     359   1e-115   Eucalyptus grandis [rose gum]
ref|XP_009418872.1|  PREDICTED: transcription initiation factor T...    353   2e-115   
ref|XP_002872141.1|  nucleotide binding protein                         356   2e-115   Arabidopsis lyrata subsp. lyrata
dbj|BAC79801.1|  putative TATA box binding protein-associated factor    352   4e-115   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009129987.1|  PREDICTED: transcription initiation factor T...    355   4e-115   Brassica rapa
emb|CDY05473.1|  BnaA02g32180D                                          355   5e-115   
ref|XP_008658972.1|  PREDICTED: uncharacterized protein LOC100501...    352   5e-115   
gb|EMS49310.1|  Transcription initiation factor TFIID subunit 5         353   5e-115   Triticum urartu
ref|XP_010239968.1|  PREDICTED: transcription initiation factor T...    355   6e-115   Brachypodium distachyon [annual false brome]
ref|XP_010454835.1|  PREDICTED: transcription initiation factor T...    354   8e-115   Camelina sativa [gold-of-pleasure]
ref|XP_006286673.1|  hypothetical protein CARUB_v10002639mg             354   8e-115   Capsella rubella
ref|XP_010493762.1|  PREDICTED: transcription initiation factor T...    354   1e-114   Camelina sativa [gold-of-pleasure]
gb|KFK27773.1|  hypothetical protein AALP_AA8G427000                    354   1e-114   Arabis alpina [alpine rockcress]
emb|CDY05378.1|  BnaC02g40860D                                          354   1e-114   
gb|EMS67415.1|  Transcription initiation factor TFIID subunit 5         352   1e-114   Triticum urartu
ref|XP_004501380.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    355   1e-114   
gb|EEC81710.1|  hypothetical protein OsI_25319                          352   2e-114   Oryza sativa Indica Group [Indian rice]
ref|NP_001183382.1|  uncharacterized protein LOC100501797               353   2e-114   Zea mays [maize]
gb|KDO67472.1|  hypothetical protein CISIN_1g005277mg                   350   9e-113   Citrus sinensis [apfelsine]
gb|EEC81088.1|  hypothetical protein OsI_23915                          348   1e-112   Oryza sativa Indica Group [Indian rice]
ref|NP_001058217.1|  Os06g0649500                                       348   1e-112   
ref|XP_006657544.1|  PREDICTED: transcription initiation factor T...    347   5e-112   Oryza brachyantha
gb|KDO67474.1|  hypothetical protein CISIN_1g005277mg                   340   3e-109   Citrus sinensis [apfelsine]
ref|XP_008378948.1|  PREDICTED: transcription initiation factor T...    335   3e-107   
ref|XP_008664126.1|  PREDICTED: transcription initiation factor T...    312   3e-104   
ref|XP_002974112.1|  hypothetical protein SELMODRAFT_100375             325   4e-104   
ref|XP_002968859.1|  hypothetical protein SELMODRAFT_90562              325   4e-104   
gb|EMT08674.1|  Transcription initiation factor TFIID subunit 5         333   5e-104   
ref|XP_007011732.1|  TBP-associated factor 5 isoform 3                  314   1e-100   
ref|XP_010101040.1|  Transcription initiation factor TFIID subunit 5    305   4e-96    
ref|XP_001769775.1|  TFIID and SAGA complex subunit                     303   4e-95    
gb|AFW57937.1|  hypothetical protein ZEAMMB73_474444                    301   7e-93    
gb|KCW81293.1|  hypothetical protein EUGRSUZ_C02661                     297   4e-92    Eucalyptus grandis [rose gum]
gb|KHN29623.1|  Transcription initiation factor TFIID subunit 5         280   5e-86    Glycine soja [wild soybean]
gb|AFW74199.1|  hypothetical protein ZEAMMB73_168723                    258   2e-80    
ref|XP_008650104.1|  PREDICTED: transcription initiation factor T...    258   1e-79    
gb|KJB07685.1|  hypothetical protein B456_001G037500                    256   3e-77    Gossypium raimondii
gb|AFW87526.1|  hypothetical protein ZEAMMB73_966623                    250   3e-76    
gb|AFW87525.1|  hypothetical protein ZEAMMB73_966623                    251   9e-76    
ref|XP_008658971.1|  PREDICTED: uncharacterized protein LOC100501...    249   3e-75    Zea mays [maize]
ref|XP_004348907.1|  TBP-associated factor 5                            238   1e-69    Capsaspora owczarzaki ATCC 30864
ref|XP_637246.1|  transcription initiation factor TFIID subunit         232   7e-67    Dictyostelium discoideum AX4
ref|XP_003057739.1|  transcription factor TFIID with WD40 repeat        230   1e-66    Micromonas pusilla CCMP1545
ref|XP_002500199.1|  TATA binding protein associated factor 5 pro...    228   4e-66    Micromonas commoda
ref|XP_002500198.1|  transcription factor TFIID with WD40 repeat        228   6e-66    Micromonas commoda
ref|XP_003292803.1|  hypothetical protein DICPUDRAFT_157560             229   8e-66    Dictyostelium purpureum
gb|EIE80005.1|  hypothetical protein RO3G_04710                         226   1e-65    Rhizopus delemar RA 99-880
gb|EFA76132.1|  transcription initiation factor TFIID subunit           225   2e-65    Heterostelium album PN500
emb|CAN63613.1|  hypothetical protein VITISV_005881                     209   6e-65    Vitis vinifera
ref|XP_005835344.1|  hypothetical protein GUITHDRAFT_39635              221   2e-64    Guillardia theta CCMP2712
gb|EXX76119.1|  Cop1p                                                   222   5e-64    Rhizophagus irregularis DAOM 197198w
gb|AFW65564.1|  hypothetical protein ZEAMMB73_156387                    214   7e-64    
ref|XP_008938106.1|  PREDICTED: transcription initiation factor T...    209   1e-63    Merops nubicus
ref|XP_004333557.1|  WD domain G-beta repeat-containing protein         221   2e-63    Acanthamoeba castellanii str. Neff
ref|XP_010150367.1|  PREDICTED: transcription initiation factor T...    209   8e-63    Eurypyga helias
ref|XP_007763481.1|  TFIID and SAGA subunit                             219   1e-62    Coniophora puteana RWD-64-598 SS2
emb|CEI87105.1|  hypothetical protein RMCBS344292_01525                 218   1e-62    Rhizopus microsporus
emb|CEG66816.1|  hypothetical protein RMATCC62417_03334                 218   1e-62    Rhizopus microsporus
emb|CEI89162.1|  hypothetical protein RMCBS344292_03530                 217   2e-62    Rhizopus microsporus
gb|KJA29408.1|  hypothetical protein HYPSUDRAFT_196768                  217   6e-62    Hypholoma sublateritium FD-334 SS-4
ref|XP_010196282.1|  PREDICTED: transcription initiation factor T...    211   6e-62    Colius striatus
gb|KFP24818.1|  Transcription initiation factor TFIID subunit 5         211   7e-62    Colius striatus
gb|KIM66256.1|  hypothetical protein SCLCIDRAFT_1211492                 217   9e-62    Scleroderma citrinum Foug A
dbj|GAN03752.1|  conserved hypothetical protein                         215   4e-61    Mucor ambiguus
gb|EPB92347.1|  hypothetical protein HMPREF1544_00916                   214   5e-61    Mucor circinelloides f. circinelloides 1006PhL
gb|KIJ68525.1|  hypothetical protein HYDPIDRAFT_173223                  215   5e-61    Hydnomerulius pinastri MD-312
ref|XP_008879875.1|  hypothetical protein H310_13972                    214   5e-61    Aphanomyces invadans
gb|KFZ57379.1|  Transcription initiation factor TFIID subunit 5         212   5e-61    Podiceps cristatus
gb|KFP37312.1|  Transcription initiation factor TFIID subunit 5         212   6e-61    Chlamydotis macqueenii
gb|EMC84382.1|  Transcription initiation factor TFIID subunit 5         212   6e-61    
gb|KFV01929.1|  Transcription initiation factor TFIID subunit 5         212   6e-61    Pterocles gutturalis
ref|XP_010125523.1|  PREDICTED: transcription initiation factor T...    212   6e-61    Chlamydotis macqueenii
ref|XP_010082733.1|  PREDICTED: transcription initiation factor T...    212   7e-61    Pterocles gutturalis
gb|KFQ67229.1|  Transcription initiation factor TFIID subunit 5         212   8e-61    Phaethon lepturus
gb|KFV76048.1|  Transcription initiation factor TFIID subunit 5         212   8e-61    Struthio camelus australis
gb|KFQ41510.1|  Transcription initiation factor TFIID subunit 5         212   8e-61    Nestor notabilis
gb|KFP15306.1|  Transcription initiation factor TFIID subunit 5         212   8e-61    Egretta garzetta
gb|KFO13790.1|  Transcription initiation factor TFIID subunit 5         212   8e-61    Balearica regulorum gibbericeps
gb|KGL84363.1|  Transcription initiation factor TFIID subunit 5         212   8e-61    Tinamus guttatus
gb|KFU91532.1|  Transcription initiation factor TFIID subunit 5         212   9e-61    Chaetura pelagica
ref|XP_010022326.1|  PREDICTED: transcription initiation factor T...    212   9e-61    Nestor notabilis
ref|XP_006681986.1|  hypothetical protein BATDEDRAFT_36007              213   9e-61    Batrachochytrium dendrobatidis JAM81
ref|XP_005026527.1|  PREDICTED: transcription initiation factor T...    212   9e-61    
ref|XP_010284775.1|  PREDICTED: transcription initiation factor T...    212   9e-61    Phaethon lepturus
ref|XP_010166621.1|  PREDICTED: transcription initiation factor T...    212   9e-61    Antrostomus carolinensis
gb|EOA96407.1|  Transcription initiation factor TFIID subunit 5         212   9e-61    Anas platyrhynchos [duck]
gb|KFQ30319.1|  Transcription initiation factor TFIID subunit 5         212   1e-60    Mesitornis unicolor
ref|XP_009940588.1|  PREDICTED: transcription initiation factor T...    212   1e-60    Opisthocomus hoazin [hoatzin]
ref|XP_010713053.1|  PREDICTED: transcription initiation factor T...    212   1e-60    Meleagris gallopavo [common turkey]
gb|KIJ21816.1|  hypothetical protein PAXINDRAFT_105345                  214   1e-60    Paxillus involutus ATCC 200175
gb|KFW76480.1|  Transcription initiation factor TFIID subunit 5         211   1e-60    Manacus vitellinus
gb|KFW95731.1|  Transcription initiation factor TFIID subunit 5         211   1e-60    Phalacrocorax carbo [common cormorant]
gb|KFH65505.1|  hypothetical protein MVEG_08982                         213   1e-60    Mortierella verticillata NRRL 6337
gb|KFM06584.1|  Transcription initiation factor TFIID subunit 5         211   1e-60    Aptenodytes forsteri
ref|XP_005508619.1|  PREDICTED: transcription initiation factor T...    212   1e-60    
ref|XP_009998472.1|  PREDICTED: transcription initiation factor T...    212   1e-60    Chaetura pelagica
ref|XP_009636390.1|  PREDICTED: transcription initiation factor T...    211   1e-60    Egretta garzetta
ref|XP_009326723.1|  PREDICTED: transcription initiation factor T...    212   1e-60    Pygoscelis adeliae
ref|XP_009879920.1|  PREDICTED: transcription initiation factor T...    212   1e-60    Charadrius vociferus
ref|XP_010177158.1|  PREDICTED: transcription initiation factor T...    212   1e-60    Mesitornis unicolor
gb|KFV74673.1|  Transcription initiation factor TFIID subunit 5         211   1e-60    Picoides pubescens
ref|XP_009554071.1|  PREDICTED: transcription initiation factor T...    212   1e-60    Cuculus canorus
gb|KFO69542.1|  Transcription initiation factor TFIID subunit 5         211   1e-60    Cuculus canorus
ref|XP_008932384.1|  PREDICTED: transcription initiation factor T...    211   1e-60    
ref|XP_009074045.1|  PREDICTED: transcription initiation factor T...    211   1e-60    Acanthisitta chloris
ref|XP_009572404.1|  PREDICTED: transcription initiation factor T...    211   1e-60    Fulmarus glacialis
gb|KFP84791.1|  Transcription initiation factor TFIID subunit 5         211   1e-60    Apaloderma vittatum
gb|KFV90642.1|  Transcription initiation factor TFIID subunit 5         211   1e-60    Fulmarus glacialis
ref|XP_009963838.1|  PREDICTED: transcription initiation factor T...    211   1e-60    Tyto alba [Schleiereule]
ref|XP_009484390.1|  PREDICTED: transcription initiation factor T...    211   1e-60    Pelecanus crispus
ref|XP_008608025.1|  hypothetical protein SDRG_04142                    213   1e-60    Saprolegnia diclina VS20
ref|XP_007423302.1|  PREDICTED: transcription initiation factor T...    213   1e-60    Python bivittatus
ref|XP_010141597.1|  PREDICTED: transcription initiation factor T...    211   2e-60    Buceros rhinoceros silvestris
ref|XP_005417385.1|  PREDICTED: transcription initiation factor T...    211   2e-60    
ref|XP_009985392.1|  PREDICTED: transcription initiation factor T...    211   2e-60    Tauraco erythrolophus
ref|XP_009663933.1|  PREDICTED: transcription initiation factor T...    212   2e-60    Struthio camelus australis
ref|XP_005437324.1|  PREDICTED: transcription initiation factor T...    211   2e-60    
ref|XP_009067209.1|  hypothetical protein LOTGIDRAFT_135304             211   2e-60    Lottia gigantea
ref|XP_009810490.1|  PREDICTED: transcription initiation factor T...    211   2e-60    Gavia stellata
ref|XP_009276349.1|  PREDICTED: transcription initiation factor T...    211   2e-60    
ref|XP_007373809.1|  hypothetical protein SPAPADRAFT_134515             213   2e-60    Spathaspora passalidarum NRRL Y-27907
ref|XP_009694116.1|  PREDICTED: transcription initiation factor T...    211   2e-60    Cariama cristata
ref|XP_010223265.1|  PREDICTED: transcription initiation factor T...    211   2e-60    Tinamus guttatus
ref|XP_009085891.1|  PREDICTED: transcription initiation factor T...    212   2e-60    Serinus canaria [canary]
gb|KFQ16224.1|  Transcription initiation factor TFIID subunit 5         211   2e-60    Leptosomus discolor
gb|KFO98259.1|  Transcription initiation factor TFIID subunit 5         212   2e-60    Calypte anna
gb|KDQ30867.1|  hypothetical protein PLEOSDRAFT_1075107                 213   2e-60    Pleurotus ostreatus PC15
ref|XP_008488661.1|  PREDICTED: transcription initiation factor T...    212   2e-60    Calypte anna
ref|XP_009906511.1|  PREDICTED: transcription initiation factor T...    211   2e-60    Picoides pubescens
ref|XP_005048731.1|  PREDICTED: transcription initiation factor T...    212   3e-60    
ref|XP_009826029.1|  hypothetical protein H257_03576                    212   3e-60    Aphanomyces astaci
emb|CEP13051.1|  hypothetical protein                                   212   3e-60    Parasitella parasitica
ref|XP_008407821.1|  PREDICTED: transcription initiation factor T...    212   3e-60    Poecilia reticulata
ref|XP_009917937.1|  PREDICTED: transcription initiation factor T...    211   3e-60    Haliaeetus albicilla
ref|NP_001026406.1|  transcription initiation factor TFIID subunit 5    212   4e-60    Gallus gallus [bantam]
ref|XP_010411242.1|  PREDICTED: transcription initiation factor T...    211   4e-60    
ref|XP_008407811.1|  PREDICTED: transcription initiation factor T...    212   4e-60    Poecilia reticulata
ref|XP_009474358.1|  PREDICTED: transcription initiation factor T...    211   4e-60    Nipponia nippon
gb|KFP62880.1|  Transcription initiation factor TFIID subunit 5         211   4e-60    Cariama cristata
ref|XP_007860943.1|  WD40 repeat-like protein                           212   4e-60    Gloeophyllum trabeum ATCC 11539
ref|XP_005239096.1|  PREDICTED: transcription initiation factor T...    211   4e-60    
ref|XP_005481188.1|  PREDICTED: transcription initiation factor T...    212   5e-60    Zonotrichia albicollis
ref|XP_002197117.1|  PREDICTED: transcription initiation factor T...    212   5e-60    
ref|XP_008047779.1|  PREDICTED: transcription initiation factor T...    207   5e-60    Carlito syrichta
ref|XP_005971225.1|  PREDICTED: transcription initiation factor T...    206   6e-60    Pantholops hodgsonii [Tibetan antelope]
ref|XP_005520763.1|  PREDICTED: transcription initiation factor T...    212   6e-60    Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_007543235.1|  PREDICTED: transcription initiation factor T...    211   6e-60    Poecilia formosa
ref|XP_005154604.1|  PREDICTED: transcription initiation factor T...    212   6e-60    Melopsittacus undulatus
ref|XP_001525241.1|  conserved hypothetical protein                     212   6e-60    Lodderomyces elongisporus NRRL YB-4239
ref|XP_009499020.1|  PREDICTED: transcription initiation factor T...    211   6e-60    Phalacrocorax carbo [common cormorant]
ref|XP_004539013.1|  PREDICTED: transcription initiation factor T...    211   6e-60    Maylandia zebra
ref|XP_010563095.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    212   6e-60    Haliaeetus leucocephalus
gb|KIO08342.1|  hypothetical protein M404DRAFT_134605                   211   6e-60    Pisolithus tinctorius Marx 270
ref|XP_006273730.1|  PREDICTED: transcription initiation factor T...    209   7e-60    
ref|XP_009863455.1|  PREDICTED: transcription initiation factor T...    210   7e-60    Apaloderma vittatum
dbj|BAE02158.1|  unnamed protein product                                207   7e-60    Macaca fascicularis [crab eating macaque]
ref|XP_003755480.1|  PREDICTED: transcription initiation factor T...    210   7e-60    
ref|XP_005458591.1|  PREDICTED: transcription initiation factor T...    211   1e-59    
ref|XP_001511993.2|  PREDICTED: transcription initiation factor T...    209   1e-59    
ref|XP_009957672.1|  PREDICTED: transcription initiation factor T...    210   1e-59    Leptosomus discolor
ref|XP_006824247.1|  PREDICTED: TAF5-like RNA polymerase II p300/...    208   1e-59    Saccoglossus kowalevskii
ref|XP_008104783.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    211   1e-59    
ref|XP_004701006.1|  PREDICTED: transcription initiation factor T...    208   2e-59    Echinops telfairi [lesser hedgehog tenrec]
emb|CCA25505.1|  transcription initiation factor TFIID subunit pu...    211   2e-59    Albugo laibachii Nc14
ref|XP_008177989.1|  PREDICTED: transcription initiation factor T...    211   2e-59    Chrysemys picta bellii
gb|KIK47871.1|  hypothetical protein CY34DRAFT_171675                   206   2e-59    Suillus luteus UH-Slu-Lm8-n1
gb|EPQ15170.1|  Transcription initiation factor TFIID subunit 5         208   2e-59    Myotis brandtii
gb|KDO27296.1|  hypothetical protein SPRG_07546                         210   2e-59    Saprolegnia parasitica CBS 223.65
ref|XP_007057933.1|  PREDICTED: transcription initiation factor T...    209   2e-59    
ref|XP_007650816.1|  PREDICTED: transcription initiation factor T...    207   2e-59    Cricetulus griseus [Chinese hamsters]
ref|XP_008684798.1|  PREDICTED: transcription initiation factor T...    208   2e-59    Ursus maritimus [white bear]
ref|XP_002672490.1|  transcription initiation factor TFIID subunit      209   2e-59    Naegleria gruberi strain NEG-M
gb|KIK28401.1|  hypothetical protein PISMIDRAFT_7425                    210   2e-59    Pisolithus microcarpus 441
gb|EPZ34266.1|  TFIID subunit, WD40-associated region domain-cont...    208   3e-59    Rozella allomycis CSF55
ref|XP_006120928.1|  PREDICTED: transcription initiation factor T...    208   3e-59    
ref|XP_006021378.1|  PREDICTED: transcription initiation factor T...    210   3e-59    
ref|XP_005878281.1|  PREDICTED: transcription initiation factor T...    208   3e-59    
ref|XP_006790718.1|  PREDICTED: transcription initiation factor T...    209   3e-59    Neolamprologus brichardi [lyretail cichlid]
ref|XP_006790717.1|  PREDICTED: transcription initiation factor T...    209   3e-59    Neolamprologus brichardi [lyretail cichlid]
ref|XP_001378650.2|  PREDICTED: transcription initiation factor T...    210   3e-59    Monodelphis domestica
ref|XP_005735825.1|  PREDICTED: transcription initiation factor T...    209   3e-59    Pundamilia nyererei
ref|XP_005735826.1|  PREDICTED: transcription initiation factor T...    209   3e-59    Pundamilia nyererei
gb|EMG48744.1|  Transcription initiation factor TFIID subunit 5         210   3e-59    Candida maltosa Xu316
ref|XP_010969581.1|  PREDICTED: transcription initiation factor T...    208   3e-59    Camelus bactrianus [camel]
ref|XP_007130638.1|  PREDICTED: transcription initiation factor T...    208   3e-59    
gb|KFO32333.1|  Transcription initiation factor TFIID subunit 5         207   3e-59    Fukomys damarensis [Damara mole rat]
ref|XP_004616448.1|  PREDICTED: transcription initiation factor T...    208   3e-59    
ref|XP_006821419.1|  PREDICTED: transcription initiation factor T...    208   3e-59    Saccoglossus kowalevskii
ref|XP_002592899.1|  hypothetical protein BRAFLDRAFT_65485              204   4e-59    Branchiostoma floridae
ref|XP_005698510.1|  PREDICTED: transcription initiation factor T...    208   4e-59    
gb|ELK35598.1|  Transcription initiation factor TFIID subunit 5         208   4e-59    Myotis davidii
ref|XP_007080356.1|  PREDICTED: transcription initiation factor T...    208   4e-59    Panthera tigris altaica
ref|XP_717491.1|  likely TFIID and SAGA complex component Taf5p         209   4e-59    
ref|XP_010985444.1|  PREDICTED: transcription initiation factor T...    208   4e-59    Camelus dromedarius [camel]
gb|AGO12117.1|  AaceriAEL246Cp                                          209   4e-59    Saccharomycetaceae sp. 'Ashbya aceri'
gb|KHC66398.1|  transcription initiation factor TFIID subunit 5         209   5e-59    Candida albicans P78042
gb|KHC28270.1|  transcription initiation factor TFIID subunit 5         209   5e-59    Candida albicans P76067
gb|EHH64992.1|  hypothetical protein EGM_18329                          208   5e-59    Macaca fascicularis [crab eating macaque]
ref|XP_006756719.1|  PREDICTED: transcription initiation factor T...    209   5e-59    Myotis davidii
ref|XP_005888176.1|  PREDICTED: transcription initiation factor T...    209   5e-59    Bos mutus
ref|XP_009859272.1|  PREDICTED: transcription initiation factor T...    209   5e-59    Ciona intestinalis [sea vase]
gb|ELR61961.1|  Transcription initiation factor TFIID subunit 5         208   5e-59    Bos mutus
gb|KGU02554.1|  transcription initiation factor TFIID subunit 5         209   5e-59    Candida albicans 19F
sp|Q8C092.1|TAF5_MOUSE  RecName: Full=Transcription initiation fa...    209   5e-59    Mus musculus [mouse]
ref|XP_006183078.1|  PREDICTED: transcription initiation factor T...    208   5e-59    Camelus ferus
ref|NP_001178407.1|  transcription initiation factor TFIID subunit 5    209   6e-59    Bos taurus [bovine]
ref|XP_005815637.1|  PREDICTED: transcription initiation factor T...    209   6e-59    
ref|XP_004358584.1|  transcription initiation factor TFIID subunit      209   6e-59    Cavenderia fasciculata
ref|XP_004020206.1|  PREDICTED: transcription initiation factor T...    209   6e-59    
emb|CCI43779.1|  unnamed protein product                                209   6e-59    
ref|XP_004909417.1|  PREDICTED: transcription initiation factor T...    208   6e-59    
ref|XP_010857720.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    209   6e-59    
emb|CCI43781.1|  unnamed protein product                                209   6e-59    
emb|CCI43782.1|  unnamed protein product                                209   6e-59    
ref|XP_008540799.1|  PREDICTED: transcription initiation factor T...    208   6e-59    
ref|XP_007470491.1|  PREDICTED: transcription initiation factor T...    209   6e-59    
ref|XP_005980835.1|  PREDICTED: transcription initiation factor T...    208   6e-59    
ref|XP_007187278.1|  PREDICTED: transcription initiation factor T...    209   6e-59    
ref|XP_008679679.1|  PREDICTED: transcription initiation factor T...    192   6e-59    
ref|XP_004265939.1|  PREDICTED: transcription initiation factor T...    209   6e-59    
ref|XP_008576352.1|  PREDICTED: transcription initiation factor T...    208   6e-59    
ref|XP_008281076.1|  PREDICTED: transcription initiation factor T...    208   7e-59    
gb|ELT88262.1|  hypothetical protein CAPTEDRAFT_225253                  207   7e-59    
ref|XP_008281075.1|  PREDICTED: transcription initiation factor T...    208   7e-59    
ref|XP_004322803.1|  PREDICTED: transcription initiation factor T...    209   7e-59    
ref|XP_005333662.1|  PREDICTED: transcription initiation factor T...    209   7e-59    
ref|XP_004794990.1|  PREDICTED: transcription initiation factor T...    209   7e-59    
ref|XP_004749396.1|  PREDICTED: transcription initiation factor T...    209   7e-59    
ref|XP_004402055.1|  PREDICTED: transcription initiation factor T...    209   7e-59    
ref|XP_003994427.1|  PREDICTED: transcription initiation factor T...    209   7e-59    
ref|XP_006166500.1|  PREDICTED: transcription initiation factor T...    208   7e-59    
ref|XP_011362106.1|  PREDICTED: transcription initiation factor T...    209   7e-59    
ref|XP_006831371.1|  PREDICTED: transcription initiation factor T...    209   7e-59    
ref|XP_003433663.1|  PREDICTED: transcription initiation factor T...    209   7e-59    
ref|XP_005403980.1|  PREDICTED: transcription initiation factor T...    207   7e-59    
ref|XP_002913943.1|  PREDICTED: transcription initiation factor T...    209   7e-59    
ref|XP_007962201.1|  PREDICTED: transcription initiation factor T...    209   8e-59    
ref|XP_006216415.1|  PREDICTED: transcription initiation factor T...    209   8e-59    
ref|XP_003475277.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    208   8e-59    
ref|XP_001113759.1|  PREDICTED: transcription initiation factor T...    209   8e-59    
ref|NP_984615.1|  AEL246Cp                                              209   8e-59    
ref|XP_010624819.1|  PREDICTED: transcription initiation factor T...    207   8e-59    
emb|CCI43780.1|  unnamed protein product                                209   8e-59    
ref|XP_010354502.1|  PREDICTED: transcription initiation factor T...    209   8e-59    
ref|XP_008268663.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    209   8e-59    
gb|KHC78385.1|  transcription initiation factor TFIID subunit 5         209   8e-59    
gb|KGR03414.1|  transcription initiation factor TFIID subunit 5         209   8e-59    
ref|XP_006096001.1|  PREDICTED: transcription initiation factor T...    208   8e-59    
ref|XP_007530621.1|  PREDICTED: transcription initiation factor T...    209   8e-59    
ref|XP_006596051.1|  PREDICTED: transcription initiation factor T...    193   8e-59    
ref|XP_006920954.1|  PREDICTED: transcription initiation factor T...    209   8e-59    
gb|EHH19344.1|  hypothetical protein EGK_20030                          209   8e-59    
gb|AEY96738.1|  FAEL246Cp                                               209   8e-59    
gb|ERE80909.1|  transcription initiation factor TFIID subunit 5-l...    207   8e-59    
ref|XP_006880026.1|  PREDICTED: transcription initiation factor T...    209   8e-59    
ref|XP_004474043.1|  PREDICTED: transcription initiation factor T...    209   9e-59    
ref|NP_796316.2|  transcription initiation factor TFIID subunit 5       209   9e-59    
dbj|BAC40670.1|  unnamed protein product                                208   9e-59    
ref|XP_003922284.1|  PREDICTED: transcription initiation factor T...    208   9e-59    
ref|XP_004659440.1|  PREDICTED: transcription initiation factor T...    208   9e-59    
ref|XP_004428087.1|  PREDICTED: transcription initiation factor T...    208   9e-59    
gb|AAC50902.1|  TBP-associated factor                                   208   9e-59    
ref|XP_002756617.1|  PREDICTED: transcription initiation factor T...    208   9e-59    
ref|XP_004370158.1|  PREDICTED: transcription initiation factor T...    208   9e-59    
ref|XP_001135279.1|  PREDICTED: transcription initiation factor T...    208   9e-59    
ref|XP_007938069.1|  PREDICTED: transcription initiation factor T...    208   9e-59    
gb|AAC51215.1|  TFIID subunit TAFII100                                  208   9e-59    
dbj|BAD97335.1|  Transcription initiation factor TFIID subunit 5 ...    208   9e-59    
ref|NP_008882.2|  transcription initiation factor TFIID subunit 5       208   9e-59    
ref|XP_005063548.1|  PREDICTED: transcription initiation factor T...    208   1e-58    
ref|XP_003825586.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    208   1e-58    
ref|XP_004631556.1|  PREDICTED: transcription initiation factor T...    208   1e-58    
ref|XP_004579943.1|  PREDICTED: transcription initiation factor T...    208   1e-58    
ref|XP_005352490.1|  PREDICTED: transcription initiation factor T...    208   1e-58    
ref|NP_001099835.1|  transcription initiation factor TFIID subunit 5    208   1e-58    
ref|XP_004680526.1|  PREDICTED: transcription initiation factor T...    208   1e-58    
ref|XP_002821162.1|  PREDICTED: transcription initiation factor T...    208   1e-58    
gb|EMD42134.1|  hypothetical protein CERSUDRAFT_147709                  208   1e-58    
ref|XP_004866533.1|  PREDICTED: transcription initiation factor T...    208   1e-58    
gb|KGQ81776.1|  transcription initiation factor TFIID subunit 5         208   1e-58    
ref|XP_003255469.1|  PREDICTED: transcription initiation factor T...    208   1e-58    
ref|XP_003787249.1|  PREDICTED: transcription initiation factor T...    208   1e-58    
gb|EDL42024.1|  TAF5 RNA polymerase II, TATA box binding protein ...    208   1e-58    
ref|XP_011187517.1|  PREDICTED: transcription initiation factor T...    207   1e-58    
ref|XP_010587317.1|  PREDICTED: transcription initiation factor T...    208   1e-58    
ref|XP_001916305.2|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    208   1e-58    
ref|XP_001929370.2|  PREDICTED: transcription initiation factor T...    207   1e-58    
ref|XP_006983384.1|  PREDICTED: transcription initiation factor T...    208   1e-58    
ref|XP_009540412.1|  hypothetical protein HETIRDRAFT_59490              208   1e-58    
ref|XP_011202863.1|  PREDICTED: transcription initiation factor T...    207   1e-58    
gb|KGR01919.1|  transcription initiation factor TFIID subunit 5         207   2e-58    
gb|KHC71390.1|  transcription initiation factor TFIID subunit 5         207   2e-58    
ref|XP_006566682.1|  PREDICTED: transcription initiation factor T...    206   2e-58    
gb|KIY50538.1|  TFIID and SAGA subunit                                  207   2e-58    
gb|KHC29812.1|  transcription initiation factor TFIID subunit 5         207   2e-58    
gb|KGU19081.1|  transcription initiation factor TFIID subunit 5         207   2e-58    
gb|KIM48273.1|  hypothetical protein M413DRAFT_439995                   207   2e-58    
ref|XP_008843901.1|  PREDICTED: transcription initiation factor T...    207   3e-58    
ref|XP_008642186.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    206   3e-58    
ref|XP_007390546.1|  hypothetical protein PHACADRAFT_180260             207   3e-58    
ref|XP_006005678.1|  PREDICTED: transcription initiation factor T...    206   3e-58    
gb|KIK05488.1|  hypothetical protein K443DRAFT_342798                   207   3e-58    
ref|NP_001116833.1|  transcription initiation factor TFIID subunit 5    207   3e-58    
ref|NP_001032508.1|  transcription initiation factor TFIID subunit 5    206   4e-58    
gb|AAH67651.1|  Taf5 protein                                            206   4e-58    
ref|XP_008142484.1|  PREDICTED: transcription initiation factor T...    207   4e-58    
ref|XP_003038534.1|  hypothetical protein SCHCODRAFT_48129              206   4e-58    
ref|XP_007910610.1|  PREDICTED: transcription initiation factor T...    206   4e-58    
ref|XP_004534987.1|  PREDICTED: transcription initiation factor T...    206   4e-58    
ref|XP_002110861.1|  hypothetical protein TRIADDRAFT_37330              203   6e-58    
gb|KDQ63458.1|  hypothetical protein JAAARDRAFT_202902                  206   6e-58    
gb|KIL70913.1|  hypothetical protein M378DRAFT_155857                   206   6e-58    
emb|CDH56267.1|  transcription initiation factor tfiid subunit 5        206   6e-58    
gb|KDR84911.1|  hypothetical protein GALMADRAFT_217991                  206   6e-58    
gb|KIY64206.1|  TFIID and SAGA subunit                                  206   6e-58    
emb|CEP09597.1|  hypothetical protein                                   205   6e-58    
ref|XP_005536366.1|  TATA-box binding protein-associated factor 5       205   7e-58    
dbj|GAM18992.1|  hypothetical protein SAMD00019534_021670               204   8e-58    
ref|XP_011477836.1|  PREDICTED: transcription initiation factor T...    205   9e-58    
gb|KIM75420.1|  hypothetical protein PILCRDRAFT_827344                  206   9e-58    
gb|KIJ45050.1|  hypothetical protein M422DRAFT_29906                    205   9e-58    
gb|ETL97538.1|  hypothetical protein, variant                           205   9e-58    
ref|XP_002545629.1|  transcription initiation factor TFIID subunit 5    206   1e-57    
ref|XP_011477828.1|  PREDICTED: transcription initiation factor T...    205   1e-57    
ref|XP_008545973.1|  PREDICTED: transcription initiation factor T...    204   1e-57    
gb|ETI51073.1|  hypothetical protein, variant                           205   1e-57    
gb|ETP48782.1|  hypothetical protein, variant                           205   1e-57    
ref|XP_008902944.1|  hypothetical protein, variant                      205   1e-57    
emb|CEI89011.1|  hypothetical protein RMCBS344292_03386                 201   1e-57    
ref|XP_011500143.1|  PREDICTED: transcription initiation factor T...    204   1e-57    
gb|KGU21301.1|  transcription initiation factor TFIID subunit 5         205   1e-57    
gb|AAH52268.2|  TAF5 RNA polymerase II, TATA box binding protein ...    205   1e-57    
dbj|GAN02745.1|  conserved hypothetical protein                         204   1e-57    
ref|NP_001135586.1|  transcription initiation factor TFIID subunit 5    205   1e-57    
emb|CDQ77760.1|  unnamed protein product                                205   1e-57    
gb|KIK87440.1|  hypothetical protein PAXRUDRAFT_152390                  205   2e-57    
ref|XP_010871213.1|  PREDICTED: transcription initiation factor T...    205   2e-57    
emb|CEI89007.1|  hypothetical protein RMCBS344292_03382                 203   2e-57    
ref|XP_007842751.1|  tfiid and saga subunit                             205   2e-57    
ref|XP_011305467.1|  PREDICTED: transcription initiation factor T...    203   2e-57    
gb|ETL97537.1|  hypothetical protein L917_05197                         205   2e-57    
ref|XP_002492679.1|  Subunit (90 kDa) of TFIID and SAGA complexes       204   2e-57    
ref|XP_003972608.1|  PREDICTED: transcription initiation factor T...    204   2e-57    
ref|XP_008902943.1|  hypothetical protein PPTG_09675                    205   2e-57    
gb|ETI51072.1|  hypothetical protein F443_05503                         205   2e-57    
gb|ETP48781.1|  hypothetical protein F442_05548                         205   2e-57    
gb|EPT03874.1|  hypothetical protein FOMPIDRAFT_1157768                 204   3e-57    
ref|XP_006630816.1|  PREDICTED: transcription initiation factor T...    204   3e-57    
ref|XP_009523167.1|  hypothetical protein PHYSODRAFT_354295             203   3e-57    
emb|CDQ85271.1|  unnamed protein product                                204   3e-57    
ref|XP_003647711.1|  hypothetical protein Ecym_7038                     204   3e-57    
ref|XP_002422005.1|  transcription initiation factor TFIID subuni...    204   4e-57    
gb|KIK70910.1|  hypothetical protein GYMLUDRAFT_32992                   204   4e-57    
gb|EPB90187.1|  hypothetical protein HMPREF1544_03021                   203   4e-57    
ref|XP_001625160.1|  predicted protein                                  201   5e-57    
emb|CEG84234.1|  hypothetical protein RMATCC62417_18068                 199   5e-57    
ref|XP_002413739.1|  guanine nucleotide-binding protein, putative       203   5e-57    
gb|KIP11385.1|  hypothetical protein PHLGIDRAFT_99542                   204   5e-57    
gb|AJP88278.1|  Taf5p                                                   203   6e-57    
ref|XP_006454675.1|  hypothetical protein AGABI2DRAFT_189919            203   7e-57    
gb|EUC67220.1|  TFIID and SAGA subunit                                  203   7e-57    
gb|EIE80415.1|  hypothetical protein RO3G_05120                         199   7e-57    
ref|XP_007259122.1|  PREDICTED: transcription initiation factor T...    202   7e-57    
emb|CDS06666.1|  hypothetical protein LRAMOSA09193                      202   7e-57    
ref|XP_010732503.1|  PREDICTED: transcription initiation factor T...    203   7e-57    
ref|XP_006684192.1|  WD40 repeat-like protein                           196   7e-57    
ref|XP_005187303.1|  PREDICTED: transcription initiation factor T...    202   8e-57    
emb|CDK27805.1|  unnamed protein product                                202   9e-57    
ref|XP_007379065.1|  TFIID and SAGA subunit                             202   1e-56    
ref|XP_008315589.1|  PREDICTED: transcription initiation factor T...    202   1e-56    
emb|CBK39274.1|  Taf5p                                                  202   1e-56    
gb|AJP83338.1|  Taf5p                                                   202   1e-56    
gb|AJP84872.1|  Taf5p                                                   202   1e-56    
gb|AJP37273.1|  Taf5p                                                   202   1e-56    
gb|AJP86389.1|  Taf5p                                                   202   1e-56    
gb|AJP84487.1|  Taf5p                                                   202   1e-56    
ref|NP_009757.1|  Taf5p                                                 202   1e-56    
gb|EFX87221.1|  hypothetical protein DAPPUDRAFT_307153                  201   1e-56    
ref|XP_007325449.1|  hypothetical protein AGABI1DRAFT_110185            202   1e-56    
gb|KII93918.1|  hypothetical protein PLICRDRAFT_36137                   202   1e-56    
ref|XP_008315590.1|  PREDICTED: transcription initiation factor T...    201   1e-56    
ref|XP_002897804.1|  transcription initiation factor TFIID subuni...    202   2e-56    
gb|AJQ12042.1|  Taf5p                                                   202   2e-56    
gb|EDN64808.1|  TafII90                                                 202   2e-56    
gb|AJP85254.1|  Taf5p                                                   202   2e-56    
emb|CAA64777.1|  hTAFII100                                              202   2e-56    
ref|XP_780473.2|  PREDICTED: transcription initiation factor TFII...    201   2e-56    
gb|AJQ12808.1|  Taf5p                                                   202   2e-56    
gb|EIW12132.1|  Taf5p                                                   202   2e-56    
gb|AJQ13196.1|  Taf5p                                                   202   2e-56    
emb|CEG69913.1|  hypothetical protein RMATCC62417_05904                 200   2e-56    
gb|KIM29122.1|  hypothetical protein M408DRAFT_329125                   202   2e-56    
gb|KFR00877.1|  Transcription initiation factor TFIID subunit 5         200   2e-56    
gb|EHJ65153.1|  wd-repeat protein                                       201   2e-56    
emb|CEG84233.1|  hypothetical protein RMATCC62417_18068                 200   2e-56    
ref|XP_005104946.1|  PREDICTED: transcription initiation factor T...    201   2e-56    
gb|KDE06754.1|  hypothetical protein MVLG_02950                         202   3e-56    
ref|NP_001164203.1|  cannonball                                         200   3e-56    
gb|AJP86771.1|  Taf5p                                                   201   3e-56    
ref|XP_011057802.1|  PREDICTED: transcription initiation factor T...    200   3e-56    
ref|XP_011102574.1|  taf5p                                              201   3e-56    
ref|XP_003869516.1|  Taf5 protein                                       201   3e-56    
ref|XP_001386490.2|  TFIID and SAGA subunit                             201   3e-56    
gb|KDR10646.1|  Transcription initiation factor TFIID subunit 5         200   3e-56    
gb|EGA63318.1|  Taf5p                                                   201   4e-56    
gb|EJT44371.1|  TAF5-like protein                                       201   4e-56    
ref|XP_010772026.1|  PREDICTED: transcription initiation factor T...    201   4e-56    
ref|XP_003724354.1|  PREDICTED: TAF5-like RNA polymerase II p300/...    197   4e-56    
gb|EJU01186.1|  WD40 repeat-like protein                                200   4e-56    
ref|XP_008032976.1|  TFIID and SAGA subunit                             201   5e-56    
ref|XP_003737306.1|  PREDICTED: transcription initiation factor T...    201   5e-56    
ref|XP_006684191.1|  hypothetical protein CANTEDRAFT_101515             201   6e-56    
ref|XP_004933726.1|  PREDICTED: transcription initiation factor T...    199   6e-56    
ref|XP_007265606.1|  TFIID and SAGA subunit                             200   6e-56    
gb|ETO79828.1|  hypothetical protein, variant                           200   7e-56    
ref|XP_001420161.1|  predicted protein                                  198   9e-56    
ref|XP_004199851.1|  Piso0_002398                                       200   1e-55    
gb|AJQ16624.1|  Taf5p                                                   200   1e-55    
gb|EDK36870.2|  hypothetical protein PGUG_00968                         199   1e-55    
emb|CDO71656.1|  hypothetical protein BN946_scf184911.g127              200   1e-55    
gb|ETO79827.1|  hypothetical protein F444_05545                         200   1e-55    
ref|XP_011169995.1|  PREDICTED: transcription initiation factor T...    197   1e-55    
ref|XP_004198999.1|  Piso0_002398                                       199   1e-55    
ref|XP_002173749.1|  SAGA complex subunit/TATA-binding protein as...    198   2e-55    
ref|XP_011273427.1|  Transcription initiation factor TFIID subunit 5    199   2e-55    
ref|XP_005646951.1|  putative TAF5                                      197   2e-55    
ref|XP_011252820.1|  PREDICTED: transcription initiation factor T...    198   2e-55    
gb|ETN66998.1|  wd-repeat protein                                       197   3e-55    
gb|AJP91675.1|  Taf5p                                                   199   3e-55    
ref|XP_320836.4|  AGAP011678-PA                                         197   3e-55    



>ref|XP_008452860.1| PREDICTED: transcription initiation factor TFIID subunit 5 [Cucumis 
melo]
Length=674

 Score =   384 bits (985),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 176/196 (90%), Positives = 190/196 (97%), Gaps = 0/196 (0%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFAS SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS
Sbjct  476  YFASCSHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  535

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVRIFIGHRSMILSLAMSPDGR+MASGDEDG IM+WDL++GRC+TPL+GH SCVWTLA
Sbjct  536  GECVRIFIGHRSMILSLAMSPDGRFMASGDEDGTIMMWDLSTGRCVTPLIGHTSCVWTLA  595

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            FSCEGSLLASGSADCTVKLWDVT+STK P+++ENK+G+ NRLRSLKTLPTKSTP+Y+LRF
Sbjct  596  FSCEGSLLASGSADCTVKLWDVTSSTKPPRTDENKTGTANRLRSLKTLPTKSTPVYSLRF  655

Query  135  SRRNLLFAAGAFSKSA  88
            SRRNLLFAAGA SKSA
Sbjct  656  SRRNLLFAAGALSKSA  671


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 61/125 (49%), Gaps = 0/125 (0%)
 Frame = -3

Query  618  QPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAM  439
            +P  +  GH   V    +    +++ + S+D T+RLW  +    +  + GH   +  +  
Sbjct  411  RPYTLFQGHSGPVHSATFSPIGDFVLSSSADTTIRLWSTKLNANLVCYKGHNYPVWDVQF  470

Query  438  SPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKL  259
            SP G Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D TV+L
Sbjct  471  SPVGHYFASCSHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRL  530

Query  258  WDVTT  244
            WDV +
Sbjct  531  WDVQS  535



>ref|XP_009795607.1| PREDICTED: transcription initiation factor TFIID subunit 5 isoform 
X2 [Nicotiana sylvestris]
Length=427

 Score =   375 bits (964),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 178/196 (91%), Positives = 185/196 (94%), Gaps = 0/196 (0%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFAS SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS
Sbjct  232  YFASCSHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  291

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIFIGHRSMILSLAMSPDGRYMASGDEDG +M+WDL+SGRCITPLVGH+SCVW+LA
Sbjct  292  GNCVRIFIGHRSMILSLAMSPDGRYMASGDEDGTVMMWDLSSGRCITPLVGHSSCVWSLA  351

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            FS EGSLLASGSADCTVKLWDVTTSTK P  EENK G  NRLRSLKTLPTK+TP+YALRF
Sbjct  352  FSGEGSLLASGSADCTVKLWDVTTSTKAPLKEENKPGINNRLRSLKTLPTKATPVYALRF  411

Query  135  SRRNLLFAAGAFSKSA  88
            SRRNLLFAAGAFSK A
Sbjct  412  SRRNLLFAAGAFSKGA  427


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = -3

Query  606  IMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDG  427
            +  GH   V    +    +++ + SSD T+RLW  +    +  + GH   +  +  SP G
Sbjct  171  LFQGHSGPVYSASFSPYGDFLLSSSSDSTIRLWSTRLNANLVCYKGHNYPVWDVQFSPVG  230

Query  426  RYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVT  247
             Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D TV+LWDV 
Sbjct  231  HYFASCSHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQ  290

Query  246  T  244
            +
Sbjct  291  S  291



>ref|XP_009795606.1| PREDICTED: transcription initiation factor TFIID subunit 5 isoform 
X1 [Nicotiana sylvestris]
Length=428

 Score =   375 bits (963),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 178/196 (91%), Positives = 185/196 (94%), Gaps = 0/196 (0%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFAS SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS
Sbjct  233  YFASCSHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  292

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIFIGHRSMILSLAMSPDGRYMASGDEDG +M+WDL+SGRCITPLVGH+SCVW+LA
Sbjct  293  GNCVRIFIGHRSMILSLAMSPDGRYMASGDEDGTVMMWDLSSGRCITPLVGHSSCVWSLA  352

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            FS EGSLLASGSADCTVKLWDVTTSTK P  EENK G  NRLRSLKTLPTK+TP+YALRF
Sbjct  353  FSGEGSLLASGSADCTVKLWDVTTSTKAPLKEENKPGINNRLRSLKTLPTKATPVYALRF  412

Query  135  SRRNLLFAAGAFSKSA  88
            SRRNLLFAAGAFSK A
Sbjct  413  SRRNLLFAAGAFSKGA  428


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = -3

Query  606  IMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDG  427
            +  GH   V    +    +++ + SSD T+RLW  +    +  + GH   +  +  SP G
Sbjct  172  LFQGHSGPVYSASFSPYGDFLLSSSSDSTIRLWSTRLNANLVCYKGHNYPVWDVQFSPVG  231

Query  426  RYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVT  247
             Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D TV+LWDV 
Sbjct  232  HYFASCSHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQ  291

Query  246  T  244
            +
Sbjct  292  S  292



>ref|XP_004145505.1| PREDICTED: transcription initiation factor TFIID subunit 5-like 
[Cucumis sativus]
 ref|XP_004157092.1| PREDICTED: transcription initiation factor TFIID subunit 5-like 
[Cucumis sativus]
 gb|KGN55438.1| hypothetical protein Csa_4G652030 [Cucumis sativus]
Length=674

 Score =   383 bits (983),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 175/196 (89%), Positives = 190/196 (97%), Gaps = 0/196 (0%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFAS SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS
Sbjct  476  YFASCSHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  535

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVRIFIGHRSMILSLAMSPDGR+MASGDEDG IM+WDL++GRC+TPL+GH SCVWTLA
Sbjct  536  GECVRIFIGHRSMILSLAMSPDGRFMASGDEDGTIMMWDLSTGRCVTPLIGHTSCVWTLA  595

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            FSCEGSLLASGSADCTVKLWDVT+STK P+++ENK+G+ NRLRSLKTLPTKSTP+Y+LRF
Sbjct  596  FSCEGSLLASGSADCTVKLWDVTSSTKPPRTDENKTGTPNRLRSLKTLPTKSTPVYSLRF  655

Query  135  SRRNLLFAAGAFSKSA  88
            SRRNLLFAAGA SK+A
Sbjct  656  SRRNLLFAAGALSKNA  671


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 61/125 (49%), Gaps = 0/125 (0%)
 Frame = -3

Query  618  QPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAM  439
            +P  +  GH   V    +    +++ + S+D T+RLW  +    +  + GH   +  +  
Sbjct  411  RPYTLFQGHSGPVHSATFSPIGDFVLSSSADTTIRLWSTKLNANLVCYKGHNYPVWDVQF  470

Query  438  SPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKL  259
            SP G Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D TV+L
Sbjct  471  SPVGHYFASCSHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRL  530

Query  258  WDVTT  244
            WDV +
Sbjct  531  WDVQS  535



>ref|XP_007011731.1| TBP-associated factor 5 isoform 2 [Theobroma cacao]
 gb|EOY29350.1| TBP-associated factor 5 isoform 2 [Theobroma cacao]
Length=571

 Score =   379 bits (973),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 177/195 (91%), Positives = 190/195 (97%), Gaps = 1/195 (1%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFASASHDRTARIWSMD+IQP+RIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS
Sbjct  377  YFASASHDRTARIWSMDKIQPMRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  436

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVRIFIGHRSMILSLAMSPDGRYMASGDEDG IM+WDL+SGRC+TPL+GH+SCVWTLA
Sbjct  437  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGTIMMWDLSSGRCVTPLMGHSSCVWTLA  496

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            FSCEGSLLASGSADCTVKLWDVTTSTK+PK+EE KSG+ NRLRSLKTLPTK TP+Y+LRF
Sbjct  497  FSCEGSLLASGSADCTVKLWDVTTSTKVPKNEE-KSGNPNRLRSLKTLPTKLTPVYSLRF  555

Query  135  SRRNLLFAAGAFSKS  91
            SRRNLLFAAGA SK+
Sbjct  556  SRRNLLFAAGALSKN  570


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 60/121 (50%), Gaps = 0/121 (0%)
 Frame = -3

Query  606  IMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDG  427
            ++ GH   V    +    ++I + S+D T+RLW  +    +  + GH   +  +  SP G
Sbjct  316  LLQGHSGPVYSANFSPLGDFILSSSADTTIRLWSTELNANLVCYKGHNYPVWDVQFSPVG  375

Query  426  RYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVT  247
             Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D TV+LWDV 
Sbjct  376  HYFASASHDRTARIWSMDKIQPMRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQ  435

Query  246  T  244
            +
Sbjct  436  S  436



>ref|XP_009626036.1| PREDICTED: transcription initiation factor TFIID subunit 5 isoform 
X3 [Nicotiana tomentosiformis]
Length=571

 Score =   378 bits (971),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 178/196 (91%), Positives = 186/196 (95%), Gaps = 0/196 (0%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFAS SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS
Sbjct  376  YFASCSHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  435

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G+CVRIFIGHRSMILSLAMSPDGRYMASGDEDG +M+WDL+SGRCITPLVGH+SCVW+LA
Sbjct  436  GDCVRIFIGHRSMILSLAMSPDGRYMASGDEDGTVMMWDLSSGRCITPLVGHSSCVWSLA  495

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            FS EGSLLASGSADCTVKLWDVTTSTK P  EENK G  NRLRSLKTLPTK+TP+YALRF
Sbjct  496  FSGEGSLLASGSADCTVKLWDVTTSTKAPLKEENKPGINNRLRSLKTLPTKATPVYALRF  555

Query  135  SRRNLLFAAGAFSKSA  88
            SRRNLLFAAGAFSK A
Sbjct  556  SRRNLLFAAGAFSKGA  571


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = -3

Query  606  IMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDG  427
            +  GH   V    +    +++ + SSD T+RLW  +    +  + GH   +  +  SP G
Sbjct  315  LFQGHSGPVYSASFSPYGDFLLSSSSDSTIRLWSTRLNANLVCYKGHNYPVWDVQFSPVG  374

Query  426  RYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVT  247
             Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D TV+LWDV 
Sbjct  375  HYFASCSHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQ  434

Query  246  T  244
            +
Sbjct  435  S  435



>ref|XP_003631761.1| PREDICTED: transcription initiation factor TFIID subunit 5 [Vitis 
vinifera]
 emb|CBI21070.3| unnamed protein product [Vitis vinifera]
Length=676

 Score =   380 bits (976),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 175/196 (89%), Positives = 189/196 (96%), Gaps = 0/196 (0%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFAS+SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWH NCNYIATGSSDKTVRLWDVQS
Sbjct  481  YFASSSHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHINCNYIATGSSDKTVRLWDVQS  540

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVRIFIGHRSM+LSLAMSPDG+YMASGDEDG IM+WDL+SGRC+ PL+GH SCVW+LA
Sbjct  541  GECVRIFIGHRSMVLSLAMSPDGQYMASGDEDGTIMMWDLSSGRCVMPLMGHMSCVWSLA  600

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            FSCEGSLLASGSAD TVKLWDVTTSTK+P+SEENKSG+T+RLRSLKTLPTKSTP+Y+LRF
Sbjct  601  FSCEGSLLASGSADSTVKLWDVTTSTKVPRSEENKSGNTSRLRSLKTLPTKSTPVYSLRF  660

Query  135  SRRNLLFAAGAFSKSA  88
            SRRNLLFAAGA SKS 
Sbjct  661  SRRNLLFAAGALSKSG  676


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = -3

Query  606  IMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDG  427
            +  GH   V    +    ++I + S+D T+RLW  +    +  + GH   +  +  SP G
Sbjct  420  LFQGHSGPVYSATFSPLGDFILSSSADSTIRLWSTKLNANLVCYKGHNYPVWDVQFSPMG  479

Query  426  RYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVT  247
             Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D TV+LWDV 
Sbjct  480  HYFASSSHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHINCNYIATGSSDKTVRLWDVQ  539

Query  246  T  244
            +
Sbjct  540  S  540



>ref|XP_009626034.1| PREDICTED: transcription initiation factor TFIID subunit 5 isoform 
X1 [Nicotiana tomentosiformis]
Length=666

 Score =   380 bits (975),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 178/196 (91%), Positives = 186/196 (95%), Gaps = 0/196 (0%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFAS SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS
Sbjct  471  YFASCSHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  530

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G+CVRIFIGHRSMILSLAMSPDGRYMASGDEDG +M+WDL+SGRCITPLVGH+SCVW+LA
Sbjct  531  GDCVRIFIGHRSMILSLAMSPDGRYMASGDEDGTVMMWDLSSGRCITPLVGHSSCVWSLA  590

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            FS EGSLLASGSADCTVKLWDVTTSTK P  EENK G  NRLRSLKTLPTK+TP+YALRF
Sbjct  591  FSGEGSLLASGSADCTVKLWDVTTSTKAPLKEENKPGINNRLRSLKTLPTKATPVYALRF  650

Query  135  SRRNLLFAAGAFSKSA  88
            SRRNLLFAAGAFSK A
Sbjct  651  SRRNLLFAAGAFSKGA  666


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = -3

Query  606  IMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDG  427
            +  GH   V    +    +++ + SSD T+RLW  +    +  + GH   +  +  SP G
Sbjct  410  LFQGHSGPVYSASFSPYGDFLLSSSSDSTIRLWSTRLNANLVCYKGHNYPVWDVQFSPVG  469

Query  426  RYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVT  247
             Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D TV+LWDV 
Sbjct  470  HYFASCSHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQ  529

Query  246  T  244
            +
Sbjct  530  S  530



>ref|XP_009626035.1| PREDICTED: transcription initiation factor TFIID subunit 5 isoform 
X2 [Nicotiana tomentosiformis]
Length=665

 Score =   379 bits (974),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 178/196 (91%), Positives = 186/196 (95%), Gaps = 0/196 (0%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFAS SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS
Sbjct  470  YFASCSHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  529

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G+CVRIFIGHRSMILSLAMSPDGRYMASGDEDG +M+WDL+SGRCITPLVGH+SCVW+LA
Sbjct  530  GDCVRIFIGHRSMILSLAMSPDGRYMASGDEDGTVMMWDLSSGRCITPLVGHSSCVWSLA  589

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            FS EGSLLASGSADCTVKLWDVTTSTK P  EENK G  NRLRSLKTLPTK+TP+YALRF
Sbjct  590  FSGEGSLLASGSADCTVKLWDVTTSTKAPLKEENKPGINNRLRSLKTLPTKATPVYALRF  649

Query  135  SRRNLLFAAGAFSKSA  88
            SRRNLLFAAGAFSK A
Sbjct  650  SRRNLLFAAGAFSKGA  665


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = -3

Query  606  IMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDG  427
            +  GH   V    +    +++ + SSD T+RLW  +    +  + GH   +  +  SP G
Sbjct  409  LFQGHSGPVYSASFSPYGDFLLSSSSDSTIRLWSTRLNANLVCYKGHNYPVWDVQFSPVG  468

Query  426  RYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVT  247
             Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D TV+LWDV 
Sbjct  469  HYFASCSHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQ  528

Query  246  T  244
            +
Sbjct  529  S  529



>ref|XP_002324907.2| hypothetical protein POPTR_0018s02430g [Populus trichocarpa]
 gb|EEF03472.2| hypothetical protein POPTR_0018s02430g [Populus trichocarpa]
Length=675

 Score =   379 bits (973),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 176/195 (90%), Positives = 188/195 (96%), Gaps = 0/195 (0%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDC+QWHANCNYIATGSSDKTVRLWDVQS
Sbjct  480  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCLQWHANCNYIATGSSDKTVRLWDVQS  539

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVRIFIGHRSMILSLAMSPDGRYMAS DEDG IM+WDL+SGRCI+PL+GH SCVW+LA
Sbjct  540  GECVRIFIGHRSMILSLAMSPDGRYMASADEDGTIMMWDLSSGRCISPLIGHNSCVWSLA  599

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            FSCEGSLLASGSADCTVKLWDVTTSTK P++EE+KSG+TNRLR LKTLPTKSTP+Y LRF
Sbjct  600  FSCEGSLLASGSADCTVKLWDVTTSTKAPRTEESKSGNTNRLRLLKTLPTKSTPVYTLRF  659

Query  135  SRRNLLFAAGAFSKS  91
            SRRNLLFAAGA +KS
Sbjct  660  SRRNLLFAAGALAKS  674


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 36/121 (30%), Positives = 60/121 (50%), Gaps = 0/121 (0%)
 Frame = -3

Query  606  IMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDG  427
            +  GH   V    +    ++I + S+D TVRLW  +    +  + GH   +  +  SP G
Sbjct  419  LFQGHSGPVHSATFSPLGDFILSSSADTTVRLWSTKLNANLVCYKGHNYPVWDVQFSPVG  478

Query  426  RYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVT  247
            +Y AS   D    +W +   + +  + GH S V  L +    + +A+GS+D TV+LWDV 
Sbjct  479  QYFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCLQWHANCNYIATGSSDKTVRLWDVQ  538

Query  246  T  244
            +
Sbjct  539  S  539



>ref|XP_011036669.1| PREDICTED: transcription initiation factor TFIID subunit 5-like 
isoform X2 [Populus euphratica]
Length=673

 Score =   379 bits (973),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 176/195 (90%), Positives = 187/195 (96%), Gaps = 0/195 (0%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDC+QWHANCNYIATGSSDKTVRLWDVQS
Sbjct  478  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCLQWHANCNYIATGSSDKTVRLWDVQS  537

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVRIFIGHRSMILSLAMSPDGRYMAS DEDG IM+WDL+SGRCI+PL+GH SCVW LA
Sbjct  538  GECVRIFIGHRSMILSLAMSPDGRYMASADEDGTIMMWDLSSGRCISPLIGHNSCVWALA  597

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            FSCEGSLLASGSADCTVKLWDVTTSTK P++EE+KSG+TNRLR LKTLPTKSTP+Y LRF
Sbjct  598  FSCEGSLLASGSADCTVKLWDVTTSTKAPRTEESKSGNTNRLRLLKTLPTKSTPVYTLRF  657

Query  135  SRRNLLFAAGAFSKS  91
            SRRNLLFAAGA +KS
Sbjct  658  SRRNLLFAAGALAKS  672


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 36/121 (30%), Positives = 60/121 (50%), Gaps = 0/121 (0%)
 Frame = -3

Query  606  IMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDG  427
            +  GH   V    +    ++I + S+D TVRLW  +    +  + GH   +  +  SP G
Sbjct  417  LFQGHSGPVHSTTFSPAGDFILSSSADTTVRLWSTKLNANLVCYKGHNYPVWDVQFSPVG  476

Query  426  RYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVT  247
            +Y AS   D    +W +   + +  + GH S V  L +    + +A+GS+D TV+LWDV 
Sbjct  477  QYFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCLQWHANCNYIATGSSDKTVRLWDVQ  536

Query  246  T  244
            +
Sbjct  537  S  537



>ref|XP_007011730.1| TBP-associated factor 5 isoform 1 [Theobroma cacao]
 gb|EOY29349.1| TBP-associated factor 5 isoform 1 [Theobroma cacao]
Length=701

 Score =   380 bits (975),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 177/195 (91%), Positives = 190/195 (97%), Gaps = 1/195 (1%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFASASHDRTARIWSMD+IQP+RIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS
Sbjct  507  YFASASHDRTARIWSMDKIQPMRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  566

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVRIFIGHRSMILSLAMSPDGRYMASGDEDG IM+WDL+SGRC+TPL+GH+SCVWTLA
Sbjct  567  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGTIMMWDLSSGRCVTPLMGHSSCVWTLA  626

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            FSCEGSLLASGSADCTVKLWDVTTSTK+PK+EE KSG+ NRLRSLKTLPTK TP+Y+LRF
Sbjct  627  FSCEGSLLASGSADCTVKLWDVTTSTKVPKNEE-KSGNPNRLRSLKTLPTKLTPVYSLRF  685

Query  135  SRRNLLFAAGAFSKS  91
            SRRNLLFAAGA SK+
Sbjct  686  SRRNLLFAAGALSKN  700


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 60/121 (50%), Gaps = 0/121 (0%)
 Frame = -3

Query  606  IMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDG  427
            ++ GH   V    +    ++I + S+D T+RLW  +    +  + GH   +  +  SP G
Sbjct  446  LLQGHSGPVYSANFSPLGDFILSSSADTTIRLWSTELNANLVCYKGHNYPVWDVQFSPVG  505

Query  426  RYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVT  247
             Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D TV+LWDV 
Sbjct  506  HYFASASHDRTARIWSMDKIQPMRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQ  565

Query  246  T  244
            +
Sbjct  566  S  566



>ref|XP_011036668.1| PREDICTED: transcription initiation factor TFIID subunit 5-like 
isoform X1 [Populus euphratica]
Length=676

 Score =   379 bits (973),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 176/195 (90%), Positives = 187/195 (96%), Gaps = 0/195 (0%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDC+QWHANCNYIATGSSDKTVRLWDVQS
Sbjct  481  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCLQWHANCNYIATGSSDKTVRLWDVQS  540

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVRIFIGHRSMILSLAMSPDGRYMAS DEDG IM+WDL+SGRCI+PL+GH SCVW LA
Sbjct  541  GECVRIFIGHRSMILSLAMSPDGRYMASADEDGTIMMWDLSSGRCISPLIGHNSCVWALA  600

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            FSCEGSLLASGSADCTVKLWDVTTSTK P++EE+KSG+TNRLR LKTLPTKSTP+Y LRF
Sbjct  601  FSCEGSLLASGSADCTVKLWDVTTSTKAPRTEESKSGNTNRLRLLKTLPTKSTPVYTLRF  660

Query  135  SRRNLLFAAGAFSKS  91
            SRRNLLFAAGA +KS
Sbjct  661  SRRNLLFAAGALAKS  675


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 36/121 (30%), Positives = 60/121 (50%), Gaps = 0/121 (0%)
 Frame = -3

Query  606  IMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDG  427
            +  GH   V    +    ++I + S+D TVRLW  +    +  + GH   +  +  SP G
Sbjct  420  LFQGHSGPVHSTTFSPAGDFILSSSADTTVRLWSTKLNANLVCYKGHNYPVWDVQFSPVG  479

Query  426  RYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVT  247
            +Y AS   D    +W +   + +  + GH S V  L +    + +A+GS+D TV+LWDV 
Sbjct  480  QYFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCLQWHANCNYIATGSSDKTVRLWDVQ  539

Query  246  T  244
            +
Sbjct  540  S  540



>ref|XP_006353658.1| PREDICTED: transcription initiation factor TFIID subunit 5-like 
[Solanum tuberosum]
Length=677

 Score =   379 bits (973),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 177/196 (90%), Positives = 188/196 (96%), Gaps = 0/196 (0%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFAS+SHDRTA+IWS+DRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS
Sbjct  482  YFASSSHDRTAKIWSVDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  541

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G+CVRIFIGHRSMILSLAMSPDGRYMASGDEDG +M+WDL+SGRCITPLVGH+SCVW+LA
Sbjct  542  GDCVRIFIGHRSMILSLAMSPDGRYMASGDEDGTVMMWDLSSGRCITPLVGHSSCVWSLA  601

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            FS EGSLLASGSADCTVKLWDVTTSTK P  EENKSGS NRLR LKTLPTK+TP+YAL F
Sbjct  602  FSGEGSLLASGSADCTVKLWDVTTSTKAPLKEENKSGSNNRLRLLKTLPTKATPVYALHF  661

Query  135  SRRNLLFAAGAFSKSA  88
            SRRNLLFAAGAFSKSA
Sbjct  662  SRRNLLFAAGAFSKSA  677


 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 35/121 (29%), Positives = 61/121 (50%), Gaps = 0/121 (0%)
 Frame = -3

Query  606  IMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDG  427
            ++ GH   V    +  + +++ + SSD T+RLW  +    V  + GH   +  +  SP G
Sbjct  421  LLQGHSGPVYSASFSPDGDFLLSSSSDSTIRLWSTKLNANVVCYKGHNYPVWDVQFSPAG  480

Query  426  RYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVT  247
             Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D TV+LWDV 
Sbjct  481  HYFASSSHDRTAKIWSVDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQ  540

Query  246  T  244
            +
Sbjct  541  S  541


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 36/139 (26%), Positives = 56/139 (40%), Gaps = 28/139 (20%)
 Frame = -3

Query  582  VDCVQWHANCNYIATGSSDKTVRLWDV-----QSG-----------------------EC  487
            ++C     + + +A G SD ++++WD+     Q+G                        C
Sbjct  359  LNCASISHDGSLVAGGFSDSSLKVWDMAKLGQQTGPSFLQGETDSPSSEHVLGSSGGRRC  418

Query  486  VRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSC  307
              +  GH   + S + SPDG ++ S   D  I +W       +    GH   VW + FS 
Sbjct  419  YTLLQGHSGPVYSASFSPDGDFLLSSSSDSTIRLWSTKLNANVVCYKGHNYPVWDVQFSP  478

Query  306  EGSLLASGSADCTVKLWDV  250
             G   AS S D T K+W V
Sbjct  479  AGHYFASSSHDRTAKIWSV  497



>ref|XP_007225152.1| hypothetical protein PRUPE_ppa002437mg [Prunus persica]
 gb|EMJ26351.1| hypothetical protein PRUPE_ppa002437mg [Prunus persica]
Length=673

 Score =   378 bits (971),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 174/195 (89%), Positives = 187/195 (96%), Gaps = 0/195 (0%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFASASHDRTARIWSMD+IQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQ+
Sbjct  478  YFASASHDRTARIWSMDKIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQT  537

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVRIFIGHRSM+LSLAMSPDGRYMASGDEDG IM+WDL+SGRC+TPL GH SCVWTLA
Sbjct  538  GECVRIFIGHRSMVLSLAMSPDGRYMASGDEDGAIMMWDLSSGRCVTPLTGHTSCVWTLA  597

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            FS EGSLLASGSADCTVKLWDVT STK+PK+EENKSG+T+RLRSLKTLPTK TP+Y+LRF
Sbjct  598  FSGEGSLLASGSADCTVKLWDVTASTKLPKTEENKSGNTSRLRSLKTLPTKCTPVYSLRF  657

Query  135  SRRNLLFAAGAFSKS  91
            SRRNLLFAAG  SK+
Sbjct  658  SRRNLLFAAGVLSKT  672


 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 37/125 (30%), Positives = 62/125 (50%), Gaps = 0/125 (0%)
 Frame = -3

Query  618  QPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAM  439
            +P  +  GH   V    ++   ++I + S+D TVRLW  +    +  + GH   +  +  
Sbjct  413  RPYTLFQGHSGPVYSATFNPLGDFILSSSADSTVRLWSTKLNANLVCYKGHNYPVWDVQF  472

Query  438  SPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKL  259
            SP G Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D TV+L
Sbjct  473  SPVGHYFASASHDRTARIWSMDKIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRL  532

Query  258  WDVTT  244
            WDV T
Sbjct  533  WDVQT  537



>gb|EYU40594.1| hypothetical protein MIMGU_mgv1a002477mg [Erythranthe guttata]
Length=668

 Score =   377 bits (969),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 173/194 (89%), Positives = 188/194 (97%), Gaps = 0/194 (0%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFASASHDRTARIWS+DRIQPLRIMAGHLSDVDCVQWHANCNY+ATGSSDKTVRLWDVQS
Sbjct  473  YFASASHDRTARIWSVDRIQPLRIMAGHLSDVDCVQWHANCNYVATGSSDKTVRLWDVQS  532

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVRIFIGHRSMILSLAMSPDGRYMASGDEDG IM+WDLA+GRCI+PLVGH+SC+W+L+
Sbjct  533  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGTIMMWDLATGRCISPLVGHSSCIWSLS  592

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            FSCEGSLLASGSADCTVK+WDV TS+K+ K+EENKSGS NRLRSLKTLPTKSTP+YAL+F
Sbjct  593  FSCEGSLLASGSADCTVKIWDVATSSKVSKAEENKSGSVNRLRSLKTLPTKSTPVYALKF  652

Query  135  SRRNLLFAAGAFSK  94
            S RNLLFAAGA SK
Sbjct  653  SPRNLLFAAGALSK  666


 Score = 55.8 bits (133),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = -3

Query  606  IMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDG  427
            +  GH   V    +    +++ + SSD T+RLW  +    +  + GH   +  +  SP G
Sbjct  412  LFRGHAGPVHSATFSPFGDFLLSSSSDSTIRLWSTKLNTNLVCYKGHNYPVWDVQFSPMG  471

Query  426  RYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVT  247
             Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D TV+LWDV 
Sbjct  472  HYFASASHDRTARIWSVDRIQPLRIMAGHLSDVDCVQWHANCNYVATGSSDKTVRLWDVQ  531

Query  246  T  244
            +
Sbjct  532  S  532



>ref|XP_008220685.1| PREDICTED: transcription initiation factor TFIID subunit 5 [Prunus 
mume]
Length=673

 Score =   377 bits (969),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 173/195 (89%), Positives = 187/195 (96%), Gaps = 0/195 (0%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFASASHDRTARIWSMD+IQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQ+
Sbjct  478  YFASASHDRTARIWSMDKIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQT  537

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVRIFIGHRSM+LSLAMSPDGRYMASGDEDG IM+WDL+SGRC+TPL GH SCVWTLA
Sbjct  538  GECVRIFIGHRSMVLSLAMSPDGRYMASGDEDGAIMMWDLSSGRCVTPLTGHTSCVWTLA  597

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            FS EGSLLASGSADCTVKLWDVT STK+PK+EENKSG+T+RLRSLKTLPTK TP+Y+LRF
Sbjct  598  FSGEGSLLASGSADCTVKLWDVTASTKLPKTEENKSGNTSRLRSLKTLPTKCTPVYSLRF  657

Query  135  SRRNLLFAAGAFSKS  91
            SRRNLLFAAG  +K+
Sbjct  658  SRRNLLFAAGVLAKT  672


 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 37/125 (30%), Positives = 62/125 (50%), Gaps = 0/125 (0%)
 Frame = -3

Query  618  QPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAM  439
            +P  +  GH   V    ++   ++I + S+D TVRLW  +    +  + GH   +  +  
Sbjct  413  RPYTLFQGHSGPVYSATFNPLGDFILSSSADSTVRLWSTKLNANLVCYKGHNYPVWDVQF  472

Query  438  SPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKL  259
            SP G Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D TV+L
Sbjct  473  SPVGHYFASASHDRTARIWSMDKIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRL  532

Query  258  WDVTT  244
            WDV T
Sbjct  533  WDVQT  537



>gb|KDP33523.1| hypothetical protein JCGZ_07094 [Jatropha curcas]
Length=670

 Score =   377 bits (967),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 173/195 (89%), Positives = 187/195 (96%), Gaps = 0/195 (0%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS
Sbjct  475  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  534

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVRIFIGHRSMILSLAMSPDGRYMAS DEDG IM+WDL++GRC++PL+GH SCVWTLA
Sbjct  535  GECVRIFIGHRSMILSLAMSPDGRYMASADEDGTIMMWDLSTGRCVSPLMGHNSCVWTLA  594

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            FSCEGSLLASGSADCTVKLWDVT+STK+P++E++KSG+ NRLRSLKTLPTK TP+Y LRF
Sbjct  595  FSCEGSLLASGSADCTVKLWDVTSSTKVPRAEDSKSGTANRLRSLKTLPTKMTPVYTLRF  654

Query  135  SRRNLLFAAGAFSKS  91
            SRRNLLFAAG  SKS
Sbjct  655  SRRNLLFAAGVLSKS  669


 Score = 62.0 bits (149),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = -3

Query  606  IMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDG  427
            +  GH   V    +    ++I + S+D T+RLW  +    +  + GH   +  +  SP G
Sbjct  414  LFQGHSGPVYSATFSLLGDFILSSSADTTIRLWSTKLNANLVCYKGHNYPVWDVQFSPVG  473

Query  426  RYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVT  247
             Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D TV+LWDV 
Sbjct  474  HYFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQ  533

Query  246  T  244
            +
Sbjct  534  S  534



>ref|XP_002515435.1| protein with unknown function [Ricinus communis]
 gb|EEF46884.1| protein with unknown function [Ricinus communis]
Length=670

 Score =   376 bits (966),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 174/196 (89%), Positives = 188/196 (96%), Gaps = 0/196 (0%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFASASHDRTARIWSMDR+QPLRI+AGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS
Sbjct  475  YFASASHDRTARIWSMDRLQPLRILAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  534

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVRIFIGHRSMILSLAMSPDGR+MAS DEDG IM+WDL+SGRC++PL+GH SCVWTLA
Sbjct  535  GECVRIFIGHRSMILSLAMSPDGRFMASADEDGTIMMWDLSSGRCVSPLMGHNSCVWTLA  594

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            FSCEGSLLASGSADCTVKLWDVT+STK+ K+EE+KSGS NRLRSLKTLPTKSTP+Y+LRF
Sbjct  595  FSCEGSLLASGSADCTVKLWDVTSSTKVTKAEESKSGSANRLRSLKTLPTKSTPVYSLRF  654

Query  135  SRRNLLFAAGAFSKSA  88
            SRRNLLFAAG  SKS 
Sbjct  655  SRRNLLFAAGVLSKSG  670


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/121 (29%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = -3

Query  606  IMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDG  427
            +  GH   V    +    ++I + S+D T+RLW  +    +  + GH   +  +  SP G
Sbjct  414  LFQGHSGPVYSATFSPLGDFILSSSADTTIRLWSTKLNANLVCYKGHNYPVWDVQFSPVG  473

Query  426  RYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVT  247
             Y AS   D    +W +   + +  L GH S V  + +    + +A+GS+D TV+LWDV 
Sbjct  474  HYFASASHDRTARIWSMDRLQPLRILAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQ  533

Query  246  T  244
            +
Sbjct  534  S  534



>ref|XP_008377658.1| PREDICTED: transcription initiation factor TFIID subunit 5 [Malus 
domestica]
Length=675

 Score =   376 bits (965),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 171/195 (88%), Positives = 188/195 (96%), Gaps = 0/195 (0%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQ+
Sbjct  480  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQT  539

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVRIFIGHRSM+LSLAMSPDGRYMASGDEDG IM+WDL++GRC+TPL+GH SCVWTL 
Sbjct  540  GECVRIFIGHRSMVLSLAMSPDGRYMASGDEDGAIMMWDLSTGRCVTPLMGHTSCVWTLD  599

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            FS EGSLLASGSADCTVKLWDVT STK+P++EENKSG+T+RLRSL+TLPTKSTP+Y+LRF
Sbjct  600  FSGEGSLLASGSADCTVKLWDVTASTKLPRTEENKSGNTSRLRSLRTLPTKSTPVYSLRF  659

Query  135  SRRNLLFAAGAFSKS  91
            SRRNLLFA+G  SK+
Sbjct  660  SRRNLLFASGVLSKT  674


 Score = 68.2 bits (165),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 37/125 (30%), Positives = 62/125 (50%), Gaps = 0/125 (0%)
 Frame = -3

Query  618  QPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAM  439
            +P  +  GH   V    ++   ++I + S+D TVRLW  +    +  + GH   +  +  
Sbjct  415  KPYTLFQGHSGPVYSATFNPLGDFILSSSADSTVRLWSTKLNANLVCYKGHNYPVWDVQF  474

Query  438  SPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKL  259
            SP G Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D TV+L
Sbjct  475  SPVGHYFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRL  534

Query  258  WDVTT  244
            WDV T
Sbjct  535  WDVQT  539



>emb|CDP05651.1| unnamed protein product [Coffea canephora]
Length=674

 Score =   375 bits (964),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 172/195 (88%), Positives = 187/195 (96%), Gaps = 0/195 (0%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFAS+SHDRTARIWSMDR+QPLRIMAGHLSDVDC+QWH NCNYIATGSSDKTVRLWDVQS
Sbjct  479  YFASSSHDRTARIWSMDRMQPLRIMAGHLSDVDCLQWHVNCNYIATGSSDKTVRLWDVQS  538

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVRIFIGHRSMILSLAMSPDGRYMASGDEDG +M+W+LASGRCI+PLVGH SCVWTLA
Sbjct  539  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGTVMMWELASGRCISPLVGHTSCVWTLA  598

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            FSCEGSLLASGSADCTVKLWDVT STK+ K+E+NK+GS NRLRSLKTLPTKSTP+Y+L+F
Sbjct  599  FSCEGSLLASGSADCTVKLWDVTASTKLLKTEDNKTGSINRLRSLKTLPTKSTPVYSLQF  658

Query  135  SRRNLLFAAGAFSKS  91
            SRRNLLFAAG  SK+
Sbjct  659  SRRNLLFAAGVLSKN  673


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 58/121 (48%), Gaps = 0/121 (0%)
 Frame = -3

Query  606  IMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDG  427
            +  GH   V    +    +YI + SSD T+RLW       +  + GH   +  +  SP G
Sbjct  418  LFQGHSGPVYSATFSPFGDYILSSSSDSTIRLWSTNLNTNLVCYKGHNYPVWDVQFSPVG  477

Query  426  RYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVT  247
             Y AS   D    +W +   + +  + GH S V  L +    + +A+GS+D TV+LWDV 
Sbjct  478  HYFASSSHDRTARIWSMDRMQPLRIMAGHLSDVDCLQWHVNCNYIATGSSDKTVRLWDVQ  537

Query  246  T  244
            +
Sbjct  538  S  538



>ref|XP_011459607.1| PREDICTED: transcription initiation factor TFIID subunit 5 isoform 
X2 [Fragaria vesca subsp. vesca]
Length=665

 Score =   374 bits (961),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 175/195 (90%), Positives = 187/195 (96%), Gaps = 1/195 (1%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWH+NCNYIATGSSDKTVRLWDVQS
Sbjct  471  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHSNCNYIATGSSDKTVRLWDVQS  530

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVRIFIGHRSMILSLAMSPDGRYMASGDEDG IM+WDL++GRC+TPL+GH SCVWTLA
Sbjct  531  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGSIMMWDLSTGRCVTPLMGHTSCVWTLA  590

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            FS EGSLLASGSADCTVKLWD+T STK+PK+EE KSGS +RLRSLKTLPTKSTP+Y+LRF
Sbjct  591  FSGEGSLLASGSADCTVKLWDITASTKLPKAEE-KSGSASRLRSLKTLPTKSTPVYSLRF  649

Query  135  SRRNLLFAAGAFSKS  91
            SRRNLLFAAG  SKS
Sbjct  650  SRRNLLFAAGVLSKS  664


 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 61/125 (49%), Gaps = 0/125 (0%)
 Frame = -3

Query  618  QPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAM  439
            +P  +  GH   V    ++   ++I + S+D T+RLW       +  + GH   +  +  
Sbjct  406  RPYTLFQGHSGPVYSATFNPLGDFILSSSADSTIRLWSTNLNANLVCYKGHNYPVWDVQF  465

Query  438  SPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKL  259
            SP G Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D TV+L
Sbjct  466  SPVGHYFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHSNCNYIATGSSDKTVRL  525

Query  258  WDVTT  244
            WDV +
Sbjct  526  WDVQS  530



>ref|XP_004291953.1| PREDICTED: transcription initiation factor TFIID subunit 5 isoform 
X1 [Fragaria vesca subsp. vesca]
Length=666

 Score =   374 bits (961),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 175/195 (90%), Positives = 187/195 (96%), Gaps = 1/195 (1%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWH+NCNYIATGSSDKTVRLWDVQS
Sbjct  472  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHSNCNYIATGSSDKTVRLWDVQS  531

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVRIFIGHRSMILSLAMSPDGRYMASGDEDG IM+WDL++GRC+TPL+GH SCVWTLA
Sbjct  532  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGSIMMWDLSTGRCVTPLMGHTSCVWTLA  591

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            FS EGSLLASGSADCTVKLWD+T STK+PK+EE KSGS +RLRSLKTLPTKSTP+Y+LRF
Sbjct  592  FSGEGSLLASGSADCTVKLWDITASTKLPKAEE-KSGSASRLRSLKTLPTKSTPVYSLRF  650

Query  135  SRRNLLFAAGAFSKS  91
            SRRNLLFAAG  SKS
Sbjct  651  SRRNLLFAAGVLSKS  665


 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 61/125 (49%), Gaps = 0/125 (0%)
 Frame = -3

Query  618  QPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAM  439
            +P  +  GH   V    ++   ++I + S+D T+RLW       +  + GH   +  +  
Sbjct  407  RPYTLFQGHSGPVYSATFNPLGDFILSSSADSTIRLWSTNLNANLVCYKGHNYPVWDVQF  466

Query  438  SPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKL  259
            SP G Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D TV+L
Sbjct  467  SPVGHYFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHSNCNYIATGSSDKTVRL  526

Query  258  WDVTT  244
            WDV +
Sbjct  527  WDVQS  531



>ref|XP_010906860.1| PREDICTED: transcription initiation factor TFIID subunit 5 isoform 
X1 [Elaeis guineensis]
Length=657

 Score =   373 bits (957),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 171/196 (87%), Positives = 183/196 (93%), Gaps = 0/196 (0%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFAS SHDRTARIWSM+RIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS
Sbjct  462  YFASCSHDRTARIWSMERIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  521

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVRIFIGHRSM+LSLAMSPDGRYMASGDEDG IM+WDL+SGRC++PL+GH SCVWTLA
Sbjct  522  GECVRIFIGHRSMVLSLAMSPDGRYMASGDEDGTIMMWDLSSGRCVSPLMGHNSCVWTLA  581

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            FSCEG+LLASGSADCTVKLWDVT S K+P+ EENK+ STNRLR LK LPTKSTP+Y LRF
Sbjct  582  FSCEGTLLASGSADCTVKLWDVTASMKVPRMEENKASSTNRLRLLKALPTKSTPVYTLRF  641

Query  135  SRRNLLFAAGAFSKSA  88
            SRRNLLFAAG  SK A
Sbjct  642  SRRNLLFAAGGLSKQA  657


 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = -3

Query  606  IMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDG  427
            +  GH   V    +    +++ + SSD T+RLW  +    +  + GH   +  +  SP G
Sbjct  401  LFQGHAGPVYSATFSPFGDFLLSSSSDSTIRLWSTKLNSNLVCYKGHNYPVWDVQFSPVG  460

Query  426  RYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVT  247
             Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D TV+LWDV 
Sbjct  461  HYFASCSHDRTARIWSMERIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQ  520

Query  246  T  244
            +
Sbjct  521  S  521



>ref|XP_010906861.1| PREDICTED: transcription initiation factor TFIID subunit 5 isoform 
X2 [Elaeis guineensis]
Length=656

 Score =   372 bits (956),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 171/196 (87%), Positives = 183/196 (93%), Gaps = 0/196 (0%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFAS SHDRTARIWSM+RIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS
Sbjct  461  YFASCSHDRTARIWSMERIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  520

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVRIFIGHRSM+LSLAMSPDGRYMASGDEDG IM+WDL+SGRC++PL+GH SCVWTLA
Sbjct  521  GECVRIFIGHRSMVLSLAMSPDGRYMASGDEDGTIMMWDLSSGRCVSPLMGHNSCVWTLA  580

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            FSCEG+LLASGSADCTVKLWDVT S K+P+ EENK+ STNRLR LK LPTKSTP+Y LRF
Sbjct  581  FSCEGTLLASGSADCTVKLWDVTASMKVPRMEENKASSTNRLRLLKALPTKSTPVYTLRF  640

Query  135  SRRNLLFAAGAFSKSA  88
            SRRNLLFAAG  SK A
Sbjct  641  SRRNLLFAAGGLSKQA  656


 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = -3

Query  606  IMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDG  427
            +  GH   V    +    +++ + SSD T+RLW  +    +  + GH   +  +  SP G
Sbjct  400  LFQGHAGPVYSATFSPFGDFLLSSSSDSTIRLWSTKLNSNLVCYKGHNYPVWDVQFSPVG  459

Query  426  RYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVT  247
             Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D TV+LWDV 
Sbjct  460  HYFASCSHDRTARIWSMERIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQ  519

Query  246  T  244
            +
Sbjct  520  S  520



>ref|XP_004241800.1| PREDICTED: transcription initiation factor TFIID subunit 5 isoform 
X1 [Solanum lycopersicum]
Length=685

 Score =   373 bits (958),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 174/196 (89%), Positives = 186/196 (95%), Gaps = 0/196 (0%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFAS+SHDRTARIWS+DRIQPLRIMAGHLSDVDCV+WHANCNYIATGSSDKTVRLWDVQS
Sbjct  482  YFASSSHDRTARIWSVDRIQPLRIMAGHLSDVDCVRWHANCNYIATGSSDKTVRLWDVQS  541

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G+CVRIFIGHRSMILSLAMSPDGRYMASGDEDG +M+WDL+SGRCITPL GH+SCVW+LA
Sbjct  542  GDCVRIFIGHRSMILSLAMSPDGRYMASGDEDGTVMMWDLSSGRCITPLTGHSSCVWSLA  601

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            FS EGSLLASGSADCTVKLWDVTTST+ P  EENKSG  NRLR LKTLPTK+TP+YAL F
Sbjct  602  FSGEGSLLASGSADCTVKLWDVTTSTRAPLKEENKSGGNNRLRLLKTLPTKATPIYALHF  661

Query  135  SRRNLLFAAGAFSKSA  88
            SRRNLLFAAGAFSKSA
Sbjct  662  SRRNLLFAAGAFSKSA  677


 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 36/121 (30%), Positives = 61/121 (50%), Gaps = 0/121 (0%)
 Frame = -3

Query  606  IMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDG  427
            ++ GH   V    +  + +++ + SSD TVRLW  +    V  + GH   +  +  SP G
Sbjct  421  LLQGHSGPVYSASFSPHGDFLLSSSSDSTVRLWSTKLNANVVCYKGHNYPVWDVQFSPAG  480

Query  426  RYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVT  247
             Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D TV+LWDV 
Sbjct  481  HYFASSSHDRTARIWSVDRIQPLRIMAGHLSDVDCVRWHANCNYIATGSSDKTVRLWDVQ  540

Query  246  T  244
            +
Sbjct  541  S  541



>ref|XP_010275775.1| PREDICTED: transcription initiation factor TFIID subunit 5 [Nelumbo 
nucifera]
Length=664

 Score =   372 bits (954),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 171/194 (88%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFAS+SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS
Sbjct  469  YFASSSHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  528

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVRIFIGHRSM+LSLAMSPDGRYM SGDEDG IM+WDL+SGRC+TPL+GH SCVWTLA
Sbjct  529  GECVRIFIGHRSMVLSLAMSPDGRYMTSGDEDGMIMMWDLSSGRCVTPLMGHTSCVWTLA  588

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            FS EGSLLASGSADCTVKLWDVT STK+ ++EENKSG+ NRLRSLKTLPT+STP+Y L+F
Sbjct  589  FSREGSLLASGSADCTVKLWDVTASTKVARTEENKSGAMNRLRSLKTLPTRSTPVYTLQF  648

Query  135  SRRNLLFAAGAFSK  94
            SRRNLLFAAG  SK
Sbjct  649  SRRNLLFAAGVLSK  662


 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 35/121 (29%), Positives = 61/121 (50%), Gaps = 0/121 (0%)
 Frame = -3

Query  606  IMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDG  427
            +  GH   V  V++    ++I + S+D T+RLW  +    +  + GH   +  +  SP G
Sbjct  408  LFQGHAGPVYSVKFSPLGDFILSSSADSTIRLWSTKLNANLVCYKGHNYPVWDVQFSPVG  467

Query  426  RYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVT  247
             Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D TV+LWDV 
Sbjct  468  HYFASSSHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQ  527

Query  246  T  244
            +
Sbjct  528  S  528



>gb|KJB07683.1| hypothetical protein B456_001G037500 [Gossypium raimondii]
Length=668

 Score =   371 bits (952),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 172/194 (89%), Positives = 186/194 (96%), Gaps = 1/194 (1%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFAS+SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSD+TVRLWDVQS
Sbjct  474  YFASSSHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDRTVRLWDVQS  533

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVRIFIGHRSMILSLAMSPDGRYMASGDEDG IM+WDL+SGRC+TPL+GH SCVW+LA
Sbjct  534  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGTIMMWDLSSGRCVTPLMGHTSCVWSLA  593

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            FSCEG++LASGSADCTVKLWDVTTSTK PK+EE KSG+ NRLRSLKTL TKS+P+Y+LRF
Sbjct  594  FSCEGTVLASGSADCTVKLWDVTTSTKAPKNEE-KSGNPNRLRSLKTLATKSSPVYSLRF  652

Query  135  SRRNLLFAAGAFSK  94
            SRRNLLFAAG  SK
Sbjct  653  SRRNLLFAAGVLSK  666


 Score = 62.0 bits (149),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = -3

Query  606  IMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDG  427
            +  GH   V    +    ++I + S+D T+RLW  +    +  + GH   +  +  SP G
Sbjct  413  LFQGHSGPVYSATFSPLGDFILSSSADTTIRLWSTKLNANLVCYKGHNYPVWDVQFSPVG  472

Query  426  RYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVT  247
             Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D TV+LWDV 
Sbjct  473  HYFASSSHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDRTVRLWDVQ  532

Query  246  T  244
            +
Sbjct  533  S  533



>gb|KHG10775.1| Transcription initiation factor TFIID subunit 5 [Gossypium arboreum]
Length=650

 Score =   370 bits (951),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 172/195 (88%), Positives = 187/195 (96%), Gaps = 1/195 (1%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFAS+SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSD+TVRLWDVQS
Sbjct  456  YFASSSHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDRTVRLWDVQS  515

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVRIFIGHRSMILSLAMSPDGRYMASGDEDG IM+WDL+SGRC+TPL+GH SCVW+LA
Sbjct  516  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGTIMMWDLSSGRCVTPLMGHTSCVWSLA  575

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            FSCEG+LLASGSADCTVKLWDVTTSTK PK+E+ KSG+ NRLRSLKTL TKS+P+Y+LRF
Sbjct  576  FSCEGTLLASGSADCTVKLWDVTTSTKAPKNED-KSGNPNRLRSLKTLATKSSPVYSLRF  634

Query  135  SRRNLLFAAGAFSKS  91
            SRRNLLFAAG  SK+
Sbjct  635  SRRNLLFAAGVLSKN  649


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/147 (25%), Positives = 68/147 (46%), Gaps = 10/147 (7%)
 Frame = -3

Query  654  DRTARIWSMDRI----------QPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWD  505
            D + ++W M ++          +   +  GH   V    +    ++I + S+D T+RLW 
Sbjct  369  DSSLKVWDMAKLGQQAGPNGVKRSYTLFQGHSGPVYSATFSPLGDFILSSSADTTIRLWS  428

Query  504  VQSGECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVW  325
             +    +  + GH   +  +  SP G Y AS   D    +W +   + +  + GH S V 
Sbjct  429  TKLNANLVCYKGHNYPVWDVQFSPVGHYFASSSHDRTARIWSMDRIQPLRIMAGHLSDVD  488

Query  324  TLAFSCEGSLLASGSADCTVKLWDVTT  244
             + +    + +A+GS+D TV+LWDV +
Sbjct  489  CVQWHANCNYIATGSSDRTVRLWDVQS  515



>ref|XP_011031464.1| PREDICTED: transcription initiation factor TFIID subunit 5-like 
[Populus euphratica]
Length=675

 Score =   371 bits (952),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 174/195 (89%), Positives = 185/195 (95%), Gaps = 0/195 (0%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS
Sbjct  480  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  539

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVRIFIGHRSMILSLAMSPDGRYMASGDEDG IM+WDL+SGRCI+P++GH SCVW+LA
Sbjct  540  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGTIMMWDLSSGRCISPMMGHHSCVWSLA  599

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            FSCE SLLASGSADCTVKLWDVTTSTK  K+EENKSG+ +RLR LKTLPTKSTP+  LRF
Sbjct  600  FSCESSLLASGSADCTVKLWDVTTSTKPAKTEENKSGNAHRLRLLKTLPTKSTPVSTLRF  659

Query  135  SRRNLLFAAGAFSKS  91
            SRRNLLFAAGA S+S
Sbjct  660  SRRNLLFAAGALSRS  674


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/121 (29%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = -3

Query  606  IMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDG  427
            +  GH   V    +    ++I + S+D TVRLW  +    +  + GH   +  +  SP G
Sbjct  419  LFQGHSGPVHSATFSPLGDFILSSSADTTVRLWSTELNANLVCYKGHNYPVWDVQFSPVG  478

Query  426  RYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVT  247
             Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D TV+LWDV 
Sbjct  479  HYFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQ  538

Query  246  T  244
            +
Sbjct  539  S  539



>ref|XP_008790671.1| PREDICTED: transcription initiation factor TFIID subunit 5 isoform 
X4 [Phoenix dactylifera]
Length=656

 Score =   370 bits (950),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 170/194 (88%), Positives = 183/194 (94%), Gaps = 0/194 (0%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFAS SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS
Sbjct  461  YFASCSHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  520

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVR+FIGHRSM+LSLAMS DGRYMASGDEDG IM+WDL+SGRC++PL+GH+SCVWTLA
Sbjct  521  GECVRVFIGHRSMVLSLAMSLDGRYMASGDEDGTIMMWDLSSGRCVSPLMGHSSCVWTLA  580

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            FSCEG+LLASGSADCTVKLWDVT S K+P+ EENK+ STNRLR LK LPTKSTP+Y LRF
Sbjct  581  FSCEGTLLASGSADCTVKLWDVTASMKVPRMEENKASSTNRLRLLKALPTKSTPVYTLRF  640

Query  135  SRRNLLFAAGAFSK  94
            SRRNLLFAAGA SK
Sbjct  641  SRRNLLFAAGALSK  654


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 62/128 (48%), Gaps = 0/128 (0%)
 Frame = -3

Query  627  DRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILS  448
            +R +   +  GH   V    +    +++ + SSD T+RLW  +    +  + GH   +  
Sbjct  393  ERKRSYTLFQGHAGPVYSATFSPFGDFLLSSSSDSTIRLWSTKLNSNLVCYKGHNYPVWD  452

Query  447  LAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCT  268
            +  SP G Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D T
Sbjct  453  VQFSPVGHYFASCSHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKT  512

Query  267  VKLWDVTT  244
            V+LWDV +
Sbjct  513  VRLWDVQS  520



>ref|XP_002309672.1| hypothetical protein POPTR_0006s27930g [Populus trichocarpa]
 gb|EEE93195.1| hypothetical protein POPTR_0006s27930g [Populus trichocarpa]
Length=675

 Score =   370 bits (951),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 174/195 (89%), Positives = 186/195 (95%), Gaps = 0/195 (0%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS
Sbjct  480  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  539

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVRIFIGHRSMILSLAMSPDGRYMASGDEDG IM+WDL+SGRCI+P++GH SCVW+LA
Sbjct  540  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGSIMMWDLSSGRCISPMMGHHSCVWSLA  599

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            FSCE SLLASGSADCTVKLWDVTTSTK  K+EE+KSG+T+RLR LKTLPTKSTP+  LRF
Sbjct  600  FSCESSLLASGSADCTVKLWDVTTSTKPAKTEESKSGNTHRLRFLKTLPTKSTPVSTLRF  659

Query  135  SRRNLLFAAGAFSKS  91
            SRRNLLFAAGA S+S
Sbjct  660  SRRNLLFAAGALSRS  674


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/121 (29%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = -3

Query  606  IMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDG  427
            +  GH   V    +    ++I + S+D TVRLW  +    +  + GH   +  +  SP G
Sbjct  419  LFQGHSGPVHSATFSPLGDFILSSSADTTVRLWSTELNANLVCYKGHNYPVWDVQFSPVG  478

Query  426  RYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVT  247
             Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D TV+LWDV 
Sbjct  479  HYFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQ  538

Query  246  T  244
            +
Sbjct  539  S  539



>ref|XP_008790670.1| PREDICTED: transcription initiation factor TFIID subunit 5 isoform 
X3 [Phoenix dactylifera]
Length=657

 Score =   370 bits (950),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 170/194 (88%), Positives = 183/194 (94%), Gaps = 0/194 (0%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFAS SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS
Sbjct  462  YFASCSHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  521

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVR+FIGHRSM+LSLAMS DGRYMASGDEDG IM+WDL+SGRC++PL+GH+SCVWTLA
Sbjct  522  GECVRVFIGHRSMVLSLAMSLDGRYMASGDEDGTIMMWDLSSGRCVSPLMGHSSCVWTLA  581

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            FSCEG+LLASGSADCTVKLWDVT S K+P+ EENK+ STNRLR LK LPTKSTP+Y LRF
Sbjct  582  FSCEGTLLASGSADCTVKLWDVTASMKVPRMEENKASSTNRLRLLKALPTKSTPVYTLRF  641

Query  135  SRRNLLFAAGAFSK  94
            SRRNLLFAAGA SK
Sbjct  642  SRRNLLFAAGALSK  655


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 62/128 (48%), Gaps = 0/128 (0%)
 Frame = -3

Query  627  DRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILS  448
            +R +   +  GH   V    +    +++ + SSD T+RLW  +    +  + GH   +  
Sbjct  394  ERKRSYTLFQGHAGPVYSATFSPFGDFLLSSSSDSTIRLWSTKLNSNLVCYKGHNYPVWD  453

Query  447  LAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCT  268
            +  SP G Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D T
Sbjct  454  VQFSPVGHYFASCSHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKT  513

Query  267  VKLWDVTT  244
            V+LWDV +
Sbjct  514  VRLWDVQS  521



>ref|XP_008790668.1| PREDICTED: transcription initiation factor TFIID subunit 5 isoform 
X1 [Phoenix dactylifera]
Length=664

 Score =   370 bits (950),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 170/194 (88%), Positives = 183/194 (94%), Gaps = 0/194 (0%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFAS SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS
Sbjct  469  YFASCSHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  528

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVR+FIGHRSM+LSLAMS DGRYMASGDEDG IM+WDL+SGRC++PL+GH+SCVWTLA
Sbjct  529  GECVRVFIGHRSMVLSLAMSLDGRYMASGDEDGTIMMWDLSSGRCVSPLMGHSSCVWTLA  588

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            FSCEG+LLASGSADCTVKLWDVT S K+P+ EENK+ STNRLR LK LPTKSTP+Y LRF
Sbjct  589  FSCEGTLLASGSADCTVKLWDVTASMKVPRMEENKASSTNRLRLLKALPTKSTPVYTLRF  648

Query  135  SRRNLLFAAGAFSK  94
            SRRNLLFAAGA SK
Sbjct  649  SRRNLLFAAGALSK  662


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 62/128 (48%), Gaps = 0/128 (0%)
 Frame = -3

Query  627  DRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILS  448
            +R +   +  GH   V    +    +++ + SSD T+RLW  +    +  + GH   +  
Sbjct  401  ERKRSYTLFQGHAGPVYSATFSPFGDFLLSSSSDSTIRLWSTKLNSNLVCYKGHNYPVWD  460

Query  447  LAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCT  268
            +  SP G Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D T
Sbjct  461  VQFSPVGHYFASCSHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKT  520

Query  267  VKLWDVTT  244
            V+LWDV +
Sbjct  521  VRLWDVQS  528



>ref|XP_008790669.1| PREDICTED: transcription initiation factor TFIID subunit 5 isoform 
X2 [Phoenix dactylifera]
Length=663

 Score =   370 bits (950),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 170/194 (88%), Positives = 183/194 (94%), Gaps = 0/194 (0%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFAS SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS
Sbjct  468  YFASCSHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  527

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVR+FIGHRSM+LSLAMS DGRYMASGDEDG IM+WDL+SGRC++PL+GH+SCVWTLA
Sbjct  528  GECVRVFIGHRSMVLSLAMSLDGRYMASGDEDGTIMMWDLSSGRCVSPLMGHSSCVWTLA  587

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            FSCEG+LLASGSADCTVKLWDVT S K+P+ EENK+ STNRLR LK LPTKSTP+Y LRF
Sbjct  588  FSCEGTLLASGSADCTVKLWDVTASMKVPRMEENKASSTNRLRLLKALPTKSTPVYTLRF  647

Query  135  SRRNLLFAAGAFSK  94
            SRRNLLFAAGA SK
Sbjct  648  SRRNLLFAAGALSK  661


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 62/128 (48%), Gaps = 0/128 (0%)
 Frame = -3

Query  627  DRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILS  448
            +R +   +  GH   V    +    +++ + SSD T+RLW  +    +  + GH   +  
Sbjct  400  ERKRSYTLFQGHAGPVYSATFSPFGDFLLSSSSDSTIRLWSTKLNSNLVCYKGHNYPVWD  459

Query  447  LAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCT  268
            +  SP G Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D T
Sbjct  460  VQFSPVGHYFASCSHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKT  519

Query  267  VKLWDVTT  244
            V+LWDV +
Sbjct  520  VRLWDVQS  527



>gb|KHG15465.1| Transcription initiation factor TFIID subunit 5 [Gossypium arboreum]
Length=669

 Score =   369 bits (948),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 171/195 (88%), Positives = 182/195 (93%), Gaps = 0/195 (0%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS
Sbjct  474  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  533

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVRIFIGHRSMILSLAMSPDGRYMASGDEDG IM WDL+SGRCITPL+GH SCVWTL 
Sbjct  534  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGMIMTWDLSSGRCITPLMGHTSCVWTLG  593

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            FSCEGSLLASGSADCT+KLWDVTTSTK+P++EE    + NRLRSLKTL TKST +Y+L+F
Sbjct  594  FSCEGSLLASGSADCTIKLWDVTTSTKVPRNEEKSGTNPNRLRSLKTLATKSTSVYSLQF  653

Query  135  SRRNLLFAAGAFSKS  91
            SRRNLLFAAG  SK+
Sbjct  654  SRRNLLFAAGVLSKN  668


 Score = 62.0 bits (149),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = -3

Query  606  IMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDG  427
            +  GH + V    +    ++I + S D T+RLW  +    +  + GH   +  +  SP G
Sbjct  413  LFEGHSAPVYSATFSPLGDFILSSSVDTTIRLWSTKLNANLVCYKGHNYPVWDVQFSPVG  472

Query  426  RYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVT  247
             Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D TV+LWDV 
Sbjct  473  HYFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQ  532

Query  246  T  244
            +
Sbjct  533  S  533



>ref|XP_006450297.1| hypothetical protein CICLE_v100076131mg, partial [Citrus clementina]
 gb|ESR63537.1| hypothetical protein CICLE_v100076131mg, partial [Citrus clementina]
Length=611

 Score =   367 bits (943),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 175/196 (89%), Positives = 188/196 (96%), Gaps = 2/196 (1%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFAS+SHDRTARIWSMDRIQPLRIMAGHLSDVDCV+WH NCNYIATGSSDKTVRLWDV S
Sbjct  418  YFASSSHDRTARIWSMDRIQPLRIMAGHLSDVDCVRWHINCNYIATGSSDKTVRLWDVSS  477

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVRIFIGHRSMILSLAMSPDGRYMASGDEDG IM+WDLASGRC+TPL+GH SCVWTLA
Sbjct  478  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGTIMMWDLASGRCVTPLMGHTSCVWTLA  537

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            +SCEGSLLASGSADCTVKLWDVTTSTK+ K+EE KSG TNRLRSLKTLPTKSTP+Y+L+F
Sbjct  538  YSCEGSLLASGSADCTVKLWDVTTSTKVLKTEE-KSG-TNRLRSLKTLPTKSTPVYSLQF  595

Query  135  SRRNLLFAAGAFSKSA  88
            SRRNLLFAAGA SK++
Sbjct  596  SRRNLLFAAGALSKTS  611


 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 34/127 (27%), Positives = 62/127 (49%), Gaps = 0/127 (0%)
 Frame = -3

Query  624  RIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSL  445
            R +   +  GH   V    +    ++I + S+D T+RLW  +    +  + GH   +  +
Sbjct  351  RKRSYTLYQGHSGPVYSASFSPLGDFILSSSADTTIRLWSTKLNANLVCYKGHNYPVWDV  410

Query  444  AMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTV  265
              +P G Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D TV
Sbjct  411  QFNPQGHYFASSSHDRTARIWSMDRIQPLRIMAGHLSDVDCVRWHINCNYIATGSSDKTV  470

Query  264  KLWDVTT  244
            +LWDV++
Sbjct  471  RLWDVSS  477



>ref|XP_006483465.1| PREDICTED: transcription initiation factor TFIID subunit 5-like 
isoform X2 [Citrus sinensis]
 gb|KDO67473.1| hypothetical protein CISIN_1g005277mg [Citrus sinensis]
Length=670

 Score =   369 bits (946),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 175/196 (89%), Positives = 188/196 (96%), Gaps = 2/196 (1%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFAS+SHDRTARIWSMDRIQPLRIMAGHLSDVDCV+WH NCNYIATGSSDKTVRLWDV S
Sbjct  477  YFASSSHDRTARIWSMDRIQPLRIMAGHLSDVDCVRWHINCNYIATGSSDKTVRLWDVSS  536

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVRIFIGHRSMILSLAMSPDGRYMASGDEDG IM+WDLASGRC+TPL+GH SCVWTLA
Sbjct  537  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGTIMMWDLASGRCVTPLMGHTSCVWTLA  596

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            +SCEGSLLASGSADCTVKLWDVTTSTK+ K+EE KSG TNRLRSLKTLPTKSTP+Y+L+F
Sbjct  597  YSCEGSLLASGSADCTVKLWDVTTSTKVLKTEE-KSG-TNRLRSLKTLPTKSTPVYSLQF  654

Query  135  SRRNLLFAAGAFSKSA  88
            SRRNLLFAAGA SK++
Sbjct  655  SRRNLLFAAGALSKTS  670


 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 34/127 (27%), Positives = 62/127 (49%), Gaps = 0/127 (0%)
 Frame = -3

Query  624  RIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSL  445
            R +   +  GH   V    +    ++I + S+D T+RLW  +    +  + GH   +  +
Sbjct  410  RKRSYTLYQGHSGPVYSASFSPLGDFILSSSADTTIRLWSTKLNANLVCYKGHNYPVWDV  469

Query  444  AMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTV  265
              +P G Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D TV
Sbjct  470  QFNPQGHYFASSSHDRTARIWSMDRIQPLRIMAGHLSDVDCVRWHINCNYIATGSSDKTV  529

Query  264  KLWDVTT  244
            +LWDV++
Sbjct  530  RLWDVSS  536



>ref|XP_006483464.1| PREDICTED: transcription initiation factor TFIID subunit 5-like 
isoform X1 [Citrus sinensis]
Length=698

 Score =   369 bits (947),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 175/196 (89%), Positives = 188/196 (96%), Gaps = 2/196 (1%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFAS+SHDRTARIWSMDRIQPLRIMAGHLSDVDCV+WH NCNYIATGSSDKTVRLWDV S
Sbjct  505  YFASSSHDRTARIWSMDRIQPLRIMAGHLSDVDCVRWHINCNYIATGSSDKTVRLWDVSS  564

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVRIFIGHRSMILSLAMSPDGRYMASGDEDG IM+WDLASGRC+TPL+GH SCVWTLA
Sbjct  565  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGTIMMWDLASGRCVTPLMGHTSCVWTLA  624

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            +SCEGSLLASGSADCTVKLWDVTTSTK+ K+EE KSG TNRLRSLKTLPTKSTP+Y+L+F
Sbjct  625  YSCEGSLLASGSADCTVKLWDVTTSTKVLKTEE-KSG-TNRLRSLKTLPTKSTPVYSLQF  682

Query  135  SRRNLLFAAGAFSKSA  88
            SRRNLLFAAGA SK++
Sbjct  683  SRRNLLFAAGALSKTS  698


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 34/127 (27%), Positives = 62/127 (49%), Gaps = 0/127 (0%)
 Frame = -3

Query  624  RIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSL  445
            R +   +  GH   V    +    ++I + S+D T+RLW  +    +  + GH   +  +
Sbjct  438  RKRSYTLYQGHSGPVYSASFSPLGDFILSSSADTTIRLWSTKLNANLVCYKGHNYPVWDV  497

Query  444  AMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTV  265
              +P G Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D TV
Sbjct  498  QFNPQGHYFASSSHDRTARIWSMDRIQPLRIMAGHLSDVDCVRWHINCNYIATGSSDKTV  557

Query  264  KLWDVTT  244
            +LWDV++
Sbjct  558  RLWDVSS  564



>gb|KHN07025.1| Transcription initiation factor TFIID subunit 5 [Glycine soja]
Length=663

 Score =   367 bits (943),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 170/196 (87%), Positives = 185/196 (94%), Gaps = 1/196 (1%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFAS+SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS
Sbjct  469  YFASSSHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  528

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVR+F+GHR MILSLAMSPDGRYMASGDEDG IM+WDL+SGRC+TPL+GH SCVW+LA
Sbjct  529  GECVRVFVGHRGMILSLAMSPDGRYMASGDEDGTIMMWDLSSGRCLTPLIGHTSCVWSLA  588

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            FS EGS++ASGSADCTVKLWDV TSTK+ ++EE K GS NRLRSLKTLPTKSTP+Y+LRF
Sbjct  589  FSSEGSVIASGSADCTVKLWDVNTSTKVSRAEE-KGGSANRLRSLKTLPTKSTPVYSLRF  647

Query  135  SRRNLLFAAGAFSKSA  88
            SRRNLLFAAGA SKS 
Sbjct  648  SRRNLLFAAGALSKSG  663


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = -3

Query  606  IMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDG  427
            +  GH   V    +    ++I + S+D T+RLW  +    +  + GH   +  +  SP G
Sbjct  408  LFQGHSGPVYAASFSPVGDFILSSSADSTIRLWSTKLNANLVCYKGHNYPVWDVQFSPVG  467

Query  426  RYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVT  247
             Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D TV+LWDV 
Sbjct  468  HYFASSSHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQ  527

Query  246  T  244
            +
Sbjct  528  S  528



>ref|XP_003526182.1| PREDICTED: transcription initiation factor TFIID subunit 5-like 
[Glycine max]
Length=663

 Score =   367 bits (943),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 170/196 (87%), Positives = 185/196 (94%), Gaps = 1/196 (1%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFAS+SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS
Sbjct  469  YFASSSHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  528

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVR+F+GHR MILSLAMSPDGRYMASGDEDG IM+WDL+SGRC+TPL+GH SCVW+LA
Sbjct  529  GECVRVFVGHRGMILSLAMSPDGRYMASGDEDGTIMMWDLSSGRCLTPLIGHTSCVWSLA  588

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            FS EGS++ASGSADCTVKLWDV TSTK+ ++EE K GS NRLRSLKTLPTKSTP+Y+LRF
Sbjct  589  FSSEGSVIASGSADCTVKLWDVNTSTKVSRAEE-KGGSANRLRSLKTLPTKSTPVYSLRF  647

Query  135  SRRNLLFAAGAFSKSA  88
            SRRNLLFAAGA SKS 
Sbjct  648  SRRNLLFAAGALSKSG  663


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = -3

Query  606  IMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDG  427
            +  GH   V    +    ++I + S+D T+RLW  +    +  + GH   +  +  SP G
Sbjct  408  LFQGHSGPVYAASFSPVGDFILSSSADSTIRLWSTKLNANLVCYKGHNYPVWDVQFSPVG  467

Query  426  RYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVT  247
             Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D TV+LWDV 
Sbjct  468  HYFASSSHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQ  527

Query  246  T  244
            +
Sbjct  528  S  528



>gb|EPS72043.1| hypothetical protein M569_02713, partial [Genlisea aurea]
Length=667

 Score =   364 bits (934),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 168/193 (87%), Positives = 182/193 (94%), Gaps = 1/193 (1%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFASASHDRTAR+WSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS
Sbjct  474  YFASASHDRTARVWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  533

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVRIFIGHRSMIL LAMSPDGRYMASGDEDG +M+WDLA+GRCI+PLVGH SC+W+LA
Sbjct  534  GECVRIFIGHRSMILCLAMSPDGRYMASGDEDGTVMMWDLATGRCISPLVGHNSCIWSLA  593

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            FSCEGSLLASGSADCTVK+WD  TS+K+PKS+E K+GS  RLRSLKTLPTKSTP+Y L+F
Sbjct  594  FSCEGSLLASGSADCTVKIWDAATSSKVPKSDE-KTGSGTRLRSLKTLPTKSTPVYTLQF  652

Query  135  SRRNLLFAAGAFS  97
            SRRNLLF AGA S
Sbjct  653  SRRNLLFGAGALS  665


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/121 (30%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = -3

Query  606  IMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDG  427
            +  GH   +    +    ++I + SSD TVRLW  +    +  + GH   +  +  SP G
Sbjct  413  LFRGHSGPIHSATFSPYGDFILSSSSDSTVRLWSTKLNANLVCYKGHNYPVWDVQFSPVG  472

Query  426  RYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVT  247
             Y AS   D    VW +   + +  + GH S V  + +    + +A+GS+D TV+LWDV 
Sbjct  473  HYFASASHDRTARVWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQ  532

Query  246  T  244
            +
Sbjct  533  S  533



>ref|XP_010541564.1| PREDICTED: transcription initiation factor TFIID subunit 5 [Tarenaya 
hassleriana]
 ref|XP_010541565.1| PREDICTED: transcription initiation factor TFIID subunit 5 [Tarenaya 
hassleriana]
Length=678

 Score =   364 bits (935),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 170/194 (88%), Positives = 183/194 (94%), Gaps = 1/194 (1%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFAS SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQ+
Sbjct  483  YFASCSHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQT  542

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVRIFIGHRSM+LSLAMSPDGRYMASGDEDG IM+WDL++ RCITPL+GH SCVW+L 
Sbjct  543  GECVRIFIGHRSMVLSLAMSPDGRYMASGDEDGTIMMWDLSTARCITPLMGHNSCVWSLD  602

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            FSCEGSLLASGSADCTVKLWD+T+STKM K+EE KSG+ NRLRSLKT PTKSTP+ +LRF
Sbjct  603  FSCEGSLLASGSADCTVKLWDITSSTKMTKAEE-KSGNPNRLRSLKTFPTKSTPVQSLRF  661

Query  135  SRRNLLFAAGAFSK  94
            SRRNLLFAAGA SK
Sbjct  662  SRRNLLFAAGALSK  675


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 61/121 (50%), Gaps = 0/121 (0%)
 Frame = -3

Query  606  IMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDG  427
            +  GH   V    ++ + +++ + S+D T+RLW  +    +  + GH   +  +  SP G
Sbjct  422  LFLGHSGPVYSATFNPSGDFVLSSSADTTIRLWSTKLNANLVCYKGHNYPVWDVQFSPLG  481

Query  426  RYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVT  247
             Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D TV+LWDV 
Sbjct  482  HYFASCSHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQ  541

Query  246  T  244
            T
Sbjct  542  T  542



>ref|XP_006601207.1| PREDICTED: transcription initiation factor TFIID subunit 5-like 
isoform X2 [Glycine max]
Length=658

 Score =   363 bits (933),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/196 (85%), Positives = 183/196 (93%), Gaps = 0/196 (0%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFAS SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWH NCNYIATGSSDKTVRLWDVQS
Sbjct  463  YFASCSHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHVNCNYIATGSSDKTVRLWDVQS  522

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVR+FIGHRSMILSLAMSPDGRYMASGDEDG IM+WDL+SG C+TPLVGH SCVW+LA
Sbjct  523  GECVRVFIGHRSMILSLAMSPDGRYMASGDEDGTIMMWDLSSGCCVTPLVGHTSCVWSLA  582

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            FSCEGSLLASGSADCTVK WDVTT  K+P++EEN+SG+TNRLRSLK+LPTKS  +Y+L+F
Sbjct  583  FSCEGSLLASGSADCTVKFWDVTTGIKVPRNEENRSGNTNRLRSLKSLPTKSASVYSLQF  642

Query  135  SRRNLLFAAGAFSKSA  88
             RRNLLFAAGA +K+ 
Sbjct  643  CRRNLLFAAGAIAKTG  658


 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 36/121 (30%), Positives = 60/121 (50%), Gaps = 0/121 (0%)
 Frame = -3

Query  606  IMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDG  427
            +  GH   V    +    ++I + S+DKT+RLW  +    +  + GH   I  +  SP G
Sbjct  402  LFQGHSGPVYAATFSPAGDFILSSSADKTIRLWSTKLNANLVCYKGHNYPIWDVQFSPAG  461

Query  426  RYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVT  247
             Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D TV+LWDV 
Sbjct  462  HYFASCSHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHVNCNYIATGSSDKTVRLWDVQ  521

Query  246  T  244
            +
Sbjct  522  S  522



>ref|XP_007136950.1| hypothetical protein PHAVU_009G087600g [Phaseolus vulgaris]
 gb|ESW08944.1| hypothetical protein PHAVU_009G087600g [Phaseolus vulgaris]
Length=672

 Score =   363 bits (933),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 169/196 (86%), Positives = 185/196 (94%), Gaps = 1/196 (1%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFAS+SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS
Sbjct  478  YFASSSHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  537

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVR+F+GHR MILSLAMSPDGRYMASGDEDG IM+WDL+SGR +TPL+GH SCVW+LA
Sbjct  538  GECVRVFVGHRGMILSLAMSPDGRYMASGDEDGTIMMWDLSSGRSLTPLIGHTSCVWSLA  597

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            FS EGS+LASGSADCTVKLWDV TSTK+ ++EE KSG+ NRLRSLKTLPTKSTP+Y+LRF
Sbjct  598  FSSEGSVLASGSADCTVKLWDVNTSTKVSRAEE-KSGNANRLRSLKTLPTKSTPVYSLRF  656

Query  135  SRRNLLFAAGAFSKSA  88
            SRRNLLFAAGA +KS 
Sbjct  657  SRRNLLFAAGALAKSG  672


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = -3

Query  606  IMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDG  427
            +  GH   V    +    ++I + S+D T+RLW  +    +  + GH   +  +  SP G
Sbjct  417  LFQGHSGPVYAASFSPVGDFILSSSADSTIRLWSTKLNANLVCYKGHNYPVWDVQFSPVG  476

Query  426  RYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVT  247
             Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D TV+LWDV 
Sbjct  477  HYFASSSHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQ  536

Query  246  T  244
            +
Sbjct  537  S  537



>gb|AES73552.2| TBP-associated factor 5 [Medicago truncatula]
Length=669

 Score =   363 bits (933),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 167/196 (85%), Positives = 185/196 (94%), Gaps = 1/196 (1%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFAS+SHDRTAR+WSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS
Sbjct  475  YFASSSHDRTARVWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  534

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVR+F+GHR MILSL+MSPDGRYMASGDEDG IM+WDL+SGRC+TPLVGH SCVW+LA
Sbjct  535  GECVRVFVGHRGMILSLSMSPDGRYMASGDEDGTIMMWDLSSGRCVTPLVGHTSCVWSLA  594

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            FS EGS+LASGSADCTVKLWDV TSTK+ ++EE K+G+ NRLRSLKTLPTKSTP+  LRF
Sbjct  595  FSSEGSILASGSADCTVKLWDVNTSTKVSRTEE-KNGNANRLRSLKTLPTKSTPVNTLRF  653

Query  135  SRRNLLFAAGAFSKSA  88
            SRRNLLFAAGA +K+A
Sbjct  654  SRRNLLFAAGALAKNA  669


 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 35/121 (29%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = -3

Query  606  IMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDG  427
            +  GH   V    +    ++I + S+D T+RLW  +    +  + GH   +  +  SP G
Sbjct  414  LFQGHSGPVYAASFCPVGDFILSSSADSTIRLWSTKLNANLVCYKGHNYPVWDVQFSPMG  473

Query  426  RYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVT  247
             Y AS   D    VW +   + +  + GH S V  + +    + +A+GS+D TV+LWDV 
Sbjct  474  HYFASSSHDRTARVWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQ  533

Query  246  T  244
            +
Sbjct  534  S  534



>ref|XP_011082979.1| PREDICTED: transcription initiation factor TFIID subunit 5 [Sesamum 
indicum]
Length=671

 Score =   363 bits (931),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 165/196 (84%), Positives = 183/196 (93%), Gaps = 0/196 (0%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFASASHDRTARIWS+DR+QPLR+MAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS
Sbjct  476  YFASASHDRTARIWSVDRVQPLRVMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  535

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVRIFIGHRSMIL LAMSPDGRYMASGDEDG IM+WDLA+GRC++PLVGH+SC+W+LA
Sbjct  536  GECVRIFIGHRSMILCLAMSPDGRYMASGDEDGTIMMWDLATGRCVSPLVGHSSCIWSLA  595

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            FSCEGSLL        VKLWDVTTS+K+PK+EENKSGS +RLRSLKTLPTKSTP+YAL+F
Sbjct  596  FSCEGSLLXXXXXXXXVKLWDVTTSSKVPKTEENKSGSASRLRSLKTLPTKSTPVYALQF  655

Query  135  SRRNLLFAAGAFSKSA  88
            SRRNLLFAAGA +K +
Sbjct  656  SRRNLLFAAGALTKQS  671


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = -3

Query  606  IMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDG  427
            +  GH   V    +    +++ + SSD T+RLW  +    +  + GH   +  +  SP G
Sbjct  415  LFRGHAGPVHSATFSPFGDFLLSSSSDSTIRLWSTKLNANLVCYKGHNYPVWDVQFSPVG  474

Query  426  RYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVT  247
             Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D TV+LWDV 
Sbjct  475  HYFASASHDRTARIWSVDRVQPLRVMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQ  534

Query  246  T  244
            +
Sbjct  535  S  535



>ref|XP_006857198.1| hypothetical protein AMTR_s00065p00194240 [Amborella trichopoda]
 gb|ERN18665.1| hypothetical protein AMTR_s00065p00194240 [Amborella trichopoda]
Length=668

 Score =   362 bits (929),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 168/200 (84%), Positives = 183/200 (92%), Gaps = 1/200 (1%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFAS+SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWH NCNYIATGSSDKTVRLWDVQ+
Sbjct  469  YFASSSHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHVNCNYIATGSSDKTVRLWDVQT  528

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVRIF+GHR MILS+AMSPDGRYMASGDEDG IM+WDL+SG+C+TPL GH SCVWT+A
Sbjct  529  GECVRIFLGHRGMILSIAMSPDGRYMASGDEDGMIMMWDLSSGKCVTPLTGHTSCVWTVA  588

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            FSCEGSLLASGSADCTVKLWDV  +TK P++EE K  +TNRLR LKTLPTKSTP+YAL+F
Sbjct  589  FSCEGSLLASGSADCTVKLWDVNANTKGPRAEE-KVTNTNRLRFLKTLPTKSTPVYALQF  647

Query  135  SRRNLLFAAGAFSKSA*YYN  76
            SRRNLLFAAGA SK    YN
Sbjct  648  SRRNLLFAAGALSKGLSSYN  667


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/121 (30%), Positives = 60/121 (50%), Gaps = 0/121 (0%)
 Frame = -3

Query  606  IMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDG  427
            ++ GH   V    +    ++I + S+D T+RLW  +    +  + GH   I  +  SP G
Sbjct  408  LLQGHSGPVYSTTFCPLGDFILSSSADSTIRLWSTKLNANLVCYKGHNYPIWDVQFSPVG  467

Query  426  RYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVT  247
             Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D TV+LWDV 
Sbjct  468  HYFASSSHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHVNCNYIATGSSDKTVRLWDVQ  527

Query  246  T  244
            T
Sbjct  528  T  528



>ref|XP_003603301.1| Transcription initiation factor TFIID subunit [Medicago truncatula]
Length=715

 Score =   363 bits (932),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 167/196 (85%), Positives = 185/196 (94%), Gaps = 1/196 (1%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFAS+SHDRTAR+WSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS
Sbjct  521  YFASSSHDRTARVWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  580

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVR+F+GHR MILSL+MSPDGRYMASGDEDG IM+WDL+SGRC+TPLVGH SCVW+LA
Sbjct  581  GECVRVFVGHRGMILSLSMSPDGRYMASGDEDGTIMMWDLSSGRCVTPLVGHTSCVWSLA  640

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            FS EGS+LASGSADCTVKLWDV TSTK+ ++EE K+G+ NRLRSLKTLPTKSTP+  LRF
Sbjct  641  FSSEGSILASGSADCTVKLWDVNTSTKVSRTEE-KNGNANRLRSLKTLPTKSTPVNTLRF  699

Query  135  SRRNLLFAAGAFSKSA  88
            SRRNLLFAAGA +K+A
Sbjct  700  SRRNLLFAAGALAKNA  715


 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 40/150 (27%), Positives = 64/150 (43%), Gaps = 29/150 (19%)
 Frame = -3

Query  606  IMAGHLSDVDCVQWHANCNYIATGSSDKTVRLW-------------------DVQSGECV  484
            +  GH   V    +    ++I + S+D T+RLW                   DVQ  E  
Sbjct  431  LFQGHSGPVYAASFCPVGDFILSSSADSTIRLWSTKLNANLVCYKGHNYPVWDVQPREST  490

Query  483  ----RIFIGH---RSMILS---LAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHAS  334
                +I   H   + + +S   +  SP G Y AS   D    VW +   + +  + GH S
Sbjct  491  SVNGKILYAHIFWKVVFISFSWMQFSPMGHYFASSSHDRTARVWSMDRIQPLRIMAGHLS  550

Query  333  CVWTLAFSCEGSLLASGSADCTVKLWDVTT  244
             V  + +    + +A+GS+D TV+LWDV +
Sbjct  551  DVDCVQWHANCNYIATGSSDKTVRLWDVQS  580



>ref|XP_004965721.1| PREDICTED: transcription initiation factor TFIID subunit 5-like 
[Setaria italica]
Length=654

 Score =   361 bits (926),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 163/195 (84%), Positives = 182/195 (93%), Gaps = 0/195 (0%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFASASHDRTARIWSMD+IQPLRIMAGHLSDVDCVQWH NCNYIATGSSDKTVRLWDVQ+
Sbjct  460  YFASASHDRTARIWSMDKIQPLRIMAGHLSDVDCVQWHVNCNYIATGSSDKTVRLWDVQT  519

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GEC+R+FIGHRSM+LSLAMSPDGRYMASGDEDG IM+WDL++GRC++PL+GH SCVWTLA
Sbjct  520  GECIRMFIGHRSMVLSLAMSPDGRYMASGDEDGTIMMWDLSTGRCVSPLLGHGSCVWTLA  579

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            FSCEG++LASGSADCTVKLWDV +STK  K+E+ K GS NRLR LK LPTKSTP+Y+LRF
Sbjct  580  FSCEGAMLASGSADCTVKLWDVASSTKALKTEDTKGGSANRLRLLKALPTKSTPVYSLRF  639

Query  135  SRRNLLFAAGAFSKS  91
            SRRNLLFA+GA S S
Sbjct  640  SRRNLLFASGALSLS  654


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/125 (29%), Positives = 61/125 (49%), Gaps = 0/125 (0%)
 Frame = -3

Query  618  QPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAM  439
            +P  +  GH   V    +    +++ + SSD T+RLW  +    +  + GH   +  +  
Sbjct  395  RPYTLFQGHSGPVYSAAFSPFGDFLLSSSSDSTIRLWSTKLNANLVCYKGHNYPVWDVQF  454

Query  438  SPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKL  259
            SP G Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D TV+L
Sbjct  455  SPVGHYFASASHDRTARIWSMDKIQPLRIMAGHLSDVDCVQWHVNCNYIATGSSDKTVRL  514

Query  258  WDVTT  244
            WDV T
Sbjct  515  WDVQT  519



>dbj|BAJ91235.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=455

 Score =   353 bits (907),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 161/193 (83%), Positives = 180/193 (93%), Gaps = 0/193 (0%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFASASHDRTARIWSMD+IQPLRIMAGHL+DVDCVQWH NCNYIATGSSDKTVRLWDVQ+
Sbjct  262  YFASASHDRTARIWSMDKIQPLRIMAGHLADVDCVQWHVNCNYIATGSSDKTVRLWDVQT  321

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GEC+R+FIGHRSM+LSLAMSPDGRYMASGDEDG IM+WDL++GRC++PL GH SCVW+LA
Sbjct  322  GECIRMFIGHRSMVLSLAMSPDGRYMASGDEDGTIMMWDLSTGRCVSPLAGHNSCVWSLA  381

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            FSCEG+LLASGSADCTVKLWDV +STK  K ++ K+GSTNRLR LK LPTKSTP+Y LRF
Sbjct  382  FSCEGALLASGSADCTVKLWDVASSTKALKMDDTKAGSTNRLRLLKALPTKSTPVYNLRF  441

Query  135  SRRNLLFAAGAFS  97
            SRRNLLFA+GA S
Sbjct  442  SRRNLLFASGALS  454


 Score = 58.9 bits (141),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 61/125 (49%), Gaps = 0/125 (0%)
 Frame = -3

Query  618  QPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAM  439
            +P  +  GH   V    +    +++ + SSD T+RLW  +    +  + GH   +  +  
Sbjct  197  KPYTLFQGHSGPVYSAAFSPFGDFLLSSSSDSTIRLWSTKLNANLVCYKGHNYPVWDVQF  256

Query  438  SPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKL  259
            SP G Y AS   D    +W +   + +  + GH + V  + +    + +A+GS+D TV+L
Sbjct  257  SPVGHYFASASHDRTARIWSMDKIQPLRIMAGHLADVDCVQWHVNCNYIATGSSDKTVRL  316

Query  258  WDVTT  244
            WDV T
Sbjct  317  WDVQT  321



>ref|XP_010048886.1| PREDICTED: transcription initiation factor TFIID subunit 5 isoform 
X3 [Eucalyptus grandis]
Length=680

 Score =   360 bits (925),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 167/194 (86%), Positives = 183/194 (94%), Gaps = 1/194 (1%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFAS+SHDRTAR+WS+DRIQPLRIMAGHLSDVDCVQWH NCNYIATGSSDKTVRLWDV S
Sbjct  487  YFASSSHDRTARLWSVDRIQPLRIMAGHLSDVDCVQWHPNCNYIATGSSDKTVRLWDVAS  546

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVRIFIGHRSMILSLAMSPDGRYMASGDEDG IM+WDL+SGRCI PL+GH SCVWTLA
Sbjct  547  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGTIMMWDLSSGRCIMPLMGHTSCVWTLA  606

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            +SCEG+LLASGSADCT+KLWD+ TS K+P++EE KSGST+RLR LKTLPTKSTP+Y L+F
Sbjct  607  YSCEGTLLASGSADCTLKLWDIATSAKLPRTEE-KSGSTSRLRLLKTLPTKSTPVYTLQF  665

Query  135  SRRNLLFAAGAFSK  94
            SRRNLLFAAGA SK
Sbjct  666  SRRNLLFAAGALSK  679


 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = -3

Query  606  IMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDG  427
            +  GH   +    +    ++I T S+D T+RLW  +    +  + GH   +  +  SP G
Sbjct  426  LFQGHSGPIHSATFSPLGDFILTSSADSTIRLWSTKLNANLVCYKGHNYPVWDVQFSPAG  485

Query  426  RYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVT  247
             Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D TV+LWDV 
Sbjct  486  HYFASSSHDRTARLWSVDRIQPLRIMAGHLSDVDCVQWHPNCNYIATGSSDKTVRLWDVA  545

Query  246  T  244
            +
Sbjct  546  S  546



>ref|XP_010048885.1| PREDICTED: transcription initiation factor TFIID subunit 5 isoform 
X2 [Eucalyptus grandis]
Length=681

 Score =   360 bits (925),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 167/194 (86%), Positives = 183/194 (94%), Gaps = 1/194 (1%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFAS+SHDRTAR+WS+DRIQPLRIMAGHLSDVDCVQWH NCNYIATGSSDKTVRLWDV S
Sbjct  488  YFASSSHDRTARLWSVDRIQPLRIMAGHLSDVDCVQWHPNCNYIATGSSDKTVRLWDVAS  547

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVRIFIGHRSMILSLAMSPDGRYMASGDEDG IM+WDL+SGRCI PL+GH SCVWTLA
Sbjct  548  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGTIMMWDLSSGRCIMPLMGHTSCVWTLA  607

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            +SCEG+LLASGSADCT+KLWD+ TS K+P++EE KSGST+RLR LKTLPTKSTP+Y L+F
Sbjct  608  YSCEGTLLASGSADCTLKLWDIATSAKLPRTEE-KSGSTSRLRLLKTLPTKSTPVYTLQF  666

Query  135  SRRNLLFAAGAFSK  94
            SRRNLLFAAGA SK
Sbjct  667  SRRNLLFAAGALSK  680


 Score = 62.0 bits (149),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = -3

Query  606  IMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDG  427
            +  GH   +    +    ++I T S+D T+RLW  +    +  + GH   +  +  SP G
Sbjct  427  LFQGHSGPIHSATFSPLGDFILTSSADSTIRLWSTKLNANLVCYKGHNYPVWDVQFSPAG  486

Query  426  RYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVT  247
             Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D TV+LWDV 
Sbjct  487  HYFASSSHDRTARLWSVDRIQPLRIMAGHLSDVDCVQWHPNCNYIATGSSDKTVRLWDVA  546

Query  246  T  244
            +
Sbjct  547  S  547



>ref|XP_009111656.1| PREDICTED: transcription initiation factor TFIID subunit 5 [Brassica 
rapa]
Length=668

 Score =   360 bits (924),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 167/196 (85%), Positives = 185/196 (94%), Gaps = 1/196 (1%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFAS SHDRTARIWSMDR+QPLRIMAGHLSDVDCVQWH NCNYIATGSSDKTVRLWDVQ+
Sbjct  473  YFASCSHDRTARIWSMDRVQPLRIMAGHLSDVDCVQWHPNCNYIATGSSDKTVRLWDVQT  532

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVRIFIGHRSM+LSLAMSPDGRYMASGDEDG IM+WDL++ RCITPL+GH SCVW+L+
Sbjct  533  GECVRIFIGHRSMVLSLAMSPDGRYMASGDEDGTIMMWDLSTARCITPLMGHNSCVWSLS  592

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            +S EGSLLASGSADCTVKLWDVT+STK+ K+EE K+G+TNRLRSL+T PTKSTP++ALRF
Sbjct  593  YSGEGSLLASGSADCTVKLWDVTSSTKLTKAEE-KNGNTNRLRSLRTFPTKSTPVHALRF  651

Query  135  SRRNLLFAAGAFSKSA  88
            SRRNLLFAAGA SK A
Sbjct  652  SRRNLLFAAGALSKPA  667


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/121 (29%), Positives = 60/121 (50%), Gaps = 0/121 (0%)
 Frame = -3

Query  606  IMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDG  427
            ++ GH   V    +    +++ + S+D T+RLW  Q    +  + GH   +  +  SP G
Sbjct  412  LLLGHSGPVYSATFSPPGDFVLSSSADTTIRLWSTQLNANLVCYKGHNYPVWDVQFSPFG  471

Query  426  RYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVT  247
             Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D TV+LWDV 
Sbjct  472  HYFASCSHDRTARIWSMDRVQPLRIMAGHLSDVDCVQWHPNCNYIATGSSDKTVRLWDVQ  531

Query  246  T  244
            T
Sbjct  532  T  532



>ref|XP_010048884.1| PREDICTED: transcription initiation factor TFIID subunit 5 isoform 
X1 [Eucalyptus grandis]
Length=682

 Score =   360 bits (925),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 167/194 (86%), Positives = 183/194 (94%), Gaps = 1/194 (1%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFAS+SHDRTAR+WS+DRIQPLRIMAGHLSDVDCVQWH NCNYIATGSSDKTVRLWDV S
Sbjct  489  YFASSSHDRTARLWSVDRIQPLRIMAGHLSDVDCVQWHPNCNYIATGSSDKTVRLWDVAS  548

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVRIFIGHRSMILSLAMSPDGRYMASGDEDG IM+WDL+SGRCI PL+GH SCVWTLA
Sbjct  549  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGTIMMWDLSSGRCIMPLMGHTSCVWTLA  608

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            +SCEG+LLASGSADCT+KLWD+ TS K+P++EE KSGST+RLR LKTLPTKSTP+Y L+F
Sbjct  609  YSCEGTLLASGSADCTLKLWDIATSAKLPRTEE-KSGSTSRLRLLKTLPTKSTPVYTLQF  667

Query  135  SRRNLLFAAGAFSK  94
            SRRNLLFAAGA SK
Sbjct  668  SRRNLLFAAGALSK  681


 Score = 62.0 bits (149),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = -3

Query  606  IMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDG  427
            +  GH   +    +    ++I T S+D T+RLW  +    +  + GH   +  +  SP G
Sbjct  428  LFQGHSGPIHSATFSPLGDFILTSSADSTIRLWSTKLNANLVCYKGHNYPVWDVQFSPAG  487

Query  426  RYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVT  247
             Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D TV+LWDV 
Sbjct  488  HYFASSSHDRTARLWSVDRIQPLRIMAGHLSDVDCVQWHPNCNYIATGSSDKTVRLWDVA  547

Query  246  T  244
            +
Sbjct  548  S  548



>emb|CDY19814.1| BnaA09g04670D [Brassica napus]
Length=668

 Score =   360 bits (924),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 167/196 (85%), Positives = 185/196 (94%), Gaps = 1/196 (1%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFAS SHDRTARIWSMDR+QPLRIMAGHLSDVDCVQWH NCNYIATGSSDKTVRLWDVQ+
Sbjct  473  YFASCSHDRTARIWSMDRVQPLRIMAGHLSDVDCVQWHPNCNYIATGSSDKTVRLWDVQT  532

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVRIFIGHRSM+LSLAMSPDGRYMASGDEDG IM+WDL++ RCITPL+GH SCVW+L+
Sbjct  533  GECVRIFIGHRSMVLSLAMSPDGRYMASGDEDGTIMMWDLSTARCITPLMGHNSCVWSLS  592

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            +S EGSLLASGSADCTVKLWDVT+STK+ K+EE K+G+TNRLRSL+T PTKSTP++ALRF
Sbjct  593  YSGEGSLLASGSADCTVKLWDVTSSTKLTKAEE-KNGNTNRLRSLRTFPTKSTPVHALRF  651

Query  135  SRRNLLFAAGAFSKSA  88
            SRRNLLFAAGA SK A
Sbjct  652  SRRNLLFAAGALSKPA  667


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/121 (29%), Positives = 60/121 (50%), Gaps = 0/121 (0%)
 Frame = -3

Query  606  IMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDG  427
            ++ GH   V    +    +++ + S+D T+RLW  Q    +  + GH   +  +  SP G
Sbjct  412  LLLGHSGPVYSATFSPPGDFVLSSSADTTIRLWSTQLNANLVCYKGHNYPVWDVQFSPFG  471

Query  426  RYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVT  247
             Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D TV+LWDV 
Sbjct  472  HYFASCSHDRTARIWSMDRVQPLRIMAGHLSDVDCVQWHPNCNYIATGSSDKTVRLWDVQ  531

Query  246  T  244
            T
Sbjct  532  T  532



>ref|XP_006656305.1| PREDICTED: transcription initiation factor TFIID subunit 5-like 
[Oryza brachyantha]
Length=654

 Score =   359 bits (922),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 163/193 (84%), Positives = 181/193 (94%), Gaps = 0/193 (0%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFASASHDRTARIWSMD++QPLRIMAGHLSDVDCVQWH NCNYIATGSSDKTVRLWDVQ+
Sbjct  460  YFASASHDRTARIWSMDKVQPLRIMAGHLSDVDCVQWHVNCNYIATGSSDKTVRLWDVQT  519

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GEC+R+FIGHRSM+LSLAMSPDGRYMASGDEDG IM+WDL+SGRC++PLVGH SCVW+LA
Sbjct  520  GECIRMFIGHRSMVLSLAMSPDGRYMASGDEDGTIMMWDLSSGRCVSPLVGHNSCVWSLA  579

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            +SCEG+LLASGSADCTVKLWDV +STK  K+++ K GSTNRLR LK LPTKSTP+Y LRF
Sbjct  580  YSCEGALLASGSADCTVKLWDVASSTKALKTDDAKVGSTNRLRMLKALPTKSTPVYTLRF  639

Query  135  SRRNLLFAAGAFS  97
            SRRNLLFAAGA S
Sbjct  640  SRRNLLFAAGALS  652


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/121 (29%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = -3

Query  606  IMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDG  427
            +  GH   V    +    +++ + SSD T+RLW  +    +  + GH   +  +  SP G
Sbjct  399  LFQGHSGPVYSAAFSPFGDFLLSASSDSTIRLWSTKLNANLVCYKGHNYPVWDVQFSPVG  458

Query  426  RYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVT  247
             Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D TV+LWDV 
Sbjct  459  HYFASASHDRTARIWSMDKVQPLRIMAGHLSDVDCVQWHVNCNYIATGSSDKTVRLWDVQ  518

Query  246  T  244
            T
Sbjct  519  T  519



>ref|NP_001059147.2| Os07g0205200 [Oryza sativa Japonica Group]
 dbj|BAF21061.2| Os07g0205200, partial [Oryza sativa Japonica Group]
Length=296

 Score =   347 bits (891),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 161/193 (83%), Positives = 179/193 (93%), Gaps = 0/193 (0%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFASASHDRTARIWSMD+IQPLRIMAGHLSDVDCVQWH NCNYIATGSSDKTVRLWDVQ+
Sbjct  101  YFASASHDRTARIWSMDKIQPLRIMAGHLSDVDCVQWHVNCNYIATGSSDKTVRLWDVQT  160

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GEC+R+FIGHRSM+LSLAMSPDGRYMASGDEDG IM+WD++SGRC++PLVGH SCVW+LA
Sbjct  161  GECIRMFIGHRSMVLSLAMSPDGRYMASGDEDGTIMMWDISSGRCVSPLVGHNSCVWSLA  220

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            +SCEG+LLASGSADCTVKLWDV +STK  K ++ K GS NRLR LK LPTKSTP+Y L+F
Sbjct  221  YSCEGALLASGSADCTVKLWDVASSTKTLKMDDTKGGSANRLRMLKALPTKSTPVYTLQF  280

Query  135  SRRNLLFAAGAFS  97
            SRRNLLFAAGA S
Sbjct  281  SRRNLLFAAGAPS  293


 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 60/121 (50%), Gaps = 0/121 (0%)
 Frame = -3

Query  606  IMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDG  427
            +  GH   V    +    +++ + S+D T+RLW+ +    +  + GH   +  +  SP G
Sbjct  40   LFQGHSGPVYSAMFSPIGDFLLSSSADSTIRLWNTKLNANLVCYKGHNYPVWDVQFSPVG  99

Query  426  RYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVT  247
             Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D TV+LWDV 
Sbjct  100  HYFASASHDRTARIWSMDKIQPLRIMAGHLSDVDCVQWHVNCNYIATGSSDKTVRLWDVQ  159

Query  246  T  244
            T
Sbjct  160  T  160



>ref|XP_003522395.1| PREDICTED: transcription initiation factor TFIID subunit 5-like 
[Glycine max]
Length=669

 Score =   359 bits (921),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 169/197 (86%), Positives = 184/197 (93%), Gaps = 2/197 (1%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFAS+SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS
Sbjct  474  YFASSSHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  533

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVR+F+GHR MILSLAMSPDGRYMASGDEDG IM+WDL+SGRC+TPL+GH SCVW+LA
Sbjct  534  GECVRVFVGHRVMILSLAMSPDGRYMASGDEDGTIMMWDLSSGRCLTPLIGHTSCVWSLA  593

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTN-RLRSLKTLPTKSTPLYALR  139
            FS EGS++ASGSADCTVKLWDV  STK+ ++EE KSGS N RLRSLKTL TKSTP+Y+LR
Sbjct  594  FSSEGSIIASGSADCTVKLWDVNASTKVSRAEE-KSGSANSRLRSLKTLSTKSTPVYSLR  652

Query  138  FSRRNLLFAAGAFSKSA  88
            FSRRNLLFAAGA SKS 
Sbjct  653  FSRRNLLFAAGALSKSG  669


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = -3

Query  606  IMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDG  427
            +  GH   V    +    ++I + S+D T+RLW  +    +  + GH   +  +  SP G
Sbjct  413  LFQGHSGPVYAASFSPVGDFILSSSADSTIRLWSTKLNANLVCYKGHNYPVWDVQFSPVG  472

Query  426  RYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVT  247
             Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D TV+LWDV 
Sbjct  473  HYFASSSHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQ  532

Query  246  T  244
            +
Sbjct  533  S  533



>ref|XP_009363759.1| PREDICTED: LOW QUALITY PROTEIN: transcription initiation factor 
TFIID subunit 5 [Pyrus x bretschneideri]
Length=675

 Score =   359 bits (922),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 163/195 (84%), Positives = 183/195 (94%), Gaps = 0/195 (0%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFASASHDRTARIWSMDR+QPLR+MAGHLSDVDCVQWH NCNY+ATGSSDKTVRLWDVQ+
Sbjct  480  YFASASHDRTARIWSMDRMQPLRLMAGHLSDVDCVQWHVNCNYVATGSSDKTVRLWDVQT  539

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVRIFIG+RSM+LSLAMSPDG YMASGDEDG IM+WDL+SGRC+T L GH SCVWTL 
Sbjct  540  GECVRIFIGYRSMVLSLAMSPDGHYMASGDEDGAIMMWDLSSGRCVTFLTGHTSCVWTLD  599

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            FS +GSLLASGSADCTVKLWDVT STK+P++EENKSG+T+RLR LKTLPTKSTP+++LRF
Sbjct  600  FSGDGSLLASGSADCTVKLWDVTASTKLPRTEENKSGNTSRLRXLKTLPTKSTPVHSLRF  659

Query  135  SRRNLLFAAGAFSKS  91
            SRRNLLFA+G  SK+
Sbjct  660  SRRNLLFASGVLSKT  674


 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 66/135 (49%), Gaps = 0/135 (0%)
 Frame = -3

Query  648  TARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIG  469
            + ++ S    +P  +  GH   V    ++   ++I + S+D TVRLW  +    +  + G
Sbjct  405  SEQVLSNGXEKPYTLFQGHSGPVYSATFNPLGDFILSSSADSTVRLWSTKLNANLVCYKG  464

Query  468  HRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLA  289
            H   +  +  SP G Y AS   D    +W +   + +  + GH S V  + +    + +A
Sbjct  465  HNYPVWDVRFSPVGHYFASASHDRTARIWSMDRMQPLRLMAGHLSDVDCVQWHVNCNYVA  524

Query  288  SGSADCTVKLWDVTT  244
            +GS+D TV+LWDV T
Sbjct  525  TGSSDKTVRLWDVQT  539



>ref|NP_197897.3| TBP-associated factor 5 [Arabidopsis thaliana]
 sp|Q6S7B0.1|TAF5_ARATH RecName: Full=Transcription initiation factor TFIID subunit 5; 
AltName: Full=TBP-associated factor 5; Short=AtTAF5 [Arabidopsis 
thaliana]
 gb|AAR28022.1| TAF5 [Arabidopsis thaliana]
 gb|AED93406.1| TBP-associated factor 5 [Arabidopsis thaliana]
Length=669

 Score =   359 bits (921),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 167/196 (85%), Positives = 185/196 (94%), Gaps = 1/196 (1%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFAS SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWH NCNYIATGSSDKTVRLWDVQ+
Sbjct  474  YFASCSHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHPNCNYIATGSSDKTVRLWDVQT  533

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVRIFIGHRSM+LSLAMSPDGRYMASGDEDG IM+WDL++ RCITPL+GH SCVW+L+
Sbjct  534  GECVRIFIGHRSMVLSLAMSPDGRYMASGDEDGTIMMWDLSTARCITPLMGHNSCVWSLS  593

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            +S EGSLLASGSADCTVKLWDVT+STK+ K+EE K+G++NRLRSL+T PTKSTP++ALRF
Sbjct  594  YSGEGSLLASGSADCTVKLWDVTSSTKLTKAEE-KNGNSNRLRSLRTFPTKSTPVHALRF  652

Query  135  SRRNLLFAAGAFSKSA  88
            SRRNLLFAAGA SK A
Sbjct  653  SRRNLLFAAGAISKPA  668


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = -3

Query  606  IMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDG  427
            ++ GH   V    +    +++ + S+D T+RLW  +    +  + GH   +     SP G
Sbjct  413  LLLGHSGPVYSATFSPPGDFVLSSSADTTIRLWSTKLNANLVCYKGHNYPVWDAQFSPFG  472

Query  426  RYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVT  247
             Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D TV+LWDV 
Sbjct  473  HYFASCSHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHPNCNYIATGSSDKTVRLWDVQ  532

Query  246  T  244
            T
Sbjct  533  T  533



>gb|EMT24964.1| hypothetical protein F775_02895 [Aegilops tauschii]
Length=473

 Score =   352 bits (904),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 160/193 (83%), Positives = 179/193 (93%), Gaps = 0/193 (0%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFASASHDRTARIWSMD+IQPLRIMAGHL+DVDCVQWH NCNYIATGSSDKTVRLWDVQ+
Sbjct  280  YFASASHDRTARIWSMDKIQPLRIMAGHLADVDCVQWHVNCNYIATGSSDKTVRLWDVQT  339

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GEC+R+FIGHRSM+LSLAMSPDGRYMASGDEDG IM+WDL++G C++PL GH SCVW+LA
Sbjct  340  GECIRMFIGHRSMVLSLAMSPDGRYMASGDEDGTIMMWDLSTGSCVSPLAGHNSCVWSLA  399

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            FSCEG+LLASGSADCTVKLWDV +STK  K ++ K+GSTNRLR LK LPTKSTP+Y LRF
Sbjct  400  FSCEGALLASGSADCTVKLWDVASSTKALKMDDTKAGSTNRLRLLKALPTKSTPVYNLRF  459

Query  135  SRRNLLFAAGAFS  97
            SRRNLLFA+GA S
Sbjct  460  SRRNLLFASGALS  472



>ref|XP_010691970.1| PREDICTED: transcription initiation factor TFIID subunit 5 [Beta 
vulgaris subsp. vulgaris]
Length=678

 Score =   358 bits (920),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 169/194 (87%), Positives = 180/194 (93%), Gaps = 1/194 (1%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFAS SHDRTAR+WSMDRIQPLRIMAGHLSDVDCV+WH NCNYIATGSSDKTVRLWD+Q+
Sbjct  484  YFASCSHDRTARLWSMDRIQPLRIMAGHLSDVDCVRWHVNCNYIATGSSDKTVRLWDIQT  543

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVRIFIGHRSMILSLAMSPDGRYMASGDEDG IM+WDLASGRCITPLVGH SCVWTLA
Sbjct  544  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGAIMMWDLASGRCITPLVGHTSCVWTLA  603

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            FS EGSLLASGSADCTVKLWDV  S KM +SEE K+GS+NRLRSL+TLPTKSTP+Y+L F
Sbjct  604  FSGEGSLLASGSADCTVKLWDVNASAKMSRSEE-KTGSSNRLRSLRTLPTKSTPVYSLTF  662

Query  135  SRRNLLFAAGAFSK  94
            SRRNLLF AG  SK
Sbjct  663  SRRNLLFGAGVLSK  676


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/125 (29%), Positives = 61/125 (49%), Gaps = 0/125 (0%)
 Frame = -3

Query  618  QPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAM  439
            +P  +  GH   V    +    ++I + S+D TVRLW  +    +  + GH   +  +  
Sbjct  419  RPYTLFQGHSGPVYSASFSPLGDFILSSSADSTVRLWSTKLNANLVCYKGHNYPVWDVQF  478

Query  438  SPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKL  259
            SP G Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D TV+L
Sbjct  479  SPYGHYFASCSHDRTARLWSMDRIQPLRIMAGHLSDVDCVRWHVNCNYIATGSSDKTVRL  538

Query  258  WDVTT  244
            WD+ T
Sbjct  539  WDIQT  543



>gb|ACN31367.1| unknown [Zea mays]
Length=294

 Score =   345 bits (886),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 158/187 (84%), Positives = 176/187 (94%), Gaps = 0/187 (0%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFASASHDRTARIWSMD+IQPLRIMAGHLSDVDCVQWH NCNYIATGSSDKTVRLWDVQ+
Sbjct  98   YFASASHDRTARIWSMDKIQPLRIMAGHLSDVDCVQWHVNCNYIATGSSDKTVRLWDVQT  157

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GEC+R+FIGHRSM+LSLAMSPDGRYMASGDEDG IM+WDL++GRC++PL+GH+SCVWTLA
Sbjct  158  GECIRMFIGHRSMVLSLAMSPDGRYMASGDEDGTIMIWDLSTGRCVSPLLGHSSCVWTLA  217

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            FSCEG+LLASGSADCTVKLWDV +STK  K+E+ K  S NRLR LK LPTKSTP+Y+LRF
Sbjct  218  FSCEGALLASGSADCTVKLWDVASSTKTLKTEDTKGSSANRLRLLKALPTKSTPVYSLRF  277

Query  135  SRRNLLF  115
            SRRNLLF
Sbjct  278  SRRNLLF  284


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/121 (29%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = -3

Query  606  IMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDG  427
            +  GH   V    +    +++ + SSD T+RLW  +    +  + GH   +  +  SP G
Sbjct  37   LFQGHSGPVYSAAFSPFGDFLLSSSSDSTIRLWSTKLNANLVCYKGHNYPVWDVQFSPVG  96

Query  426  RYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVT  247
             Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D TV+LWDV 
Sbjct  97   HYFASASHDRTARIWSMDKIQPLRIMAGHLSDVDCVQWHVNCNYIATGSSDKTVRLWDVQ  156

Query  246  T  244
            T
Sbjct  157  T  157



>ref|XP_003549326.1| PREDICTED: transcription initiation factor TFIID subunit 5-like 
isoform X1 [Glycine max]
 gb|KHN37095.1| Transcription initiation factor TFIID subunit 5 [Glycine soja]
Length=657

 Score =   357 bits (917),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 167/196 (85%), Positives = 182/196 (93%), Gaps = 1/196 (1%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFAS SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWH NCNYIATGSSDKTVRLWDVQS
Sbjct  463  YFASCSHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHVNCNYIATGSSDKTVRLWDVQS  522

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVR+FIGHRSMILSLAMSPDGRYMASGDEDG IM+WDL+SG C+TPLVGH SCVW+LA
Sbjct  523  GECVRVFIGHRSMILSLAMSPDGRYMASGDEDGTIMMWDLSSGCCVTPLVGHTSCVWSLA  582

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            FSCEGSLLASGSADCTVK WDVTT  K+P++EE KSG+TNRLRSLK+LPTKS  +Y+L+F
Sbjct  583  FSCEGSLLASGSADCTVKFWDVTTGIKVPRNEE-KSGNTNRLRSLKSLPTKSASVYSLQF  641

Query  135  SRRNLLFAAGAFSKSA  88
             RRNLLFAAGA +K+ 
Sbjct  642  CRRNLLFAAGAIAKTG  657


 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 36/121 (30%), Positives = 60/121 (50%), Gaps = 0/121 (0%)
 Frame = -3

Query  606  IMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDG  427
            +  GH   V    +    ++I + S+DKT+RLW  +    +  + GH   I  +  SP G
Sbjct  402  LFQGHSGPVYAATFSPAGDFILSSSADKTIRLWSTKLNANLVCYKGHNYPIWDVQFSPAG  461

Query  426  RYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVT  247
             Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D TV+LWDV 
Sbjct  462  HYFASCSHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHVNCNYIATGSSDKTVRLWDVQ  521

Query  246  T  244
            +
Sbjct  522  S  522



>emb|CDX87098.1| BnaC09g04130D [Brassica napus]
Length=668

 Score =   358 bits (918),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 166/196 (85%), Positives = 185/196 (94%), Gaps = 1/196 (1%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFAS SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWH NCNYIATGSSDKTVRLWDVQ+
Sbjct  473  YFASCSHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHPNCNYIATGSSDKTVRLWDVQT  532

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVRIFIGHRSM+LSLAMSPDGRYMASGDEDG IM+WDL++ RCITPL+GH SCVW+L+
Sbjct  533  GECVRIFIGHRSMVLSLAMSPDGRYMASGDEDGTIMMWDLSTARCITPLMGHNSCVWSLS  592

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            +S EGSLLASGSADCTVKLWDVT+STK+ K+EE K+G++NRLRSL+T PTKSTP++ALRF
Sbjct  593  YSGEGSLLASGSADCTVKLWDVTSSTKLTKAEE-KNGNSNRLRSLRTFPTKSTPVHALRF  651

Query  135  SRRNLLFAAGAFSKSA  88
            SRRNLLFAAGA +K A
Sbjct  652  SRRNLLFAAGALAKPA  667


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 35/121 (29%), Positives = 60/121 (50%), Gaps = 0/121 (0%)
 Frame = -3

Query  606  IMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDG  427
            ++ GH   V    +    ++I + S+D T+RLW  +    +  + GH   +  +  SP G
Sbjct  412  LLLGHSGPVYSATFSPPGDFILSSSADTTIRLWSTKLNANLVCYKGHNYPVWDVQFSPFG  471

Query  426  RYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVT  247
             Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D TV+LWDV 
Sbjct  472  HYFASCSHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHPNCNYIATGSSDKTVRLWDVQ  531

Query  246  T  244
            T
Sbjct  532  T  532



>ref|XP_007161096.1| hypothetical protein PHAVU_001G042300g [Phaseolus vulgaris]
 gb|ESW33090.1| hypothetical protein PHAVU_001G042300g [Phaseolus vulgaris]
Length=658

 Score =   357 bits (917),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 168/196 (86%), Positives = 182/196 (93%), Gaps = 1/196 (1%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFAS SHDRTARIWSMDRI+PLRIMAGHLSDVDCVQWH NCNYIATGSSDKTVRLWDVQS
Sbjct  463  YFASCSHDRTARIWSMDRIKPLRIMAGHLSDVDCVQWHPNCNYIATGSSDKTVRLWDVQS  522

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVR+FIGHRSMILSLAMSPDGRYMASGDEDG IM WDL+SG C+TPLV H SCVW+LA
Sbjct  523  GECVRVFIGHRSMILSLAMSPDGRYMASGDEDGTIMTWDLSSGCCVTPLVSHTSCVWSLA  582

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            FSCEGSLLASGSADCTVKLWDVTT  K+P++EE KSG+TNRLRSLK+LPTKS  +Y+L+F
Sbjct  583  FSCEGSLLASGSADCTVKLWDVTTGIKVPRNEE-KSGNTNRLRSLKSLPTKSASVYSLQF  641

Query  135  SRRNLLFAAGAFSKSA  88
            SRRNLLFAAGA +KS 
Sbjct  642  SRRNLLFAAGALAKSG  657


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/121 (29%), Positives = 60/121 (50%), Gaps = 0/121 (0%)
 Frame = -3

Query  606  IMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDG  427
            +  GH   V    +    +++ + S+DKT+RLW  +    +  + GH   I  +  SP G
Sbjct  402  LFQGHSGPVYAATFSEAGDFLLSSSADKTIRLWSTKLNANLVCYKGHNYPIWDVQFSPAG  461

Query  426  RYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVT  247
             Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D TV+LWDV 
Sbjct  462  HYFASCSHDRTARIWSMDRIKPLRIMAGHLSDVDCVQWHPNCNYIATGSSDKTVRLWDVQ  521

Query  246  T  244
            +
Sbjct  522  S  522



>ref|XP_006394764.1| hypothetical protein EUTSA_v10003767mg [Eutrema salsugineum]
 gb|ESQ32050.1| hypothetical protein EUTSA_v10003767mg [Eutrema salsugineum]
Length=669

 Score =   358 bits (918),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 166/196 (85%), Positives = 185/196 (94%), Gaps = 1/196 (1%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFAS SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWH NCNYIATGSSDKTVRLWDVQ+
Sbjct  474  YFASCSHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHPNCNYIATGSSDKTVRLWDVQT  533

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVRIFIGHRSM+LSLAMSPDG+YMASGDEDG IM+WDL++ RCITPL+GH SCVW+L+
Sbjct  534  GECVRIFIGHRSMVLSLAMSPDGKYMASGDEDGTIMMWDLSTARCITPLMGHNSCVWSLS  593

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            +S EGSLLASGSADCTVKLWDVT+STK+ K+EE K+G++NRLRSL+T PTKSTP++ALRF
Sbjct  594  YSGEGSLLASGSADCTVKLWDVTSSTKLTKAEE-KNGNSNRLRSLRTFPTKSTPVHALRF  652

Query  135  SRRNLLFAAGAFSKSA  88
            SRRNLLFAAGA SK A
Sbjct  653  SRRNLLFAAGALSKPA  668


 Score = 62.0 bits (149),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 60/121 (50%), Gaps = 0/121 (0%)
 Frame = -3

Query  606  IMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDG  427
            ++ GH   V    +    +++ + S+D T+RLW  +    +  + GH   +  +  SP G
Sbjct  413  LLLGHSGPVYSATFSPPGDFVLSSSADTTIRLWSTKLNANLVCYKGHNYPVWDVQFSPFG  472

Query  426  RYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVT  247
             Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D TV+LWDV 
Sbjct  473  HYFASCSHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHPNCNYIATGSSDKTVRLWDVQ  532

Query  246  T  244
            T
Sbjct  533  T  533



>gb|KCW81292.1| hypothetical protein EUGRSUZ_C02661 [Eucalyptus grandis]
Length=765

 Score =   360 bits (924),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 167/194 (86%), Positives = 183/194 (94%), Gaps = 1/194 (1%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFAS+SHDRTAR+WS+DRIQPLRIMAGHLSDVDCVQWH NCNYIATGSSDKTVRLWDV S
Sbjct  572  YFASSSHDRTARLWSVDRIQPLRIMAGHLSDVDCVQWHPNCNYIATGSSDKTVRLWDVAS  631

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVRIFIGHRSMILSLAMSPDGRYMASGDEDG IM+WDL+SGRCI PL+GH SCVWTLA
Sbjct  632  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGTIMMWDLSSGRCIMPLMGHTSCVWTLA  691

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            +SCEG+LLASGSADCT+KLWD+ TS K+P++EE KSGST+RLR LKTLPTKSTP+Y L+F
Sbjct  692  YSCEGTLLASGSADCTLKLWDIATSAKLPRTEE-KSGSTSRLRLLKTLPTKSTPVYTLQF  750

Query  135  SRRNLLFAAGAFSK  94
            SRRNLLFAAGA SK
Sbjct  751  SRRNLLFAAGALSK  764


 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = -3

Query  606  IMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDG  427
            +  GH   +    +    ++I T S+D T+RLW  +    +  + GH   +  +  SP G
Sbjct  511  LFQGHSGPIHSATFSPLGDFILTSSADSTIRLWSTKLNANLVCYKGHNYPVWDVQFSPAG  570

Query  426  RYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVT  247
             Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D TV+LWDV 
Sbjct  571  HYFASSSHDRTARLWSVDRIQPLRIMAGHLSDVDCVQWHPNCNYIATGSSDKTVRLWDVA  630

Query  246  T  244
            +
Sbjct  631  S  631



>ref|XP_009411258.1| PREDICTED: transcription initiation factor TFIID subunit 5 [Musa 
acuminata subsp. malaccensis]
Length=658

 Score =   356 bits (914),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 167/194 (86%), Positives = 180/194 (93%), Gaps = 0/194 (0%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFAS+SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNY+ATGSSDKTVRLWDVQS
Sbjct  464  YFASSSHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYVATGSSDKTVRLWDVQS  523

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVRIFIGHRS +LSLAMSPDGR+MASGDEDG IM+WDL+SGRCI+PL+GH+SCVWTLA
Sbjct  524  GECVRIFIGHRSTVLSLAMSPDGRFMASGDEDGTIMMWDLSSGRCISPLMGHSSCVWTLA  583

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            FS EGSLLASG+ADCTVKLWDVTTS K  K EE+K  S NRLR LK LPTKSTP+Y L+F
Sbjct  584  FSREGSLLASGAADCTVKLWDVTTSMKGQKIEESKPSSINRLRLLKALPTKSTPVYTLQF  643

Query  135  SRRNLLFAAGAFSK  94
            SRRNLLFAAGA SK
Sbjct  644  SRRNLLFAAGALSK  657


 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 59/124 (48%), Gaps = 0/124 (0%)
 Frame = -3

Query  615  PLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMS  436
            P  +  GH   +    +    +++ + SSD T+RLW       +  + GH   +  +  S
Sbjct  400  PYTLFHGHSGPIYSATFSPLGDFLLSSSSDSTIRLWSTNLNANLVCYKGHNYPVWDVQFS  459

Query  435  PDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLW  256
            P G Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D TV+LW
Sbjct  460  PVGHYFASSSHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYVATGSSDKTVRLW  519

Query  255  DVTT  244
            DV +
Sbjct  520  DVQS  523



>gb|KCW81291.1| hypothetical protein EUGRSUZ_C02661 [Eucalyptus grandis]
Length=772

 Score =   359 bits (922),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 167/200 (84%), Positives = 184/200 (92%), Gaps = 6/200 (3%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFAS+SHDRTAR+WS+DRIQPLRIMAGHLSDVDCVQWH NCNYIATGSSDKTVRLWDV S
Sbjct  572  YFASSSHDRTARLWSVDRIQPLRIMAGHLSDVDCVQWHPNCNYIATGSSDKTVRLWDVAS  631

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVRIFIGHRSMILSLAMSPDGRYMASGDEDG IM+WDL+SGRCI PL+GH SCVWTLA
Sbjct  632  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGTIMMWDLSSGRCIMPLMGHTSCVWTLA  691

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE------NKSGSTNRLRSLKTLPTKSTP  154
            +SCEG+LLASGSADCT+KLWD+ TS K+P++EE      N+SGST+RLR LKTLPTKSTP
Sbjct  692  YSCEGTLLASGSADCTLKLWDIATSAKLPRTEENRLTCINRSGSTSRLRLLKTLPTKSTP  751

Query  153  LYALRFSRRNLLFAAGAFSK  94
            +Y L+FSRRNLLFAAGA SK
Sbjct  752  VYTLQFSRRNLLFAAGALSK  771


 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = -3

Query  606  IMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDG  427
            +  GH   +    +    ++I T S+D T+RLW  +    +  + GH   +  +  SP G
Sbjct  511  LFQGHSGPIHSATFSPLGDFILTSSADSTIRLWSTKLNANLVCYKGHNYPVWDVQFSPAG  570

Query  426  RYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVT  247
             Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D TV+LWDV 
Sbjct  571  HYFASSSHDRTARLWSVDRIQPLRIMAGHLSDVDCVQWHPNCNYIATGSSDKTVRLWDVA  630

Query  246  T  244
            +
Sbjct  631  S  631



>ref|XP_009418872.1| PREDICTED: transcription initiation factor TFIID subunit 5-like 
[Musa acuminata subsp. malaccensis]
Length=571

 Score =   353 bits (907),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 167/194 (86%), Positives = 181/194 (93%), Gaps = 1/194 (1%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFAS+SHDRTARIWSM+RIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS
Sbjct  377  YFASSSHDRTARIWSMERIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  436

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVRIFIGHRSMILSLAMSPDGRYMASGDEDG IM+WDL+SGRC++PLVGH+SCVWTLA
Sbjct  437  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGTIMMWDLSSGRCVSPLVGHSSCVWTLA  496

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            FSCEG+LLASGSADCT+KLWDVT ST+  + E   S S+NRLR LK LPTKSTP+Y L+F
Sbjct  497  FSCEGTLLASGSADCTIKLWDVTASTRASRMESKSS-SSNRLRLLKALPTKSTPVYTLQF  555

Query  135  SRRNLLFAAGAFSK  94
            SRRNLLFAAGA SK
Sbjct  556  SRRNLLFAAGALSK  569



>ref|XP_002872141.1| nucleotide binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48400.1| nucleotide binding protein [Arabidopsis lyrata subsp. lyrata]
Length=669

 Score =   356 bits (914),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 167/196 (85%), Positives = 183/196 (93%), Gaps = 1/196 (1%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFAS SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWH NCNYIATGSSDKTVRLWDVQ+
Sbjct  474  YFASCSHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHPNCNYIATGSSDKTVRLWDVQT  533

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVRIFIGHRSM+LSLAMSPDGRYMASGDEDG IM+WDL + RCITPL+GH SCVW+L+
Sbjct  534  GECVRIFIGHRSMVLSLAMSPDGRYMASGDEDGTIMMWDLLTARCITPLMGHNSCVWSLS  593

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            +S EGSLLASGSADCTVKLWDVT+STK+ K+ E K+G+TNRLRSL+T PTKSTP++ALRF
Sbjct  594  YSGEGSLLASGSADCTVKLWDVTSSTKLTKAVE-KNGNTNRLRSLRTFPTKSTPVHALRF  652

Query  135  SRRNLLFAAGAFSKSA  88
            SRRNLLFAAGA SK A
Sbjct  653  SRRNLLFAAGALSKPA  668


 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 60/121 (50%), Gaps = 0/121 (0%)
 Frame = -3

Query  606  IMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDG  427
            ++ GH   V    +    +++ + S+D T+RLW  +    +  + GH   +  +  SP G
Sbjct  413  LLLGHSGPVYSATFSPPGDFVLSSSADTTIRLWSTKLNANLVCYKGHNYPVWDVQFSPFG  472

Query  426  RYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVT  247
             Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D TV+LWDV 
Sbjct  473  HYFASCSHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHPNCNYIATGSSDKTVRLWDVQ  532

Query  246  T  244
            T
Sbjct  533  T  533



>dbj|BAC79801.1| putative TATA box binding protein-associated factor [Oryza sativa 
Japonica Group]
Length=563

 Score =   352 bits (903),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 161/193 (83%), Positives = 179/193 (93%), Gaps = 0/193 (0%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFASASHDRTARIWSMD+IQPLRIMAGHLSDVDCVQWH NCNYIATGSSDKTVRLWDVQ+
Sbjct  368  YFASASHDRTARIWSMDKIQPLRIMAGHLSDVDCVQWHVNCNYIATGSSDKTVRLWDVQT  427

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GEC+R+FIGHRSM+LSLAMSPDGRYMASGDEDG IM+WD++SGRC++PLVGH SCVW+LA
Sbjct  428  GECIRMFIGHRSMVLSLAMSPDGRYMASGDEDGTIMMWDISSGRCVSPLVGHNSCVWSLA  487

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            +SCEG+LLASGSADCTVKLWDV +STK  K ++ K GS NRLR LK LPTKSTP+Y L+F
Sbjct  488  YSCEGALLASGSADCTVKLWDVASSTKTLKMDDTKGGSANRLRMLKALPTKSTPVYTLQF  547

Query  135  SRRNLLFAAGAFS  97
            SRRNLLFAAGA S
Sbjct  548  SRRNLLFAAGAPS  560


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/98 (31%), Positives = 48/98 (49%), Gaps = 0/98 (0%)
 Frame = -3

Query  537  GSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCI  358
            G   K  RLW+ +    +  + GH   +  +  SP G Y AS   D    +W +   + +
Sbjct  330  GQPSKAFRLWNTKLNANLVCYKGHNYPVWDVQFSPVGHYFASASHDRTARIWSMDKIQPL  389

Query  357  TPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVTT  244
              + GH S V  + +    + +A+GS+D TV+LWDV T
Sbjct  390  RIMAGHLSDVDCVQWHVNCNYIATGSSDKTVRLWDVQT  427



>ref|XP_009129987.1| PREDICTED: transcription initiation factor TFIID subunit 5-like 
[Brassica rapa]
Length=666

 Score =   355 bits (911),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 164/194 (85%), Positives = 184/194 (95%), Gaps = 1/194 (1%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFAS SHDRTARIWSMDR+QPLR+MAGHLSDVDCVQWH NCNYIATGSSDKTVRLWDVQ+
Sbjct  471  YFASCSHDRTARIWSMDRMQPLRMMAGHLSDVDCVQWHPNCNYIATGSSDKTVRLWDVQT  530

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVRIFIGHRSM+LSLAMSPDGRYMASGDEDG IM+WDL++ RCITPL+GH SCVWTL+
Sbjct  531  GECVRIFIGHRSMVLSLAMSPDGRYMASGDEDGTIMMWDLSTARCITPLMGHNSCVWTLS  590

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            +S EGSLLASGSADCTVKLWDV++STK+ K+EE K+G++NRLRSL+T PTKSTP++ALRF
Sbjct  591  YSGEGSLLASGSADCTVKLWDVSSSTKLTKAEE-KNGNSNRLRSLRTFPTKSTPVHALRF  649

Query  135  SRRNLLFAAGAFSK  94
            SRRNLLFAAGA SK
Sbjct  650  SRRNLLFAAGAISK  663


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/121 (29%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = -3

Query  606  IMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDG  427
            ++ GH   V    +    +Y+ + S+D T+RLW  +    +  + GH   +     SP G
Sbjct  410  LLVGHSGPVYSATFSPPGDYVLSSSADTTIRLWSTKLNANLVCYKGHNHAVWDAQFSPFG  469

Query  426  RYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVT  247
             Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D TV+LWDV 
Sbjct  470  HYFASCSHDRTARIWSMDRMQPLRMMAGHLSDVDCVQWHPNCNYIATGSSDKTVRLWDVQ  529

Query  246  T  244
            T
Sbjct  530  T  530



>emb|CDY05473.1| BnaA02g32180D [Brassica napus]
Length=666

 Score =   355 bits (911),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 164/194 (85%), Positives = 184/194 (95%), Gaps = 1/194 (1%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFAS SHDRTARIWSMDR+QPLR+MAGHLSDVDCVQWH NCNYIATGSSDKTVRLWDVQ+
Sbjct  471  YFASCSHDRTARIWSMDRMQPLRMMAGHLSDVDCVQWHPNCNYIATGSSDKTVRLWDVQT  530

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVRIFIGHRSM+LSLAMSPDGRYMASGDEDG IM+WDL++ RCITPL+GH SCVWTL+
Sbjct  531  GECVRIFIGHRSMVLSLAMSPDGRYMASGDEDGTIMMWDLSTARCITPLMGHNSCVWTLS  590

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            +S EGSLLASGSADCTVKLWDV++STK+ K+EE K+G++NRLRSL+T PTKSTP++ALRF
Sbjct  591  YSGEGSLLASGSADCTVKLWDVSSSTKLTKAEE-KNGNSNRLRSLRTFPTKSTPVHALRF  649

Query  135  SRRNLLFAAGAFSK  94
            SRRNLLFAAGA SK
Sbjct  650  SRRNLLFAAGAISK  663


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/121 (29%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = -3

Query  606  IMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDG  427
            ++ GH   V    +    +Y+ + S+D T+RLW  +    +  + GH   +     SP G
Sbjct  410  LLVGHSGPVYSATFSPPGDYVLSSSADTTIRLWSTKLNANLVCYKGHNHTVWDAQFSPFG  469

Query  426  RYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVT  247
             Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D TV+LWDV 
Sbjct  470  HYFASCSHDRTARIWSMDRMQPLRMMAGHLSDVDCVQWHPNCNYIATGSSDKTVRLWDVQ  529

Query  246  T  244
            T
Sbjct  530  T  530



>ref|XP_008658972.1| PREDICTED: uncharacterized protein LOC100501797 isoform X2 [Zea 
mays]
Length=570

 Score =   352 bits (903),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 158/187 (84%), Positives = 176/187 (94%), Gaps = 0/187 (0%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFASASHDRTARIWSMD+IQPLRIMAGHLSDVDCVQWH NCNYIATGSSDKTVRLWDVQ+
Sbjct  374  YFASASHDRTARIWSMDKIQPLRIMAGHLSDVDCVQWHVNCNYIATGSSDKTVRLWDVQT  433

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GEC+R+FIGHRSM+LSLAMSPDGRYMASGDEDG IM+WDL++GRC++PL+GH+SCVWTLA
Sbjct  434  GECIRMFIGHRSMVLSLAMSPDGRYMASGDEDGTIMIWDLSTGRCVSPLLGHSSCVWTLA  493

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            FSCEG+LLASGSADCTVKLWDV +STK  K+E+ K  S NRLR LK LPTKSTP+Y+LRF
Sbjct  494  FSCEGALLASGSADCTVKLWDVASSTKTLKTEDTKGSSANRLRLLKALPTKSTPVYSLRF  553

Query  135  SRRNLLF  115
            SRRNLLF
Sbjct  554  SRRNLLF  560


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/121 (29%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = -3

Query  606  IMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDG  427
            +  GH   V    +    +++ + SSD T+RLW  +    +  + GH   +  +  SP G
Sbjct  313  LFQGHSGPVYSAAFSPFGDFLLSSSSDSTIRLWSTKLNANLVCYKGHNYPVWDVQFSPVG  372

Query  426  RYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVT  247
             Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D TV+LWDV 
Sbjct  373  HYFASASHDRTARIWSMDKIQPLRIMAGHLSDVDCVQWHVNCNYIATGSSDKTVRLWDVQ  432

Query  246  T  244
            T
Sbjct  433  T  433



>gb|EMS49310.1| Transcription initiation factor TFIID subunit 5 [Triticum urartu]
Length=593

 Score =   353 bits (905),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 161/193 (83%), Positives = 180/193 (93%), Gaps = 0/193 (0%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFASASHDRTARIWSMD+IQPLRIMAGHL+DVDCVQWH NCNYIATGSSDKTVRLWDVQ+
Sbjct  400  YFASASHDRTARIWSMDKIQPLRIMAGHLADVDCVQWHVNCNYIATGSSDKTVRLWDVQT  459

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GEC+R+FIGHRSM+LSLAMSPDGRYMASGDEDG IM+WDL++GRC++PL GH SCVW+LA
Sbjct  460  GECIRMFIGHRSMVLSLAMSPDGRYMASGDEDGTIMMWDLSTGRCVSPLAGHNSCVWSLA  519

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            FSCEG+LLASGSADCTVKLWDV +STK  K ++ K+GSTNRLR LK LPTKSTP+Y LRF
Sbjct  520  FSCEGALLASGSADCTVKLWDVASSTKALKMDDTKAGSTNRLRLLKALPTKSTPVYNLRF  579

Query  135  SRRNLLFAAGAFS  97
            SRRNLLFA+GA S
Sbjct  580  SRRNLLFASGALS  592


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 55/121 (45%), Gaps = 4/121 (3%)
 Frame = -3

Query  606  IMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDG  427
            ++ G  SD     W    +    G   KT RLW  +    +  + GH   +  +  SP G
Sbjct  343  LIVGGFSDSSVKVW----DMAKIGQPAKTFRLWSTKLNANLVCYKGHNYPVWDVQFSPVG  398

Query  426  RYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVT  247
             Y AS   D    +W +   + +  + GH + V  + +    + +A+GS+D TV+LWDV 
Sbjct  399  HYFASASHDRTARIWSMDKIQPLRIMAGHLADVDCVQWHVNCNYIATGSSDKTVRLWDVQ  458

Query  246  T  244
            T
Sbjct  459  T  459



>ref|XP_010239968.1| PREDICTED: transcription initiation factor TFIID subunit 5 [Brachypodium 
distachyon]
Length=678

 Score =   355 bits (911),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 162/193 (84%), Positives = 179/193 (93%), Gaps = 0/193 (0%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFASASHDRTARIWSMD+IQPLRIMAGHLSDVDCVQWH NCNYIATGSSDKTVRLWDVQ+
Sbjct  483  YFASASHDRTARIWSMDKIQPLRIMAGHLSDVDCVQWHVNCNYIATGSSDKTVRLWDVQT  542

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GEC+R+FIGHRSM+LSLAMSPDGRYMASGDEDG IM+WDL++GRC++PL GH SCVW+LA
Sbjct  543  GECIRMFIGHRSMVLSLAMSPDGRYMASGDEDGTIMMWDLSTGRCVSPLAGHNSCVWSLA  602

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            FSCEG+LLASGSADCTVKLWDV +STK  K ++ K GSTNRLR LK LPTKS+P+Y LRF
Sbjct  603  FSCEGALLASGSADCTVKLWDVASSTKALKLDDTKGGSTNRLRLLKALPTKSSPVYNLRF  662

Query  135  SRRNLLFAAGAFS  97
            SRRNLLFAAGA S
Sbjct  663  SRRNLLFAAGALS  675


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/125 (29%), Positives = 61/125 (49%), Gaps = 0/125 (0%)
 Frame = -3

Query  618  QPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAM  439
            +P  +  GH   V    +    +++ + SSD T+RLW  +    +  + GH   +  +  
Sbjct  418  RPYTLFQGHSGPVYSAAFSPFGDFLLSSSSDSTIRLWSTKLNANLVCYKGHNYPVWDVQF  477

Query  438  SPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKL  259
            SP G Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D TV+L
Sbjct  478  SPVGHYFASASHDRTARIWSMDKIQPLRIMAGHLSDVDCVQWHVNCNYIATGSSDKTVRL  537

Query  258  WDVTT  244
            WDV T
Sbjct  538  WDVQT  542



>ref|XP_010454835.1| PREDICTED: transcription initiation factor TFIID subunit 5-like 
[Camelina sativa]
Length=667

 Score =   354 bits (909),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 167/196 (85%), Positives = 183/196 (93%), Gaps = 1/196 (1%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFAS SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWH NCNYIATGSSDKTVRLWDVQ+
Sbjct  472  YFASCSHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHPNCNYIATGSSDKTVRLWDVQT  531

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVRIFIGHRSM+LSLAMSPDGRYM+SGDEDG IM+WDL++ RCITPL+GH SCVW+LA
Sbjct  532  GECVRIFIGHRSMVLSLAMSPDGRYMSSGDEDGTIMMWDLSTARCITPLMGHNSCVWSLA  591

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            +S EGSLLASGSADCTVKLWDVT+STK  K+EE K+ S+NRLRSL+T PTKSTP++ALRF
Sbjct  592  YSGEGSLLASGSADCTVKLWDVTSSTKSTKAEE-KNVSSNRLRSLRTFPTKSTPVHALRF  650

Query  135  SRRNLLFAAGAFSKSA  88
            SRRNLLFAAGA SK A
Sbjct  651  SRRNLLFAAGAISKPA  666


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/121 (29%), Positives = 60/121 (50%), Gaps = 0/121 (0%)
 Frame = -3

Query  606  IMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDG  427
            ++ GH   V    +    +++ + S+D T+RLW  Q    +  + GH   +  +  SP G
Sbjct  411  LLLGHSGPVYSATFSPPGDFVLSSSADTTIRLWSTQLNANLVCYKGHNYPVWDVQFSPFG  470

Query  426  RYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVT  247
             Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D TV+LWDV 
Sbjct  471  HYFASCSHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHPNCNYIATGSSDKTVRLWDVQ  530

Query  246  T  244
            T
Sbjct  531  T  531



>ref|XP_006286673.1| hypothetical protein CARUB_v10002639mg [Capsella rubella]
 gb|EOA19571.1| hypothetical protein CARUB_v10002639mg [Capsella rubella]
Length=668

 Score =   354 bits (909),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 166/196 (85%), Positives = 183/196 (93%), Gaps = 1/196 (1%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFAS SHDRTARIWSMD+IQPLRIMAGHLSDVDCVQWH NCNYIATGSSDKTVRLWDVQ+
Sbjct  473  YFASCSHDRTARIWSMDQIQPLRIMAGHLSDVDCVQWHPNCNYIATGSSDKTVRLWDVQT  532

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVRIFIGHRSM+LSLAMSPDGRYMASGDEDG IM+WDL++ RCITPL+GH SCVW+L 
Sbjct  533  GECVRIFIGHRSMVLSLAMSPDGRYMASGDEDGTIMMWDLSTARCITPLMGHNSCVWSLC  592

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            +S EGSLLASGSADCTVKLWDVT+STK  K+EE K+G++NRLRSL+T PTKSTP++ALRF
Sbjct  593  YSGEGSLLASGSADCTVKLWDVTSSTKSTKAEE-KNGNSNRLRSLRTFPTKSTPVHALRF  651

Query  135  SRRNLLFAAGAFSKSA  88
            SRRNLLFAAGA SK A
Sbjct  652  SRRNLLFAAGALSKPA  667


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 60/121 (50%), Gaps = 0/121 (0%)
 Frame = -3

Query  606  IMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDG  427
            ++ GH   V    +    +++ + S+D T+RLW  +    +  + GH   +  +  SP G
Sbjct  412  LLLGHSGPVYSATFSPPGDFVLSSSADTTIRLWSTKLNANLVCYKGHNYPVWDVQFSPFG  471

Query  426  RYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVT  247
             Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D TV+LWDV 
Sbjct  472  HYFASCSHDRTARIWSMDQIQPLRIMAGHLSDVDCVQWHPNCNYIATGSSDKTVRLWDVQ  531

Query  246  T  244
            T
Sbjct  532  T  532



>ref|XP_010493762.1| PREDICTED: transcription initiation factor TFIID subunit 5 [Camelina 
sativa]
Length=668

 Score =   354 bits (908),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 167/196 (85%), Positives = 183/196 (93%), Gaps = 1/196 (1%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFAS SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWH NCNYIATGSSDKTVRLWDVQ+
Sbjct  473  YFASCSHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHPNCNYIATGSSDKTVRLWDVQT  532

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVRIFIGHRSM+LSLAMSPDGRYMASGDEDG IM+WDL++ RCITPL+GH SCVW+LA
Sbjct  533  GECVRIFIGHRSMVLSLAMSPDGRYMASGDEDGTIMMWDLSTARCITPLMGHNSCVWSLA  592

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            +S EGSLLASGSADCTVKLWDVT+STK  K+EE K+ ++NRLRSL+T PTKSTP++ALRF
Sbjct  593  YSGEGSLLASGSADCTVKLWDVTSSTKSTKAEE-KNVNSNRLRSLRTFPTKSTPVHALRF  651

Query  135  SRRNLLFAAGAFSKSA  88
            SRRNLLFAAGA SK A
Sbjct  652  SRRNLLFAAGAISKPA  667


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/121 (29%), Positives = 60/121 (50%), Gaps = 0/121 (0%)
 Frame = -3

Query  606  IMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDG  427
            ++ GH   V    +    +++ + S+D T+RLW  Q    +  + GH   +  +  SP G
Sbjct  412  LLLGHSGPVYSATFSPPGDFVLSSSADTTIRLWSTQLNANLVCYKGHNYPVWDVQFSPFG  471

Query  426  RYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVT  247
             Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D TV+LWDV 
Sbjct  472  HYFASCSHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHPNCNYIATGSSDKTVRLWDVQ  531

Query  246  T  244
            T
Sbjct  532  T  532



>gb|KFK27773.1| hypothetical protein AALP_AA8G427000 [Arabis alpina]
Length=667

 Score =   354 bits (908),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 164/196 (84%), Positives = 183/196 (93%), Gaps = 1/196 (1%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFAS SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWH NCNYIATGSSDKTVRLWDVQ+
Sbjct  472  YFASCSHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHPNCNYIATGSSDKTVRLWDVQT  531

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G+C RIF+GHRSM+LSLAMSPDGRYMASGDEDG IM+WDL++ RCITPL+GH SCVW+L 
Sbjct  532  GKCARIFVGHRSMVLSLAMSPDGRYMASGDEDGTIMMWDLSTARCITPLMGHNSCVWSLT  591

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            +S EGSLLASGSADCTVKLWDVT+STK+ K+EE K+G++NRLRSL+T PTKSTP++ALRF
Sbjct  592  YSGEGSLLASGSADCTVKLWDVTSSTKLTKAEE-KNGNSNRLRSLRTFPTKSTPVHALRF  650

Query  135  SRRNLLFAAGAFSKSA  88
            SRRNLLFAAGA SK A
Sbjct  651  SRRNLLFAAGALSKPA  666


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 60/121 (50%), Gaps = 0/121 (0%)
 Frame = -3

Query  606  IMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDG  427
            ++ GH   V    +    +++ + S+D T+RLW  +    +  + GH   +  +  SP G
Sbjct  411  LLLGHSGPVYSATFSPPGDFLLSSSADTTIRLWSTKLNANLVCYKGHNYPVWDVQFSPFG  470

Query  426  RYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVT  247
             Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D TV+LWDV 
Sbjct  471  HYFASCSHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHPNCNYIATGSSDKTVRLWDVQ  530

Query  246  T  244
            T
Sbjct  531  T  531



>emb|CDY05378.1| BnaC02g40860D [Brassica napus]
Length=664

 Score =   354 bits (908),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 163/194 (84%), Positives = 184/194 (95%), Gaps = 1/194 (1%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFAS SHDRTARIWSMDR+QPLR+MAGHLSDVDCVQWH NCNYIATGSSDKTVRLWDVQ+
Sbjct  469  YFASCSHDRTARIWSMDRMQPLRMMAGHLSDVDCVQWHPNCNYIATGSSDKTVRLWDVQT  528

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVRIFIGHRSM+LSLAMSPDGRYMASGDEDG IM+WDL++ RCITPL+GH SCVWTL+
Sbjct  529  GECVRIFIGHRSMVLSLAMSPDGRYMASGDEDGTIMMWDLSTARCITPLMGHNSCVWTLS  588

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            +S EGSLLASGSADCTVKLWDV++STK+ K+EE K+G++NRLRS++T PTKSTP++ALRF
Sbjct  589  YSGEGSLLASGSADCTVKLWDVSSSTKLTKAEE-KNGNSNRLRSIRTFPTKSTPVHALRF  647

Query  135  SRRNLLFAAGAFSK  94
            SRRNLLFAAGA SK
Sbjct  648  SRRNLLFAAGAVSK  661


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/121 (29%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = -3

Query  606  IMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDG  427
            ++ GH   V    +    +Y+ + S+D T+RLW  +    +  + GH   +     SP G
Sbjct  408  LLVGHSGPVYSATFSPPGDYVLSSSADTTIRLWSTKLNANLVCYKGHNHTVWDAQFSPFG  467

Query  426  RYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVT  247
             Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D TV+LWDV 
Sbjct  468  HYFASCSHDRTARIWSMDRMQPLRMMAGHLSDVDCVQWHPNCNYIATGSSDKTVRLWDVQ  527

Query  246  T  244
            T
Sbjct  528  T  528



>gb|EMS67415.1| Transcription initiation factor TFIID subunit 5 [Triticum urartu]
Length=607

 Score =   352 bits (903),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 160/193 (83%), Positives = 179/193 (93%), Gaps = 0/193 (0%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFASASHDRTARIWSMD+IQPLRIMAGHL+DVDCVQWH NCNYIATGSSDKTVRLWDVQ+
Sbjct  414  YFASASHDRTARIWSMDKIQPLRIMAGHLADVDCVQWHVNCNYIATGSSDKTVRLWDVQT  473

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GEC+R+FIGHRSM+LSLAMSPDGRYMASGDEDG IM+WDL++GRC++PL GH SCVW+LA
Sbjct  474  GECIRMFIGHRSMVLSLAMSPDGRYMASGDEDGTIMMWDLSTGRCVSPLAGHNSCVWSLA  533

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            FSCEG+LLASGSADCTVKLWDV +STK  K ++ K+GSTNRLR LK LPTKSTP+Y LRF
Sbjct  534  FSCEGALLASGSADCTVKLWDVASSTKALKMDDTKAGSTNRLRLLKALPTKSTPVYNLRF  593

Query  135  SRRNLLFAAGAFS  97
            S RNLLFA+GA S
Sbjct  594  SGRNLLFASGALS  606


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 55/121 (45%), Gaps = 4/121 (3%)
 Frame = -3

Query  606  IMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDG  427
            ++ G  SD     W    +    G   KT RLW  +    +  + GH   +  +  SP G
Sbjct  357  LVVGGFSDSSVKVW----DMAKIGQPAKTFRLWSTKLNANLVCYKGHNYPVWDVQFSPVG  412

Query  426  RYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVT  247
             Y AS   D    +W +   + +  + GH + V  + +    + +A+GS+D TV+LWDV 
Sbjct  413  HYFASASHDRTARIWSMDKIQPLRIMAGHLADVDCVQWHVNCNYIATGSSDKTVRLWDVQ  472

Query  246  T  244
            T
Sbjct  473  T  473



>ref|XP_004501380.1| PREDICTED: LOW QUALITY PROTEIN: transcription initiation factor 
TFIID subunit 5-like [Cicer arietinum]
Length=698

 Score =   355 bits (910),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 163/196 (83%), Positives = 180/196 (92%), Gaps = 0/196 (0%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFAS+SHDRTARIWS+DRI+PLRIMAGHLSDVDCVQWH NCNYIATGSSDKTVRLWDVQS
Sbjct  503  YFASSSHDRTARIWSVDRIRPLRIMAGHLSDVDCVQWHVNCNYIATGSSDKTVRLWDVQS  562

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVR+F+GHR MILSLAMSPDGRYMASGDEDG IM+WDL+SGRC+TPLVGH SCVW+LA
Sbjct  563  GECVRVFVGHRGMILSLAMSPDGRYMASGDEDGTIMMWDLSSGRCVTPLVGHTSCVWSLA  622

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            FS EG++LASGSADCTVKLWDV TSTK+ + EE    + NRLRSLKTL TKSTP+ ALRF
Sbjct  623  FSSEGAILASGSADCTVKLWDVNTSTKVSRIEEKNGNTNNRLRSLKTLTTKSTPVNALRF  682

Query  135  SRRNLLFAAGAFSKSA  88
            SRRNLLFAAGA +K+A
Sbjct  683  SRRNLLFAAGALAKNA  698



>gb|EEC81710.1| hypothetical protein OsI_25319 [Oryza sativa Indica Group]
 gb|EEE66773.1| hypothetical protein OsJ_23498 [Oryza sativa Japonica Group]
Length=631

 Score =   352 bits (904),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 161/193 (83%), Positives = 179/193 (93%), Gaps = 0/193 (0%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFASASHDRTARIWSMD+IQPLRIMAGHLSDVDCVQWH NCNYIATGSSDKTVRLWDVQ+
Sbjct  436  YFASASHDRTARIWSMDKIQPLRIMAGHLSDVDCVQWHVNCNYIATGSSDKTVRLWDVQT  495

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GEC+R+FIGHRSM+LSLAMSPDGRYMASGDEDG IM+WD++SGRC++PLVGH SCVW+LA
Sbjct  496  GECIRMFIGHRSMVLSLAMSPDGRYMASGDEDGTIMMWDISSGRCVSPLVGHNSCVWSLA  555

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            +SCEG+LLASGSADCTVKLWDV +STK  K ++ K GS NRLR LK LPTKSTP+Y L+F
Sbjct  556  YSCEGALLASGSADCTVKLWDVASSTKTLKMDDTKGGSANRLRMLKALPTKSTPVYTLQF  615

Query  135  SRRNLLFAAGAFS  97
            SRRNLLFAAGA S
Sbjct  616  SRRNLLFAAGAPS  628


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 60/121 (50%), Gaps = 0/121 (0%)
 Frame = -3

Query  606  IMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDG  427
            +  GH   V    +    +++ + S+D T+RLW+ +    +  + GH   +  +  SP G
Sbjct  375  LFQGHSGPVYSAMFSPIGDFLLSSSADSTIRLWNTKLNANLVCYKGHNYPVWDVQFSPVG  434

Query  426  RYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVT  247
             Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D TV+LWDV 
Sbjct  435  HYFASASHDRTARIWSMDKIQPLRIMAGHLSDVDCVQWHVNCNYIATGSSDKTVRLWDVQ  494

Query  246  T  244
            T
Sbjct  495  T  495



>ref|NP_001183382.1| uncharacterized protein LOC100501797 [Zea mays]
 gb|ACR36608.1| unknown [Zea mays]
Length=657

 Score =   353 bits (905),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 158/187 (84%), Positives = 176/187 (94%), Gaps = 0/187 (0%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFASASHDRTARIWSMD+IQPLRIMAGHLSDVDCVQWH NCNYIATGSSDKTVRLWDVQ+
Sbjct  461  YFASASHDRTARIWSMDKIQPLRIMAGHLSDVDCVQWHVNCNYIATGSSDKTVRLWDVQT  520

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GEC+R+FIGHRSM+LSLAMSPDGRYMASGDEDG IM+WDL++GRC++PL+GH+SCVWTLA
Sbjct  521  GECIRMFIGHRSMVLSLAMSPDGRYMASGDEDGTIMIWDLSTGRCVSPLLGHSSCVWTLA  580

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            FSCEG+LLASGSADCTVKLWDV +STK  K+E+ K  S NRLR LK LPTKSTP+Y+LRF
Sbjct  581  FSCEGALLASGSADCTVKLWDVASSTKTLKTEDTKGSSANRLRLLKALPTKSTPVYSLRF  640

Query  135  SRRNLLF  115
            SRRNLLF
Sbjct  641  SRRNLLF  647


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/121 (29%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = -3

Query  606  IMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDG  427
            +  GH   V    +    +++ + SSD T+RLW  +    +  + GH   +  +  SP G
Sbjct  400  LFQGHSGPVYSAAFSPFGDFLLSSSSDSTIRLWSTKLNANLVCYKGHNYPVWDVQFSPVG  459

Query  426  RYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVT  247
             Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D TV+LWDV 
Sbjct  460  HYFASASHDRTARIWSMDKIQPLRIMAGHLSDVDCVQWHVNCNYIATGSSDKTVRLWDVQ  519

Query  246  T  244
            T
Sbjct  520  T  520



>gb|KDO67472.1| hypothetical protein CISIN_1g005277mg [Citrus sinensis]
Length=704

 Score =   350 bits (898),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 175/230 (76%), Positives = 188/230 (82%), Gaps = 36/230 (16%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFAS+SHDRTARIWSMDRIQPLRIMAGHLSDVDCV+WH NCNYIATGSSDKTVRLWDV S
Sbjct  477  YFASSSHDRTARIWSMDRIQPLRIMAGHLSDVDCVRWHINCNYIATGSSDKTVRLWDVSS  536

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVRIFIGHRSMILSLAMSPDGRYMASGDEDG IM+WDLASGRC+TPL+GH SCVWTLA
Sbjct  537  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGTIMMWDLASGRCVTPLMGHTSCVWTLA  596

Query  315  F----------------------------------SCEGSLLASGSADCTVKLWDVTTST  238
            +                                  SCEGSLLASGSADCTVKLWDVTTST
Sbjct  597  YRFLLLVTNAYLKISDKVSTGFLFYSLTIIYFGCASCEGSLLASGSADCTVKLWDVTTST  656

Query  237  KMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRFSRRNLLFAAGAFSKSA  88
            K+ K+EE KSG TNRLRSLKTLPTKSTP+Y+L+FSRRNLLFAAGA SK++
Sbjct  657  KVLKTEE-KSG-TNRLRSLKTLPTKSTPVYSLQFSRRNLLFAAGALSKTS  704


 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 34/127 (27%), Positives = 62/127 (49%), Gaps = 0/127 (0%)
 Frame = -3

Query  624  RIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSL  445
            R +   +  GH   V    +    ++I + S+D T+RLW  +    +  + GH   +  +
Sbjct  410  RKRSYTLYQGHSGPVYSASFSPLGDFILSSSADTTIRLWSTKLNANLVCYKGHNYPVWDV  469

Query  444  AMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTV  265
              +P G Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D TV
Sbjct  470  QFNPQGHYFASSSHDRTARIWSMDRIQPLRIMAGHLSDVDCVRWHINCNYIATGSSDKTV  529

Query  264  KLWDVTT  244
            +LWDV++
Sbjct  530  RLWDVSS  536



>gb|EEC81088.1| hypothetical protein OsI_23915 [Oryza sativa Indica Group]
Length=654

 Score =   348 bits (894),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 161/193 (83%), Positives = 180/193 (93%), Gaps = 3/193 (2%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFASASHDRTARIWSMD+IQPLRIMAGHLSDVDCVQWH NCNYIATGSSDKTVRLWDVQ+
Sbjct  462  YFASASHDRTARIWSMDKIQPLRIMAGHLSDVDCVQWHVNCNYIATGSSDKTVRLWDVQT  521

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GEC+R+FIGHRSM+LSLAMSPDGRYMASGDEDG IM+WDL+SGRC++PL GH+SCVW+LA
Sbjct  522  GECIRMFIGHRSMVLSLAMSPDGRYMASGDEDGTIMMWDLSSGRCVSPLGGHSSCVWSLA  581

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            +SCEG+LLASGSADCTVKLWDV +STK+ K+++    STNRLR LKTL TKSTP+Y LRF
Sbjct  582  YSCEGALLASGSADCTVKLWDVASSTKVLKTDDT---STNRLRMLKTLRTKSTPVYTLRF  638

Query  135  SRRNLLFAAGAFS  97
            SRRNLLFAAGA S
Sbjct  639  SRRNLLFAAGALS  651


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/125 (29%), Positives = 61/125 (49%), Gaps = 0/125 (0%)
 Frame = -3

Query  618  QPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAM  439
            +P  +  GH   V    +    +++ + SSD T+RLW  +    +  + GH   +  +  
Sbjct  397  RPYTLFQGHSGPVYSAAFSPFGDFLLSSSSDSTIRLWSTKLNANLVCYKGHNYPVWDVQF  456

Query  438  SPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKL  259
            SP G Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D TV+L
Sbjct  457  SPVGHYFASASHDRTARIWSMDKIQPLRIMAGHLSDVDCVQWHVNCNYIATGSSDKTVRL  516

Query  258  WDVTT  244
            WDV T
Sbjct  517  WDVQT  521



>ref|NP_001058217.1| Os06g0649500 [Oryza sativa Japonica Group]
 dbj|BAD38100.1| putative TAF5 [Oryza sativa Japonica Group]
 dbj|BAD37340.1| putative TAF5 [Oryza sativa Japonica Group]
 dbj|BAF20131.1| Os06g0649500 [Oryza sativa Japonica Group]
 gb|EEE66126.1| hypothetical protein OsJ_22170 [Oryza sativa Japonica Group]
Length=654

 Score =   348 bits (894),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 161/193 (83%), Positives = 180/193 (93%), Gaps = 3/193 (2%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFASASHDRTARIWSMD+IQPLRIMAGHLSDVDCVQWH NCNYIATGSSDKTVRLWDVQ+
Sbjct  462  YFASASHDRTARIWSMDKIQPLRIMAGHLSDVDCVQWHVNCNYIATGSSDKTVRLWDVQT  521

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GEC+R+FIGHRSM+LSLAMSPDGRYMASGDEDG IM+WDL+SGRC++PL GH+SCVW+LA
Sbjct  522  GECIRMFIGHRSMVLSLAMSPDGRYMASGDEDGTIMMWDLSSGRCVSPLGGHSSCVWSLA  581

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            +SCEG+LLASGSADCTVKLWDV +STK+ K+++    STNRLR LKTL TKSTP+Y LRF
Sbjct  582  YSCEGALLASGSADCTVKLWDVASSTKVLKTDDT---STNRLRMLKTLRTKSTPVYTLRF  638

Query  135  SRRNLLFAAGAFS  97
            SRRNLLFAAGA S
Sbjct  639  SRRNLLFAAGALS  651


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/125 (29%), Positives = 61/125 (49%), Gaps = 0/125 (0%)
 Frame = -3

Query  618  QPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAM  439
            +P  +  GH   V    +    +++ + SSD T+RLW  +    +  + GH   +  +  
Sbjct  397  RPYTLFQGHSGPVYSAAFSPFGDFLLSSSSDSTIRLWSTKLNANLVCYKGHNYPVWDVQF  456

Query  438  SPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKL  259
            SP G Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D TV+L
Sbjct  457  SPVGHYFASASHDRTARIWSMDKIQPLRIMAGHLSDVDCVQWHVNCNYIATGSSDKTVRL  516

Query  258  WDVTT  244
            WDV T
Sbjct  517  WDVQT  521



>ref|XP_006657544.1| PREDICTED: transcription initiation factor TFIID subunit 5-like 
isoform X1 [Oryza brachyantha]
 ref|XP_006657545.1| PREDICTED: transcription initiation factor TFIID subunit 5-like 
isoform X2 [Oryza brachyantha]
Length=657

 Score =   347 bits (890),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 158/196 (81%), Positives = 179/196 (91%), Gaps = 0/196 (0%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFASASHDRTARIWSMD+IQPLRIMAGHLSDVDCVQWH NC YIATGSSD+TVRLWDVQ+
Sbjct  462  YFASASHDRTARIWSMDKIQPLRIMAGHLSDVDCVQWHVNCKYIATGSSDRTVRLWDVQT  521

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GEC+R+FIGHRSM+LSLAMSP+GRYMASGDEDG IMVWD++SGR I+P VGH SCVW+LA
Sbjct  522  GECIRMFIGHRSMVLSLAMSPNGRYMASGDEDGTIMVWDISSGRYISPPVGHNSCVWSLA  581

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            +SCEG+LLASGSADCTVKLWDV++STK  K ++ K GS NRLR LK LPTKSTP+Y L+F
Sbjct  582  YSCEGALLASGSADCTVKLWDVSSSTKALKMDDTKGGSANRLRMLKVLPTKSTPVYTLQF  641

Query  135  SRRNLLFAAGAFSKSA  88
            SRRNLLFAAGA S+ +
Sbjct  642  SRRNLLFAAGALSRGS  657


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/121 (29%), Positives = 58/121 (48%), Gaps = 0/121 (0%)
 Frame = -3

Query  606  IMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDG  427
            +  GH   V    +    +++ + SSD T+RLW  +    +  + GH   +  +  SP G
Sbjct  401  LFQGHSGQVYSATFSPIGDFLLSSSSDSTIRLWSTKLNANLVCYKGHNYPVWDVQFSPVG  460

Query  426  RYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVT  247
             Y AS   D    +W +   + +  + GH S V  + +      +A+GS+D TV+LWDV 
Sbjct  461  HYFASASHDRTARIWSMDKIQPLRIMAGHLSDVDCVQWHVNCKYIATGSSDRTVRLWDVQ  520

Query  246  T  244
            T
Sbjct  521  T  521



>gb|KDO67474.1| hypothetical protein CISIN_1g005277mg [Citrus sinensis]
Length=656

 Score =   340 bits (871),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 173/182 (95%), Gaps = 2/182 (1%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFAS+SHDRTARIWSMDRIQPLRIMAGHLSDVDCV+WH NCNYIATGSSDKTVRLWDV S
Sbjct  477  YFASSSHDRTARIWSMDRIQPLRIMAGHLSDVDCVRWHINCNYIATGSSDKTVRLWDVSS  536

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVRIFIGHRSMILSLAMSPDGRYMASGDEDG IM+WDLASGRC+TPL+GH SCVWTLA
Sbjct  537  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGTIMMWDLASGRCVTPLMGHTSCVWTLA  596

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            +SCEGSLLASGSADCTVKLWDVTTSTK+ K+EE KSG TNRLRSLKTLPTKSTP+Y+L+ 
Sbjct  597  YSCEGSLLASGSADCTVKLWDVTTSTKVLKTEE-KSG-TNRLRSLKTLPTKSTPVYSLQV  654

Query  135  SR  130
             R
Sbjct  655  LR  656


 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 34/127 (27%), Positives = 62/127 (49%), Gaps = 0/127 (0%)
 Frame = -3

Query  624  RIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSL  445
            R +   +  GH   V    +    ++I + S+D T+RLW  +    +  + GH   +  +
Sbjct  410  RKRSYTLYQGHSGPVYSASFSPLGDFILSSSADTTIRLWSTKLNANLVCYKGHNYPVWDV  469

Query  444  AMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTV  265
              +P G Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D TV
Sbjct  470  QFNPQGHYFASSSHDRTARIWSMDRIQPLRIMAGHLSDVDCVRWHINCNYIATGSSDKTV  529

Query  264  KLWDVTT  244
            +LWDV++
Sbjct  530  RLWDVSS  536



>ref|XP_008378948.1| PREDICTED: transcription initiation factor TFIID subunit 5-like 
isoform X3 [Malus domestica]
Length=663

 Score =   335 bits (858),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 156/195 (80%), Positives = 172/195 (88%), Gaps = 11/195 (6%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFASASHDRTARIWSMDRIQPL           CVQWH NCNYIATGSSDKTVRLWDVQ+
Sbjct  479  YFASASHDRTARIWSMDRIQPL-----------CVQWHVNCNYIATGSSDKTVRLWDVQT  527

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVRIFIGHRSM+LSLAMSPDGRY ASGDEDG +M+WDL+SGRC+TPL GH SCVWTL 
Sbjct  528  GECVRIFIGHRSMVLSLAMSPDGRYTASGDEDGAMMMWDLSSGRCVTPLTGHTSCVWTLD  587

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            FS EGSLLASGSADCTVKLWDVT STK+P++EENKSG+T+ +RSLKTLPTKSTP+Y+LRF
Sbjct  588  FSGEGSLLASGSADCTVKLWDVTASTKLPRTEENKSGNTSGMRSLKTLPTKSTPVYSLRF  647

Query  135  SRRNLLFAAGAFSKS  91
            SRRNLL A+G  SK+
Sbjct  648  SRRNLLLASGVLSKT  662



>ref|XP_008664126.1| PREDICTED: transcription initiation factor TFIID subunit 5-like 
[Zea mays]
Length=216

 Score =   312 bits (799),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 146/181 (81%), Positives = 165/181 (91%), Gaps = 1/181 (1%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFASASHDRT RIWS+D+IQPLRIMAGHLSDVDCVQWH NCNYI TGSSDKTVRLWDVQ+
Sbjct  32   YFASASHDRTVRIWSVDKIQPLRIMAGHLSDVDCVQWHVNCNYIGTGSSDKTVRLWDVQT  91

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GEC+R+FIGHRSM+LSLAMSPDGRYMASGDEDG IM+WDL++G C++PL+GH+SCVWTLA
Sbjct  92   GECIRMFIGHRSMVLSLAMSPDGRYMASGDEDGTIMIWDLSTGCCVSPLLGHSSCVWTLA  151

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENK-SGSTNRLRSLKTLPTKSTPLYALR  139
            FSCEG+LLASGSADCTVKLWDV  STK  K+E+ K S S NRLR LK+LPTKS P+Y+LR
Sbjct  152  FSCEGALLASGSADCTVKLWDVAFSTKAMKTEDTKGSSSANRLRLLKSLPTKSAPVYSLR  211

Query  138  F  136
             
Sbjct  212  I  212


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/82 (32%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = -3

Query  489  CVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFS  310
            CV  + GH   +  +  SP G Y AS   D  + +W +   + +  + GH S V  + + 
Sbjct  10   CVICYKGHNYPVWDVQFSPVGHYFASASHDRTVRIWSVDKIQPLRIMAGHLSDVDCVQWH  69

Query  309  CEGSLLASGSADCTVKLWDVTT  244
               + + +GS+D TV+LWDV T
Sbjct  70   VNCNYIGTGSSDKTVRLWDVQT  91



>ref|XP_002974112.1| hypothetical protein SELMODRAFT_100375, partial [Selaginella 
moellendorffii]
 gb|EFJ25067.1| hypothetical protein SELMODRAFT_100375, partial [Selaginella 
moellendorffii]
Length=590

 Score =   325 bits (832),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 153/195 (78%), Positives = 170/195 (87%), Gaps = 6/195 (3%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFASAS+DRTAR+WSMDR+QPLRIMAGHLSDVDCVQWH NCNYIATGSSDKTVRLWDVQ+
Sbjct  399  YFASASYDRTARVWSMDRLQPLRIMAGHLSDVDCVQWHVNCNYIATGSSDKTVRLWDVQT  458

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVRIF GHRSMI+S+AMSPDG +MASGDEDG IM+WDLAS RC+TPL+GH  CVW+LA
Sbjct  459  GECVRIFTGHRSMIVSIAMSPDGLFMASGDEDGAIMMWDLASSRCVTPLLGHTGCVWSLA  518

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            FS EGS+LASGSAD TV+LWDV  S+K+       +  T RLR LKTLPTKSTP+Y LRF
Sbjct  519  FSGEGSILASGSADNTVRLWDVNGSSKV------TADKTRRLRLLKTLPTKSTPIYTLRF  572

Query  135  SRRNLLFAAGAFSKS  91
            SRRNLLF AGAFS S
Sbjct  573  SRRNLLFVAGAFSPS  587


 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 58/120 (48%), Gaps = 0/120 (0%)
 Frame = -3

Query  603  MAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDGR  424
            + GH   V  V +    + + + S D T+RLW  +    +  + GH   +  +  SP G 
Sbjct  339  LVGHAGPVYGVDFSPEGDSLLSASGDCTIRLWSTRLNANLACYKGHNYPVWDVQYSPVGH  398

Query  423  YMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVTT  244
            Y AS   D    VW +   + +  + GH S V  + +    + +A+GS+D TV+LWDV T
Sbjct  399  YFASASYDRTARVWSMDRLQPLRIMAGHLSDVDCVQWHVNCNYIATGSSDKTVRLWDVQT  458


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/162 (25%), Positives = 69/162 (43%), Gaps = 38/162 (23%)
 Frame = -3

Query  477  FIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLA---------------------SGRC  361
            F+   + +   ++S DG Y+A G  D  I +WD+                      S R 
Sbjct  276  FVNTNNSLNCASISADGAYLAGGFSDSAIKLWDMVKMGEPSMYSDAGKQSLNKRPTSIRH  335

Query  360  ITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSL  181
               LVGHA  V+ + FS EG  L S S DCT++LW                 ST    +L
Sbjct  336  YIRLVGHAGPVYGVDFSPEGDSLLSASGDCTIRLW-----------------STRLNANL  378

Query  180  KTLPTKSTPLYALRFSRRNLLFAAGAFSKSA*YYNIFTLENL  55
                  + P++ +++S     FA+ ++ ++A  +++  L+ L
Sbjct  379  ACYKGHNYPVWDVQYSPVGHYFASASYDRTARVWSMDRLQPL  420


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 36/130 (28%), Positives = 55/130 (42%), Gaps = 21/130 (16%)
 Frame = -3

Query  582  VDCVQWHANCNYIATGSSDKTVRLWD-VQSGE-----------------CVRIFI---GH  466
            ++C    A+  Y+A G SD  ++LWD V+ GE                  +R +I   GH
Sbjct  283  LNCASISADGAYLAGGFSDSAIKLWDMVKMGEPSMYSDAGKQSLNKRPTSIRHYIRLVGH  342

Query  465  RSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLAS  286
               +  +  SP+G  + S   D  I +W       +    GH   VW + +S  G   AS
Sbjct  343  AGPVYGVDFSPEGDSLLSASGDCTIRLWSTRLNANLACYKGHNYPVWDVQYSPVGHYFAS  402

Query  285  GSADCTVKLW  256
             S D T ++W
Sbjct  403  ASYDRTARVW  412



>ref|XP_002968859.1| hypothetical protein SELMODRAFT_90562, partial [Selaginella moellendorffii]
 gb|EFJ29975.1| hypothetical protein SELMODRAFT_90562, partial [Selaginella moellendorffii]
Length=590

 Score =   325 bits (832),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 153/195 (78%), Positives = 170/195 (87%), Gaps = 6/195 (3%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFASAS+DRTAR+WSMDR+QPLRIMAGHLSDVDCVQWH NCNYIATGSSDKTVRLWDVQ+
Sbjct  399  YFASASYDRTARVWSMDRLQPLRIMAGHLSDVDCVQWHVNCNYIATGSSDKTVRLWDVQT  458

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVRIF GHRSMI+S+AMSPDG +MASGDEDG IM+WDLAS RC+TPL+GH  CVW+LA
Sbjct  459  GECVRIFTGHRSMIVSIAMSPDGLFMASGDEDGAIMMWDLASSRCVTPLLGHTGCVWSLA  518

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            FS EGS+LASGSAD TV+LWDV  S+K+       +  T RLR LKTLPTKSTP+Y LRF
Sbjct  519  FSGEGSILASGSADNTVRLWDVNGSSKV------TADKTRRLRLLKTLPTKSTPIYTLRF  572

Query  135  SRRNLLFAAGAFSKS  91
            SRRNLLF AGAFS S
Sbjct  573  SRRNLLFVAGAFSPS  587


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 44/165 (27%), Positives = 69/165 (42%), Gaps = 21/165 (13%)
 Frame = -3

Query  675  YFASASHDRTARIWSM------------------DRIQPLRI---MAGHLSDVDCVQWHA  559
            Y A    D   ++W M                   R  P+R    + GH   V  V +  
Sbjct  294  YLAGGFSDSAIKLWDMVKMGEPSMYSDAGKQSLNKRPTPIRHYIRLVGHAGPVYGVDFSP  353

Query  558  NCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWD  379
              + + + S D T+RLW  +    +  + GH   +  +  SP G Y AS   D    VW 
Sbjct  354  EGDSLLSASGDCTIRLWSTRLNANLACYKGHNYPVWDVQYSPVGHYFASASYDRTARVWS  413

Query  378  LASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVTT  244
            +   + +  + GH S V  + +    + +A+GS+D TV+LWDV T
Sbjct  414  MDRLQPLRIMAGHLSDVDCVQWHVNCNYIATGSSDKTVRLWDVQT  458


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 41/162 (25%), Positives = 70/162 (43%), Gaps = 38/162 (23%)
 Frame = -3

Query  477  FIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLAS---------------GRCITP---  352
            F+   + +   ++S DG Y+A G  D  I +WD+                  +  TP   
Sbjct  276  FVNTNNSLNCASISADGAYLAGGFSDSAIKLWDMVKMGEPSMYSDAGKQSLNKRPTPIRH  335

Query  351  ---LVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSL  181
               LVGHA  V+ + FS EG  L S S DCT++LW                 ST    +L
Sbjct  336  YIRLVGHAGPVYGVDFSPEGDSLLSASGDCTIRLW-----------------STRLNANL  378

Query  180  KTLPTKSTPLYALRFSRRNLLFAAGAFSKSA*YYNIFTLENL  55
                  + P++ +++S     FA+ ++ ++A  +++  L+ L
Sbjct  379  ACYKGHNYPVWDVQYSPVGHYFASASYDRTARVWSMDRLQPL  420


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 36/130 (28%), Positives = 55/130 (42%), Gaps = 21/130 (16%)
 Frame = -3

Query  582  VDCVQWHANCNYIATGSSDKTVRLWD-VQSGE-----------------CVRIFI---GH  466
            ++C    A+  Y+A G SD  ++LWD V+ GE                  +R +I   GH
Sbjct  283  LNCASISADGAYLAGGFSDSAIKLWDMVKMGEPSMYSDAGKQSLNKRPTPIRHYIRLVGH  342

Query  465  RSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLAS  286
               +  +  SP+G  + S   D  I +W       +    GH   VW + +S  G   AS
Sbjct  343  AGPVYGVDFSPEGDSLLSASGDCTIRLWSTRLNANLACYKGHNYPVWDVQYSPVGHYFAS  402

Query  285  GSADCTVKLW  256
             S D T ++W
Sbjct  403  ASYDRTARVW  412



>gb|EMT08674.1| Transcription initiation factor TFIID subunit 5 [Aegilops tauschii]
Length=924

 Score =   333 bits (853),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 150/180 (83%), Positives = 168/180 (93%), Gaps = 0/180 (0%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFASASHDRTARIWSMD+IQPLRIMAGHL+DVDCVQWH NCNYIATGSSDKTVRLWDVQ+
Sbjct  376  YFASASHDRTARIWSMDKIQPLRIMAGHLADVDCVQWHVNCNYIATGSSDKTVRLWDVQT  435

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GEC+R+FIGHRSM+LSLAMSPDGRYMASGDEDG IM+WDL++GRC++PL GH SCVW+LA
Sbjct  436  GECIRMFIGHRSMVLSLAMSPDGRYMASGDEDGTIMMWDLSTGRCVSPLAGHNSCVWSLA  495

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            FSCEG+LLASGSADCTVKLWDV +STK  K ++ K+GSTNRLR LK LPTKSTP+Y LRF
Sbjct  496  FSCEGALLASGSADCTVKLWDVASSTKALKMDDTKAGSTNRLRLLKALPTKSTPVYNLRF  555


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 55/121 (45%), Gaps = 4/121 (3%)
 Frame = -3

Query  606  IMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDG  427
            ++ G  SD     W    +    G   KT RLW  +    +  + GH   +  +  SP G
Sbjct  319  MVVGGFSDSSVKVW----DMAKIGQPAKTFRLWSTKLNANLVCYKGHNYPVWDVQFSPVG  374

Query  426  RYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVT  247
             Y AS   D    +W +   + +  + GH + V  + +    + +A+GS+D TV+LWDV 
Sbjct  375  HYFASASHDRTARIWSMDKIQPLRIMAGHLADVDCVQWHVNCNYIATGSSDKTVRLWDVQ  434

Query  246  T  244
            T
Sbjct  435  T  435



>ref|XP_007011732.1| TBP-associated factor 5 isoform 3 [Theobroma cacao]
 gb|EOY29351.1| TBP-associated factor 5 isoform 3 [Theobroma cacao]
Length=530

 Score =   314 bits (804),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 143/153 (93%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFASASHDRTARIWSMD+IQP+RIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS
Sbjct  377  YFASASHDRTARIWSMDKIQPMRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  436

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVRIFIGHRSMILSLAMSPDGRYMASGDEDG IM+WDL+SGRC+TPL+GH+SCVWTLA
Sbjct  437  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGTIMMWDLSSGRCVTPLMGHSSCVWTLA  496

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE  217
            FSCEGSLLASGSADCTVKLWDVTTSTK+PK+EE
Sbjct  497  FSCEGSLLASGSADCTVKLWDVTTSTKVPKNEE  529


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 60/121 (50%), Gaps = 0/121 (0%)
 Frame = -3

Query  606  IMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDG  427
            ++ GH   V    +    ++I + S+D T+RLW  +    +  + GH   +  +  SP G
Sbjct  316  LLQGHSGPVYSANFSPLGDFILSSSADTTIRLWSTELNANLVCYKGHNYPVWDVQFSPVG  375

Query  426  RYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVT  247
             Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D TV+LWDV 
Sbjct  376  HYFASASHDRTARIWSMDKIQPMRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQ  435

Query  246  T  244
            +
Sbjct  436  S  436



>ref|XP_010101040.1| Transcription initiation factor TFIID subunit 5 [Morus notabilis]
 gb|EXB86688.1| Transcription initiation factor TFIID subunit 5 [Morus notabilis]
Length=650

 Score =   305 bits (782),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 141/163 (87%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFASASHDRTARIWSMDRIQPLRI+AGHLSDVDC+QWHANCNYIATGSSDKTVRLWDVQS
Sbjct  479  YFASASHDRTARIWSMDRIQPLRILAGHLSDVDCLQWHANCNYIATGSSDKTVRLWDVQS  538

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVRIFIGHRSMILSLAMSPDGRYMASGDEDG IM+WDL SGRC+TPL+GH S VWTLA
Sbjct  539  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGAIMMWDLLSGRCVTPLMGHTSSVWTLA  598

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLR  187
            FSCEGSLLASGSADCTVKLWDVT+STK+ ++E+N  G    L+
Sbjct  599  FSCEGSLLASGSADCTVKLWDVTSSTKVSRTEDNFLGGIFYLQ  641


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/121 (30%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = -3

Query  606  IMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDG  427
            +  GH   V    +    ++I + S+D T+RLW  +    +  + GH   +  +  SP G
Sbjct  418  LFQGHSGPVYSATFSPLGDFILSSSADSTIRLWSTKLNANLVCYKGHNYPVWDVQYSPVG  477

Query  426  RYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVT  247
             Y AS   D    +W +   + +  L GH S V  L +    + +A+GS+D TV+LWDV 
Sbjct  478  HYFASASHDRTARIWSMDRIQPLRILAGHLSDVDCLQWHANCNYIATGSSDKTVRLWDVQ  537

Query  246  T  244
            +
Sbjct  538  S  538



>ref|XP_001769775.1| TFIID and SAGA complex subunit [Physcomitrella patens]
 gb|EDQ65337.1| TFIID and SAGA complex subunit [Physcomitrella patens]
Length=673

 Score =   303 bits (777),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 141/195 (72%), Positives = 164/195 (84%), Gaps = 1/195 (1%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFA+ASHDRTARIW M+R+QPLRI+ GH+SDVDC+QWH NCNY+ATG +D TVRLWDVQ+
Sbjct  473  YFATASHDRTARIWCMERMQPLRILVGHMSDVDCLQWHVNCNYVATGGTDNTVRLWDVQT  532

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GEC+R+F GH   +LSLAMS DGRYMASGD+ G I +WDL SG+C+ PL+GH SCVWTLA
Sbjct  533  GECLRVFNGHCGTVLSLAMSSDGRYMASGDDRGAIFMWDLGSGQCVAPLMGHTSCVWTLA  592

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            FS EGSLLASGSAD TV+LWDV  S+K  +SEE K  +T  LR LKTLPTKSTP+YAL+F
Sbjct  593  FSGEGSLLASGSADNTVRLWDVNASSKGSRSEE-KLSATRHLRLLKTLPTKSTPVYALKF  651

Query  135  SRRNLLFAAGAFSKS  91
            SR NLL AAGAFS S
Sbjct  652  SRTNLLLAAGAFSPS  666


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 60/121 (50%), Gaps = 0/121 (0%)
 Frame = -3

Query  606  IMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDG  427
            ++ GH   V    +  +  ++ T S+D TVRLW ++    +  + GH   +  +  SP G
Sbjct  412  LLQGHAGPVYAASFSPDSEFLLTSSADCTVRLWSMRLKTNLMGYKGHNFPVWDVQYSPVG  471

Query  426  RYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVT  247
             Y A+   D    +W +   + +  LVGH S V  L +    + +A+G  D TV+LWDV 
Sbjct  472  HYFATASHDRTARIWCMERMQPLRILVGHMSDVDCLQWHVNCNYVATGGTDNTVRLWDVQ  531

Query  246  T  244
            T
Sbjct  532  T  532



>gb|AFW57937.1| hypothetical protein ZEAMMB73_474444 [Zea mays]
Length=846

 Score =   301 bits (772),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 146/215 (68%), Positives = 165/215 (77%), Gaps = 34/215 (16%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFASASHDRT RIWS+D+IQPLRIMAGHLSDVDCVQWH NCNYI TGSSDKTVRLWDVQ+
Sbjct  629  YFASASHDRTVRIWSVDKIQPLRIMAGHLSDVDCVQWHVNCNYIGTGSSDKTVRLWDVQT  688

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GEC+R+FIGHRSM+LSLAMSPDGRYMASGDEDG IM+WDL++G C++PL+GH+SCVWTLA
Sbjct  689  GECIRMFIGHRSMVLSLAMSPDGRYMASGDEDGTIMIWDLSTGCCVSPLLGHSSCVWTLA  748

Query  315  FS---------------------------------CEGSLLASGSADCTVKLWDVTTSTK  235
            FS                                 CEG+LLASGSADCTVKLWDV  STK
Sbjct  749  FSSPQVSFYLNASCMSLPKEQVFIAVKGKPGLISCCEGALLASGSADCTVKLWDVAFSTK  808

Query  234  MPKSEENK-SGSTNRLRSLKTLPTKSTPLYALRFS  133
              K+E+ K S S NRLR LK+LPTKS P+Y+LR  
Sbjct  809  AMKTEDTKGSSSANRLRLLKSLPTKSAPVYSLRIQ  843



>gb|KCW81293.1| hypothetical protein EUGRSUZ_C02661 [Eucalyptus grandis]
 gb|KCW81294.1| hypothetical protein EUGRSUZ_C02661 [Eucalyptus grandis]
Length=725

 Score =   297 bits (760),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 133/154 (86%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFAS+SHDRTAR+WS+DRIQPLRIMAGHLSDVDCVQWH NCNYIATGSSDKTVRLWDV S
Sbjct  572  YFASSSHDRTARLWSVDRIQPLRIMAGHLSDVDCVQWHPNCNYIATGSSDKTVRLWDVAS  631

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVRIFIGHRSMILSLAMSPDGRYMASGDEDG IM+WDL+SGRCI PL+GH SCVWTLA
Sbjct  632  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGTIMMWDLSSGRCIMPLMGHTSCVWTLA  691

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEEN  214
            +SCEG+LLASGSADCT+KLWD+ TS K+P++EE 
Sbjct  692  YSCEGTLLASGSADCTLKLWDIATSAKLPRTEEK  725


 Score = 62.0 bits (149),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = -3

Query  606  IMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDG  427
            +  GH   +    +    ++I T S+D T+RLW  +    +  + GH   +  +  SP G
Sbjct  511  LFQGHSGPIHSATFSPLGDFILTSSADSTIRLWSTKLNANLVCYKGHNYPVWDVQFSPAG  570

Query  426  RYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVT  247
             Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D TV+LWDV 
Sbjct  571  HYFASSSHDRTARLWSVDRIQPLRIMAGHLSDVDCVQWHPNCNYIATGSSDKTVRLWDVA  630

Query  246  T  244
            +
Sbjct  631  S  631



>gb|KHN29623.1| Transcription initiation factor TFIID subunit 5 [Glycine soja]
Length=664

 Score =   280 bits (715),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 141/197 (72%), Positives = 154/197 (78%), Gaps = 33/197 (17%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFAS+SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS
Sbjct  500  YFASSSHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  559

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
                                           DG IM+WDL+SGRC+TPL+GH SCVW+LA
Sbjct  560  -------------------------------DGTIMMWDLSSGRCLTPLIGHTSCVWSLA  588

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTN-RLRSLKTLPTKSTPLYALR  139
            FS EGS++ASGSADCTVKLWDV  STK+ ++EE KSGS N RLRSLKTL TKSTP+Y+LR
Sbjct  589  FSSEGSIIASGSADCTVKLWDVNASTKVSRAEE-KSGSANSRLRSLKTLSTKSTPVYSLR  647

Query  138  FSRRNLLFAAGAFSKSA  88
            FSRRNLLFAAGA SKS 
Sbjct  648  FSRRNLLFAAGALSKSG  664



>gb|AFW74199.1| hypothetical protein ZEAMMB73_168723 [Zea mays]
Length=407

 Score =   258 bits (659),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 138/180 (77%), Gaps = 31/180 (17%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFASASHDRTARIWS+D+IQPLRIMAGHLSDVDCVQWH NCNYIATGSSDKTVRLWDVQ+
Sbjct  255  YFASASHDRTARIWSIDKIQPLRIMAGHLSDVDCVQWHVNCNYIATGSSDKTVRLWDVQT  314

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GEC+R+FIGHRSM+LSLAMSPDGRYMASGDEDG IM+WDL++GRC++PL+GH+SCV TLA
Sbjct  315  GECIRMFIGHRSMVLSLAMSPDGRYMASGDEDGTIMIWDLSTGRCVSPLLGHSSCVRTLA  374

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            FS                                 S S NRLR LK+LPTKS P Y+LR 
Sbjct  375  FS-------------------------------KGSSSANRLRLLKSLPTKSAPFYSLRI  403


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/121 (29%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = -3

Query  606  IMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDG  427
            +  GH   V    +    +++ + SSD T+RLW  +    +  + GH   +  +  SP G
Sbjct  194  LFQGHSGPVYSAAFSPFGDFLLSSSSDLTIRLWSTKLNANLVCYKGHNYPVWDVQFSPVG  253

Query  426  RYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVT  247
             Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D TV+LWDV 
Sbjct  254  HYFASASHDRTARIWSIDKIQPLRIMAGHLSDVDCVQWHVNCNYIATGSSDKTVRLWDVQ  313

Query  246  T  244
            T
Sbjct  314  T  314



>ref|XP_008650104.1| PREDICTED: transcription initiation factor TFIID subunit 5-like 
[Zea mays]
Length=482

 Score =   258 bits (659),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 123/179 (69%), Positives = 138/179 (77%), Gaps = 31/179 (17%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFASASHDRTARIWS+D+IQPLRIMAGHLSDVDCVQWH NCNYIATGSSDKTVRLWDVQ+
Sbjct  330  YFASASHDRTARIWSIDKIQPLRIMAGHLSDVDCVQWHVNCNYIATGSSDKTVRLWDVQT  389

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GEC+R+FIGHRSM+LSLAMSPDGRYMASGDEDG IM+WDL++GRC++PL+GH+SCV TLA
Sbjct  390  GECIRMFIGHRSMVLSLAMSPDGRYMASGDEDGTIMIWDLSTGRCVSPLLGHSSCVRTLA  449

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALR  139
            FS                                 S S NRLR LK+LPTKS P Y+LR
Sbjct  450  FS-------------------------------KGSSSANRLRLLKSLPTKSAPFYSLR  477


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/121 (29%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = -3

Query  606  IMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDG  427
            +  GH   V    +    +++ + SSD T+RLW  +    +  + GH   +  +  SP G
Sbjct  269  LFQGHSGPVYSAAFSPFGDFLLSSSSDLTIRLWSTKLNANLVCYKGHNYPVWDVQFSPVG  328

Query  426  RYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVT  247
             Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D TV+LWDV 
Sbjct  329  HYFASASHDRTARIWSIDKIQPLRIMAGHLSDVDCVQWHVNCNYIATGSSDKTVRLWDVQ  388

Query  246  T  244
            T
Sbjct  389  T  389



>gb|KJB07685.1| hypothetical protein B456_001G037500 [Gossypium raimondii]
Length=619

 Score =   256 bits (653),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 129/145 (89%), Gaps = 1/145 (1%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFAS+SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSD+TVRLWDVQS
Sbjct  474  YFASSSHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDRTVRLWDVQS  533

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVRIFIGHRSMILSLAMSPDGRYMASGDEDG IM+WDL+SGRC+TPL+GH SCVW+LA
Sbjct  534  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGTIMMWDLSSGRCVTPLMGHTSCVWSLA  593

Query  315  FSCEGSLLASGSADCTVKLW-DVTT  244
            F  E  LL    +   + L+ DV T
Sbjct  594  FRWESLLLYIQKSYTEIHLFLDVDT  618


 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/144 (33%), Positives = 78/144 (54%), Gaps = 0/144 (0%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            +  S+S D T R+WS      L    GH   V  VQ+    +Y A+ S D+T R+W +  
Sbjct  432  FILSSSADTTIRLWSTKLNANLVCYKGHNYPVWDVQFSPVGHYFASSSHDRTARIWSMDR  491

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
             + +RI  GH S +  +    +  Y+A+G  D  + +WD+ SG C+   +GH S + +LA
Sbjct  492  IQPLRIMAGHLSDVDCVQWHANCNYIATGSSDRTVRLWDVQSGECVRIFIGHRSMILSLA  551

Query  315  FSCEGSLLASGSADCTVKLWDVTT  244
             S +G  +ASG  D T+ +WD+++
Sbjct  552  MSPDGRYMASGDEDGTIMMWDLSS  575


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = -3

Query  606  IMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDG  427
            +  GH   V    +    ++I + S+D T+RLW  +    +  + GH   +  +  SP G
Sbjct  413  LFQGHSGPVYSATFSPLGDFILSSSADTTIRLWSTKLNANLVCYKGHNYPVWDVQFSPVG  472

Query  426  RYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVT  247
             Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D TV+LWDV 
Sbjct  473  HYFASSSHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDRTVRLWDVQ  532

Query  246  T  244
            +
Sbjct  533  S  533



>gb|AFW87526.1| hypothetical protein ZEAMMB73_966623 [Zea mays]
Length=501

 Score =   250 bits (638),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 108/128 (84%), Positives = 122/128 (95%), Gaps = 0/128 (0%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFASASHDRTARIWSMD+IQPLRIMAGHLSDVDCVQWH NCNYIATGSSDKTVRLWDVQ+
Sbjct  374  YFASASHDRTARIWSMDKIQPLRIMAGHLSDVDCVQWHVNCNYIATGSSDKTVRLWDVQT  433

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GEC+R+FIGHRSM+LSLAMSPDGRYMASGDEDG IM+WDL++GRC++PL+GH+SCVWTLA
Sbjct  434  GECIRMFIGHRSMVLSLAMSPDGRYMASGDEDGTIMIWDLSTGRCVSPLLGHSSCVWTLA  493

Query  315  FSCEGSLL  292
            F  E  ++
Sbjct  494  FRFEDHVI  501


 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/135 (35%), Positives = 73/135 (54%), Gaps = 0/135 (0%)
 Frame = -3

Query  648  TARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIG  469
            T R+WS      L    GH   V  VQ+    +Y A+ S D+T R+W +   + +RI  G
Sbjct  341  TIRLWSTKLNANLVCYKGHNYPVWDVQFSPVGHYFASASHDRTARIWSMDKIQPLRIMAG  400

Query  468  HRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLA  289
            H S +  +    +  Y+A+G  D  + +WD+ +G CI   +GH S V +LA S +G  +A
Sbjct  401  HLSDVDCVQWHVNCNYIATGSSDKTVRLWDVQTGECIRMFIGHRSMVLSLAMSPDGRYMA  460

Query  288  SGSADCTVKLWDVTT  244
            SG  D T+ +WD++T
Sbjct  461  SGDEDGTIMIWDLST  475


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/121 (29%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = -3

Query  606  IMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDG  427
            +  GH   V    +    +++ + SSD T+RLW  +    +  + GH   +  +  SP G
Sbjct  313  LFQGHSGPVYSAAFSPFGDFLLSSSSDSTIRLWSTKLNANLVCYKGHNYPVWDVQFSPVG  372

Query  426  RYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVT  247
             Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D TV+LWDV 
Sbjct  373  HYFASASHDRTARIWSMDKIQPLRIMAGHLSDVDCVQWHVNCNYIATGSSDKTVRLWDVQ  432

Query  246  T  244
            T
Sbjct  433  T  433



>gb|AFW87525.1| hypothetical protein ZEAMMB73_966623 [Zea mays]
Length=588

 Score =   251 bits (640),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 108/128 (84%), Positives = 122/128 (95%), Gaps = 0/128 (0%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFASASHDRTARIWSMD+IQPLRIMAGHLSDVDCVQWH NCNYIATGSSDKTVRLWDVQ+
Sbjct  461  YFASASHDRTARIWSMDKIQPLRIMAGHLSDVDCVQWHVNCNYIATGSSDKTVRLWDVQT  520

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GEC+R+FIGHRSM+LSLAMSPDGRYMASGDEDG IM+WDL++GRC++PL+GH+SCVWTLA
Sbjct  521  GECIRMFIGHRSMVLSLAMSPDGRYMASGDEDGTIMIWDLSTGRCVSPLLGHSSCVWTLA  580

Query  315  FSCEGSLL  292
            F  E  ++
Sbjct  581  FRFEDHVI  588


 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/135 (35%), Positives = 73/135 (54%), Gaps = 0/135 (0%)
 Frame = -3

Query  648  TARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIG  469
            T R+WS      L    GH   V  VQ+    +Y A+ S D+T R+W +   + +RI  G
Sbjct  428  TIRLWSTKLNANLVCYKGHNYPVWDVQFSPVGHYFASASHDRTARIWSMDKIQPLRIMAG  487

Query  468  HRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLA  289
            H S +  +    +  Y+A+G  D  + +WD+ +G CI   +GH S V +LA S +G  +A
Sbjct  488  HLSDVDCVQWHVNCNYIATGSSDKTVRLWDVQTGECIRMFIGHRSMVLSLAMSPDGRYMA  547

Query  288  SGSADCTVKLWDVTT  244
            SG  D T+ +WD++T
Sbjct  548  SGDEDGTIMIWDLST  562


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/121 (29%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = -3

Query  606  IMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDG  427
            +  GH   V    +    +++ + SSD T+RLW  +    +  + GH   +  +  SP G
Sbjct  400  LFQGHSGPVYSAAFSPFGDFLLSSSSDSTIRLWSTKLNANLVCYKGHNYPVWDVQFSPVG  459

Query  426  RYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVT  247
             Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D TV+LWDV 
Sbjct  460  HYFASASHDRTARIWSMDKIQPLRIMAGHLSDVDCVQWHVNCNYIATGSSDKTVRLWDVQ  519

Query  246  T  244
            T
Sbjct  520  T  520



>ref|XP_008658971.1| PREDICTED: uncharacterized protein LOC100501797 isoform X1 [Zea 
mays]
Length=585

 Score =   249 bits (636),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 107/121 (88%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFASASHDRTARIWSMD+IQPLRIMAGHLSDVDCVQWH NCNYIATGSSDKTVRLWDVQ+
Sbjct  461  YFASASHDRTARIWSMDKIQPLRIMAGHLSDVDCVQWHVNCNYIATGSSDKTVRLWDVQT  520

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GEC+R+FIGHRSM+LSLAMSPDGRYMASGDEDG IM+WDL++GRC++PL+GH+SCVWTLA
Sbjct  521  GECIRMFIGHRSMVLSLAMSPDGRYMASGDEDGTIMIWDLSTGRCVSPLLGHSSCVWTLA  580

Query  315  F  313
            F
Sbjct  581  F  581


 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/135 (35%), Positives = 73/135 (54%), Gaps = 0/135 (0%)
 Frame = -3

Query  648  TARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIG  469
            T R+WS      L    GH   V  VQ+    +Y A+ S D+T R+W +   + +RI  G
Sbjct  428  TIRLWSTKLNANLVCYKGHNYPVWDVQFSPVGHYFASASHDRTARIWSMDKIQPLRIMAG  487

Query  468  HRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLA  289
            H S +  +    +  Y+A+G  D  + +WD+ +G CI   +GH S V +LA S +G  +A
Sbjct  488  HLSDVDCVQWHVNCNYIATGSSDKTVRLWDVQTGECIRMFIGHRSMVLSLAMSPDGRYMA  547

Query  288  SGSADCTVKLWDVTT  244
            SG  D T+ +WD++T
Sbjct  548  SGDEDGTIMIWDLST  562


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/121 (29%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = -3

Query  606  IMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDG  427
            +  GH   V    +    +++ + SSD T+RLW  +    +  + GH   +  +  SP G
Sbjct  400  LFQGHSGPVYSAAFSPFGDFLLSSSSDSTIRLWSTKLNANLVCYKGHNYPVWDVQFSPVG  459

Query  426  RYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVT  247
             Y AS   D    +W +   + +  + GH S V  + +    + +A+GS+D TV+LWDV 
Sbjct  460  HYFASASHDRTARIWSMDKIQPLRIMAGHLSDVDCVQWHVNCNYIATGSSDKTVRLWDVQ  519

Query  246  T  244
            T
Sbjct  520  T  520



>ref|XP_004348907.1| TBP-associated factor 5 [Capsaspora owczarzaki ATCC 30864]
 gb|KJE90929.1| TBP-associated factor 5 [Capsaspora owczarzaki ATCC 30864]
Length=732

 Score =   238 bits (606),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 116/200 (58%), Positives = 143/200 (72%), Gaps = 8/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFASASHDRTAR+WS + I PLRI AGH SDVD V++H NCNY+ATGSSD+TVRLWDVQS
Sbjct  531  YFASASHDRTARLWSCEEIYPLRIFAGHESDVDVVKFHPNCNYVATGSSDRTVRLWDVQS  590

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVR+F GH   ++SLA+SPDG+Y+AS   D  +++WDL SGR ++   GHA+ V++L 
Sbjct  591  GECVRLFTGHTGAVMSLAISPDGKYIASSGVDKTVILWDLGSGRRVSTFSGHANVVYSLD  650

Query  315  FSCEGSLLASGSADCTVKLWDV--------TTSTKMPKSEENKSGSTNRLRSLKTLPTKS  160
            FS EGSLLASGSAD TV++WDV        ++S    +   N   +      L T  TKS
Sbjct  651  FSIEGSLLASGSADSTVRIWDVKAAVSSAASSSNATARRPPNAKAAITSPELLTTYNTKS  710

Query  159  TPLYALRFSRRNLLFAAGAF  100
            TP+  LRFS RNLLF AG F
Sbjct  711  TPVSCLRFSHRNLLFGAGVF  730


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/122 (30%), Positives = 60/122 (49%), Gaps = 0/122 (0%)
 Frame = -3

Query  609  RIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPD  430
            R + GH   V    +  +   + + S D TVRLW +++   + ++ GH S + S++ +  
Sbjct  469  RSLMGHSGAVYSTDFSTDNRLLLSASQDSTVRLWSLETMSNLVVYRGHLSPVWSVSFASV  528

Query  429  GRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDV  250
            G Y AS   D    +W       +    GH S V  + F    + +A+GS+D TV+LWDV
Sbjct  529  GHYFASASHDRTARLWSCEEIYPLRIFAGHESDVDVVKFHPNCNYVATGSSDRTVRLWDV  588

Query  249  TT  244
             +
Sbjct  589  QS  590



>ref|XP_637246.1| transcription initiation factor TFIID subunit [Dictyostelium 
discoideum AX4]
 gb|EAL63736.1| transcription initiation factor TFIID subunit [Dictyostelium 
discoideum AX4]
Length=948

 Score =   232 bits (592),  Expect = 7e-67, Method: Composition-based stats.
 Identities = 107/206 (52%), Positives = 151/206 (73%), Gaps = 13/206 (6%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFA+ASHDRTAR+W+ + I PLRI  GHLSD + V++H N NY+ATGS+DK+ RLW++Q+
Sbjct  735  YFATASHDRTARLWTTNHISPLRIFTGHLSDCNTVRFHPNINYLATGSNDKSARLWEIQT  794

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G+CVRIF+GHR+ I ++A SPDGR +A+  ED  +++WDL++G+ +  + GH  CV++L 
Sbjct  795  GKCVRIFMGHRAPIYTVAFSPDGRLLATAGEDTSVILWDLSTGKKVKKMDGHTKCVYSLD  854

Query  315  FSCEGSLLASGSADCTVKLWDV------TTSTKMPKSEENKSGSTNRLRS-------LKT  175
            FSC+GS+LASGS+DCTV+LWDV      + ST+      ++S     L+S       L+T
Sbjct  855  FSCDGSILASGSSDCTVRLWDVKKAFNSSLSTQPSSLINDESRKRKTLKSKLFSDELLET  914

Query  174  LPTKSTPLYALRFSRRNLLFAAGAFS  97
             PTK TP+Y + FSRRNLL A+GAF+
Sbjct  915  YPTKQTPVYNVCFSRRNLLLASGAFN  940


 Score = 52.8 bits (125),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 36/139 (26%), Positives = 57/139 (41%), Gaps = 17/139 (12%)
 Frame = -3

Query  483  RIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCE  304
            + F+GH   +   + SPD +Y+ S  ED    +W + +   +    GH   VW ++FS  
Sbjct  673  KTFLGHSGPVYGCSFSPDSQYLLSCSEDTTARLWSMETMSNLVCYKGHNFPVWDVSFSPF  732

Query  303  GSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRFSRRN  124
            G   A+ S D T +LW                 +TN +  L+      +    +RF    
Sbjct  733  GFYFATASHDRTARLW-----------------TTNHISPLRIFTGHLSDCNTVRFHPNI  775

Query  123  LLFAAGAFSKSA*YYNIFT  67
               A G+  KSA  + I T
Sbjct  776  NYLATGSNDKSARLWEIQT  794



>ref|XP_003057739.1| transcription factor TFIID with WD40 repeat [Micromonas pusilla 
CCMP1545]
 gb|EEH57690.1| transcription factor TFIID with WD40 repeat [Micromonas pusilla 
CCMP1545]
Length=745

 Score =   230 bits (586),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 112/195 (57%), Positives = 141/195 (72%), Gaps = 4/195 (2%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFASASHD+TAR+W+MD   P RIM GHL+DVD V WH NCNYIATGSSD+T+RLWDV +
Sbjct  540  YFASASHDKTARVWAMDVATPRRIMVGHLADVDVVTWHPNCNYIATGSSDRTLRLWDVST  599

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVRIF GHR  I S+AMSPDG+ MASG +DG I+ WDL S +C     GHA  V++L 
Sbjct  600  GECVRIFTGHRGGIRSIAMSPDGKSMASGSDDGGILTWDLGSAKCERAFAGHAGAVYSLD  659

Query  315  FS-CEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGST---NRLRSLKTLPTKSTPLY  148
            ++  + +LLASG AD TV+LWDVTT +    +    +       R  ++KTL T+STP+Y
Sbjct  660  YAGGDATLLASGGADETVRLWDVTTGSGSVVAGGGGTAGGGTKKRAGAVKTLRTRSTPVY  719

Query  147  ALRFSRRNLLFAAGA  103
            A++F+RRNLL   GA
Sbjct  720  AVKFTRRNLLIGMGA  734


 Score = 59.3 bits (142),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 61/120 (51%), Gaps = 4/120 (3%)
 Frame = -3

Query  597  GHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDGRYM  418
            GH S V  V       ++ + S D TVR W +Q    +  +  H   +  +  +P G Y 
Sbjct  482  GHSSAVHAVSLSPGNEFLLSCSRDSTVRAWSMQLEMPLCAYRSHNYPVWDVKWAPTGHYF  541

Query  417  ASGDEDGKIMVW--DLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVTT  244
            AS   D    VW  D+A+ R I  +VGH + V  + +    + +A+GS+D T++LWDV+T
Sbjct  542  ASASHDKTARVWAMDVATPRRI--MVGHLADVDVVTWHPNCNYIATGSSDRTLRLWDVST  599



>ref|XP_002500199.1| TATA binding protein associated factor 5 protein [Micromonas 
sp. RCC299]
 gb|ACO61457.1| TATA binding protein associated factor 5 protein [Micromonas 
sp. RCC299]
Length=706

 Score =   228 bits (580),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 113/207 (55%), Positives = 146/207 (71%), Gaps = 9/207 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFASAS+D TAR+W+MD  QP R+M GHL+DVDCV WH N NYIATGS+D+TVRLWDVQ+
Sbjct  496  YFASASNDCTARVWAMDESQPRRVMVGHLADVDCVAWHPNTNYIATGSTDRTVRLWDVQT  555

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G+CVRIF GHR  + SLAMSPDG+ MASG +DG ++VWDLA+ +C     GH   V++L 
Sbjct  556  GDCVRIFTGHRGGVRSLAMSPDGKSMASGSDDGGVLVWDLATAKCSHAFEGHGGAVYSLD  615

Query  315  FS-CEGSLLASGSADCTVKLWDVTTSTKMPKS--------EENKSGSTNRLRSLKTLPTK  163
            +S   G++LASG AD TVKLWDV+ S     +         ENK+ +  R   + +L TK
Sbjct  616  YSHGAGTVLASGGADETVKLWDVSQSALNEANGGEAGAVKAENKASAAARKPPMTSLRTK  675

Query  162  STPLYALRFSRRNLLFAAGAFSKSA*Y  82
            STP++ ++F+ RNLL A GA + S  Y
Sbjct  676  STPVFNVQFTGRNLLMAMGARAPSVRY  702


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 59/127 (46%), Gaps = 0/127 (0%)
 Frame = -3

Query  624  RIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSL  445
            R  P     GH + V  V      +++ + S D+T+R+W  +    +  +  HR  +  +
Sbjct  429  RPVPCVEYVGHSAAVHGVDLSPGHDFLLSCSRDQTIRVWSTRLEIPLAAYKSHRFPVWDV  488

Query  444  AMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTV  265
                 G Y AS   D    VW +   +    +VGH + V  +A+    + +A+GS D TV
Sbjct  489  KWCGTGHYFASASNDCTARVWAMDESQPRRVMVGHLADVDCVAWHPNTNYIATGSTDRTV  548

Query  264  KLWDVTT  244
            +LWDV T
Sbjct  549  RLWDVQT  555



>ref|XP_002500198.1| transcription factor TFIID with WD40 repeat [Micromonas sp. RCC299]
 gb|ACO61456.1| transcription factor TFIID with WD40 repeat [Micromonas sp. RCC299]
Length=755

 Score =   228 bits (581),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 113/207 (55%), Positives = 146/207 (71%), Gaps = 9/207 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFASAS+D TAR+W+MD  QP R+M GHL+DVDCV WH N NYIATGS+D+TVRLWDVQ+
Sbjct  545  YFASASNDCTARVWAMDESQPRRVMVGHLADVDCVAWHPNTNYIATGSTDRTVRLWDVQT  604

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G+CVRIF GHR  + SLAMSPDG+ MASG +DG ++VWDLA+ +C     GH   V++L 
Sbjct  605  GDCVRIFTGHRGGVRSLAMSPDGKSMASGSDDGGVLVWDLATAKCSHAFEGHGGAVYSLD  664

Query  315  FS-CEGSLLASGSADCTVKLWDVTTSTKMPKS--------EENKSGSTNRLRSLKTLPTK  163
            +S   G++LASG AD TVKLWDV+ S     +         ENK+ +  R   + +L TK
Sbjct  665  YSHGAGTVLASGGADETVKLWDVSQSALNEANGGEAGAVKAENKASAAARKPPMTSLRTK  724

Query  162  STPLYALRFSRRNLLFAAGAFSKSA*Y  82
            STP++ ++F+ RNLL A GA + S  Y
Sbjct  725  STPVFNVQFTGRNLLMAMGARAPSVRY  751


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 59/127 (46%), Gaps = 0/127 (0%)
 Frame = -3

Query  624  RIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSL  445
            R  P     GH + V  V      +++ + S D+T+R+W  +    +  +  HR  +  +
Sbjct  478  RPVPCVEYVGHSAAVHGVDLSPGHDFLLSCSRDQTIRVWSTRLEIPLAAYKSHRFPVWDV  537

Query  444  AMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTV  265
                 G Y AS   D    VW +   +    +VGH + V  +A+    + +A+GS D TV
Sbjct  538  KWCGTGHYFASASNDCTARVWAMDESQPRRVMVGHLADVDCVAWHPNTNYIATGSTDRTV  597

Query  264  KLWDVTT  244
            +LWDV T
Sbjct  598  RLWDVQT  604



>ref|XP_003292803.1| hypothetical protein DICPUDRAFT_157560 [Dictyostelium purpureum]
 gb|EGC30678.1| hypothetical protein DICPUDRAFT_157560 [Dictyostelium purpureum]
Length=924

 Score =   229 bits (583),  Expect = 8e-66, Method: Composition-based stats.
 Identities = 108/209 (52%), Positives = 152/209 (73%), Gaps = 17/209 (8%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFA+ASHDRTAR+W+ + I PLRI  GHLSD + V++H N NY+ATGS+DK+ RLW++Q+
Sbjct  709  YFATASHDRTARLWTTNYISPLRIFTGHLSDCNTVKFHPNINYLATGSNDKSARLWEIQT  768

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G+CVRIF+GHR+ I SLA SPDGR +A+  ED  +++WDL++G+ +  + GH  CV++L 
Sbjct  769  GKCVRIFMGHRAPIYSLAFSPDGRLLATAGEDTSVILWDLSTGKKVKKMDGHTKCVYSLD  828

Query  315  FSCEGSLLASGSADCTVKLWDV------TTSTKMPKSEENKSGSTNRLRSLK--------  178
            FS +GS+LASGS+DCTV+LWDV      + ST+   ++E    + N+ +S+K        
Sbjct  829  FSQDGSILASGSSDCTVRLWDVKKAFNNSISTQTSINDEAIRNA-NKRKSIKSKLFSEEL  887

Query  177  --TLPTKSTPLYALRFSRRNLLFAAGAFS  97
              T PTK TP+Y + FSRRNLL A+GAF+
Sbjct  888  IETYPTKQTPVYTVSFSRRNLLLASGAFN  916



>gb|EIE80005.1| hypothetical protein RO3G_04710 [Rhizopus delemar RA 99-880]
Length=677

 Score =   226 bits (576),  Expect = 1e-65, Method: Composition-based stats.
 Identities = 103/200 (52%), Positives = 134/200 (67%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFA+ASHDRTAR+WS D I PLRI  GHLSDVD V++H N  Y+ TGSSD+T RLWD+ +
Sbjct  471  YFATASHDRTARLWSCDHIGPLRIFTGHLSDVDTVKFHPNSKYLVTGSSDRTCRLWDISN  530

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G+CVR+F GH   I ++A+SP+GRYMAS  ED  IM+WDL SG+ I  + GH   V++L 
Sbjct  531  GQCVRVFTGHTGAIKTVAVSPNGRYMASAGEDKSIMLWDLKSGKKIKKMTGHTGFVYSLE  590

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRS-------LKTLPTKST  157
            FS + ++L SG +DCTV++WDV T    P   E K       R        L   PTK T
Sbjct  591  FSADNNILVSGGSDCTVRVWDVNTEEVDPMEMEPKRRKLEDDRRIYESRDHLGVFPTKQT  650

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+Y ++F+ RNL  A+GAF+
Sbjct  651  PIYNIQFTDRNLCLASGAFT  670



>gb|EFA76132.1| transcription initiation factor TFIID subunit [Polysphondylium 
pallidum PN500]
Length=639

 Score =   225 bits (573),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/205 (50%), Positives = 146/205 (71%), Gaps = 13/205 (6%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFA+ASHD+TAR+W  + I P+RI AGHLSDV+CV++H N NY+ATGSSDK+ RLW+  +
Sbjct  428  YFATASHDKTARLWCTNYISPMRIFAGHLSDVNCVKFHPNINYVATGSSDKSARLWECHT  487

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G+CVRIF+GHR+ I S+++SPDG+Y+A+  ED  I++WDL SG+ I  + GH   +++L 
Sbjct  488  GKCVRIFMGHRAPIYSVSISPDGKYLATAGEDTSIILWDLGSGKKIKKMDGHNKTIYSLD  547

Query  315  FSCEGSLLASGSADCTVKLWDV------TTSTKMPKSEENKSGSTNRLRS-------LKT  175
            FS +GS+LAS SADCTV+LWDV      +T+T +  +         RL+        L+T
Sbjct  548  FSMDGSILASASADCTVRLWDVNAASSTSTNTNIEDTVSKTPSKKARLKQKRISPELLET  607

Query  174  LPTKSTPLYALRFSRRNLLFAAGAF  100
             PTK TP++ + FSRRNLL ++G +
Sbjct  608  YPTKQTPVFNVTFSRRNLLLSSGPY  632


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 30/97 (31%), Positives = 46/97 (47%), Gaps = 4/97 (4%)
 Frame = -3

Query  546  IATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASG  367
            + TG S  T +  D +     R FIGH   +   ++SPD +++ S  ED    +W L + 
Sbjct  349  MPTGKSTFTQQKMDSE----FRTFIGHCGPVYGCSISPDNQFIMSCSEDNTARLWSLETM  404

Query  366  RCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLW  256
              +    GH   +W + FS  G   A+ S D T +LW
Sbjct  405  SNLVCYKGHNYPIWDVNFSPYGYYFATASHDKTARLW  441



>emb|CAN63613.1| hypothetical protein VITISV_005881 [Vitis vinifera]
Length=118

 Score =   209 bits (531),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = -3

Query  441  MSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVK  262
            MSPDG+YMASGDEDG IM+WDL+SGRC+ PL+GH SCVW+LAFSCEGSLLASGSAD TVK
Sbjct  1    MSPDGQYMASGDEDGTIMMWDLSSGRCVMPLMGHMSCVWSLAFSCEGSLLASGSADSTVK  60

Query  261  LWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRFSRRNLLFAAGAFSKSA  88
            LWDVTTSTK+P+SEENKSG+T+RLRSLKTL TKSTP+Y+LRFSRRNLLFAAGA SKS 
Sbjct  61   LWDVTTSTKVPRSEENKSGNTSRLRSLKTLXTKSTPVYSLRFSRRNLLFAAGALSKSG  118



>ref|XP_005835344.1| hypothetical protein GUITHDRAFT_39635, partial [Guillardia theta 
CCMP2712]
 gb|EKX48364.1| hypothetical protein GUITHDRAFT_39635, partial [Guillardia theta 
CCMP2712]
Length=592

 Score =   221 bits (563),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 108/192 (56%), Positives = 136/192 (71%), Gaps = 1/192 (1%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFA+ASHDRTARIWS D I PLRI+AGHLS VD V +H NCNY+ATGS DKT RLWD+  
Sbjct  401  YFATASHDRTARIWSTDHIYPLRILAGHLSSVDHVVFHPNCNYVATGSVDKTCRLWDITH  460

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVR+F GHRS I  LA+SP G+ +ASG + G+++VWD+AS +CI  L GH   V +  
Sbjct  461  GECVRLFKGHRSPISCLAISPCGKLLASGSDSGELLVWDMASSKCIFELPGHEGGVLSAE  520

Query  315  FSC-EGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALR  139
            FSC EGSLLASG  DCTV+LWD+T + +      +   +   L+ +K L T+ST +  +R
Sbjct  521  FSCGEGSLLASGGQDCTVRLWDMTQANQSKGKGASLRATLTSLQGMKVLHTRSTSMMTVR  580

Query  138  FSRRNLLFAAGA  103
            FSR NLL   G+
Sbjct  581  FSRTNLLLVGGS  592



>gb|EXX76119.1| Cop1p [Rhizophagus irregularis DAOM 197198w]
Length=710

 Score =   222 bits (566),  Expect = 5e-64, Method: Composition-based stats.
 Identities = 108/213 (51%), Positives = 138/213 (65%), Gaps = 21/213 (10%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF +ASHDRTAR+WS D I PLRI AGH+SDVD V++H N  YI TGSSDK+VR+WD+Q 
Sbjct  479  YFVTASHDRTARLWSCDHIYPLRIFAGHISDVDTVKFHPNSKYIVTGSSDKSVRMWDIQG  538

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G C+R+F GH   I  +++S DGR MAS  ED  IM+WDL SG+ +  ++GH S V++L 
Sbjct  539  GRCLRLFSGHTGGISCISISDDGRLMASAGEDKSIMLWDLGSGKLLKKMLGHKSTVYSLD  598

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSE-------------ENKSGS--------T  199
            FS E S+L SG +DCTV+LWDV   T    +E             EN+S S        T
Sbjct  599  FSKESSILVSGGSDCTVRLWDVKKGTSDSPNEDEHYLSKIRMDIDENRSHSSLAKQKQIT  658

Query  198  NRLRSLKTLPTKSTPLYALRFSRRNLLFAAGAF  100
                 + TLPTK TP+Y + F+RRNL  AAGA+
Sbjct  659  ETKDLIATLPTKQTPVYKIHFTRRNLCLAAGAY  691


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 49/195 (25%), Positives = 80/195 (41%), Gaps = 31/195 (16%)
 Frame = -3

Query  603  MAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDGR  424
            + GH   V  + +  +  Y+ + S D+T RLW   +   +  + GH S I  +  SP G 
Sbjct  419  LLGHSGPVFGLSFSPDNKYLISCSEDRTARLWSSDTYTNLVCYKGHNSPIWDVDFSPLGF  478

Query  423  YMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVT-  247
            Y  +   D    +W       +    GH S V T+ F      + +GS+D +V++WD+  
Sbjct  479  YFVTASHDRTARLWSCDHIYPLRIFAGHISDVDTVKFHPNSKYIVTGSSDKSVRMWDIQG  538

Query  246  ---------------------TSTKMPKSEENKS------GSTNRLRSLKTLPTKSTPLY  148
                                     M  + E+KS      GS   L+  K L  KST +Y
Sbjct  539  GRCLRLFSGHTGGISCISISDDGRLMASAGEDKSIMLWDLGSGKLLK--KMLGHKST-VY  595

Query  147  ALRFSRRNLLFAAGA  103
            +L FS+ + +  +G 
Sbjct  596  SLDFSKESSILVSGG  610


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 32/116 (28%), Positives = 51/116 (44%), Gaps = 17/116 (15%)
 Frame = -3

Query  492  ECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAF  313
            +C R+ +GH   +  L+ SPD +Y+ S  ED    +W   +   +    GH S +W + F
Sbjct  415  DCKRL-LGHSGPVFGLSFSPDNKYLISCSEDRTARLWSSDTYTNLVCYKGHNSPIWDVDF  473

Query  312  SCEGSLLASGSADCTVKLW----------------DVTTSTKMPKSEENKSGSTNR  193
            S  G    + S D T +LW                DV T    P S+   +GS+++
Sbjct  474  SPLGFYFVTASHDRTARLWSCDHIYPLRIFAGHISDVDTVKFHPNSKYIVTGSSDK  529



>gb|AFW65564.1| hypothetical protein ZEAMMB73_156387 [Zea mays]
Length=387

 Score =   214 bits (546),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 110/194 (57%), Positives = 131/194 (68%), Gaps = 38/194 (20%)
 Frame = -3

Query  621  IQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLA  442
            +QPLRIMAGHLSDVDCVQWH NCNYIATGSSDKTVRLWDVQ+GEC+R+FIGHRSM+LSLA
Sbjct  203  VQPLRIMAGHLSDVDCVQWHVNCNYIATGSSDKTVRLWDVQTGECIRMFIGHRSMVLSLA  262

Query  441  MSPDGRYMAS--------------GDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCE  304
            MSPDGRYM                GDEDG IM+WDL++GRC++PL+GH+SCVWTLAFS  
Sbjct  263  MSPDGRYMGPLMSAGPRTENRINYGDEDGTIMIWDLSTGRCVSPLLGHSSCVWTLAFSSP  322

Query  303  GSLLASGSADCTVKLWDVTTSTKMPKSE-----ENKSG--------STNRLRSLKTLPTK  163
                        V  +   +   +PK +     + K G        S NRLR LK+LPTK
Sbjct  323  -----------QVSFYLNASCMSLPKEQVFIAVKGKPGLISCKGSSSANRLRLLKSLPTK  371

Query  162  STPLYALRFSRRNL  121
            S  +Y+LR  R+ L
Sbjct  372  SAHVYSLRSIRKCL  385



>ref|XP_008938106.1| PREDICTED: transcription initiation factor TFIID subunit 5, partial 
[Merops nubicus]
Length=245

 Score =   209 bits (533),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NYIATGS+D+T+RLWDV +
Sbjct  44   YFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYIATGSADRTIRLWDVLN  103

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   ++ L 
Sbjct  104  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTIYALR  163

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  164  FSRDGEILASGSMDNTVRLWDAVKAFEDLETDDFTTATGHINLPENSQDLLLGTYMTKST  223

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA+S
Sbjct  224  PVVHLHFTRRNLLLAAGAYS  243


 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 75/180 (42%), Gaps = 25/180 (14%)
 Frame = -3

Query  552  NYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLA  373
            NY+ + S D TVRLW +Q+  C+  + GH   +     SP G Y  SG  D    +W   
Sbjct  1    NYLLSCSEDGTVRLWSLQTFTCLVGYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATD  60

Query  372  SGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVTTSTKM-------------  232
              + +    GH + V    F    + +A+GSAD T++LWDV     +             
Sbjct  61   HYQPLRIFAGHLADVTCTRFHPNSNYIATGSADRTIRLWDVLNGNCVRIFTGHKGPIHSL  120

Query  231  ---PKSEENKSGSTNRLRSL---------KTLPTKSTPLYALRFSRRNLLFAAGAFSKSA  88
               P      +G+T+    L           L   +  +YALRFSR   + A+G+   + 
Sbjct  121  AFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTIYALRFSRDGEILASGSMDNTV  180



>ref|XP_004333557.1| WD domain G-beta repeat-containing protein [Acanthamoeba castellanii 
str. Neff]
 gb|ELR11544.1| WD domain G-beta repeat-containing protein [Acanthamoeba castellanii 
str. Neff]
Length=725

 Score =   221 bits (562),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 112/231 (48%), Positives = 141/231 (61%), Gaps = 39/231 (17%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFA+ASHDRTAR+WS D I PLRI AGHLSDVDCV++H NCNY+ATGSSDK++RLW++ S
Sbjct  492  YFATASHDRTARLWSTDHIYPLRIFAGHLSDVDCVKFHPNCNYVATGSSDKSIRLWEMNS  551

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVG-HASCVWTL  319
            G CVRIF GH   + +LA SPDGR +AS  ED  +M+WDL +G+ +  L G H   +W+L
Sbjct  552  GNCVRIFTGHFGPVYALAFSPDGRLLASAGEDKTVMIWDLGTGKRVKVLSGHHEKTIWSL  611

Query  318  AFSCEGSLLASGSADCTVKLWDVTTSTKMPKSE---------------------------  220
             FS EG+LLASGSAD TV+LW +  S     S                            
Sbjct  612  DFSAEGTLLASGSADNTVRLWAMDRSAATAPSAGLAAATASITGGAAPAPILPSASFSTA  671

Query  219  ----ENKSGSTNRLRS-------LKTLPTKSTPLYALRFSRRNLLFAAGAF  100
                 + +G   + R        LKT  TK TP+Y+L+F+ RNLL AAG F
Sbjct  672  ALATSDDAGKHGKKRPVTKSPELLKTFATKKTPVYSLKFTHRNLLLAAGPF  722


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/181 (28%), Positives = 76/181 (42%), Gaps = 46/181 (25%)
 Frame = -3

Query  648  TARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGEC------  487
            T+R  S D +Q L    GH   V    +  +  Y+ + S D T RLW++++         
Sbjct  421  TSRKRSTDYVQLL----GHSGPVYACSFSPDNQYLISASEDNTARLWNLETRTNLVCYRG  476

Query  486  ------------------------------------VRIFIGHRSMILSLAMSPDGRYMA  415
                                                +RIF GH S +  +   P+  Y+A
Sbjct  477  HNYPVWDVEFSPLGYYFATASHDRTARLWSTDHIYPLRIFAGHLSDVDCVKFHPNCNYVA  536

Query  414  SGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVTTSTK  235
            +G  D  I +W++ SG C+    GH   V+ LAFS +G LLAS   D TV +WD+ T  +
Sbjct  537  TGSSDKSIRLWEMNSGNCVRIFTGHFGPVYALAFSPDGRLLASAGEDKTVMIWDLGTGKR  596

Query  234  M  232
            +
Sbjct  597  V  597


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 60/129 (47%), Gaps = 21/129 (16%)
 Frame = -3

Query  582  VDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIF--------------------IGHR  463
            ++CV    + + +A G +D ++++WD+Q  +  RIF                    +GH 
Sbjct  378  INCVDITRDASVVAGGYADSSIKVWDLQK-DHQRIFGTGKEEAPTSRKRSTDYVQLLGHS  436

Query  462  SMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASG  283
              + + + SPD +Y+ S  ED    +W+L +   +    GH   VW + FS  G   A+ 
Sbjct  437  GPVYACSFSPDNQYLISASEDNTARLWNLETRTNLVCYRGHNYPVWDVEFSPLGYYFATA  496

Query  282  SADCTVKLW  256
            S D T +LW
Sbjct  497  SHDRTARLW  505



>ref|XP_010150367.1| PREDICTED: transcription initiation factor TFIID subunit 5, partial 
[Eurypyga helias]
Length=288

 Score =   209 bits (531),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NYIATGS+D+TVRLWDV +
Sbjct  87   YFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYIATGSADRTVRLWDVLN  146

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   V+ L 
Sbjct  147  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVYALR  206

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L +  TKST
Sbjct  207  FSRDGEILASGSMDNTVRLWDAVKAFEDLETDDFTTATGHINLPENSQDLLLGSYMTKST  266

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA++
Sbjct  267  PVVHLHFTRRNLLLAAGAYT  286


 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 59/216 (27%), Positives = 88/216 (41%), Gaps = 25/216 (12%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  8    SDDVLERIMDEKTASELKILYGHSGPVYGTSFSPDRNYLLSCSEDGTVRLWSLQTFTCLV  67

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  68   GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNS  127

Query  300  SLLASGSADCTVKLWDVTTSTKM----------------PKSEENKSGSTNRLRSL----  181
            + +A+GSAD TV+LWDV     +                P      +G+T+    L    
Sbjct  128  NYIATGSADRTVRLWDVLNGNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIG  187

Query  180  -----KTLPTKSTPLYALRFSRRNLLFAAGAFSKSA  88
                   L   +  +YALRFSR   + A+G+   + 
Sbjct  188  HGLMVGELKGHTDTVYALRFSRDGEILASGSMDNTV  223



>ref|XP_007763481.1| TFIID and SAGA subunit [Coniophora puteana RWD-64-598 SS2]
 gb|EIW86788.1| TFIID and SAGA subunit [Coniophora puteana RWD-64-598 SS2]
Length=778

 Score =   219 bits (558),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 108/203 (53%), Positives = 136/203 (67%), Gaps = 11/203 (5%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFA+ S DRTAR+WS DR+  LRI AGHLSDVDCV++H N  Y+ATGSSD T RLWDVQ 
Sbjct  570  YFATGSRDRTARLWSTDRVSCLRIYAGHLSDVDCVRFHPNSLYLATGSSDWTARLWDVQR  629

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G C+R+FIGH+  + SLAMSPDG+Y+AS  ED  I +WDL SGR I  + GH + +++LA
Sbjct  630  GTCIRVFIGHQGTLSSLAMSPDGKYLASAGEDLAINLWDLGSGRRIKKMTGHTASIYSLA  689

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRS-----------LKTLP  169
            FS E SLL SG AD TV+ WDV +S    K++EN S   +  R            + T P
Sbjct  690  FSAESSLLVSGGADWTVRCWDVKSSGGQNKAKENGSSEVSPFRGEENENFETTDLVATFP  749

Query  168  TKSTPLYALRFSRRNLLFAAGAF  100
            TK TP+  + F+ RNL  AAG +
Sbjct  750  TKRTPILNVHFTPRNLCLAAGVY  772



>emb|CEI87105.1| hypothetical protein RMCBS344292_01525 [Rhizopus microsporus]
Length=678

 Score =   218 bits (555),  Expect = 1e-62, Method: Composition-based stats.
 Identities = 97/204 (48%), Positives = 135/204 (66%), Gaps = 12/204 (6%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFA+ASHDRTAR+WS+D I PLRI  GHLSDVD +++H N  Y+ATGSSD+T RLWD+ S
Sbjct  473  YFATASHDRTARLWSLDHISPLRIFTGHLSDVDTIKFHPNSKYLATGSSDRTCRLWDIHS  532

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVR+F GH   + ++A+SP+G+ MAS  ED  I++WDL SG+ I  + GH   ++++ 
Sbjct  533  GNCVRVFTGHTGAVKAVAISPNGKLMASAGEDKSILLWDLKSGKKIKKMTGHTGFIYSIQ  592

Query  315  FSCEGSLLASGSADCTVKLWDVTT--------STKMPKSEENKSGSTNRL----RSLKTL  172
            FS + ++L SG +DCTV++WDV T        ST   +  +   G + R+      L   
Sbjct  593  FSADSNILVSGGSDCTVRVWDVNTSHDDNMMDSTLKKRRLQEDEGYSKRVYESRDQLGVF  652

Query  171  PTKSTPLYALRFSRRNLLFAAGAF  100
            PTK TP+Y  +F+ RNL   +GAF
Sbjct  653  PTKQTPIYNTQFTDRNLCLVSGAF  676


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 40/174 (23%), Positives = 65/174 (37%), Gaps = 44/174 (25%)
 Frame = -3

Query  582  VDCVQWHANCNYIATGSSDKTVRLWDVQS----------------------------GEC  487
            ++CV    +   IA G S   +++W ++                             G  
Sbjct  350  LNCVTMTKDATLIAGGFSQSFIKIWSLKGEKLRSLRNTINPAHVNDYNDLNRQRERHGSD  409

Query  486  VRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSC  307
             +  +GH   I  L+ SPD +Y+ S  ED  + +W   +   +    GH S +W + F  
Sbjct  410  YKRLVGHSGPIYGLSFSPDNKYLLSCSEDKTVRLWSTQTYSNLVVFKGHNSPIWDVEFGP  469

Query  306  EGSLLASGSADCTVKLW----------------DVTTSTKMPKSEENKSGSTNR  193
             G   A+ S D T +LW                DV T    P S+   +GS++R
Sbjct  470  FGFYFATASHDRTARLWSLDHISPLRIFTGHLSDVDTIKFHPNSKYLATGSSDR  523



>emb|CEG66816.1| hypothetical protein RMATCC62417_03334 [Rhizopus microsporus]
Length=686

 Score =   218 bits (555),  Expect = 1e-62, Method: Composition-based stats.
 Identities = 97/204 (48%), Positives = 135/204 (66%), Gaps = 12/204 (6%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFA+ASHDRTAR+WS+D I PLRI  GHLSDVD +++H N  Y+ATGSSD+T RLWD+ S
Sbjct  481  YFATASHDRTARLWSLDHISPLRIFTGHLSDVDTIKFHPNSKYLATGSSDRTCRLWDIHS  540

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVR+F GH   + ++A+SP+G+ MAS  ED  I++WDL SG+ I  + GH   ++++ 
Sbjct  541  GNCVRVFTGHTGAVKAVAISPNGKLMASAGEDKSILLWDLKSGKKIKKMTGHTGFIYSIQ  600

Query  315  FSCEGSLLASGSADCTVKLWDVTT--------STKMPKSEENKSGSTNRL----RSLKTL  172
            FS + ++L SG +DCTV++WDV T        ST   +  +   G + R+      L   
Sbjct  601  FSADSNILVSGGSDCTVRVWDVNTSHDDNMMDSTLKKRRLQEDEGYSKRVYESRDQLGVF  660

Query  171  PTKSTPLYALRFSRRNLLFAAGAF  100
            PTK TP+Y  +F+ RNL   +GAF
Sbjct  661  PTKQTPIYNTQFTDRNLCLVSGAF  684


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 40/174 (23%), Positives = 65/174 (37%), Gaps = 44/174 (25%)
 Frame = -3

Query  582  VDCVQWHANCNYIATGSSDKTVRLWDVQS----------------------------GEC  487
            ++CV    +   IA G S   +++W ++                             G  
Sbjct  358  LNCVTMTKDATLIAGGFSQSFIKIWSLKGEKLRSLRNTINPAHVNDYNDLNRQRERHGSD  417

Query  486  VRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSC  307
             +  +GH   I  L+ SPD +Y+ S  ED  + +W   +   +    GH S +W + F  
Sbjct  418  YKRLVGHSGPIYGLSFSPDNKYLLSCSEDKTVRLWSTQTYSNLVVFKGHNSPIWDVEFGP  477

Query  306  EGSLLASGSADCTVKLW----------------DVTTSTKMPKSEENKSGSTNR  193
             G   A+ S D T +LW                DV T    P S+   +GS++R
Sbjct  478  FGFYFATASHDRTARLWSLDHISPLRIFTGHLSDVDTIKFHPNSKYLATGSSDR  531



>emb|CEI89162.1| hypothetical protein RMCBS344292_03530 [Rhizopus microsporus]
Length=678

 Score =   217 bits (553),  Expect = 2e-62, Method: Composition-based stats.
 Identities = 96/204 (47%), Positives = 135/204 (66%), Gaps = 12/204 (6%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFA+ASHDRTAR+WS+D I PLRI  GHLSDVD +++H N  Y+ATGSSD+T RLWD+ +
Sbjct  473  YFATASHDRTARLWSLDHISPLRIFTGHLSDVDTIKFHPNSKYVATGSSDRTCRLWDIHN  532

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVR+F GH   + ++A+SP+G+ MAS  ED  I++WDL SG+ I  + GH   ++++ 
Sbjct  533  GNCVRVFTGHTGAVKAVAISPNGKLMASAGEDKSILLWDLKSGKKIKKMTGHTGFIYSIQ  592

Query  315  FSCEGSLLASGSADCTVKLWDVTT--------STKMPKSEENKSGSTNRL----RSLKTL  172
            FS + ++L SG +DCTV++WDV T        ST   +  +   G + R+      L   
Sbjct  593  FSADSNILVSGGSDCTVRVWDVNTSHDDNMVDSTLKKRRLQEDEGYSKRVYESRDQLGVF  652

Query  171  PTKSTPLYALRFSRRNLLFAAGAF  100
            PTK TP+Y  +F+ RNL   +GAF
Sbjct  653  PTKQTPIYNTQFTDRNLCLVSGAF  676


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 41/174 (24%), Positives = 65/174 (37%), Gaps = 44/174 (25%)
 Frame = -3

Query  582  VDCVQWHANCNYIATGSSDKTVRLWDVQS----------------------------GEC  487
            ++CV    +   IA G S   +++W ++                             G  
Sbjct  350  LNCVTMTKDATLIAGGFSQSFIKIWSLKGEKLRSLRNTINPAHVNDYNDLNRQRERHGSD  409

Query  486  VRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSC  307
             +  IGH   I  L+ SPD +Y+ S  ED  + +W   +   +    GH S +W + F  
Sbjct  410  YKRLIGHSGPIYGLSFSPDNKYLLSCSEDKTVRLWSTQTYSNLVVFKGHNSPIWDVEFGP  469

Query  306  EGSLLASGSADCTVKLW----------------DVTTSTKMPKSEENKSGSTNR  193
             G   A+ S D T +LW                DV T    P S+   +GS++R
Sbjct  470  FGFYFATASHDRTARLWSLDHISPLRIFTGHLSDVDTIKFHPNSKYVATGSSDR  523



>gb|KJA29408.1| hypothetical protein HYPSUDRAFT_196768 [Hypholoma sublateritium 
FD-334 SS-4]
Length=785

 Score =   217 bits (553),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 108/205 (53%), Positives = 139/205 (68%), Gaps = 13/205 (6%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFA+AS DRTAR+WS +R   LR+ AGHLSDVDCVQ+H N  Y+ATGSSD T RLWDVQ 
Sbjct  577  YFATASRDRTARLWSTERTSCLRVYAGHLSDVDCVQFHPNSLYLATGSSDWTARLWDVQR  636

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G C+R+FIGH+  + SLA+SPDGRY+A+  ED  I +WDL SG+ +  + GH S +++LA
Sbjct  637  GSCLRVFIGHQGTVSSLALSPDGRYLATAGEDLAINLWDLGSGKRVKKMTGHTSSIYSLA  696

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRS------------LKTL  172
            FS E SLL SG AD TV+ WD+ +S   P+S+  K+GS N  RS            L T 
Sbjct  697  FSTESSLLVSGGADWTVRTWDIKSSGG-PRSKSPKNGSMNGGRSYGDEESVETSDLLATF  755

Query  171  PTKSTPLYALRFSRRNLLFAAGAFS  97
            PTK TP+  ++F+ RNL    G +S
Sbjct  756  PTKRTPITNIQFTSRNLCLVGGVYS  780



>ref|XP_010196282.1| PREDICTED: transcription initiation factor TFIID subunit 5, partial 
[Colius striatus]
Length=429

 Score =   211 bits (536),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 101/200 (51%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NYIATGS+D+TVRLWDV +
Sbjct  228  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYIATGSADRTVRLWDVLN  287

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   ++ L 
Sbjct  288  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTIYALR  347

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  348  FSRDGEILASGSMDNTVRLWDAVKAFEDLETDDFTTATGHINLPENSQDLLLGTYMTKST  407

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA+S
Sbjct  408  PVIHLHFTRRNLLLAAGAYS  427


 Score = 76.6 bits (187),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 59/216 (27%), Positives = 88/216 (41%), Gaps = 25/216 (12%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  149  SDDVLERIMDEKTASELKILYGHSGPVYGTSFSPDRNYLLSCSEDGTVRLWSLQTFTCLV  208

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  209  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNS  268

Query  300  SLLASGSADCTVKLWDVTTSTKM----------------PKSEENKSGSTNRLRSL----  181
            + +A+GSAD TV+LWDV     +                P      +G+T+    L    
Sbjct  269  NYIATGSADRTVRLWDVLNGNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIG  328

Query  180  -----KTLPTKSTPLYALRFSRRNLLFAAGAFSKSA  88
                   L   +  +YALRFSR   + A+G+   + 
Sbjct  329  HGLMVGELKGHTDTIYALRFSRDGEILASGSMDNTV  364



>gb|KFP24818.1| Transcription initiation factor TFIID subunit 5, partial [Colius 
striatus]
Length=430

 Score =   211 bits (536),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 101/200 (51%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NYIATGS+D+TVRLWDV +
Sbjct  229  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYIATGSADRTVRLWDVLN  288

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   ++ L 
Sbjct  289  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTIYALR  348

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  349  FSRDGEILASGSMDNTVRLWDAVKAFEDLETDDFTTATGHINLPENSQDLLLGTYMTKST  408

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA+S
Sbjct  409  PVIHLHFTRRNLLLAAGAYS  428


 Score = 76.3 bits (186),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 59/216 (27%), Positives = 88/216 (41%), Gaps = 25/216 (12%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  150  SDDVLERIMDEKTASELKILYGHSGPVYGTSFSPDRNYLLSCSEDGTVRLWSLQTFTCLV  209

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  210  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNS  269

Query  300  SLLASGSADCTVKLWDVTTSTKM----------------PKSEENKSGSTNRLRSL----  181
            + +A+GSAD TV+LWDV     +                P      +G+T+    L    
Sbjct  270  NYIATGSADRTVRLWDVLNGNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIG  329

Query  180  -----KTLPTKSTPLYALRFSRRNLLFAAGAFSKSA  88
                   L   +  +YALRFSR   + A+G+   + 
Sbjct  330  HGLMVGELKGHTDTIYALRFSRDGEILASGSMDNTV  365



>gb|KIM66256.1| hypothetical protein SCLCIDRAFT_1211492 [Scleroderma citrinum 
Foug A]
Length=784

 Score =   217 bits (552),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 108/202 (53%), Positives = 137/202 (68%), Gaps = 10/202 (5%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFA+AS DRTAR+WS DR   LRI AGHLSDVDCV++H N  Y+ATGSSD T RLWDVQ 
Sbjct  577  YFATASRDRTARLWSTDRTSCLRIYAGHLSDVDCVRFHPNSLYLATGSSDWTARLWDVQR  636

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVR+FIGH+  + +LA+SPDGRY+AS  ED  I +WDL SGR I  + GH + +++LA
Sbjct  637  GTCVRVFIGHQGTLSTLAISPDGRYLASAGEDLAINLWDLGSGRRIKKMTGHTASIYSLA  696

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRS----------LKTLPT  166
            FS E SLL SG AD TV+ WDV  +    K  +N +   + LR+          L T PT
Sbjct  697  FSAESSLLISGGADWTVRCWDVKNAGNQGKPRQNGTEEPSPLRAGEESNETTDLLATFPT  756

Query  165  KSTPLYALRFSRRNLLFAAGAF  100
            K TP+ +++F+ RNL  AAG +
Sbjct  757  KRTPIISVQFTSRNLGLAAGYY  778



>dbj|GAN03752.1| conserved hypothetical protein [Mucor ambiguus]
Length=760

 Score =   215 bits (547),  Expect = 4e-61, Method: Composition-based stats.
 Identities = 105/211 (50%), Positives = 136/211 (64%), Gaps = 19/211 (9%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFA+ASHDRTARIWS D I PLRI  GHLSDVD V++H N  YI TGSSD+T RLWDVQ+
Sbjct  544  YFATASHDRTARIWSCDHINPLRIFTGHLSDVDAVKFHPNSKYIVTGSSDRTSRLWDVQT  603

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVR+F GH   I ++A+SP+GR MAS  ED  IM+WD+ASG+ I  L GH   +++L+
Sbjct  604  GSCVRVFTGHTGSIKTVAVSPNGRLMASAGEDKSIMLWDIASGKRIKKLTGHTGFIYSLS  663

Query  315  FSCEGSLLASGSADCTVKLWDVTTS------------------TKMPKSEENKSGSTNRL  190
            FS +  +L SG AD TV +WDV T                    ++   ++ K+   +R 
Sbjct  664  FSVDSGVLVSGGADSTVCVWDVNTDNTSAVASYMDTDTNDAKRARLDDDKKRKAVHESRE  723

Query  189  RSLKTLPTKSTPLYALRFSRRNLLFAAGAFS  97
            R L   PTK TP+Y ++F+ RNL   AGAF+
Sbjct  724  R-LAVFPTKQTPIYDIQFTDRNLCLVAGAFT  753


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 41/168 (24%), Positives = 69/168 (41%), Gaps = 42/168 (25%)
 Frame = -3

Query  603  MAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS------------------------  496
            + GH   V  + +  +  Y+ + S DKT RLW  Q+                        
Sbjct  484  LVGHSGPVYGLSFSRDNKYLVSCSGDKTARLWSTQTFSNLVVYKGHNSPVWDVDFGPYGF  543

Query  495  -------------GEC-----VRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLAS  370
                           C     +RIF GH S + ++   P+ +Y+ +G  D    +WD+ +
Sbjct  544  YFATASHDRTARIWSCDHINPLRIFTGHLSDVDAVKFHPNSKYIVTGSSDRTSRLWDVQT  603

Query  369  GRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVTTSTKMPK  226
            G C+    GH   + T+A S  G L+AS   D ++ LWD+ +  ++ K
Sbjct  604  GSCVRVFTGHTGSIKTVAVSPNGRLMASAGEDKSIMLWDIASGKRIKK  651



>gb|EPB92347.1| hypothetical protein HMPREF1544_00916 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=756

 Score =   214 bits (546),  Expect = 5e-61, Method: Composition-based stats.
 Identities = 105/211 (50%), Positives = 136/211 (64%), Gaps = 19/211 (9%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFA+ASHDRTARIWS D I PLRI  GHLSDVD V++H N  YI TGSSD+T RLWDVQ+
Sbjct  540  YFATASHDRTARIWSCDHINPLRIFTGHLSDVDTVKFHPNSKYIVTGSSDRTSRLWDVQT  599

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVR+F GH   I ++A+SP+GR MAS  ED  IM+WD+ASG+ I  L GH   +++L+
Sbjct  600  GSCVRVFTGHTGSIKTVAVSPNGRLMASAGEDRSIMLWDIASGKRIKKLTGHTGFIYSLS  659

Query  315  FSCEGSLLASGSADCTVKLWDVTTS------------------TKMPKSEENKSGSTNRL  190
            FS +  +L SG AD TV +WDV T                    ++   ++ K+   +R 
Sbjct  660  FSADSGVLVSGGADSTVCVWDVNTENTSAVASYMDTDANDVKRARLDDDKKRKAVHESRE  719

Query  189  RSLKTLPTKSTPLYALRFSRRNLLFAAGAFS  97
            R L   PTK TP+Y ++F+ RNL   AGAF+
Sbjct  720  R-LAVFPTKQTPIYDIQFTDRNLCLVAGAFT  749


 Score = 69.7 bits (169),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 41/168 (24%), Positives = 69/168 (41%), Gaps = 42/168 (25%)
 Frame = -3

Query  603  MAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS------------------------  496
            + GH   V  + +  +  Y+ + S DKT RLW  Q+                        
Sbjct  480  LVGHSGPVYGLSFSHDNKYLVSCSGDKTARLWSTQTFSNLVVYKGHNSPVWDVDFGPYGF  539

Query  495  -------------GEC-----VRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLAS  370
                           C     +RIF GH S + ++   P+ +Y+ +G  D    +WD+ +
Sbjct  540  YFATASHDRTARIWSCDHINPLRIFTGHLSDVDTVKFHPNSKYIVTGSSDRTSRLWDVQT  599

Query  369  GRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVTTSTKMPK  226
            G C+    GH   + T+A S  G L+AS   D ++ LWD+ +  ++ K
Sbjct  600  GSCVRVFTGHTGSIKTVAVSPNGRLMASAGEDRSIMLWDIASGKRIKK  647



>gb|KIJ68525.1| hypothetical protein HYDPIDRAFT_173223 [Hydnomerulius pinastri 
MD-312]
Length=788

 Score =   215 bits (547),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 108/203 (53%), Positives = 134/203 (66%), Gaps = 11/203 (5%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFA+AS DRTAR+WS DR   LR+ AGHLSDVDCV++H N  Y+ATGSSD T RLWDVQ 
Sbjct  580  YFATASRDRTARLWSTDRTSCLRVYAGHLSDVDCVRFHPNSLYLATGSSDWTARLWDVQR  639

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVR+FIGH+  I +LA+SPDGRY+AS  ED  I +WDL SG+ I  + GHA+ V++LA
Sbjct  640  GTCVRVFIGHQGTISTLAISPDGRYLASAGEDLAINLWDLGSGKRIKKMTGHAASVYSLA  699

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRS-----------LKTLP  169
            FS E S+L SG AD TV+ WDV ++    K  EN +     LR            L T P
Sbjct  700  FSAESSMLVSGGADWTVRCWDVKSAGGQSKPRENGTDENAVLRPTEDESNETSDLLATFP  759

Query  168  TKSTPLYALRFSRRNLLFAAGAF  100
            TK TP+  + F+ RNL   AG +
Sbjct  760  TKRTPITNVHFTPRNLCLVAGNY  782



>ref|XP_008879875.1| hypothetical protein H310_13972 [Aphanomyces invadans]
 gb|ETV91423.1| hypothetical protein H310_13972 [Aphanomyces invadans]
Length=717

 Score =   214 bits (545),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 107/203 (53%), Positives = 136/203 (67%), Gaps = 11/203 (5%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF SAS DRTAR+WS DR QPLR+ AGHLSDV+CV +H N NYIATGSSDK+VRLWDVQS
Sbjct  510  YFVSASMDRTARLWSTDRTQPLRVFAGHLSDVECVVFHPNHNYIATGSSDKSVRLWDVQS  569

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G C+R+F GH   + ++A SP+GRY+AS  +D  + +WDL  G+ +  LVGH   V +LA
Sbjct  570  GHCLRVFSGHYGGVSAVAFSPNGRYLASAGDDALVSIWDLHMGKKLDTLVGHQDAVHSLA  629

Query  315  FSCEGSLLASGSADCTVKLWDV----------TTSTKMPKSEENKSGSTNRLRS-LKTLP  169
            FS E SL+ SG AD TV+LWD+          TT        + K+GS    RS LKT  
Sbjct  630  FSAESSLVVSGGADNTVRLWDMHRLDTAVNHKTTPPVTVHQHKRKAGSAIASRSLLKTFT  689

Query  168  TKSTPLYALRFSRRNLLFAAGAF  100
            TK TP+  ++F+ RN+L   GA+
Sbjct  690  TKRTPVLRVQFTPRNMLLVGGAY  712


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 41/148 (28%), Positives = 67/148 (45%), Gaps = 13/148 (9%)
 Frame = -3

Query  654  DRTARIWSMDRIQPL-----------RIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLW  508
            D + R+WS D   PL            I+ GH   V    +  +  +  T S+D T+RLW
Sbjct  424  DSSFRVWSQDG-APLGGFAHHKDSTSAILRGHAGPVYGCGFTPDNRFALTSSADATIRLW  482

Query  507  DVQSGECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCV  328
             + S   + ++      +  +AM+P G Y  S   D    +W     + +    GH S V
Sbjct  483  SLASRTTMVVYRAQYP-VWDVAMAPLGYYFVSASMDRTARLWSTDRTQPLRVFAGHLSDV  541

Query  327  WTLAFSCEGSLLASGSADCTVKLWDVTT  244
              + F    + +A+GS+D +V+LWDV +
Sbjct  542  ECVVFHPNHNYIATGSSDKSVRLWDVQS  569



>gb|KFZ57379.1| Transcription initiation factor TFIID subunit 5, partial [Podiceps 
cristatus]
Length=611

 Score =   212 bits (540),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 102/200 (51%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NYIATGS+D+TVRLWDV +
Sbjct  410  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYIATGSADRTVRLWDVLN  469

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   V+ L 
Sbjct  470  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVYALR  529

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  530  FSRDGEILASGSMDNTVRLWDAVKAFEDLETDDFTTATGHINLPENSQDLLLGTYMTKST  589

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA+S
Sbjct  590  PVVHLHFTRRNLLLAAGAYS  609


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/186 (28%), Positives = 76/186 (41%), Gaps = 17/186 (9%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  331  SDDVLERIMDEKTASELKILYGHSGPVYGTSFSPDRNYLLSCSEDGTVRLWSLQTFTCLV  390

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  391  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNS  450

Query  300  SLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRFSRRNL  121
            + +A+GSAD TV+LWDV                      ++       P+++L FS    
Sbjct  451  NYIATGSADRTVRLWDVLNGN-----------------CVRIFTGHKGPIHSLAFSPNGR  493

Query  120  LFAAGA  103
              A GA
Sbjct  494  FLATGA  499



>gb|KFP37312.1| Transcription initiation factor TFIID subunit 5, partial [Chlamydotis 
macqueenii]
Length=611

 Score =   212 bits (540),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 102/200 (51%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NYIATGS+D+TVRLWDV +
Sbjct  410  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYIATGSADRTVRLWDVLN  469

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   V+ L 
Sbjct  470  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVYALR  529

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  530  FSRDGEILASGSMDNTVRLWDAVKAFEDLETDDFTTATGHINLPENSQDLLLGTYMTKST  589

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA+S
Sbjct  590  PVIHLHFTRRNLLLAAGAYS  609


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/186 (28%), Positives = 76/186 (41%), Gaps = 17/186 (9%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  331  SDDVLERIMDEKTASELKILYGHSGPVYGTSFSPDRNYLLSCSEDGTVRLWSLQTFTCLV  390

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  391  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNS  450

Query  300  SLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRFSRRNL  121
            + +A+GSAD TV+LWDV                      ++       P+++L FS    
Sbjct  451  NYIATGSADRTVRLWDVLNGN-----------------CVRIFTGHKGPIHSLAFSPNGR  493

Query  120  LFAAGA  103
              A GA
Sbjct  494  FLATGA  499



>gb|EMC84382.1| Transcription initiation factor TFIID subunit 5, partial [Columba 
livia]
Length=611

 Score =   212 bits (540),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 102/200 (51%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NYIATGS+D+TVRLWDV +
Sbjct  410  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYIATGSADRTVRLWDVLN  469

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   V+ L 
Sbjct  470  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVYALR  529

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  530  FSRDGEILASGSMDNTVRLWDAVKAFEDLETDDFTTATGHINLPENSQDLLLGTYMTKST  589

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA+S
Sbjct  590  PVVHLHFTRRNLLLAAGAYS  609


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/186 (28%), Positives = 76/186 (41%), Gaps = 17/186 (9%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  331  SDDVLERIMDEKTASELKILYGHSGPVYGTSFSPDRNYLLSCSEDGTVRLWSLQTFTCLV  390

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  391  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNS  450

Query  300  SLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRFSRRNL  121
            + +A+GSAD TV+LWDV                      ++       P+++L FS    
Sbjct  451  NYIATGSADRTVRLWDVLNGN-----------------CVRIFTGHKGPIHSLAFSPNGR  493

Query  120  LFAAGA  103
              A GA
Sbjct  494  FLATGA  499



>gb|KFV01929.1| Transcription initiation factor TFIID subunit 5, partial [Pterocles 
gutturalis]
Length=611

 Score =   212 bits (540),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 102/200 (51%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NYIATGS+D+TVRLWDV +
Sbjct  410  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYIATGSADRTVRLWDVLN  469

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   V+ L 
Sbjct  470  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVYALR  529

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  530  FSRDGEILASGSMDNTVRLWDAVKAFEDLETDDFTTATGHINLPENSQDLLLGTYMTKST  589

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA+S
Sbjct  590  PVIHLHFTRRNLLLAAGAYS  609


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/186 (28%), Positives = 76/186 (41%), Gaps = 17/186 (9%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  331  SDDVLERIMDEKTASELKILYGHSGPVYGTSFSPDRNYLLSCSEDGTVRLWSLQTFTCLV  390

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  391  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNS  450

Query  300  SLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRFSRRNL  121
            + +A+GSAD TV+LWDV                      ++       P+++L FS    
Sbjct  451  NYIATGSADRTVRLWDVLNGN-----------------CVRIFTGHKGPIHSLAFSPNGR  493

Query  120  LFAAGA  103
              A GA
Sbjct  494  FLATGA  499



>ref|XP_010125523.1| PREDICTED: transcription initiation factor TFIID subunit 5, partial 
[Chlamydotis macqueenii]
Length=614

 Score =   212 bits (540),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 102/200 (51%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NYIATGS+D+TVRLWDV +
Sbjct  413  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYIATGSADRTVRLWDVLN  472

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   V+ L 
Sbjct  473  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVYALR  532

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  533  FSRDGEILASGSMDNTVRLWDAVKAFEDLETDDFTTATGHINLPENSQDLLLGTYMTKST  592

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA+S
Sbjct  593  PVIHLHFTRRNLLLAAGAYS  612


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/186 (28%), Positives = 76/186 (41%), Gaps = 17/186 (9%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  334  SDDVLERIMDEKTASELKILYGHSGPVYGTSFSPDRNYLLSCSEDGTVRLWSLQTFTCLV  393

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  394  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNS  453

Query  300  SLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRFSRRNL  121
            + +A+GSAD TV+LWDV                      ++       P+++L FS    
Sbjct  454  NYIATGSADRTVRLWDVLNGN-----------------CVRIFTGHKGPIHSLAFSPNGR  496

Query  120  LFAAGA  103
              A GA
Sbjct  497  FLATGA  502



>ref|XP_010082733.1| PREDICTED: transcription initiation factor TFIID subunit 5, partial 
[Pterocles gutturalis]
Length=614

 Score =   212 bits (540),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 102/200 (51%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NYIATGS+D+TVRLWDV +
Sbjct  413  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYIATGSADRTVRLWDVLN  472

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   V+ L 
Sbjct  473  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVYALR  532

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  533  FSRDGEILASGSMDNTVRLWDAVKAFEDLETDDFTTATGHINLPENSQDLLLGTYMTKST  592

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA+S
Sbjct  593  PVIHLHFTRRNLLLAAGAYS  612


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/186 (28%), Positives = 76/186 (41%), Gaps = 17/186 (9%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  334  SDDVLERIMDEKTASELKILYGHSGPVYGTSFSPDRNYLLSCSEDGTVRLWSLQTFTCLV  393

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  394  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNS  453

Query  300  SLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRFSRRNL  121
            + +A+GSAD TV+LWDV                      ++       P+++L FS    
Sbjct  454  NYIATGSADRTVRLWDVLNGN-----------------CVRIFTGHKGPIHSLAFSPNGR  496

Query  120  LFAAGA  103
              A GA
Sbjct  497  FLATGA  502



>gb|KFQ67229.1| Transcription initiation factor TFIID subunit 5, partial [Phaethon 
lepturus]
Length=611

 Score =   212 bits (539),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 101/200 (51%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NYIATGS+D+TVRLWDV +
Sbjct  410  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYIATGSADRTVRLWDVLN  469

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   ++ L 
Sbjct  470  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTIYALR  529

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  530  FSRDGEILASGSMDNTVRLWDAVKAFEDLETDDFTTATGHINLPENSQDLLLGTYMTKST  589

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA+S
Sbjct  590  PVVHLHFTRRNLLLAAGAYS  609


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/186 (28%), Positives = 76/186 (41%), Gaps = 17/186 (9%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  331  SDDVLERIMDEKTASELKILYGHSGPVYGTSFSPDRNYLLSCSEDGTVRLWSLQTFTCLV  390

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  391  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNS  450

Query  300  SLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRFSRRNL  121
            + +A+GSAD TV+LWDV                      ++       P+++L FS    
Sbjct  451  NYIATGSADRTVRLWDVLNGN-----------------CVRIFTGHKGPIHSLAFSPNGR  493

Query  120  LFAAGA  103
              A GA
Sbjct  494  FLATGA  499



>gb|KFV76048.1| Transcription initiation factor TFIID subunit 5, partial [Struthio 
camelus australis]
Length=611

 Score =   212 bits (539),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 101/200 (51%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NYIATGS+D+TVRLWDV +
Sbjct  410  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYIATGSADRTVRLWDVLN  469

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   ++ L 
Sbjct  470  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTIYALR  529

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  530  FSRDGEILASGSMDNTVRLWDAVKAFEDLETDDFTTATGHINLPENSQDLLLGTYMTKST  589

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA+S
Sbjct  590  PVVHLHFTRRNLLLAAGAYS  609


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 59/216 (27%), Positives = 88/216 (41%), Gaps = 25/216 (12%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  331  SDDVLERIMDEKTASELKILYGHSGPVYGTSFSPDRNYLLSCSEDGTVRLWSLQTFTCLV  390

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  391  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNS  450

Query  300  SLLASGSADCTVKLWDVTTSTKM----------------PKSEENKSGSTNRLRSL----  181
            + +A+GSAD TV+LWDV     +                P      +G+T+    L    
Sbjct  451  NYIATGSADRTVRLWDVLNGNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIG  510

Query  180  -----KTLPTKSTPLYALRFSRRNLLFAAGAFSKSA  88
                   L   +  +YALRFSR   + A+G+   + 
Sbjct  511  HGLMVGELKGHTDTIYALRFSRDGEILASGSMDNTV  546



>gb|KFQ41510.1| Transcription initiation factor TFIID subunit 5, partial [Nestor 
notabilis]
Length=611

 Score =   212 bits (539),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 101/200 (51%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NYIATGS+D+T+RLWDV +
Sbjct  410  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYIATGSADRTIRLWDVLN  469

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   V+ L 
Sbjct  470  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVYALR  529

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  530  FSRDGEILASGSMDNTVRLWDAVKAFEDLETDDFTTATGHINLPENSQDLLLGTYMTKST  589

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA+S
Sbjct  590  PVIHLHFTRRNLLLAAGAYS  609


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 76/186 (41%), Gaps = 17/186 (9%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  331  SDDVLERIMDEKTASELKILYGHSGPVYGTSFSPDRNYLLSCSEDGTVRLWSLQTFTCLV  390

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  391  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNS  450

Query  300  SLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRFSRRNL  121
            + +A+GSAD T++LWDV                      ++       P+++L FS    
Sbjct  451  NYIATGSADRTIRLWDVLNGN-----------------CVRIFTGHKGPIHSLAFSPNGR  493

Query  120  LFAAGA  103
              A GA
Sbjct  494  FLATGA  499



>gb|KFP15306.1| Transcription initiation factor TFIID subunit 5, partial [Egretta 
garzetta]
 gb|KFW70204.1| Transcription initiation factor TFIID subunit 5, partial [Pygoscelis 
adeliae]
Length=611

 Score =   212 bits (539),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 101/200 (51%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NYIATGS+D+T+RLWDV +
Sbjct  410  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYIATGSADRTIRLWDVLN  469

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   V+ L 
Sbjct  470  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVYALR  529

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  530  FSRDGEILASGSMDNTVRLWDAVKAFEDLETDDFTTATGHINLPENSQDLLLGTYMTKST  589

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA+S
Sbjct  590  PVVHLHFTRRNLLLAAGAYS  609


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 76/186 (41%), Gaps = 17/186 (9%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  331  SDDVLERIMDEKTASELKILYGHSGPVYGTSFSPDRNYLLSCSEDGTVRLWSLQTFTCLV  390

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  391  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNS  450

Query  300  SLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRFSRRNL  121
            + +A+GSAD T++LWDV                      ++       P+++L FS    
Sbjct  451  NYIATGSADRTIRLWDVLNGN-----------------CVRIFTGHKGPIHSLAFSPNGR  493

Query  120  LFAAGA  103
              A GA
Sbjct  494  FLATGA  499



>gb|KFO13790.1| Transcription initiation factor TFIID subunit 5, partial [Balearica 
regulorum gibbericeps]
 gb|KFZ47171.1| Transcription initiation factor TFIID subunit 5, partial [Caprimulgus 
carolinensis]
 gb|KGL90477.1| Transcription initiation factor TFIID subunit 5, partial [Charadrius 
vociferus]
Length=611

 Score =   212 bits (539),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 101/200 (51%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NYIATGS+D+TVRLWDV +
Sbjct  410  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYIATGSADRTVRLWDVLN  469

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   ++ L 
Sbjct  470  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTIYALR  529

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  530  FSRDGEILASGSMDNTVRLWDAVKAFEDLETDDFTTATGHINLPENSQDLLLGTYMTKST  589

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA+S
Sbjct  590  PVVHLHFTRRNLLLAAGAYS  609


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/186 (28%), Positives = 76/186 (41%), Gaps = 17/186 (9%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  331  SDDVLERIMDEKTASELKILYGHSGPVYGTSFSPDRNYLLSCSEDGTVRLWSLQTFTCLV  390

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  391  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNS  450

Query  300  SLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRFSRRNL  121
            + +A+GSAD TV+LWDV                      ++       P+++L FS    
Sbjct  451  NYIATGSADRTVRLWDVLNGN-----------------CVRIFTGHKGPIHSLAFSPNGR  493

Query  120  LFAAGA  103
              A GA
Sbjct  494  FLATGA  499



>gb|KGL84363.1| Transcription initiation factor TFIID subunit 5, partial [Tinamus 
guttatus]
Length=611

 Score =   212 bits (539),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 101/200 (51%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NYIATGS+D+TVRLWDV +
Sbjct  410  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYIATGSADRTVRLWDVLN  469

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   ++ L 
Sbjct  470  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTIYALR  529

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  530  FSRDGEILASGSMDNTVRLWDAVKAFEDLETDDFTTATGHINLPENSQDLLLGTYMTKST  589

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA+S
Sbjct  590  PVVHLHFTRRNLLLAAGAYS  609


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/186 (28%), Positives = 76/186 (41%), Gaps = 17/186 (9%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  331  SDDVLERIMDEKTASELKILYGHSGPVYGTSFSPDRNYLLSCSEDGTVRLWSLQTFTCLV  390

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  391  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNS  450

Query  300  SLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRFSRRNL  121
            + +A+GSAD TV+LWDV                      ++       P+++L FS    
Sbjct  451  NYIATGSADRTVRLWDVLNGN-----------------CVRIFTGHKGPIHSLAFSPNGR  493

Query  120  LFAAGA  103
              A GA
Sbjct  494  FLATGA  499



>gb|KFU91532.1| Transcription initiation factor TFIID subunit 5, partial [Chaetura 
pelagica]
Length=611

 Score =   212 bits (539),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 101/200 (51%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NYIATGS+D+TVRLWDV +
Sbjct  410  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYIATGSADRTVRLWDVLN  469

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   ++ L 
Sbjct  470  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTIYALR  529

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  530  FSRDGEILASGSMDNTVRLWDAVKAFEDLETDDFTTATGHINLPENSQELLLGTYMTKST  589

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA+S
Sbjct  590  PVVHLHFTRRNLLLAAGAYS  609


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/186 (28%), Positives = 76/186 (41%), Gaps = 17/186 (9%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  331  SDDVLERIMDEKTASELKILYGHSGPVYGTSFSPDRNYLLSCSEDGTVRLWSLQTFTCLV  390

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  391  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNS  450

Query  300  SLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRFSRRNL  121
            + +A+GSAD TV+LWDV                      ++       P+++L FS    
Sbjct  451  NYIATGSADRTVRLWDVLNGN-----------------CVRIFTGHKGPIHSLAFSPNGR  493

Query  120  LFAAGA  103
              A GA
Sbjct  494  FLATGA  499



>ref|XP_010022326.1| PREDICTED: transcription initiation factor TFIID subunit 5, partial 
[Nestor notabilis]
Length=614

 Score =   212 bits (539),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 101/200 (51%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NYIATGS+D+T+RLWDV +
Sbjct  413  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYIATGSADRTIRLWDVLN  472

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   V+ L 
Sbjct  473  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVYALR  532

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  533  FSRDGEILASGSMDNTVRLWDAVKAFEDLETDDFTTATGHINLPENSQDLLLGTYMTKST  592

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA+S
Sbjct  593  PVIHLHFTRRNLLLAAGAYS  612


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 76/186 (41%), Gaps = 17/186 (9%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  334  SDDVLERIMDEKTASELKILYGHSGPVYGTSFSPDRNYLLSCSEDGTVRLWSLQTFTCLV  393

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  394  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNS  453

Query  300  SLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRFSRRNL  121
            + +A+GSAD T++LWDV                      ++       P+++L FS    
Sbjct  454  NYIATGSADRTIRLWDVLNGN-----------------CVRIFTGHKGPIHSLAFSPNGR  496

Query  120  LFAAGA  103
              A GA
Sbjct  497  FLATGA  502



>ref|XP_006681986.1| hypothetical protein BATDEDRAFT_36007 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF77425.1| hypothetical protein BATDEDRAFT_36007 [Batrachochytrium dendrobatidis 
JAM81]
Length=663

 Score =   213 bits (541),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 103/197 (52%), Positives = 135/197 (69%), Gaps = 4/197 (2%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFASASHDRTAR+WS D + PLR+  GHLSDVD V++H N NY+ TGS+D+T RLWDVQ 
Sbjct  464  YFASASHDRTARLWSCDHLFPLRVFVGHLSDVDTVRFHPNSNYLLTGSADRTCRLWDVQK  523

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF  H+  + ++A+SPDGR MASG +D  I +WDL SGR I  + GH S + +L 
Sbjct  524  GSCVRIFSKHQGAVSAVAISPDGRTMASGGDDKTIRLWDLGSGRRIKSMHGHNSFISSLE  583

Query  315  FSCEGSLLASGSADCTVKLWDV----TTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLY  148
            FS +GSLLASG  D +V+LWDV    T   KM     ++     R   +   PTK TP+Y
Sbjct  584  FSQDGSLLASGGIDDSVRLWDVKRADTHEIKMDSQISDQPSDGARSDHIAAYPTKRTPVY  643

Query  147  ALRFSRRNLLFAAGAFS  97
            +++F++RN+L A G F+
Sbjct  644  SVQFTKRNVLMALGVFN  660



>ref|XP_005026527.1| PREDICTED: transcription initiation factor TFIID subunit 5 [Anas 
platyrhynchos]
Length=638

 Score =   212 bits (540),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 101/200 (51%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NYIATGS+D+TVRLWDV +
Sbjct  437  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYIATGSADRTVRLWDVLN  496

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   ++ L 
Sbjct  497  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTIYALR  556

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  557  FSRDGEILASGSMDNTVRLWDAVKAFEDLETDDFTTATGHINLPENSQDLLLGTYMTKST  616

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA+S
Sbjct  617  PVVHLHFTRRNLLLAAGAYS  636


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 59/216 (27%), Positives = 88/216 (41%), Gaps = 25/216 (12%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  358  SDDVLERIMDEKTASELKILYGHSGPVYGTSFSPDRNYLLSCSEDGTVRLWSLQTFTCLV  417

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  418  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNS  477

Query  300  SLLASGSADCTVKLWDVTTSTKM----------------PKSEENKSGSTNRLRSL----  181
            + +A+GSAD TV+LWDV     +                P      +G+T+    L    
Sbjct  478  NYIATGSADRTVRLWDVLNGNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIG  537

Query  180  -----KTLPTKSTPLYALRFSRRNLLFAAGAFSKSA  88
                   L   +  +YALRFSR   + A+G+   + 
Sbjct  538  HGLMVGELKGHTDTIYALRFSRDGEILASGSMDNTV  573



>ref|XP_010284775.1| PREDICTED: transcription initiation factor TFIID subunit 5, partial 
[Phaethon lepturus]
Length=614

 Score =   212 bits (539),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 101/200 (51%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NYIATGS+D+TVRLWDV +
Sbjct  413  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYIATGSADRTVRLWDVLN  472

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   ++ L 
Sbjct  473  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTIYALR  532

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  533  FSRDGEILASGSMDNTVRLWDAVKAFEDLETDDFTTATGHINLPENSQDLLLGTYMTKST  592

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA+S
Sbjct  593  PVVHLHFTRRNLLLAAGAYS  612


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 59/216 (27%), Positives = 88/216 (41%), Gaps = 25/216 (12%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  334  SDDVLERIMDEKTASELKILYGHSGPVYGTSFSPDRNYLLSCSEDGTVRLWSLQTFTCLV  393

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  394  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNS  453

Query  300  SLLASGSADCTVKLWDVTTSTKM----------------PKSEENKSGSTNRLRSL----  181
            + +A+GSAD TV+LWDV     +                P      +G+T+    L    
Sbjct  454  NYIATGSADRTVRLWDVLNGNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIG  513

Query  180  -----KTLPTKSTPLYALRFSRRNLLFAAGAFSKSA  88
                   L   +  +YALRFSR   + A+G+   + 
Sbjct  514  HGLMVGELKGHTDTIYALRFSRDGEILASGSMDNTV  549



>ref|XP_010166621.1| PREDICTED: transcription initiation factor TFIID subunit 5, partial 
[Caprimulgus carolinensis]
 ref|XP_010306624.1| PREDICTED: transcription initiation factor TFIID subunit 5, partial 
[Balearica regulorum gibbericeps]
Length=614

 Score =   212 bits (539),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 101/200 (51%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NYIATGS+D+TVRLWDV +
Sbjct  413  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYIATGSADRTVRLWDVLN  472

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   ++ L 
Sbjct  473  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTIYALR  532

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  533  FSRDGEILASGSMDNTVRLWDAVKAFEDLETDDFTTATGHINLPENSQDLLLGTYMTKST  592

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA+S
Sbjct  593  PVVHLHFTRRNLLLAAGAYS  612


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 59/216 (27%), Positives = 88/216 (41%), Gaps = 25/216 (12%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  334  SDDVLERIMDEKTASELKILYGHSGPVYGTSFSPDRNYLLSCSEDGTVRLWSLQTFTCLV  393

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  394  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNS  453

Query  300  SLLASGSADCTVKLWDVTTSTKM----------------PKSEENKSGSTNRLRSL----  181
            + +A+GSAD TV+LWDV     +                P      +G+T+    L    
Sbjct  454  NYIATGSADRTVRLWDVLNGNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIG  513

Query  180  -----KTLPTKSTPLYALRFSRRNLLFAAGAFSKSA  88
                   L   +  +YALRFSR   + A+G+   + 
Sbjct  514  HGLMVGELKGHTDTIYALRFSRDGEILASGSMDNTV  549



>gb|EOA96407.1| Transcription initiation factor TFIID subunit 5, partial [Anas 
platyrhynchos]
Length=617

 Score =   212 bits (539),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 101/200 (51%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NYIATGS+D+TVRLWDV +
Sbjct  416  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYIATGSADRTVRLWDVLN  475

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   ++ L 
Sbjct  476  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTIYALR  535

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  536  FSRDGEILASGSMDNTVRLWDAVKAFEDLETDDFTTATGHINLPENSQDLLLGTYMTKST  595

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA+S
Sbjct  596  PVVHLHFTRRNLLLAAGAYS  615


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/186 (28%), Positives = 76/186 (41%), Gaps = 17/186 (9%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  337  SDDVLERIMDEKTASELKILYGHSGPVYGTSFSPDRNYLLSCSEDGTVRLWSLQTFTCLV  396

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  397  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNS  456

Query  300  SLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRFSRRNL  121
            + +A+GSAD TV+LWDV                      ++       P+++L FS    
Sbjct  457  NYIATGSADRTVRLWDVLNGN-----------------CVRIFTGHKGPIHSLAFSPNGR  499

Query  120  LFAAGA  103
              A GA
Sbjct  500  FLATGA  505



>gb|KFQ30319.1| Transcription initiation factor TFIID subunit 5, partial [Mesitornis 
unicolor]
Length=611

 Score =   212 bits (539),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 101/200 (51%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NYIATGS+D+TVRLWDV +
Sbjct  410  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYIATGSADRTVRLWDVLN  469

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   ++ L 
Sbjct  470  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTIYALR  529

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  530  FSRDGEILASGSMDNTVRLWDAVKAFEDLETDDFTTATGHINLPENSQELLLGTYMTKST  589

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA+S
Sbjct  590  PVVHLHFTRRNLLLAAGAYS  609


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/186 (28%), Positives = 76/186 (41%), Gaps = 17/186 (9%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  331  SDDVLERIMDEKTASELKILYGHSGPVYGTSFSPDRNYLLSCSEDGTVRLWSLQTFTCLV  390

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  391  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNS  450

Query  300  SLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRFSRRNL  121
            + +A+GSAD TV+LWDV                      ++       P+++L FS    
Sbjct  451  NYIATGSADRTVRLWDVLNGN-----------------CVRIFTGHKGPIHSLAFSPNGR  493

Query  120  LFAAGA  103
              A GA
Sbjct  494  FLATGA  499



>ref|XP_009940588.1| PREDICTED: transcription initiation factor TFIID subunit 5 [Opisthocomus 
hoazin]
Length=625

 Score =   212 bits (539),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 101/200 (51%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NYIATGS+D+TVRLWDV +
Sbjct  424  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYIATGSADRTVRLWDVLN  483

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   ++ L 
Sbjct  484  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTIYALR  543

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  544  FSRDGEILASGSMDNTVRLWDAVKAFEDLETDDFTTATGHINLPENSQELLLGTYMTKST  603

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA+S
Sbjct  604  PVVHLHFTRRNLLLAAGAYS  623


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/186 (28%), Positives = 76/186 (41%), Gaps = 17/186 (9%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  345  SDDVLERIMDEKTASELKILYGHSGPVYGTSFSPDRNYLLSCSEDGTVRLWSLQTFTCLV  404

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  405  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNS  464

Query  300  SLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRFSRRNL  121
            + +A+GSAD TV+LWDV                      ++       P+++L FS    
Sbjct  465  NYIATGSADRTVRLWDVLNGN-----------------CVRIFTGHKGPIHSLAFSPNGR  507

Query  120  LFAAGA  103
              A GA
Sbjct  508  FLATGA  513



>ref|XP_010713053.1| PREDICTED: transcription initiation factor TFIID subunit 5 [Meleagris 
gallopavo]
Length=645

 Score =   212 bits (540),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 101/200 (51%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NYIATGS+D+TVRLWDV +
Sbjct  444  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYIATGSADRTVRLWDVLN  503

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   ++ L 
Sbjct  504  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTIYALR  563

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  564  FSRDGEILASGSMDNTVRLWDAVKAFEDLETDDFTTATGHINLPENSQDLLLGTYMTKST  623

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA+S
Sbjct  624  PVVHLHFTRRNLLLAAGAYS  643


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 59/216 (27%), Positives = 88/216 (41%), Gaps = 25/216 (12%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  365  SDDVLERIMDEKTASELKILYGHSGPVYGTSFSPDRNYLLSCSEDGTVRLWSLQTFTCLV  424

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  425  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNS  484

Query  300  SLLASGSADCTVKLWDVTTSTKM----------------PKSEENKSGSTNRLRSL----  181
            + +A+GSAD TV+LWDV     +                P      +G+T+    L    
Sbjct  485  NYIATGSADRTVRLWDVLNGNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIG  544

Query  180  -----KTLPTKSTPLYALRFSRRNLLFAAGAFSKSA  88
                   L   +  +YALRFSR   + A+G+   + 
Sbjct  545  HGLMVGELKGHTDTIYALRFSRDGEILASGSMDNTV  580



>gb|KIJ21816.1| hypothetical protein PAXINDRAFT_105345 [Paxillus involutus ATCC 
200175]
Length=785

 Score =   214 bits (544),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 108/203 (53%), Positives = 135/203 (67%), Gaps = 11/203 (5%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFA+AS DRTAR+WS DR   LRI AGHLSDVDCV++H N  Y+ATGSSD T RLWDVQ 
Sbjct  577  YFATASRDRTARLWSTDRTSCLRIYAGHLSDVDCVRFHPNSLYLATGSSDWTARLWDVQR  636

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVR+FIGH+  + +LA+SPDGRY+AS  ED  I +WDL SG+ I  + GH++ V++LA
Sbjct  637  GTCVRVFIGHQGTLSTLAISPDGRYLASAGEDLAINLWDLGSGKRIKKMTGHSASVYSLA  696

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRS-----------LKTLP  169
            FS E S+L SG AD TV+ WDV +S    +  EN +     LRS           L T P
Sbjct  697  FSAESSMLVSGGADWTVRCWDVKSSGGPSQPRENGADENTVLRSGEEEGNETSDLLATFP  756

Query  168  TKSTPLYALRFSRRNLLFAAGAF  100
            TK TP+  + F+ RNL   AG +
Sbjct  757  TKRTPITQVHFTPRNLCLVAGNY  779



>gb|KFW76480.1| Transcription initiation factor TFIID subunit 5, partial [Manacus 
vitellinus]
Length=611

 Score =   211 bits (538),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NYIATGS+D+T+RLWDV +
Sbjct  410  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYIATGSADRTIRLWDVLN  469

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   ++ L 
Sbjct  470  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTIYALR  529

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  530  FSRDGEILASGSMDNTVRLWDAVKAFEDLETDDFTTATGHINLPENSQDLLLGTYMTKST  589

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA+S
Sbjct  590  PVVHLHFTRRNLLLAAGAYS  609


 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 76/186 (41%), Gaps = 17/186 (9%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  331  SDDVLERIMDEKTASELKILYGHSGPVYGTSFSPDRNYLLSCSEDGTVRLWSLQTFTCLV  390

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  391  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNS  450

Query  300  SLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRFSRRNL  121
            + +A+GSAD T++LWDV                      ++       P+++L FS    
Sbjct  451  NYIATGSADRTIRLWDVLNGN-----------------CVRIFTGHKGPIHSLAFSPNGR  493

Query  120  LFAAGA  103
              A GA
Sbjct  494  FLATGA  499



>gb|KFW95731.1| Transcription initiation factor TFIID subunit 5, partial [Phalacrocorax 
carbo]
Length=611

 Score =   211 bits (538),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NYIATGS+D+T+RLWDV +
Sbjct  410  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYIATGSADRTIRLWDVLN  469

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   ++ L 
Sbjct  470  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTIYALR  529

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  530  FSRDGEILASGSMDNTVRLWDAVKAFEDLETDDFTTATGHINLPENSQDLLLGTYMTKST  589

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA+S
Sbjct  590  PVVHLHFTRRNLLLAAGAYS  609


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 76/186 (41%), Gaps = 17/186 (9%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  331  SDDVLERIMDEKTASELKILYGHSGPVYGTSFSPDRNYLLSCSEDGTVRLWSLQTFTCLV  390

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  391  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNS  450

Query  300  SLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRFSRRNL  121
            + +A+GSAD T++LWDV                      ++       P+++L FS    
Sbjct  451  NYIATGSADRTIRLWDVLNGN-----------------CVRIFTGHKGPIHSLAFSPNGR  493

Query  120  LFAAGA  103
              A GA
Sbjct  494  FLATGA  499



>gb|KFH65505.1| hypothetical protein MVEG_08982 [Mortierella verticillata NRRL 
6337]
Length=713

 Score =   213 bits (542),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 105/225 (47%), Positives = 133/225 (59%), Gaps = 32/225 (14%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFA+ASHDRTAR+WS D I PLRI AGHLSDVD V++H N  YI TGSSDK+ RLWDVQ 
Sbjct  488  YFATASHDRTARLWSCDHIYPLRIFAGHLSDVDVVKFHPNSKYIVTGSSDKSARLWDVQR  547

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVR+F GH   I +LA+SPDGR MAS  ED  I +WDL SG+ +  + GH   +++L 
Sbjct  548  GTCVRVFTGHVGAIQALAVSPDGRMMASAGEDRSIQLWDLGSGKRMKKMTGHQGVIYSLD  607

Query  315  FSCEGSLLASGSADCTVKLWDVTTST--------------------------------KM  232
            FS +G++L SGSADCTV+ WDV                                    ++
Sbjct  608  FSQDGTVLVSGSADCTVRAWDVKKEAIAGQPSHRILQDHNGSVGSPTTPATTHQQAVERL  667

Query  231  PKSEENKSGSTNRLRSLKTLPTKSTPLYALRFSRRNLLFAAGAFS  97
             K +  +         L   PTK TP+Y ++F++RNL  A GAFS
Sbjct  668  TKKQAVQGAHFESEDHLAAFPTKRTPIYKVQFTKRNLCLAIGAFS  712


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 43/170 (25%), Positives = 68/170 (40%), Gaps = 42/170 (25%)
 Frame = -3

Query  609  RIMAGHLSDVDCVQWHANCNYIATGSSDKTVRL-------------------WDVQSGE-  490
            R + GH   V    +  +  Y+ + S DKT RL                   WDV  G  
Sbjct  426  RKLIGHSGAVFGASFSPDNKYLISCSEDKTARLWSTDTLTNLVAYKGHNYPVWDVDFGPQ  485

Query  489  ----------------------CVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDL  376
                                   +RIF GH S +  +   P+ +Y+ +G  D    +WD+
Sbjct  486  GFYFATASHDRTARLWSCDHIYPLRIFAGHLSDVDVVKFHPNSKYIVTGSSDKSARLWDV  545

Query  375  ASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVTTSTKMPK  226
              G C+    GH   +  LA S +G ++AS   D +++LWD+ +  +M K
Sbjct  546  QRGTCVRVFTGHVGAIQALAVSPDGRMMASAGEDRSIQLWDLGSGKRMKK  595


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/138 (25%), Positives = 53/138 (38%), Gaps = 28/138 (20%)
 Frame = -3

Query  585  DVDCVQWHANCNYIATGSSDKTVRLWDV----------------------------QSGE  490
            +++CV    +   +A G S+  VRLW +                            + G 
Sbjct  364  NINCVTVSEDATLMAAGFSESYVRLWSLKGTKLRGFNSTFKPATIHDSDDLDRIREEHGT  423

Query  489  CVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFS  310
              R  IGH   +   + SPD +Y+ S  ED    +W   +   +    GH   VW + F 
Sbjct  424  DSRKLIGHSGAVFGASFSPDNKYLISCSEDKTARLWSTDTLTNLVAYKGHNYPVWDVDFG  483

Query  309  CEGSLLASGSADCTVKLW  256
             +G   A+ S D T +LW
Sbjct  484  PQGFYFATASHDRTARLW  501



>gb|KFM06584.1| Transcription initiation factor TFIID subunit 5, partial [Aptenodytes 
forsteri]
 gb|KFP46880.1| Transcription initiation factor TFIID subunit 5, partial [Cathartes 
aura]
 gb|KFP81091.1| Transcription initiation factor TFIID subunit 5, partial [Acanthisitta 
chloris]
 gb|KFP94302.1| Transcription initiation factor TFIID subunit 5, partial [Haliaeetus 
albicilla]
 gb|KFQ62834.1| Transcription initiation factor TFIID subunit 5, partial [Pelecanus 
crispus]
 gb|KFV42908.1| Transcription initiation factor TFIID subunit 5, partial [Gavia 
stellata]
 gb|KFV49244.1| Transcription initiation factor TFIID subunit 5, partial [Tyto 
alba]
Length=611

 Score =   211 bits (538),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NYIATGS+D+T+RLWDV +
Sbjct  410  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYIATGSADRTIRLWDVLN  469

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   ++ L 
Sbjct  470  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTIYALR  529

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  530  FSRDGEILASGSMDNTVRLWDAVKAFEDLETDDFTTATGHINLPENSQDLLLGTYMTKST  589

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA+S
Sbjct  590  PVVHLHFTRRNLLLAAGAYS  609


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 76/186 (41%), Gaps = 17/186 (9%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  331  SDDVLERIMDEKTASELKILYGHSGPVYGTSFSPDRNYLLSCSEDGTVRLWSLQTFTCLV  390

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  391  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNS  450

Query  300  SLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRFSRRNL  121
            + +A+GSAD T++LWDV                      ++       P+++L FS    
Sbjct  451  NYIATGSADRTIRLWDVLNGN-----------------CVRIFTGHKGPIHSLAFSPNGR  493

Query  120  LFAAGA  103
              A GA
Sbjct  494  FLATGA  499



>ref|XP_005508619.1| PREDICTED: transcription initiation factor TFIID subunit 5 [Columba 
livia]
Length=634

 Score =   212 bits (539),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 102/200 (51%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NYIATGS+D+TVRLWDV +
Sbjct  433  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYIATGSADRTVRLWDVLN  492

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   V+ L 
Sbjct  493  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVYALR  552

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  553  FSRDGEILASGSMDNTVRLWDAVKAFEDLETDDFTTATGHINLPENSQDLLLGTYMTKST  612

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA+S
Sbjct  613  PVVHLHFTRRNLLLAAGAYS  632


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/186 (28%), Positives = 76/186 (41%), Gaps = 17/186 (9%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  354  SDDVLERIMDEKTASELKILYGHSGPVYGTSFSPDRNYLLSCSEDGTVRLWSLQTFTCLV  413

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  414  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNS  473

Query  300  SLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRFSRRNL  121
            + +A+GSAD TV+LWDV                      ++       P+++L FS    
Sbjct  474  NYIATGSADRTVRLWDVLNGN-----------------CVRIFTGHKGPIHSLAFSPNGR  516

Query  120  LFAAGA  103
              A GA
Sbjct  517  FLATGA  522



>ref|XP_009998472.1| PREDICTED: transcription initiation factor TFIID subunit 5 [Chaetura 
pelagica]
Length=632

 Score =   212 bits (539),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 101/200 (51%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NYIATGS+D+TVRLWDV +
Sbjct  431  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYIATGSADRTVRLWDVLN  490

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   ++ L 
Sbjct  491  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTIYALR  550

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  551  FSRDGEILASGSMDNTVRLWDAVKAFEDLETDDFTTATGHINLPENSQELLLGTYMTKST  610

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA+S
Sbjct  611  PVVHLHFTRRNLLLAAGAYS  630


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/186 (28%), Positives = 76/186 (41%), Gaps = 17/186 (9%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  352  SDDVLERIMDEKTASELKILYGHSGPVYGTSFSPDRNYLLSCSEDGTVRLWSLQTFTCLV  411

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  412  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNS  471

Query  300  SLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRFSRRNL  121
            + +A+GSAD TV+LWDV                      ++       P+++L FS    
Sbjct  472  NYIATGSADRTVRLWDVLNGN-----------------CVRIFTGHKGPIHSLAFSPNGR  514

Query  120  LFAAGA  103
              A GA
Sbjct  515  FLATGA  520



>ref|XP_009636390.1| PREDICTED: transcription initiation factor TFIID subunit 5 [Egretta 
garzetta]
Length=626

 Score =   211 bits (538),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 101/200 (51%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NYIATGS+D+T+RLWDV +
Sbjct  425  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYIATGSADRTIRLWDVLN  484

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   V+ L 
Sbjct  485  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVYALR  544

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  545  FSRDGEILASGSMDNTVRLWDAVKAFEDLETDDFTTATGHINLPENSQDLLLGTYMTKST  604

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA+S
Sbjct  605  PVVHLHFTRRNLLLAAGAYS  624


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 76/186 (41%), Gaps = 17/186 (9%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  346  SDDVLERIMDEKTASELKILYGHSGPVYGTSFSPDRNYLLSCSEDGTVRLWSLQTFTCLV  405

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  406  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNS  465

Query  300  SLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRFSRRNL  121
            + +A+GSAD T++LWDV                      ++       P+++L FS    
Sbjct  466  NYIATGSADRTIRLWDVLNGN-----------------CVRIFTGHKGPIHSLAFSPNGR  508

Query  120  LFAAGA  103
              A GA
Sbjct  509  FLATGA  514



>ref|XP_009326723.1| PREDICTED: transcription initiation factor TFIID subunit 5 [Pygoscelis 
adeliae]
Length=628

 Score =   212 bits (539),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 101/200 (51%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NYIATGS+D+T+RLWDV +
Sbjct  427  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYIATGSADRTIRLWDVLN  486

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   V+ L 
Sbjct  487  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVYALR  546

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  547  FSRDGEILASGSMDNTVRLWDAVKAFEDLETDDFTTATGHINLPENSQDLLLGTYMTKST  606

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA+S
Sbjct  607  PVVHLHFTRRNLLLAAGAYS  626


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 76/186 (41%), Gaps = 17/186 (9%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  348  SDDVLERIMDEKTASELKILYGHSGPVYGTSFSPDRNYLLSCSEDGTVRLWSLQTFTCLV  407

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  408  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNS  467

Query  300  SLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRFSRRNL  121
            + +A+GSAD T++LWDV                      ++       P+++L FS    
Sbjct  468  NYIATGSADRTIRLWDVLNGN-----------------CVRIFTGHKGPIHSLAFSPNGR  510

Query  120  LFAAGA  103
              A GA
Sbjct  511  FLATGA  516



>ref|XP_009879920.1| PREDICTED: transcription initiation factor TFIID subunit 5 [Charadrius 
vociferus]
Length=644

 Score =   212 bits (539),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 101/200 (51%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NYIATGS+D+TVRLWDV +
Sbjct  443  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYIATGSADRTVRLWDVLN  502

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   ++ L 
Sbjct  503  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTIYALR  562

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  563  FSRDGEILASGSMDNTVRLWDAVKAFEDLETDDFTTATGHINLPENSQDLLLGTYMTKST  622

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA+S
Sbjct  623  PVVHLHFTRRNLLLAAGAYS  642


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 59/216 (27%), Positives = 88/216 (41%), Gaps = 25/216 (12%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  364  SDDVLERIMDEKTASELKILYGHSGPVYGTSFSPDRNYLLSCSEDGTVRLWSLQTFTCLV  423

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  424  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNS  483

Query  300  SLLASGSADCTVKLWDVTTSTKM----------------PKSEENKSGSTNRLRSL----  181
            + +A+GSAD TV+LWDV     +                P      +G+T+    L    
Sbjct  484  NYIATGSADRTVRLWDVLNGNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIG  543

Query  180  -----KTLPTKSTPLYALRFSRRNLLFAAGAFSKSA  88
                   L   +  +YALRFSR   + A+G+   + 
Sbjct  544  HGLMVGELKGHTDTIYALRFSRDGEILASGSMDNTV  579



>ref|XP_010177158.1| PREDICTED: transcription initiation factor TFIID subunit 5 [Mesitornis 
unicolor]
Length=636

 Score =   212 bits (539),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 101/200 (51%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NYIATGS+D+TVRLWDV +
Sbjct  435  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYIATGSADRTVRLWDVLN  494

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   ++ L 
Sbjct  495  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTIYALR  554

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  555  FSRDGEILASGSMDNTVRLWDAVKAFEDLETDDFTTATGHINLPENSQELLLGTYMTKST  614

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA+S
Sbjct  615  PVVHLHFTRRNLLLAAGAYS  634


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/186 (28%), Positives = 76/186 (41%), Gaps = 17/186 (9%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  356  SDDVLERIMDEKTASELKILYGHSGPVYGTSFSPDRNYLLSCSEDGTVRLWSLQTFTCLV  415

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  416  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNS  475

Query  300  SLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRFSRRNL  121
            + +A+GSAD TV+LWDV                      ++       P+++L FS    
Sbjct  476  NYIATGSADRTVRLWDVLNGN-----------------CVRIFTGHKGPIHSLAFSPNGR  518

Query  120  LFAAGA  103
              A GA
Sbjct  519  FLATGA  524



>gb|KFV74673.1| Transcription initiation factor TFIID subunit 5, partial [Picoides 
pubescens]
Length=611

 Score =   211 bits (538),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NYIATGS+D+T+RLWDV +
Sbjct  410  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYIATGSADRTIRLWDVLN  469

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   ++ L 
Sbjct  470  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTIYALR  529

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  530  FSRDGEILASGSMDNTVRLWDAVKAFEDLETDDFTTATGHINLPENSQDLLLGTYMTKST  589

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA+S
Sbjct  590  PVVHLHFTRRNLLLAAGAYS  609


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 76/186 (41%), Gaps = 17/186 (9%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  331  SDDVLERIMDEKTASELKILYGHSGPVYGTSFSPDRNYLLSCSEDGTVRLWSLQTFTCLV  390

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  391  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNS  450

Query  300  SLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRFSRRNL  121
            + +A+GSAD T++LWDV                      ++       P+++L FS    
Sbjct  451  NYIATGSADRTIRLWDVLNGN-----------------CVRIFTGHKGPIHSLAFSPNGR  493

Query  120  LFAAGA  103
              A GA
Sbjct  494  FLATGA  499



>ref|XP_009554071.1| PREDICTED: transcription initiation factor TFIID subunit 5 [Cuculus 
canorus]
Length=630

 Score =   212 bits (539),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NYIATGS+D+T+RLWDV +
Sbjct  429  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYIATGSADRTIRLWDVLN  488

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   ++ L 
Sbjct  489  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTIYALR  548

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  549  FSRDGEILASGSMDNTVRLWDAVKAFEDLETDDFTTATGHINLPENSQDLLLGTYMTKST  608

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA+S
Sbjct  609  PVVHLHFTRRNLLLAAGAYS  628


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 58/216 (27%), Positives = 88/216 (41%), Gaps = 25/216 (12%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  350  SDDVLERIMDEKTASELKILYGHSGPVYGTSFSPDRNYLLSCSEDGTVRLWSLQTFTCLV  409

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  410  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNS  469

Query  300  SLLASGSADCTVKLWDVTTSTKM----------------PKSEENKSGSTNRLRSL----  181
            + +A+GSAD T++LWDV     +                P      +G+T+    L    
Sbjct  470  NYIATGSADRTIRLWDVLNGNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIG  529

Query  180  -----KTLPTKSTPLYALRFSRRNLLFAAGAFSKSA  88
                   L   +  +YALRFSR   + A+G+   + 
Sbjct  530  HGLMVGELKGHTDTIYALRFSRDGEILASGSMDNTV  565



>gb|KFO69542.1| Transcription initiation factor TFIID subunit 5, partial [Cuculus 
canorus]
Length=611

 Score =   211 bits (538),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NYIATGS+D+T+RLWDV +
Sbjct  410  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYIATGSADRTIRLWDVLN  469

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   ++ L 
Sbjct  470  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTIYALR  529

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  530  FSRDGEILASGSMDNTVRLWDAVKAFEDLETDDFTTATGHINLPENSQDLLLGTYMTKST  589

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA+S
Sbjct  590  PVVHLHFTRRNLLLAAGAYS  609


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 76/186 (41%), Gaps = 17/186 (9%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  331  SDDVLERIMDEKTASELKILYGHSGPVYGTSFSPDRNYLLSCSEDGTVRLWSLQTFTCLV  390

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  391  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNS  450

Query  300  SLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRFSRRNL  121
            + +A+GSAD T++LWDV                      ++       P+++L FS    
Sbjct  451  NYIATGSADRTIRLWDVLNGN-----------------CVRIFTGHKGPIHSLAFSPNGR  493

Query  120  LFAAGA  103
              A GA
Sbjct  494  FLATGA  499



>ref|XP_008932384.1| PREDICTED: transcription initiation factor TFIID subunit 5 [Manacus 
vitellinus]
Length=618

 Score =   211 bits (538),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NYIATGS+D+T+RLWDV +
Sbjct  417  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYIATGSADRTIRLWDVLN  476

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   ++ L 
Sbjct  477  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTIYALR  536

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  537  FSRDGEILASGSMDNTVRLWDAVKAFEDLETDDFTTATGHINLPENSQDLLLGTYMTKST  596

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA+S
Sbjct  597  PVVHLHFTRRNLLLAAGAYS  616


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 76/186 (41%), Gaps = 17/186 (9%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  338  SDDVLERIMDEKTASELKILYGHSGPVYGTSFSPDRNYLLSCSEDGTVRLWSLQTFTCLV  397

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  398  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNS  457

Query  300  SLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRFSRRNL  121
            + +A+GSAD T++LWDV                      ++       P+++L FS    
Sbjct  458  NYIATGSADRTIRLWDVLNGN-----------------CVRIFTGHKGPIHSLAFSPNGR  500

Query  120  LFAAGA  103
              A GA
Sbjct  501  FLATGA  506



>ref|XP_009074045.1| PREDICTED: transcription initiation factor TFIID subunit 5 [Acanthisitta 
chloris]
Length=632

 Score =   211 bits (538),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NYIATGS+D+T+RLWDV +
Sbjct  431  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYIATGSADRTIRLWDVLN  490

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   ++ L 
Sbjct  491  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTIYALR  550

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  551  FSRDGEILASGSMDNTVRLWDAVKAFEDLETDDFTTATGHINLPENSQDLLLGTYMTKST  610

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA+S
Sbjct  611  PVVHLHFTRRNLLLAAGAYS  630


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 58/216 (27%), Positives = 88/216 (41%), Gaps = 25/216 (12%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  352  SDDVLERIMDEKTASELKILYGHSGPVYGTSFSPDRNYLLSCSEDGTVRLWSLQTFTCLV  411

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  412  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNS  471

Query  300  SLLASGSADCTVKLWDVTTSTKM----------------PKSEENKSGSTNRLRSL----  181
            + +A+GSAD T++LWDV     +                P      +G+T+    L    
Sbjct  472  NYIATGSADRTIRLWDVLNGNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIG  531

Query  180  -----KTLPTKSTPLYALRFSRRNLLFAAGAFSKSA  88
                   L   +  +YALRFSR   + A+G+   + 
Sbjct  532  HGLMVGELKGHTDTIYALRFSRDGEILASGSMDNTV  567



>ref|XP_009572404.1| PREDICTED: transcription initiation factor TFIID subunit 5, partial 
[Fulmarus glacialis]
Length=614

 Score =   211 bits (538),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NYIATGS+D+T+RLWDV +
Sbjct  413  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYIATGSADRTIRLWDVLN  472

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   ++ L 
Sbjct  473  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTIYALR  532

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  533  FSRDGEILASGSMDNTVRLWDAVKAFEDLETDDFTTATGHINLPENSQDLLLGTYMTKST  592

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA+S
Sbjct  593  PVVHLHFTRRNLLLAAGAYS  612


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 58/216 (27%), Positives = 88/216 (41%), Gaps = 25/216 (12%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  334  SDDVLERIMDEKTASELKILYGHSGPVYGTSFSPDRNYLLSCSEDGTVRLWSLQTFTCLV  393

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  394  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNS  453

Query  300  SLLASGSADCTVKLWDVTTSTKM----------------PKSEENKSGSTNRLRSL----  181
            + +A+GSAD T++LWDV     +                P      +G+T+    L    
Sbjct  454  NYIATGSADRTIRLWDVLNGNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIG  513

Query  180  -----KTLPTKSTPLYALRFSRRNLLFAAGAFSKSA  88
                   L   +  +YALRFSR   + A+G+   + 
Sbjct  514  HGLMVGELKGHTDTIYALRFSRDGEILASGSMDNTV  549



>gb|KFP84791.1| Transcription initiation factor TFIID subunit 5, partial [Apaloderma 
vittatum]
Length=611

 Score =   211 bits (537),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NYIATGS+D+T+RLWDV +
Sbjct  410  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYIATGSADRTIRLWDVLN  469

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   ++ L 
Sbjct  470  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTIYALR  529

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  530  FSRDGEILASGSMDNTVRLWDAVKAFEDLETDDFTTATGHINLPENSQDLLLGTYMTKST  589

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA+S
Sbjct  590  PVVHLHFTRRNLLLAAGAYS  609


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 76/186 (41%), Gaps = 17/186 (9%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  331  SDDVLERIMDEKTASELKILYGHSGPVYGTSFSPDRNYLLSCSEDGTVRLWSLQTFTCLV  390

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  391  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNS  450

Query  300  SLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRFSRRNL  121
            + +A+GSAD T++LWDV                      ++       P+++L FS    
Sbjct  451  NYIATGSADRTIRLWDVLNGN-----------------CVRIFTGHKGPIHSLAFSPNGR  493

Query  120  LFAAGA  103
              A GA
Sbjct  494  FLATGA  499



>gb|KFV90642.1| Transcription initiation factor TFIID subunit 5, partial [Fulmarus 
glacialis]
Length=611

 Score =   211 bits (537),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NYIATGS+D+T+RLWDV +
Sbjct  410  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYIATGSADRTIRLWDVLN  469

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   ++ L 
Sbjct  470  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTIYALR  529

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  530  FSRDGEILASGSMDNTVRLWDAVKAFEDLETDDFTTATGHINLPENSQDLLLGTYMTKST  589

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA+S
Sbjct  590  PVVHLHFTRRNLLLAAGAYS  609


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 76/186 (41%), Gaps = 17/186 (9%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  331  SDDVLERIMDEKTASELKILYGHSGPVYGTSFSPDRNYLLSCSEDGTVRLWSLQTFTCLV  390

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  391  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNS  450

Query  300  SLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRFSRRNL  121
            + +A+GSAD T++LWDV                      ++       P+++L FS    
Sbjct  451  NYIATGSADRTIRLWDVLNGN-----------------CVRIFTGHKGPIHSLAFSPNGR  493

Query  120  LFAAGA  103
              A GA
Sbjct  494  FLATGA  499



>ref|XP_009963838.1| PREDICTED: transcription initiation factor TFIID subunit 5, partial 
[Tyto alba]
Length=614

 Score =   211 bits (538),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NYIATGS+D+T+RLWDV +
Sbjct  413  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYIATGSADRTIRLWDVLN  472

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   ++ L 
Sbjct  473  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTIYALR  532

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  533  FSRDGEILASGSMDNTVRLWDAVKAFEDLETDDFTTATGHINLPENSQDLLLGTYMTKST  592

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA+S
Sbjct  593  PVVHLHFTRRNLLLAAGAYS  612


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 58/216 (27%), Positives = 88/216 (41%), Gaps = 25/216 (12%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  334  SDDVLERIMDEKTASELKILYGHSGPVYGTSFSPDRNYLLSCSEDGTVRLWSLQTFTCLV  393

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  394  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNS  453

Query  300  SLLASGSADCTVKLWDVTTSTKM----------------PKSEENKSGSTNRLRSL----  181
            + +A+GSAD T++LWDV     +                P      +G+T+    L    
Sbjct  454  NYIATGSADRTIRLWDVLNGNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIG  513

Query  180  -----KTLPTKSTPLYALRFSRRNLLFAAGAFSKSA  88
                   L   +  +YALRFSR   + A+G+   + 
Sbjct  514  HGLMVGELKGHTDTIYALRFSRDGEILASGSMDNTV  549



>ref|XP_009484390.1| PREDICTED: transcription initiation factor TFIID subunit 5 [Pelecanus 
crispus]
Length=622

 Score =   211 bits (538),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NYIATGS+D+T+RLWDV +
Sbjct  421  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYIATGSADRTIRLWDVLN  480

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   ++ L 
Sbjct  481  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTIYALR  540

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  541  FSRDGEILASGSMDNTVRLWDAVKAFEDLETDDFTTATGHINLPENSQDLLLGTYMTKST  600

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA+S
Sbjct  601  PVVHLHFTRRNLLLAAGAYS  620


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 76/186 (41%), Gaps = 17/186 (9%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  342  SDDVLERIMDEKTASELKILYGHSGPVYGTSFSPDRNYLLSCSEDGTVRLWSLQTFTCLV  401

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  402  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNS  461

Query  300  SLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRFSRRNL  121
            + +A+GSAD T++LWDV                      ++       P+++L FS    
Sbjct  462  NYIATGSADRTIRLWDVLNGN-----------------CVRIFTGHKGPIHSLAFSPNGR  504

Query  120  LFAAGA  103
              A GA
Sbjct  505  FLATGA  510



>ref|XP_008608025.1| hypothetical protein SDRG_04142 [Saprolegnia diclina VS20]
 gb|EQC38433.1| hypothetical protein SDRG_04142 [Saprolegnia diclina VS20]
Length=731

 Score =   213 bits (542),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 101/203 (50%), Positives = 136/203 (67%), Gaps = 10/203 (5%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFASAS DRTAR+WS DR+QPLRI AGHLSDV+ V +H N NYIATGS+DK+VR+WDVQS
Sbjct  521  YFASASMDRTARLWSTDRVQPLRIFAGHLSDVETVAFHPNHNYIATGSTDKSVRIWDVQS  580

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G+C+R+F GH   + ++A SP+GRY+AS  ED  + VWDL  G+ +  L+GH+  +++L 
Sbjct  581  GQCIRVFTGHYGAVHTVAFSPNGRYLASAGEDAFVNVWDLHMGKRVDTLLGHSKAIYSLG  640

Query  315  FSCEGSLLASGSADCTVKLWDV------TTSTKMPKSEENKSGSTNRLRS----LKTLPT  166
            FS E S++ SG AD TV+LWD+        S K       +   TN +      LKT  T
Sbjct  641  FSQESSMIVSGGADHTVRLWDMHRLGHDAMSEKQVAVHVKQKRKTNHVHGSRALLKTFTT  700

Query  165  KSTPLYALRFSRRNLLFAAGAFS  97
            K TP+  ++F+ RN+L   G+F 
Sbjct  701  KQTPVVRVQFTPRNMLLVGGSFQ  723



>ref|XP_007423302.1| PREDICTED: transcription initiation factor TFIID subunit 5 [Python 
bivittatus]
Length=802

 Score =   213 bits (543),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 101/200 (51%), Positives = 137/200 (69%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NYIATGS+D+TVRLWDV +
Sbjct  601  YFVSGGHDRIARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYIATGSADRTVRLWDVLN  660

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  + SLA SP+GR++A+G  DG++++WD+  G  +  L GH+  ++ L 
Sbjct  661  GNCVRIFTGHKGPVHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHSDTIYALK  720

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   S     L T  TKST
Sbjct  721  FSRDGEILASGSMDNTVRLWDAVKAFEDLETDDFTTATGHINLPESSQDLLLGTYMTKST  780

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA+S
Sbjct  781  PVIHLHFTRRNLLLAAGAYS  800


 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 63/137 (46%), Gaps = 0/137 (0%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D T+RLW + +  C+ 
Sbjct  522  SDDVLERIMDEKTASELKILYGHSGPVYGASFSPDRNYLLSSSEDGTIRLWSLLTFSCLV  581

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  582  GYKGHNYPVWDTQFSPYGYYFVSGGHDRIARLWATDHYQPLRIFAGHLADVTCTRFHPNS  641

Query  300  SLLASGSADCTVKLWDV  250
            + +A+GSAD TV+LWDV
Sbjct  642  NYIATGSADRTVRLWDV  658



>ref|XP_010141597.1| PREDICTED: transcription initiation factor TFIID subunit 5, partial 
[Buceros rhinoceros silvestris]
Length=614

 Score =   211 bits (537),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NYIATGS+D+T+RLWDV +
Sbjct  413  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYIATGSADRTIRLWDVLN  472

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   ++ L 
Sbjct  473  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTIYALR  532

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  533  FSRDGEILASGSMDNTVRLWDAVKAFEDLETDDFTTATGHINLPENSQDLLLGTYMTKST  592

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA+S
Sbjct  593  PVIHLHFTRRNLLLAAGAYS  612


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 76/186 (41%), Gaps = 17/186 (9%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  334  SDDVLERIMDEKTASELKILYGHSGPVYGTSFSPDRNYLLSCSEDGTVRLWSLQTFTCLV  393

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  394  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNS  453

Query  300  SLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRFSRRNL  121
            + +A+GSAD T++LWDV                      ++       P+++L FS    
Sbjct  454  NYIATGSADRTIRLWDVLNGN-----------------CVRIFTGHKGPIHSLAFSPNGR  496

Query  120  LFAAGA  103
              A GA
Sbjct  497  FLATGA  502



>ref|XP_005417385.1| PREDICTED: transcription initiation factor TFIID subunit 5, partial 
[Geospiza fortis]
Length=625

 Score =   211 bits (538),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NYIATGS+D+T+RLWDV +
Sbjct  424  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYIATGSADRTIRLWDVLN  483

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   ++ L 
Sbjct  484  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTIYALR  543

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  544  FSRDGEILASGSMDNTVRLWDAVKAFEDLETDDFTTATGHINLPENSQDLLLGTYMTKST  603

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA+S
Sbjct  604  PVVHLHFTRRNLLLAAGAYS  623


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 76/186 (41%), Gaps = 17/186 (9%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  345  SDDVLERIMDEKTASELKILYGHSGPVYGTSFSPDRNYLLSCSEDGTVRLWSLQTFTCLV  404

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  405  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNS  464

Query  300  SLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRFSRRNL  121
            + +A+GSAD T++LWDV                      ++       P+++L FS    
Sbjct  465  NYIATGSADRTIRLWDVLNGN-----------------CVRIFTGHKGPIHSLAFSPNGR  507

Query  120  LFAAGA  103
              A GA
Sbjct  508  FLATGA  513



>ref|XP_009985392.1| PREDICTED: transcription initiation factor TFIID subunit 5, partial 
[Tauraco erythrolophus]
Length=620

 Score =   211 bits (537),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NY+ATGS+D+TVRLWDV +
Sbjct  419  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYVATGSADRTVRLWDVLN  478

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   ++ L 
Sbjct  479  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTIYALR  538

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  539  FSRDGEILASGSMDNTVRLWDAVKAFEDLETDDFTTATGHINLPENSQDLLLGTYMTKST  598

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA+S
Sbjct  599  PVVHLHFTRRNLLLAAGAYS  618


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/186 (28%), Positives = 76/186 (41%), Gaps = 17/186 (9%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  340  SDDVLERIMDEKTASELKILYGHSGPVYGTSFSPDRNYLLSCSEDGTVRLWSLQTFTCLV  399

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  400  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNS  459

Query  300  SLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRFSRRNL  121
            + +A+GSAD TV+LWDV                      ++       P+++L FS    
Sbjct  460  NYVATGSADRTVRLWDVLNGN-----------------CVRIFTGHKGPIHSLAFSPNGR  502

Query  120  LFAAGA  103
              A GA
Sbjct  503  FLATGA  508



>ref|XP_009663933.1| PREDICTED: transcription initiation factor TFIID subunit 5 [Struthio 
camelus australis]
Length=662

 Score =   212 bits (539),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/200 (51%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NYIATGS+D+TVRLWDV +
Sbjct  461  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYIATGSADRTVRLWDVLN  520

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   ++ L 
Sbjct  521  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTIYALR  580

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  581  FSRDGEILASGSMDNTVRLWDAVKAFEDLETDDFTTATGHINLPENSQDLLLGTYMTKST  640

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA+S
Sbjct  641  PVVHLHFTRRNLLLAAGAYS  660


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 59/216 (27%), Positives = 88/216 (41%), Gaps = 25/216 (12%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  382  SDDVLERIMDEKTASELKILYGHSGPVYGTSFSPDRNYLLSCSEDGTVRLWSLQTFTCLV  441

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  442  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNS  501

Query  300  SLLASGSADCTVKLWDVTTSTKM----------------PKSEENKSGSTNRLRSL----  181
            + +A+GSAD TV+LWDV     +                P      +G+T+    L    
Sbjct  502  NYIATGSADRTVRLWDVLNGNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIG  561

Query  180  -----KTLPTKSTPLYALRFSRRNLLFAAGAFSKSA  88
                   L   +  +YALRFSR   + A+G+   + 
Sbjct  562  HGLMVGELKGHTDTIYALRFSRDGEILASGSMDNTV  597



>ref|XP_005437324.1| PREDICTED: transcription initiation factor TFIID subunit 5, partial 
[Falco cherrug]
Length=627

 Score =   211 bits (538),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NYIATGS+D+T+RLWDV +
Sbjct  426  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYIATGSADRTIRLWDVLN  485

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   ++ L 
Sbjct  486  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTIYALR  545

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  546  FSRDGEILASGSMDNTVRLWDAVKAFEDLETDDFTTATGHINLPENSQDLLLGTYMTKST  605

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA+S
Sbjct  606  PVVHLHFTRRNLLLAAGAYS  625


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 76/186 (41%), Gaps = 17/186 (9%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  347  SDDVLERIMDEKTASELKILYGHSGPVYGTSFSPDRNYLLSCSEDGTVRLWSLQTFTCLV  406

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  407  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNS  466

Query  300  SLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRFSRRNL  121
            + +A+GSAD T++LWDV                      ++       P+++L FS    
Sbjct  467  NYIATGSADRTIRLWDVLNGN-----------------CVRIFTGHKGPIHSLAFSPNGR  509

Query  120  LFAAGA  103
              A GA
Sbjct  510  FLATGA  515



>ref|XP_009067209.1| hypothetical protein LOTGIDRAFT_135304, partial [Lottia gigantea]
 gb|ESO82043.1| hypothetical protein LOTGIDRAFT_135304, partial [Lottia gigantea]
Length=592

 Score =   211 bits (536),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/195 (52%), Positives = 137/195 (70%), Gaps = 5/195 (3%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDRTAR+WS D  QP+RI +GHLSDVDCVQ+H N NYIATGSSD+TVRLWDV S
Sbjct  397  YFVSGGHDRTARLWSTDHYQPMRIFSGHLSDVDCVQFHPNSNYIATGSSDRTVRLWDVLS  456

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G+ VRIF GH++ I SL  SPDG+Y+ S   D  I +W+LA+G  +  + GH + V++LA
Sbjct  457  GQSVRIFTGHKAPIHSLCFSPDGKYLVSSGVDQIINMWELATGSLVAQMKGHTNTVYSLA  516

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKS---GSTNRLRSLKTLPTKSTPLYA  145
            FS +G++L+SG  D TV+ WD+    +   ++ + S     +N L  L T  TK++P+ A
Sbjct  517  FSRDGAILSSGGLDNTVRTWDINKIYEDIDTDVDASIPIDGSNLL--LGTYHTKASPVLA  574

Query  144  LRFSRRNLLFAAGAF  100
            L+F+R+NLL A GAF
Sbjct  575  LQFTRKNLLLAGGAF  589


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 65/163 (40%), Gaps = 25/163 (15%)
 Frame = -3

Query  546  IATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASG  367
            I   + D   R+ D ++   ++   GH   + S + SPD   M S  EDG I +W L + 
Sbjct  314  IDKDADDVFERMMDDKTSRDMKKLNGHSGPVYSTSFSPDRSSMVSCSEDGTIRLWSLQTW  373

Query  366  RCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLW----------------DVTTSTK  235
              +    GH   VW + FS  G    SG  D T +LW                DV     
Sbjct  374  SNLVCFKGHNYSVWDVQFSPHGHYFVSGGHDRTARLWSTDHYQPMRIFSGHLSDVDCVQF  433

Query  234  MPKSEENKSGSTNRL---------RSLKTLPTKSTPLYALRFS  133
             P S    +GS++R          +S++       P+++L FS
Sbjct  434  HPNSNYIATGSSDRTVRLWDVLSGQSVRIFTGHKAPIHSLCFS  476



>ref|XP_009810490.1| PREDICTED: transcription initiation factor TFIID subunit 5, partial 
[Gavia stellata]
Length=620

 Score =   211 bits (537),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NYIATGS+D+T+RLWDV +
Sbjct  419  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYIATGSADRTIRLWDVLN  478

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   ++ L 
Sbjct  479  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTIYALR  538

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  539  FSRDGEILASGSMDNTVRLWDAVKAFEDLETDDFTTATGHINLPENSQDLLLGTYMTKST  598

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA+S
Sbjct  599  PVVHLHFTRRNLLLAAGAYS  618


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 76/186 (41%), Gaps = 17/186 (9%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  340  SDDVLERIMDEKTASELKILYGHSGPVYGTSFSPDRNYLLSCSEDGTVRLWSLQTFTCLV  399

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  400  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNS  459

Query  300  SLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRFSRRNL  121
            + +A+GSAD T++LWDV                      ++       P+++L FS    
Sbjct  460  NYIATGSADRTIRLWDVLNGN-----------------CVRIFTGHKGPIHSLAFSPNGR  502

Query  120  LFAAGA  103
              A GA
Sbjct  503  FLATGA  508



>ref|XP_009276349.1| PREDICTED: transcription initiation factor TFIID subunit 5 [Aptenodytes 
forsteri]
Length=643

 Score =   211 bits (538),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NYIATGS+D+T+RLWDV +
Sbjct  442  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYIATGSADRTIRLWDVLN  501

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   ++ L 
Sbjct  502  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTIYALR  561

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  562  FSRDGEILASGSMDNTVRLWDAVKAFEDLETDDFTTATGHINLPENSQDLLLGTYMTKST  621

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA+S
Sbjct  622  PVVHLHFTRRNLLLAAGAYS  641


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 76/186 (41%), Gaps = 17/186 (9%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  363  SDDVLERIMDEKTASELKILYGHSGPVYGTSFSPDRNYLLSCSEDGTVRLWSLQTFTCLV  422

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  423  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNS  482

Query  300  SLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRFSRRNL  121
            + +A+GSAD T++LWDV                      ++       P+++L FS    
Sbjct  483  NYIATGSADRTIRLWDVLNGN-----------------CVRIFTGHKGPIHSLAFSPNGR  525

Query  120  LFAAGA  103
              A GA
Sbjct  526  FLATGA  531



>ref|XP_007373809.1| hypothetical protein SPAPADRAFT_134515 [Spathaspora passalidarum 
NRRL Y-27907]
 gb|EGW34225.1| hypothetical protein SPAPADRAFT_134515 [Spathaspora passalidarum 
NRRL Y-27907]
Length=782

 Score =   213 bits (542),  Expect = 2e-60, Method: Composition-based stats.
 Identities = 102/219 (47%), Positives = 140/219 (64%), Gaps = 26/219 (12%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFA+ASHD+TAR+W+ D I PLRI AGH++DVDCV++H N NY+ TGSSDKT R+WDVQ+
Sbjct  563  YFATASHDQTARLWATDHIYPLRIFAGHINDVDCVEFHPNSNYVFTGSSDKTCRMWDVQT  622

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHA-SCVWTL  319
            G CVRIF+GH + +  +A+SPDGR++AS  ED  + +WD+ +GR +  + GH  S +++L
Sbjct  623  GHCVRIFMGHTNPVNCIAVSPDGRWLASAGEDSVVNLWDIGTGRRLKTMKGHGRSSIYSL  682

Query  318  AFSCEGSLLASGSADCTVKLWDV-------------------------TTSTKMPKSEEN  214
            AFS +GS+L SGSAD +V++WDV                         TT+   P  + N
Sbjct  683  AFSRDGSVLVSGSADNSVRVWDVKRNTNDAGPEPEAFSLLGDGKTDNTTTANGKPSEKVN  742

Query  213  KSGSTNRLRSLKTLPTKSTPLYALRFSRRNLLFAAGAFS  97
            K         +    TK TP+Y + F+RRNL  A GAFS
Sbjct  743  KKEIIATSDHMTAYFTKKTPVYKVHFTRRNLCLAGGAFS  781


 Score = 70.5 bits (171),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 34/124 (27%), Positives = 57/124 (46%), Gaps = 13/124 (10%)
 Frame = -3

Query  588  SDVDCVQWHANCNYIATGSSDKTVRLW-------------DVQSGECVRIFIGHRSMILS  448
            +D+ C+ ++ + N +A G  D  ++LW             D    E  R  IGH   +  
Sbjct  453  NDMTCIDFNDDSNMVAAGFHDSYIKLWSLDGKPLKSVFKKDRHRHENTRKLIGHSGPVYG  512

Query  447  LAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCT  268
            ++ SPD +++ S  ED  + +W L +   +    GH   +W + FS  G   A+ S D T
Sbjct  513  VSFSPDNKFLLSASEDKTVRLWSLDTYTALVSYKGHNQPIWDVKFSPLGHYFATASHDQT  572

Query  267  VKLW  256
             +LW
Sbjct  573  ARLW  576



>ref|XP_009694116.1| PREDICTED: transcription initiation factor TFIID subunit 5, partial 
[Cariama cristata]
Length=638

 Score =   211 bits (538),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NYIATGS+D+T+RLWDV +
Sbjct  437  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYIATGSADRTIRLWDVLN  496

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   ++ L 
Sbjct  497  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTIYALR  556

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  557  FSRDGEILASGSMDNTVRLWDAVKAFEDLETDDFTTATGHINLPENSQDLLLGTYMTKST  616

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA+S
Sbjct  617  PVVHLHFTRRNLLLAAGAYS  636


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 76/186 (41%), Gaps = 17/186 (9%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  358  SDDVLERIMDEKTASELKILYGHSGPVYGTSFSPDRNYLLSCSEDGTVRLWSLQTFTCLV  417

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  418  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNS  477

Query  300  SLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRFSRRNL  121
            + +A+GSAD T++LWDV                      ++       P+++L FS    
Sbjct  478  NYIATGSADRTIRLWDVLNGN-----------------CVRIFTGHKGPIHSLAFSPNGR  520

Query  120  LFAAGA  103
              A GA
Sbjct  521  FLATGA  526



>ref|XP_010223265.1| PREDICTED: transcription initiation factor TFIID subunit 5 [Tinamus 
guttatus]
Length=653

 Score =   211 bits (538),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/200 (51%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NYIATGS+D+TVRLWDV +
Sbjct  452  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYIATGSADRTVRLWDVLN  511

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   ++ L 
Sbjct  512  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTIYALR  571

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  572  FSRDGEILASGSMDNTVRLWDAVKAFEDLETDDFTTATGHINLPENSQDLLLGTYMTKST  631

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA+S
Sbjct  632  PVVHLHFTRRNLLLAAGAYS  651


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/186 (28%), Positives = 76/186 (41%), Gaps = 17/186 (9%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  373  SDDVLERIMDEKTASELKILYGHSGPVYGTSFSPDRNYLLSCSEDGTVRLWSLQTFTCLV  432

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  433  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNS  492

Query  300  SLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRFSRRNL  121
            + +A+GSAD TV+LWDV                      ++       P+++L FS    
Sbjct  493  NYIATGSADRTVRLWDVLNGN-----------------CVRIFTGHKGPIHSLAFSPNGR  535

Query  120  LFAAGA  103
              A GA
Sbjct  536  FLATGA  541



>ref|XP_009085891.1| PREDICTED: transcription initiation factor TFIID subunit 5 [Serinus 
canaria]
Length=674

 Score =   212 bits (539),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NYIATGS+D+T+RLWDV +
Sbjct  473  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYIATGSADRTIRLWDVLN  532

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   ++ L 
Sbjct  533  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTIYALR  592

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  593  FSRDGEILASGSMDNTVRLWDAVKAFEDLETDDFTTATGHINLPENSQDLLLGTYMTKST  652

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA+S
Sbjct  653  PVVHLHFTRRNLLLAAGAYS  672


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 58/215 (27%), Positives = 88/215 (41%), Gaps = 25/215 (12%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  394  SDDVLERIMDEKTASELKILYGHSGPVYGTSFSPDRNYLLSCSEDGTVRLWSLQTFTCLV  453

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  454  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNS  513

Query  300  SLLASGSADCTVKLWDVTTSTKM----------------PKSEENKSGSTNRLRSL----  181
            + +A+GSAD T++LWDV     +                P      +G+T+    L    
Sbjct  514  NYIATGSADRTIRLWDVLNGNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIG  573

Query  180  -----KTLPTKSTPLYALRFSRRNLLFAAGAFSKS  91
                   L   +  +YALRFSR   + A+G+   +
Sbjct  574  HGLMVGELKGHTDTIYALRFSRDGEILASGSMDNT  608



>gb|KFQ16224.1| Transcription initiation factor TFIID subunit 5, partial [Leptosomus 
discolor]
 gb|KFQ92225.1| Transcription initiation factor TFIID subunit 5, partial [Nipponia 
nippon]
Length=611

 Score =   211 bits (536),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/200 (50%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NY+ATGS+D+T+RLWDV +
Sbjct  410  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYVATGSADRTIRLWDVLN  469

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   ++ L 
Sbjct  470  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTIYALR  529

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  530  FSRDGEILASGSMDNTVRLWDAVKAFEDLETDDFTTATGHINLPENSQDLLLGTYMTKST  589

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA+S
Sbjct  590  PVVHLHFTRRNLLLAAGAYS  609


 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 76/186 (41%), Gaps = 17/186 (9%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  331  SDDVLERIMDEKTASELKILYGHSGPVYGTSFSPDRNYLLSCSEDGTVRLWSLQTFTCLV  390

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  391  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNS  450

Query  300  SLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRFSRRNL  121
            + +A+GSAD T++LWDV                      ++       P+++L FS    
Sbjct  451  NYVATGSADRTIRLWDVLNGN-----------------CVRIFTGHKGPIHSLAFSPNGR  493

Query  120  LFAAGA  103
              A GA
Sbjct  494  FLATGA  499



>gb|KFO98259.1| Transcription initiation factor TFIID subunit 5, partial [Calypte 
anna]
Length=712

 Score =   212 bits (540),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/200 (51%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NYIATGS+D+TVRLWDV +
Sbjct  511  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYIATGSADRTVRLWDVLN  570

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   ++ L 
Sbjct  571  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTIYALR  630

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  631  FSRDGEILASGSMDNTVRLWDAVKAFEDLETDDFTTATGHINLPENSQELLLGTYMTKST  690

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA+S
Sbjct  691  PVVHLHFTRRNLLLAAGAYS  710


 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 59/215 (27%), Positives = 88/215 (41%), Gaps = 25/215 (12%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  432  SDDVLERIMDEKTASELKILYGHSGPVYGTSFSPDRNYLLSCSEDGTVRLWSLQTFTCLV  491

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  492  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNS  551

Query  300  SLLASGSADCTVKLWDVTTSTKM----------------PKSEENKSGSTNRLRSL----  181
            + +A+GSAD TV+LWDV     +                P      +G+T+    L    
Sbjct  552  NYIATGSADRTVRLWDVLNGNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIG  611

Query  180  -----KTLPTKSTPLYALRFSRRNLLFAAGAFSKS  91
                   L   +  +YALRFSR   + A+G+   +
Sbjct  612  HGLMVGELKGHTDTIYALRFSRDGEILASGSMDNT  646



>gb|KDQ30867.1| hypothetical protein PLEOSDRAFT_1075107 [Pleurotus ostreatus 
PC15]
Length=781

 Score =   213 bits (542),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 107/208 (51%), Positives = 134/208 (64%), Gaps = 15/208 (7%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFA+AS DRTAR+WS DR   LR+ AGHLSDVDC+Q+H N  Y+ATGSSD T RLWDVQ 
Sbjct  569  YFATASRDRTARLWSTDRTTCLRVYAGHLSDVDCLQFHPNSLYLATGSSDWTARLWDVQR  628

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G C+R+FIGH+  I SLAMSPDGR++AS  ED  I +WDL SG+ I  + GH S +++LA
Sbjct  629  GACMRVFIGHQGAITSLAMSPDGRFLASAGEDLAINLWDLGSGKRIKKMTGHTSSIYSLA  688

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRS---------------L  181
            FS E SLL SG AD TV+ WDVT+    PK  E    +T    S               +
Sbjct  689  FSAESSLLVSGGADWTVRCWDVTSKPGGPKGNEINGSTTFSATSNGYSYPEEGQETSDLI  748

Query  180  KTLPTKSTPLYALRFSRRNLLFAAGAFS  97
             T PTK TP+  ++F+ RNL    G ++
Sbjct  749  ATFPTKRTPITNVQFTPRNLCLVGGVYT  776



>ref|XP_008488661.1| PREDICTED: transcription initiation factor TFIID subunit 5 [Calypte 
anna]
Length=723

 Score =   212 bits (540),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/200 (51%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NYIATGS+D+TVRLWDV +
Sbjct  522  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYIATGSADRTVRLWDVLN  581

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   ++ L 
Sbjct  582  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTIYALR  641

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  642  FSRDGEILASGSMDNTVRLWDAVKAFEDLETDDFTTATGHINLPENSQELLLGTYMTKST  701

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA+S
Sbjct  702  PVVHLHFTRRNLLLAAGAYS  721


 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 52/186 (28%), Positives = 76/186 (41%), Gaps = 17/186 (9%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  443  SDDVLERIMDEKTASELKILYGHSGPVYGTSFSPDRNYLLSCSEDGTVRLWSLQTFTCLV  502

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  503  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNS  562

Query  300  SLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRFSRRNL  121
            + +A+GSAD TV+LWDV                      ++       P+++L FS    
Sbjct  563  NYIATGSADRTVRLWDVLNGN-----------------CVRIFTGHKGPIHSLAFSPNGR  605

Query  120  LFAAGA  103
              A GA
Sbjct  606  FLATGA  611



>ref|XP_009906511.1| PREDICTED: transcription initiation factor TFIID subunit 5 [Picoides 
pubescens]
Length=656

 Score =   211 bits (538),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NYIATGS+D+T+RLWDV +
Sbjct  455  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYIATGSADRTIRLWDVLN  514

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   ++ L 
Sbjct  515  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTIYALR  574

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  575  FSRDGEILASGSMDNTVRLWDAVKAFEDLETDDFTTATGHINLPENSQDLLLGTYMTKST  634

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA+S
Sbjct  635  PVVHLHFTRRNLLLAAGAYS  654


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 76/186 (41%), Gaps = 17/186 (9%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  376  SDDVLERIMDEKTASELKILYGHSGPVYGTSFSPDRNYLLSCSEDGTVRLWSLQTFTCLV  435

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  436  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNS  495

Query  300  SLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRFSRRNL  121
            + +A+GSAD T++LWDV                      ++       P+++L FS    
Sbjct  496  NYIATGSADRTIRLWDVLNGN-----------------CVRIFTGHKGPIHSLAFSPNGR  538

Query  120  LFAAGA  103
              A GA
Sbjct  539  FLATGA  544



>ref|XP_005048731.1| PREDICTED: transcription initiation factor TFIID subunit 5, partial 
[Ficedula albicollis]
Length=715

 Score =   212 bits (540),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 101/200 (51%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NYIATGS+D+T+RLWDV +
Sbjct  514  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYIATGSADRTIRLWDVLN  573

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   V+ L 
Sbjct  574  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVYALR  633

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  634  FSRDGEILASGSMDNTVRLWDAVKAFEDLETDDFTTATGHINLPENSQDLLLGTYMTKST  693

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA+S
Sbjct  694  PVVHLHFTRRNLLLAAGAYS  713


 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 76/186 (41%), Gaps = 17/186 (9%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  435  SDDVLERIMDEKTASELKILYGHSGPVYGTSFSPDRNYLLSCSEDGTVRLWSLQTFTCLV  494

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  495  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNS  554

Query  300  SLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRFSRRNL  121
            + +A+GSAD T++LWDV                      ++       P+++L FS    
Sbjct  555  NYIATGSADRTIRLWDVLNGN-----------------CVRIFTGHKGPIHSLAFSPNGR  597

Query  120  LFAAGA  103
              A GA
Sbjct  598  FLATGA  603



>ref|XP_009826029.1| hypothetical protein H257_03576 [Aphanomyces astaci]
 gb|ETV84337.1| hypothetical protein H257_03576 [Aphanomyces astaci]
Length=724

 Score =   212 bits (540),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 104/208 (50%), Positives = 138/208 (66%), Gaps = 15/208 (7%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFASAS DRTAR+WS DR+QPLR+ AGHLSDV+CV +H N NY+ATGS+DKTVRLWDVQ+
Sbjct  510  YFASASMDRTARLWSTDRVQPLRVFAGHLSDVECVTFHPNHNYLATGSTDKTVRLWDVQT  569

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G C+R+F GH   + ++A SP+GRY+AS  +D  + +WDL  G+ +  LVGH   V +LA
Sbjct  570  GHCLRVFAGHYGGVSAVAFSPNGRYLASAGDDTLVNIWDLHMGKKLETLVGHQDAVHSLA  629

Query  315  FSCEGSLLASGSADCTVKLWD---VTTSTKMPKSEENKSGSTNRLRS------------L  181
            FS E +L+ASG AD TV+LWD   +  +T        KS   N+ +             L
Sbjct  630  FSAESTLVASGGADHTVRLWDMHRLDGATHKAPPVTVKSQHHNQFKRKTAAGLAPSRALL  689

Query  180  KTLPTKSTPLYALRFSRRNLLFAAGAFS  97
            KT  TK TP+  ++F+ RN+L   GA+S
Sbjct  690  KTFTTKRTPVLRVQFTPRNMLLVGGAYS  717



>emb|CEP13051.1| hypothetical protein [Parasitella parasitica]
Length=737

 Score =   212 bits (540),  Expect = 3e-60, Method: Composition-based stats.
 Identities = 106/211 (50%), Positives = 135/211 (64%), Gaps = 19/211 (9%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFA+ASHDRTARIWS D I PLRI  GHLSDVD V++H N  YI TGSSD+T RLWDVQ+
Sbjct  521  YFATASHDRTARIWSCDHINPLRIFTGHLSDVDTVKFHPNSKYIVTGSSDRTSRLWDVQT  580

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVR+F GH   I ++ +SP+GR MAS  ED  IM+WD+ASG+ I  L GH   +++L+
Sbjct  581  GNCVRMFTGHTGSIKTVDISPNGRLMASAGEDKTIMLWDIASGKRIKKLSGHTGFIYSLS  640

Query  315  FSCEGSLLASGSADCTVKLWDVTTS------------------TKMPKSEENKSGSTNRL  190
            FS + ++L SG AD TV +WDV T                    K+   ++ K    +R 
Sbjct  641  FSADSNVLVSGGADNTVCVWDVNTDNTAAMASYMDTDNNDAKRAKLDDDKKRKVVRESRE  700

Query  189  RSLKTLPTKSTPLYALRFSRRNLLFAAGAFS  97
            R L   PTK TP+Y ++F+ RNL   AGAFS
Sbjct  701  R-LAAFPTKQTPIYDIQFTDRNLCVVAGAFS  730



>ref|XP_008407821.1| PREDICTED: transcription initiation factor TFIID subunit 5 isoform 
X2 [Poecilia reticulata]
Length=746

 Score =   212 bits (540),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 98/200 (49%), Positives = 137/200 (69%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NY+ATGSSD+T+RLWDV +
Sbjct  546  YFISGGHDRVARLWATDHHQPLRIFAGHLADVTCTRFHPNANYVATGSSDRTIRLWDVLT  605

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I +LA SP+G+++ASG  DG++++WD+  G  I  L GH  C+++L 
Sbjct  606  GNCVRIFTGHKGPIHALAFSPNGKFLASGATDGRVLLWDIGHGLMIGELKGHTECIYSLR  665

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGS-------TNRLRSLKTLPTKST  157
            FS +G +L SGS D TV+LWD T +    ++++  + +        ++   L T  TKST
Sbjct  666  FSRDGEILGSGSMDNTVRLWDATKAFDDLETDDFTAATGHIHLQDNSQELLLGTYLTKST  725

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA++
Sbjct  726  PVVHLHFTRRNLLLAAGAYN  745


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 50/186 (27%), Positives = 77/186 (41%), Gaps = 17/186 (9%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI         + + GH   V  + + A+ NY+ + S D TVRLW + +  C+ 
Sbjct  467  SDDVLERIMDDKTASESKCLYGHSGPVYGISFSADRNYLLSCSEDGTVRLWSLLTFTCLV  526

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  527  GYKGHNYPVWDTQFSPYGYYFISGGHDRVARLWATDHHQPLRIFAGHLADVTCTRFHPNA  586

Query  300  SLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRFSRRNL  121
            + +A+GS+D T++LWDV T                    ++       P++AL FS    
Sbjct  587  NYVATGSSDRTIRLWDVLTGN-----------------CVRIFTGHKGPIHALAFSPNGK  629

Query  120  LFAAGA  103
              A+GA
Sbjct  630  FLASGA  635



>ref|XP_009917937.1| PREDICTED: transcription initiation factor TFIID subunit 5, partial 
[Haliaeetus albicilla]
Length=678

 Score =   211 bits (538),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NYIATGS+D+T+RLWDV +
Sbjct  477  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYIATGSADRTIRLWDVLN  536

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   ++ L 
Sbjct  537  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTIYALR  596

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  597  FSRDGEILASGSMDNTVRLWDAVKAFEDLETDDFTTATGHINLPENSQDLLLGTYMTKST  656

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA+S
Sbjct  657  PVVHLHFTRRNLLLAAGAYS  676


 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 58/216 (27%), Positives = 88/216 (41%), Gaps = 25/216 (12%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  398  SDDVLERIMDEKTASELKILYGHSGPVYGTSFSPDRNYLLSCSEDGTVRLWSLQTFTCLV  457

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  458  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNS  517

Query  300  SLLASGSADCTVKLWDVTTSTKM----------------PKSEENKSGSTNRLRSL----  181
            + +A+GSAD T++LWDV     +                P      +G+T+    L    
Sbjct  518  NYIATGSADRTIRLWDVLNGNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIG  577

Query  180  -----KTLPTKSTPLYALRFSRRNLLFAAGAFSKSA  88
                   L   +  +YALRFSR   + A+G+   + 
Sbjct  578  HGLMVGELKGHTDTIYALRFSRDGEILASGSMDNTV  613



>ref|NP_001026406.1| transcription initiation factor TFIID subunit 5 [Gallus gallus]
 emb|CAH65297.1| hypothetical protein RCJMB04_15p4 [Gallus gallus]
Length=785

 Score =   212 bits (540),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 101/200 (51%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NYIATGS+D+TVRLWDV +
Sbjct  584  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYIATGSADRTVRLWDVLN  643

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   ++ L 
Sbjct  644  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTIYALR  703

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  704  FSRDGEILASGSMDNTVRLWDAVKAFEDLETDDFTTATGHINLPENSQDLLLGTYMTKST  763

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA+S
Sbjct  764  PVVHLHFTRRNLLLAAGAYS  783


 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 52/186 (28%), Positives = 76/186 (41%), Gaps = 17/186 (9%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  505  SDDVLERIMDEKTASELKILYGHSGPVYGTSFSPDRNYLLSCSEDGTVRLWSLQTFTCLV  564

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  565  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNS  624

Query  300  SLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRFSRRNL  121
            + +A+GSAD TV+LWDV                      ++       P+++L FS    
Sbjct  625  NYIATGSADRTVRLWDVLNGN-----------------CVRIFTGHKGPIHSLAFSPNGR  667

Query  120  LFAAGA  103
              A GA
Sbjct  668  FLATGA  673



>ref|XP_010411242.1| PREDICTED: transcription initiation factor TFIID subunit 5 [Corvus 
cornix cornix]
Length=695

 Score =   211 bits (538),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NYIATGS+D+T+RLWDV +
Sbjct  494  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYIATGSADRTIRLWDVLN  553

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   ++ L 
Sbjct  554  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTIYALR  613

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  614  FSRDGEILASGSMDNTVRLWDAVKAFEDLETDDFTTATGHINLPENSQDLLLGTYMTKST  673

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA+S
Sbjct  674  PVVHLHFTRRNLLLAAGAYS  693


 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 58/216 (27%), Positives = 88/216 (41%), Gaps = 25/216 (12%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  415  SDDVLERIMDEKTASELKILYGHSGPVYGTSFSPDRNYLLSCSEDGTVRLWSLQTFTCLV  474

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  475  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNS  534

Query  300  SLLASGSADCTVKLWDVTTSTKM----------------PKSEENKSGSTNRLRSL----  181
            + +A+GSAD T++LWDV     +                P      +G+T+    L    
Sbjct  535  NYIATGSADRTIRLWDVLNGNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIG  594

Query  180  -----KTLPTKSTPLYALRFSRRNLLFAAGAFSKSA  88
                   L   +  +YALRFSR   + A+G+   + 
Sbjct  595  HGLMVGELKGHTDTIYALRFSRDGEILASGSMDNTV  630



>ref|XP_008407811.1| PREDICTED: transcription initiation factor TFIID subunit 5 isoform 
X1 [Poecilia reticulata]
Length=745

 Score =   212 bits (539),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 98/200 (49%), Positives = 137/200 (69%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NY+ATGSSD+T+RLWDV +
Sbjct  545  YFISGGHDRVARLWATDHHQPLRIFAGHLADVTCTRFHPNANYVATGSSDRTIRLWDVLT  604

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I +LA SP+G+++ASG  DG++++WD+  G  I  L GH  C+++L 
Sbjct  605  GNCVRIFTGHKGPIHALAFSPNGKFLASGATDGRVLLWDIGHGLMIGELKGHTECIYSLR  664

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGS-------TNRLRSLKTLPTKST  157
            FS +G +L SGS D TV+LWD T +    ++++  + +        ++   L T  TKST
Sbjct  665  FSRDGEILGSGSMDNTVRLWDATKAFDDLETDDFTAATGHIHLQDNSQELLLGTYLTKST  724

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA++
Sbjct  725  PVVHLHFTRRNLLLAAGAYN  744


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 50/186 (27%), Positives = 77/186 (41%), Gaps = 17/186 (9%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI         + + GH   V  + + A+ NY+ + S D TVRLW + +  C+ 
Sbjct  466  SDDVLERIMDDKTASESKCLYGHSGPVYGISFSADRNYLLSCSEDGTVRLWSLLTFTCLV  525

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  526  GYKGHNYPVWDTQFSPYGYYFISGGHDRVARLWATDHHQPLRIFAGHLADVTCTRFHPNA  585

Query  300  SLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRFSRRNL  121
            + +A+GS+D T++LWDV T                    ++       P++AL FS    
Sbjct  586  NYVATGSSDRTIRLWDVLTGN-----------------CVRIFTGHKGPIHALAFSPNGK  628

Query  120  LFAAGA  103
              A+GA
Sbjct  629  FLASGA  634



>ref|XP_009474358.1| PREDICTED: transcription initiation factor TFIID subunit 5 [Nipponia 
nippon]
Length=665

 Score =   211 bits (537),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 99/200 (50%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NY+ATGS+D+T+RLWDV +
Sbjct  464  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYVATGSADRTIRLWDVLN  523

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   ++ L 
Sbjct  524  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTIYALR  583

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  584  FSRDGEILASGSMDNTVRLWDAVKAFEDLETDDFTTATGHINLPENSQDLLLGTYMTKST  643

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA+S
Sbjct  644  PVVHLHFTRRNLLLAAGAYS  663


 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 76/186 (41%), Gaps = 17/186 (9%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  385  SDDVLERIMDEKTASELKILYGHSGPVYGTSFSPDRNYLLSCSEDGTVRLWSLQTFTCLV  444

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  445  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNS  504

Query  300  SLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRFSRRNL  121
            + +A+GSAD T++LWDV                      ++       P+++L FS    
Sbjct  505  NYVATGSADRTIRLWDVLNGN-----------------CVRIFTGHKGPIHSLAFSPNGR  547

Query  120  LFAAGA  103
              A GA
Sbjct  548  FLATGA  553



>gb|KFP62880.1| Transcription initiation factor TFIID subunit 5, partial [Cariama 
cristata]
Length=677

 Score =   211 bits (537),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NYIATGS+D+T+RLWDV +
Sbjct  476  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYIATGSADRTIRLWDVLN  535

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   ++ L 
Sbjct  536  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTIYALR  595

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  596  FSRDGEILASGSMDNTVRLWDAVKAFEDLETDDFTTATGHINLPENSQDLLLGTYMTKST  655

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA+S
Sbjct  656  PVVHLHFTRRNLLLAAGAYS  675


 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 76/186 (41%), Gaps = 17/186 (9%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  397  SDDVLERIMDEKTASELKILYGHSGPVYGTSFSPDRNYLLSCSEDGTVRLWSLQTFTCLV  456

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  457  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNS  516

Query  300  SLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRFSRRNL  121
            + +A+GSAD T++LWDV                      ++       P+++L FS    
Sbjct  517  NYIATGSADRTIRLWDVLNGN-----------------CVRIFTGHKGPIHSLAFSPNGR  559

Query  120  LFAAGA  103
              A GA
Sbjct  560  FLATGA  565



>ref|XP_007860943.1| WD40 repeat-like protein [Gloeophyllum trabeum ATCC 11539]
 gb|EPQ60553.1| WD40 repeat-like protein [Gloeophyllum trabeum ATCC 11539]
Length=781

 Score =   212 bits (540),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 107/206 (52%), Positives = 133/206 (65%), Gaps = 16/206 (8%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFA+AS DRTAR+WS DR   LRI AGHLSDVD V++H N  Y+AT SSD T RLWDVQ 
Sbjct  572  YFATASRDRTARLWSTDRASALRIYAGHLSDVDAVRFHPNSLYLATASSDWTARLWDVQR  631

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVR+FIGH+ ++ +LA SPDGRY+AS  ED  I +WDL SGR +  + GH + +++LA
Sbjct  632  GNCVRVFIGHQGIVSTLAFSPDGRYLASAGEDNAINLWDLGSGRRVKKMTGHTASIYSLA  691

Query  315  FSCEGSLLASGSADCTVKLWDV--------------TTSTKMPKSEENKSGSTNRLRSLK  178
            FS E SLL SG AD TV+ WDV                 T  PKS E +   T  L  + 
Sbjct  692  FSTESSLLVSGGADWTVRCWDVKGAGGLPGKRENGMVNGTATPKSREEEGIETTDL--VS  749

Query  177  TLPTKSTPLYALRFSRRNLLFAAGAF  100
            T PTK TP+  ++F+ RNL  AAG +
Sbjct  750  TFPTKRTPIINVQFTPRNLCLAAGPY  775



>ref|XP_005239096.1| PREDICTED: transcription initiation factor TFIID subunit 5 [Falco 
peregrinus]
Length=681

 Score =   211 bits (537),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NYIATGS+D+T+RLWDV +
Sbjct  480  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYIATGSADRTIRLWDVLN  539

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   ++ L 
Sbjct  540  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTIYALR  599

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  600  FSRDGEILASGSMDNTVRLWDAVKAFEDLETDDFTTATGHINLPENSQDLLLGTYMTKST  659

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA+S
Sbjct  660  PVVHLHFTRRNLLLAAGAYS  679


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 76/186 (41%), Gaps = 17/186 (9%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  401  SDDVLERIMDEKTASELKILYGHSGPVYGTSFSPDRNYLLSCSEDGTVRLWSLQTFTCLV  460

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  461  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNS  520

Query  300  SLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRFSRRNL  121
            + +A+GSAD T++LWDV                      ++       P+++L FS    
Sbjct  521  NYIATGSADRTIRLWDVLNGN-----------------CVRIFTGHKGPIHSLAFSPNGR  563

Query  120  LFAAGA  103
              A GA
Sbjct  564  FLATGA  569



>ref|XP_005481188.1| PREDICTED: transcription initiation factor TFIID subunit 5 [Zonotrichia 
albicollis]
Length=783

 Score =   212 bits (539),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NYIATGS+D+T+RLWDV +
Sbjct  582  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYIATGSADRTIRLWDVLN  641

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   ++ L 
Sbjct  642  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTIYALR  701

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  702  FSRDGEILASGSMDNTVRLWDAVKAFEDLETDDFTTATGHINLPENSQDLLLGTYMTKST  761

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA+S
Sbjct  762  PVVHLHFTRRNLLLAAGAYS  781


 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 58/215 (27%), Positives = 88/215 (41%), Gaps = 25/215 (12%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  503  SDDVLERIMDEKTASELKILYGHSGPVYGTSFSPDRNYLLSCSEDGTVRLWSLQTFTCLV  562

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  563  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNS  622

Query  300  SLLASGSADCTVKLWDVTTSTKM----------------PKSEENKSGSTNRLRSL----  181
            + +A+GSAD T++LWDV     +                P      +G+T+    L    
Sbjct  623  NYIATGSADRTIRLWDVLNGNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIG  682

Query  180  -----KTLPTKSTPLYALRFSRRNLLFAAGAFSKS  91
                   L   +  +YALRFSR   + A+G+   +
Sbjct  683  HGLMVGELKGHTDTIYALRFSRDGEILASGSMDNT  717



>ref|XP_002197117.1| PREDICTED: transcription initiation factor TFIID subunit 5 [Taeniopygia 
guttata]
Length=783

 Score =   212 bits (539),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NYIATGS+D+T+RLWDV +
Sbjct  582  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYIATGSADRTIRLWDVLN  641

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   ++ L 
Sbjct  642  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTIYALR  701

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  702  FSRDGEILASGSMDNTVRLWDAVKAFEDLETDDFTTATGHINLPENSQDLLLGTYMTKST  761

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA+S
Sbjct  762  PVVHLHFTRRNLLLAAGAYS  781


 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 58/215 (27%), Positives = 88/215 (41%), Gaps = 25/215 (12%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  503  SDDVLERIMDEKTASELKILYGHSGPVYGTSFSPDRNYLLSCSEDGTVRLWSLQTFTCLV  562

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  563  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNS  622

Query  300  SLLASGSADCTVKLWDVTTSTKM----------------PKSEENKSGSTNRLRSL----  181
            + +A+GSAD T++LWDV     +                P      +G+T+    L    
Sbjct  623  NYIATGSADRTIRLWDVLNGNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIG  682

Query  180  -----KTLPTKSTPLYALRFSRRNLLFAAGAFSKS  91
                   L   +  +YALRFSR   + A+G+   +
Sbjct  683  HGLMVGELKGHTDTIYALRFSRDGEILASGSMDNT  717



>ref|XP_008047779.1| PREDICTED: transcription initiation factor TFIID subunit 5 [Tarsius 
syrichta]
Length=510

 Score =   207 bits (528),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 99/200 (50%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV+C ++H N NY+ATGS+D+TVRLWDV +
Sbjct  309  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVNCTRFHPNSNYVATGSADRTVRLWDVLN  368

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SL  SP+GR++A+G  DG++++WD+  G  +  L GH   V +L 
Sbjct  369  GNCVRIFTGHKGPIHSLTFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVCSLR  428

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  429  FSRDGEILASGSMDNTVRLWDAIKAFEDLETDDFTTATGHVNLPENSQELLLGTYMTKST  488

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNL+ AAGA+S
Sbjct  489  PVVHLHFTRRNLVLAAGAYS  508


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 52/186 (28%), Positives = 76/186 (41%), Gaps = 17/186 (9%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  230  SDDVLERIMDEKTASELKILYGHSGPVYGASFSPDRNYLLSSSEDGTVRLWSLQTFTCLV  289

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  290  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVNCTRFHPNS  349

Query  300  SLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRFSRRNL  121
            + +A+GSAD TV+LWDV                      ++       P+++L FS    
Sbjct  350  NYVATGSADRTVRLWDVLNGN-----------------CVRIFTGHKGPIHSLTFSPNGR  392

Query  120  LFAAGA  103
              A GA
Sbjct  393  FLATGA  398



>ref|XP_005971225.1| PREDICTED: transcription initiation factor TFIID subunit 5-like 
[Pantholops hodgsonii]
Length=453

 Score =   206 bits (525),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 132/200 (66%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV+C ++H N NY+ATGS+D+TVRLWDV +
Sbjct  252  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVNCTRFHPNSNYVATGSADRTVRLWDVLN  311

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SL  SP+GR++A+G  DG++++WD+  G  +  L GH   V +L 
Sbjct  312  GNCVRIFTGHKGPIHSLTFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVCSLR  371

Query  315  FSCEGSLLASGSADCTVKLW-------DVTTSTKMPKSEENKSGSTNRLRSLKTLPTKST  157
            FS +G +LASGS D TV+LW       DV T    P +        ++   L T  TKST
Sbjct  372  FSRDGEILASGSMDNTVRLWDAVKAFEDVETDDFTPATGHINLPENSQELLLGTYMTKST  431

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNL+ AAGA+S
Sbjct  432  PVVHLHFTRRNLVLAAGAYS  451


 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 52/186 (28%), Positives = 76/186 (41%), Gaps = 17/186 (9%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  173  SDDVLERIMDEKTASELKILYGHSGPVYGASFSPDRNYLLSSSEDGTVRLWSLQTFTCLV  232

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  233  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVNCTRFHPNS  292

Query  300  SLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRFSRRNL  121
            + +A+GSAD TV+LWDV                      ++       P+++L FS    
Sbjct  293  NYVATGSADRTVRLWDVLNG-----------------NCVRIFTGHKGPIHSLTFSPNGR  335

Query  120  LFAAGA  103
              A GA
Sbjct  336  FLATGA  341



>ref|XP_005520763.1| PREDICTED: transcription initiation factor TFIID subunit 5 [Pseudopodoces 
humilis]
Length=783

 Score =   212 bits (539),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NYIATGS+D+T+RLWDV +
Sbjct  582  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYIATGSADRTIRLWDVLN  641

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   ++ L 
Sbjct  642  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTIYALR  701

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  702  FSRDGEILASGSMDNTVRLWDAVKAFEDLETDDFTTATGHINLPENSQDLLLGTYMTKST  761

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA+S
Sbjct  762  PVVHLHFTRRNLLLAAGAYS  781


 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 58/215 (27%), Positives = 88/215 (41%), Gaps = 25/215 (12%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  503  SDDVLERIMDEKTASELKILYGHSGPVYGTSFSPDRNYLLSCSEDGTVRLWSLQTFTCLV  562

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  563  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNS  622

Query  300  SLLASGSADCTVKLWDVTTSTKM----------------PKSEENKSGSTNRLRSL----  181
            + +A+GSAD T++LWDV     +                P      +G+T+    L    
Sbjct  623  NYIATGSADRTIRLWDVLNGNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIG  682

Query  180  -----KTLPTKSTPLYALRFSRRNLLFAAGAFSKS  91
                   L   +  +YALRFSR   + A+G+   +
Sbjct  683  HGLMVGELKGHTDTIYALRFSRDGEILASGSMDNT  717



>ref|XP_007543235.1| PREDICTED: transcription initiation factor TFIID subunit 5 [Poecilia 
formosa]
Length=745

 Score =   211 bits (538),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 97/200 (49%), Positives = 137/200 (69%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NY+ATGSSD+T+RLWDV +
Sbjct  545  YFISGGHDRVARLWATDHHQPLRIFAGHLADVTCTRFHPNANYVATGSSDRTIRLWDVLT  604

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I +LA SP+G+++ASG  DG++++WD+  G  +  L GH  C+++L 
Sbjct  605  GNCVRIFTGHKGPIHALAFSPNGKFLASGATDGRVLLWDIGHGLMVGELKGHTECIYSLR  664

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGS-------TNRLRSLKTLPTKST  157
            FS +G +L SGS D TV+LWD T +    ++++  + +        ++   L T  TKST
Sbjct  665  FSRDGEILGSGSMDNTVRLWDATKAFDDLETDDFTAATGHIHLQDNSQELLLGTYMTKST  724

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA++
Sbjct  725  PVVHLHFTRRNLLLAAGAYN  744


 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 55/209 (26%), Positives = 83/209 (40%), Gaps = 36/209 (17%)
 Frame = -3

Query  654  DRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIF  475
            D T R+WS   + P ++          V+  A+ N I   S D   R+ D ++    +  
Sbjct  437  DSTVRVWS---VTPKKLRK--------VKTAADLNLIDKESDDVLERIMDDKTASESKCL  485

Query  474  IGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSL  295
             GH   +  ++ SPD  Y+ S  EDG + +W L +  C+    GH   VW   FS  G  
Sbjct  486  YGHSGPVYGISFSPDRNYLLSCSEDGTVRLWSLLTFTCLVGYKGHNYPVWDTQFSPYGYY  545

Query  294  LASGSADCTVKLW----------------DVTTSTKMPKSEENKSGSTNRLRSL------  181
              SG  D   +LW                DVT +   P +    +GS++R   L      
Sbjct  546  FISGGHDRVARLWATDHHQPLRIFAGHLADVTCTRFHPNANYVATGSSDRTIRLWDVLTG  605

Query  180  ---KTLPTKSTPLYALRFSRRNLLFAAGA  103
               +       P++AL FS      A+GA
Sbjct  606  NCVRIFTGHKGPIHALAFSPNGKFLASGA  634



>ref|XP_005154604.1| PREDICTED: transcription initiation factor TFIID subunit 5 [Melopsittacus 
undulatus]
Length=786

 Score =   212 bits (539),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 101/200 (51%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NY+ATGS+D+TVRLWDV +
Sbjct  585  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYVATGSADRTVRLWDVLN  644

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   V+ L 
Sbjct  645  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVYALR  704

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  705  FSRDGEILASGSMDNTVRLWDSVKAFEDLETDDFTTATGHINLPENSQDLLLGTYMTKST  764

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA+S
Sbjct  765  PVIHLHFTRRNLLLAAGAYS  784


 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 52/186 (28%), Positives = 76/186 (41%), Gaps = 17/186 (9%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  506  SDDVLERIMDEKTASELKILYGHSGPVYGTSFSPDRNYLLSCSEDGTVRLWSLQTFTCLV  565

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  566  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNS  625

Query  300  SLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRFSRRNL  121
            + +A+GSAD TV+LWDV                      ++       P+++L FS    
Sbjct  626  NYVATGSADRTVRLWDVLNGN-----------------CVRIFTGHKGPIHSLAFSPNGR  668

Query  120  LFAAGA  103
              A GA
Sbjct  669  FLATGA  674



>ref|XP_001525241.1| conserved hypothetical protein [Lodderomyces elongisporus NRRL 
YB-4239]
 gb|EDK44990.1| conserved hypothetical protein [Lodderomyces elongisporus NRRL 
YB-4239]
Length=870

 Score =   212 bits (540),  Expect = 6e-60, Method: Composition-based stats.
 Identities = 99/223 (44%), Positives = 144/223 (65%), Gaps = 31/223 (14%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF ++SHD+TAR+W+ D I PLRI AGH++DVDCV++H N +Y+ TGSSDKT R+WDVQ+
Sbjct  646  YFVTSSHDQTARLWATDHIYPLRIFAGHINDVDCVEFHPNSHYVFTGSSDKTCRMWDVQT  705

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHA-SCVWTL  319
            G CVR+F+GH + I ++A SPDGR++AS  +D  I +WD+ +GR +  + GH  S +++L
Sbjct  706  GHCVRVFMGHTNAINTIAASPDGRWLASAGDDNVINIWDIGTGRRLKTMKGHGRSSIYSL  765

Query  318  AFSCEGSLLASGSADCTVKLWDVTTSTK----MPKSEENKSGSTNRLRS-----------  184
            AFS +G++L SGS DC+V++WDV  +T      P++  N +GS N   +           
Sbjct  766  AFSRDGTVLVSGSGDCSVRVWDVKKNTNDAGPEPEALLNATGSANASEATAEEGGKTQQQ  825

Query  183  ---------------LKTLPTKSTPLYALRFSRRNLLFAAGAF  100
                           +    TK TP++ + F+RRNL FAAGAF
Sbjct  826  QQQLSRRDVIASSDHMAAFFTKKTPVFKVHFTRRNLCFAAGAF  868


 Score = 56.2 bits (134),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 29/131 (22%), Positives = 54/131 (41%), Gaps = 20/131 (15%)
 Frame = -3

Query  588  SDVDCVQWHANCNYIATGSSDKTVRLWDVQSG--------------------ECVRIFIG  469
            +D+ C+ ++ +   +A G     +++W +                       +  R  IG
Sbjct  529  NDMTCIAFNDDSTLVAAGFQGSYIKIWSLDGKPLQSQSSSQSKKDRKNHHLPDNCRKLIG  588

Query  468  HRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLA  289
            H   +  ++ SPD +++ +  ED  I +W L +   +    GH   VW + FS  G    
Sbjct  589  HSGPVYGISFSPDNKFLITCSEDKTIRLWSLDTFTALVSYKGHNQPVWDVKFSPLGHYFV  648

Query  288  SGSADCTVKLW  256
            + S D T +LW
Sbjct  649  TSSHDQTARLW  659



>ref|XP_009499020.1| PREDICTED: transcription initiation factor TFIID subunit 5 [Phalacrocorax 
carbo]
Length=684

 Score =   211 bits (536),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NYIATGS+D+T+RLWDV +
Sbjct  483  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYIATGSADRTIRLWDVLN  542

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   ++ L 
Sbjct  543  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTIYALR  602

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  603  FSRDGEILASGSMDNTVRLWDAVKAFEDLETDDFTTATGHINLPENSQDLLLGTYMTKST  662

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA+S
Sbjct  663  PVVHLHFTRRNLLLAAGAYS  682


 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 58/216 (27%), Positives = 88/216 (41%), Gaps = 25/216 (12%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  404  SDDVLERIMDEKTASELKILYGHSGPVYGTSFSPDRNYLLSCSEDGTVRLWSLQTFTCLV  463

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  464  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNS  523

Query  300  SLLASGSADCTVKLWDVTTSTKM----------------PKSEENKSGSTNRLRSL----  181
            + +A+GSAD T++LWDV     +                P      +G+T+    L    
Sbjct  524  NYIATGSADRTIRLWDVLNGNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIG  583

Query  180  -----KTLPTKSTPLYALRFSRRNLLFAAGAFSKSA  88
                   L   +  +YALRFSR   + A+G+   + 
Sbjct  584  HGLMVGELKGHTDTIYALRFSRDGEILASGSMDNTV  619



>ref|XP_004539013.1| PREDICTED: transcription initiation factor TFIID subunit 5-like 
[Maylandia zebra]
Length=749

 Score =   211 bits (538),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 97/200 (49%), Positives = 137/200 (69%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI +GHL+D+ C ++H N NY+ATGSSD+T+R+WDV S
Sbjct  549  YFVSGGHDRVARLWATDHYQPLRIFSGHLADITCTRFHPNSNYVATGSSDRTIRVWDVLS  608

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+G+++ASG  DG++++WD+  G  +  L GH   +++L 
Sbjct  609  GNCVRIFTGHKGPIHSLAFSPNGKFLASGATDGRVLLWDIGHGLMVGELKGHTDTIYSLR  668

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGS-------TNRLRSLKTLPTKST  157
            FS +G +LASGS D TV+LWDV  +    ++++  + +        ++   L T  TKST
Sbjct  669  FSRDGEILASGSMDNTVRLWDVMKAFDDLETDDFTAATGHIHLQDNSQELLLGTYTTKST  728

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGAF+
Sbjct  729  PVIHLHFTRRNLLLAAGAFN  748


 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 54/209 (26%), Positives = 84/209 (40%), Gaps = 36/209 (17%)
 Frame = -3

Query  654  DRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIF  475
            D T R+WS   + P ++          V+  A+ N I   S D   R+ D ++    +I 
Sbjct  441  DSTVRVWS---VTPKKLRK--------VKSAADLNLIDKESDDVLERIMDEKTASESKIM  489

Query  474  IGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSL  295
             GH   +  ++ SPD  Y+ S  EDG + +W L +  C+    GH   VW   FS  G  
Sbjct  490  YGHSGPVYGISFSPDRNYLLSSSEDGTVRLWSLLTFTCLVAYKGHNYPVWDTQFSPYGYY  549

Query  294  LASGSADCTVKLW----------------DVTTSTKMPKSEENKSGSTNRL---------  190
              SG  D   +LW                D+T +   P S    +GS++R          
Sbjct  550  FVSGGHDRVARLWATDHYQPLRIFSGHLADITCTRFHPNSNYVATGSSDRTIRVWDVLSG  609

Query  189  RSLKTLPTKSTPLYALRFSRRNLLFAAGA  103
              ++       P+++L FS      A+GA
Sbjct  610  NCVRIFTGHKGPIHSLAFSPNGKFLASGA  638



>ref|XP_010563095.1| PREDICTED: LOW QUALITY PROTEIN: transcription initiation factor 
TFIID subunit 5 [Haliaeetus leucocephalus]
Length=790

 Score =   212 bits (539),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NYIATGS+D+T+RLWDV +
Sbjct  589  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYIATGSADRTIRLWDVLN  648

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   ++ L 
Sbjct  649  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTIYALR  708

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  709  FSRDGEILASGSMDNTVRLWDAVKAFEDLETDDFTTATGHINLPENSQDLLLGTYMTKST  768

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA+S
Sbjct  769  PVVHLHFTRRNLLLAAGAYS  788


 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 76/186 (41%), Gaps = 17/186 (9%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  510  SDDVLERIMDEKTASELKILYGHSGPVYGTSFSPDRNYLLSCSEDGTVRLWSLQTFTCLV  569

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  570  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNS  629

Query  300  SLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRFSRRNL  121
            + +A+GSAD T++LWDV                      ++       P+++L FS    
Sbjct  630  NYIATGSADRTIRLWDVLNGN-----------------CVRIFTGHKGPIHSLAFSPNGR  672

Query  120  LFAAGA  103
              A GA
Sbjct  673  FLATGA  678



>gb|KIO08342.1| hypothetical protein M404DRAFT_134605 [Pisolithus tinctorius 
Marx 270]
Length=784

 Score =   211 bits (538),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 106/202 (52%), Positives = 131/202 (65%), Gaps = 10/202 (5%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFA+AS DRTAR+WS DR   LR+  GHLSDVDCV++H N  Y+ATGS D T RLWDVQ 
Sbjct  577  YFATASRDRTARLWSTDRTSALRLYVGHLSDVDCVRFHPNSLYLATGSDDWTARLWDVQR  636

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVR+FIGH+  + +LA+SPDGRY+AS  ED  I +WDL SGR I  + GHA+ +++L+
Sbjct  637  GTCVRVFIGHQGTLSALAISPDGRYLASAGEDLAINLWDLGSGRRIKKMTGHAASIYSLS  696

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRS----------LKTLPT  166
            FS E SLL SG AD TV+ WDV  +    K  EN       LR           L T PT
Sbjct  697  FSAESSLLVSGGADWTVRCWDVRGAGSQVKPHENGVDEPQTLRPAEESNETTDLLATFPT  756

Query  165  KSTPLYALRFSRRNLLFAAGAF  100
            K TP+  + F+ RNL  AAG +
Sbjct  757  KRTPVINVHFTPRNLCLAAGYY  778


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/142 (25%), Positives = 56/142 (39%), Gaps = 33/142 (23%)
 Frame = -3

Query  582  VDCVQWHANCNYIATGSSDKTVRLWDVQS---------------------------GECV  484
            V C  +  + + +A G S+  +RLW ++                            G   
Sbjct  449  VPCCTFSPDISLMAAGFSESYIRLWSLKGEKLRGLRSDASPDVADSSGVSRLLEPDGSNT  508

Query  483  RIFIGHRSMILSLAMSPDG------RYMASGDEDGKIMVWDLASGRCITPLVGHASCVWT  322
            R  IGH   + SL+  P G      +Y+ SG  D    +W L +   +    GH + VW 
Sbjct  509  RKLIGHSGPVYSLSFDPLGGSAAPPKYLLSGSADATTRLWSLDTMTNVVAYRGHQNPVWD  568

Query  321  LAFSCEGSLLASGSADCTVKLW  256
            + +S  G+  A+ S D T +LW
Sbjct  569  VQWSPMGTYFATASRDRTARLW  590



>ref|XP_006273730.1| PREDICTED: transcription initiation factor TFIID subunit 5 [Alligator 
mississippiensis]
Length=624

 Score =   209 bits (533),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLR+ AGHL+DV C ++H N NYIATGS+D+TVRLWDV +
Sbjct  423  YFVSGGHDRVARLWATDHYQPLRMFAGHLADVTCSRFHPNSNYIATGSADRTVRLWDVLN  482

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   ++ L 
Sbjct  483  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTIYALR  542

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TVKLWD   + +  ++++    +G  N   +     L T  +KST
Sbjct  543  FSRDGEILASGSMDNTVKLWDAVKAFEDLETDDFTTATGHINLPENSQDLLLGTYMSKST  602

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA+S
Sbjct  603  PVIHLHFTRRNLLLAAGAYS  622


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 52/186 (28%), Positives = 76/186 (41%), Gaps = 17/186 (9%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  344  SDDVLERIMDEKTASELKILYGHSGPVYGTSFSPDRNYLLSSSEDGTVRLWSLQTFTCLV  403

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  404  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRMFAGHLADVTCSRFHPNS  463

Query  300  SLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRFSRRNL  121
            + +A+GSAD TV+LWDV                      ++       P+++L FS    
Sbjct  464  NYIATGSADRTVRLWDVLNGN-----------------CVRIFTGHKGPIHSLAFSPNGR  506

Query  120  LFAAGA  103
              A GA
Sbjct  507  FLATGA  512



>ref|XP_009863455.1| PREDICTED: transcription initiation factor TFIID subunit 5 [Apaloderma 
vittatum]
Length=671

 Score =   210 bits (535),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NYIATGS+D+T+RLWDV +
Sbjct  470  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYIATGSADRTIRLWDVLN  529

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   ++ L 
Sbjct  530  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTIYALR  589

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  590  FSRDGEILASGSMDNTVRLWDAVKAFEDLETDDFTTATGHINLPENSQDLLLGTYMTKST  649

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA+S
Sbjct  650  PVVHLHFTRRNLLLAAGAYS  669


 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 58/216 (27%), Positives = 88/216 (41%), Gaps = 25/216 (12%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  391  SDDVLERIMDEKTASELKILYGHSGPVYGTSFSPDRNYLLSCSEDGTVRLWSLQTFTCLV  450

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  451  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNS  510

Query  300  SLLASGSADCTVKLWDVTTSTKM----------------PKSEENKSGSTNRLRSL----  181
            + +A+GSAD T++LWDV     +                P      +G+T+    L    
Sbjct  511  NYIATGSADRTIRLWDVLNGNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIG  570

Query  180  -----KTLPTKSTPLYALRFSRRNLLFAAGAFSKSA  88
                   L   +  +YALRFSR   + A+G+   + 
Sbjct  571  HGLMVGELKGHTDTIYALRFSRDGEILASGSMDNTV  606



>dbj|BAE02158.1| unnamed protein product [Macaca fascicularis]
Length=510

 Score =   207 bits (527),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 99/200 (50%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV+C ++H N NY+ATGS+D+TVRLWDV +
Sbjct  309  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVNCTRFHPNSNYVATGSADRTVRLWDVLN  368

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SL  SP+GR++A+G  DG++++WD+  G  +  L GH   V +L 
Sbjct  369  GNCVRIFTGHKGPIHSLTFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVCSLR  428

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  429  FSRDGEILASGSMDNTVRLWDAIKAFEDLETDDFTTATGHINLPENSQELLLGTYMTKST  488

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNL+ AAGA+S
Sbjct  489  PVVHLHFTRRNLVLAAGAYS  508


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 52/186 (28%), Positives = 76/186 (41%), Gaps = 17/186 (9%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  230  SDDVLERIMDEKTASELKILYGHSGPVYGASFSPDRNYLLSSSEDGTVRLWSLQTFTCLV  289

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  290  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVNCTRFHPNS  349

Query  300  SLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRFSRRNL  121
            + +A+GSAD TV+LWDV                      ++       P+++L FS    
Sbjct  350  NYVATGSADRTVRLWDVLNGN-----------------CVRIFTGHKGPIHSLTFSPNGR  392

Query  120  LFAAGA  103
              A GA
Sbjct  393  FLATGA  398



>ref|XP_003755480.1| PREDICTED: transcription initiation factor TFIID subunit 5 [Sarcophilus 
harrisii]
Length=646

 Score =   210 bits (534),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 137/200 (69%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV+C ++H N NY+ATGS+D+TVRLWDV +
Sbjct  445  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVNCTRFHPNSNYVATGSADRTVRLWDVLN  504

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   V +L 
Sbjct  505  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVCSLK  564

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  565  FSRDGEILASGSMDNTVRLWDAIKAFEDLETDDFTTATGHINLPENSQDLLLGTYMTKST  624

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNL+ AAGA+S
Sbjct  625  PVVHLHFTRRNLVLAAGAYS  644


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 52/186 (28%), Positives = 76/186 (41%), Gaps = 17/186 (9%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  366  SDDVLERIMDEKTASELKILYGHSGPVYGASFSPDRNYLLSSSEDGTVRLWSLQTFTCLV  425

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  426  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVNCTRFHPNS  485

Query  300  SLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRFSRRNL  121
            + +A+GSAD TV+LWDV                      ++       P+++L FS    
Sbjct  486  NYVATGSADRTVRLWDVLNGN-----------------CVRIFTGHKGPIHSLAFSPNGR  528

Query  120  LFAAGA  103
              A GA
Sbjct  529  FLATGA  534



>ref|XP_005458591.1| PREDICTED: transcription initiation factor TFIID subunit 5 [Oreochromis 
niloticus]
Length=783

 Score =   211 bits (536),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 97/200 (49%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI +GHL+D+ C ++H N NY+ATGSSD+T+RLWDV S
Sbjct  583  YFVSGGHDRVARLWATDHYQPLRIFSGHLADITCTRFHPNSNYVATGSSDRTIRLWDVLS  642

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+G+++ASG  DG++++WD+  G  +  L GH   +++L 
Sbjct  643  GNCVRIFTGHKGPIHSLAFSPNGKFLASGATDGRVLLWDIGHGLMVGELKGHTDTIYSLR  702

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGS-------TNRLRSLKTLPTKST  157
            FS +G +LASGS D TV+LWD   +    ++++  + +        ++   L T  TKST
Sbjct  703  FSRDGEILASGSMDNTVRLWDAMKAFDDLETDDFTAATGHIHLQDNSQELLLGTYTTKST  762

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGAF+
Sbjct  763  PVIHLHFTRRNLLLAAGAFN  782


 Score =   102 bits (253),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 61/196 (31%), Positives = 89/196 (45%), Gaps = 17/196 (9%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            Y  S+S D T R+WS+     L    GH   V   Q+     Y  +G  D+  RLW    
Sbjct  541  YLLSSSEDGTVRLWSLLTFTCLVAYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDH  600

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
             + +RIF GH + I      P+  Y+A+G  D  I +WD+ SG C+    GH   + +LA
Sbjct  601  YQPLRIFSGHLADITCTRFHPNSNYVATGSSDRTIRLWDVLSGNCVRIFTGHKGPIHSLA  660

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            FS  G  LASG+ D  V LWD+     + +                 L   +  +Y+LRF
Sbjct  661  FSPNGKFLASGATDGRVLLWDIGHGLMVGE-----------------LKGHTDTIYSLRF  703

Query  135  SRRNLLFAAGAFSKSA  88
            SR   + A+G+   + 
Sbjct  704  SRDGEILASGSMDNTV  719


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 55/209 (26%), Positives = 84/209 (40%), Gaps = 36/209 (17%)
 Frame = -3

Query  654  DRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIF  475
            D T R+WS   + P ++          V+  A+ N I   S D   R+ D ++    +I 
Sbjct  475  DSTVRVWS---VTPKKLRK--------VKSAADLNLIDKESDDVLERIMDEKTASESKIM  523

Query  474  IGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSL  295
             GH   +  ++ SPD  Y+ S  EDG + +W L +  C+    GH   VW   FS  G  
Sbjct  524  YGHSGPVYGISFSPDRNYLLSSSEDGTVRLWSLLTFTCLVAYKGHNYPVWDTQFSPYGYY  583

Query  294  LASGSADCTVKLW----------------DVTTSTKMPKSEENKSGSTNRLRSL------  181
              SG  D   +LW                D+T +   P S    +GS++R   L      
Sbjct  584  FVSGGHDRVARLWATDHYQPLRIFSGHLADITCTRFHPNSNYVATGSSDRTIRLWDVLSG  643

Query  180  ---KTLPTKSTPLYALRFSRRNLLFAAGA  103
               +       P+++L FS      A+GA
Sbjct  644  NCVRIFTGHKGPIHSLAFSPNGKFLASGA  672



>ref|XP_001511993.2| PREDICTED: transcription initiation factor TFIID subunit 5 [Ornithorhynchus 
anatinus]
Length=620

 Score =   209 bits (531),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NY+ATGS+D+TVRLWDV +
Sbjct  419  YFVSGGHDRIARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYVATGSADRTVRLWDVLN  478

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH + V  L 
Sbjct  479  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTNTVCALK  538

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV++WD   + +  ++++    +G  N   +     L T  TKST
Sbjct  539  FSRDGEILASGSMDNTVRMWDAVKAFEDLETDDFTTATGHINLPENSQDLLLGTYMTKST  598

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA+S
Sbjct  599  PVAHLHFTRRNLLLAAGAYS  618


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 52/186 (28%), Positives = 76/186 (41%), Gaps = 17/186 (9%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  340  SDDVLERIMDEKTASELKILYGHSGPVYGASFSPDRNYLLSSSEDGTVRLWSLQTFTCLV  399

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  400  GYKGHNYPVWDTQFSPYGYYFVSGGHDRIARLWATDHYQPLRIFAGHLADVTCTRFHPNS  459

Query  300  SLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRFSRRNL  121
            + +A+GSAD TV+LWDV                      ++       P+++L FS    
Sbjct  460  NYVATGSADRTVRLWDVLNGN-----------------CVRIFTGHKGPIHSLAFSPNGR  502

Query  120  LFAAGA  103
              A GA
Sbjct  503  FLATGA  508



>ref|XP_009957672.1| PREDICTED: transcription initiation factor TFIID subunit 5 [Leptosomus 
discolor]
Length=715

 Score =   210 bits (534),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/200 (50%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NY+ATGS+D+T+RLWDV +
Sbjct  514  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYVATGSADRTIRLWDVLN  573

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   ++ L 
Sbjct  574  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTIYALR  633

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  634  FSRDGEILASGSMDNTVRLWDAVKAFEDLETDDFTTATGHINLPENSQDLLLGTYMTKST  693

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA+S
Sbjct  694  PVVHLHFTRRNLLLAAGAYS  713


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 58/216 (27%), Positives = 88/216 (41%), Gaps = 25/216 (12%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  435  SDDVLERIMDEKTASELKILYGHSGPVYGTSFSPDRNYLLSCSEDGTVRLWSLQTFTCLV  494

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  495  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNS  554

Query  300  SLLASGSADCTVKLWDVTTSTKM----------------PKSEENKSGSTNRLRSL----  181
            + +A+GSAD T++LWDV     +                P      +G+T+    L    
Sbjct  555  NYVATGSADRTIRLWDVLNGNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIG  614

Query  180  -----KTLPTKSTPLYALRFSRRNLLFAAGAFSKSA  88
                   L   +  +YALRFSR   + A+G+   + 
Sbjct  615  HGLMVGELKGHTDTIYALRFSRDGEILASGSMDNTV  650



>ref|XP_006824247.1| PREDICTED: TAF5-like RNA polymerase II p300/CBP-associated factor-associated 
factor 65 kDa subunit 5L-like [Saccoglossus 
kowalevskii]
Length=586

 Score =   208 bits (529),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/193 (51%), Positives = 133/193 (69%), Gaps = 4/193 (2%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFA+AS D TAR+W++DR  PLRI AGHL DVDCV++H NCNYIATGSSD+TVRLW VQ 
Sbjct  395  YFATASQDHTARLWTLDRNYPLRIFAGHLMDVDCVRFHPNCNYIATGSSDRTVRLWSVQD  454

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G+CVR+F GH+  + SLA SP+G+++AS  ED K+ +WDL SG  +  L GH   V++L 
Sbjct  455  GKCVRLFTGHKGTVFSLAFSPNGKFLASSGEDRKVKLWDLGSGNMVKELSGHQDNVYSLN  514

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            FS + ++LASG  D T+++WDV  S   P S  +   S   L  L + P +++ ++ L F
Sbjct  515  FSNDSTMLASGGLDNTIRVWDVRQSFS-PSSHSDTGVS---LEILGSFPMRTSSVHYLEF  570

Query  135  SRRNLLFAAGAFS  97
               NLL AAGA +
Sbjct  571  VSCNLLLAAGAIN  583


 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 55/227 (24%), Positives = 87/227 (38%), Gaps = 65/227 (29%)
 Frame = -3

Query  627  DRIQPLRI------MAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS----------  496
            D+ Q  R+      + GH   V    +  + +++ + S D TVRLWD+ +          
Sbjct  321  DKFQEDRVGIESKALRGHSGPVYAACFTVDSSHLLSSSEDTTVRLWDLDTYTNKVVYQGH  380

Query  495  --------------------------------GECVRIFIGHRSMILSLAMSPDGRYMAS  412
                                               +RIF GH   +  +   P+  Y+A+
Sbjct  381  NYPIWDMDTGSVGPYFATASQDHTARLWTLDRNYPLRIFAGHLMDVDCVRFHPNCNYIAT  440

Query  411  GDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVTTSTKM  232
            G  D  + +W +  G+C+    GH   V++LAFS  G  LAS   D  VKLWD+      
Sbjct  441  GSSDRTVRLWSVQDGKCVRLFTGHKGTVFSLAFSPNGKFLASSGEDRKVKLWDL------  494

Query  231  PKSEENKSGSTNRLRSLKTLPTKSTPLYALRFSRRNLLFAAGAFSKS  91
                    GS N    +K L      +Y+L FS  + + A+G    +
Sbjct  495  --------GSGNM---VKELSGHQDNVYSLNFSNDSTMLASGGLDNT  530



>ref|XP_008104783.1| PREDICTED: LOW QUALITY PROTEIN: transcription initiation factor 
TFIID subunit 5 [Anolis carolinensis]
Length=775

 Score =   211 bits (536),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NYIATGS+D+TVR+WD+ +
Sbjct  574  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYIATGSADRTVRIWDILT  633

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   ++ L 
Sbjct  634  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTETIYALR  693

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TVKLWD   + +  ++++    +G  N   S     L T  TKST
Sbjct  694  FSRDGEILASGSMDNTVKLWDAVRAFEDLETDDFTTATGHINLPESCQDLLLGTYMTKST  753

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  + F+RRNLL AAGA+S
Sbjct  754  PVTHIHFTRRNLLLAAGAYS  773


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 49/186 (26%), Positives = 76/186 (41%), Gaps = 17/186 (9%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D T+RLW + +  C+ 
Sbjct  495  SDDVLERIMDEKTASELKILYGHSGPVYGTSFSPDRNYLLSSSEDGTIRLWSLLTFSCLV  554

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  555  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNS  614

Query  300  SLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRFSRRNL  121
            + +A+GSAD TV++WD+ T                    ++       P+++L FS    
Sbjct  615  NYIATGSADRTVRIWDILTGN-----------------CVRIFTGHKGPIHSLAFSPNGR  657

Query  120  LFAAGA  103
              A GA
Sbjct  658  FLATGA  663



>ref|XP_004701006.1| PREDICTED: transcription initiation factor TFIID subunit 5 [Echinops 
telfairi]
Length=588

 Score =   208 bits (529),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/200 (50%), Positives = 137/200 (69%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV+C ++H N NY+ATGS+D+TVRLWDV +
Sbjct  387  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVNCTRFHPNSNYVATGSADRTVRLWDVLN  446

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVR+F GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   V +L 
Sbjct  447  GNCVRVFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVCSLR  506

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  507  FSRDGEILASGSMDNTVRLWDAIKAFEDLETDDFTTATGHINLPENPQELLLGTYLTKST  566

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNL+ AAGA+S
Sbjct  567  PVAHLHFTRRNLVLAAGAYS  586


 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 52/186 (28%), Positives = 76/186 (41%), Gaps = 17/186 (9%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  308  SDDVLERIMDEKTASELKILYGHSGPVYGASFSPDRNYLLSSSEDGTVRLWSLQTFTCLV  367

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  368  GYKGHNYPVWDTQFSPHGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVNCTRFHPNS  427

Query  300  SLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRFSRRNL  121
            + +A+GSAD TV+LWDV                      ++       P+++L FS    
Sbjct  428  NYVATGSADRTVRLWDVLNGN-----------------CVRVFTGHKGPIHSLAFSPNGR  470

Query  120  LFAAGA  103
              A GA
Sbjct  471  FLATGA  476



>emb|CCA25505.1| transcription initiation factor TFIID subunit putati [Albugo 
laibachii Nc14]
Length=880

 Score =   211 bits (537),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 111/218 (51%), Positives = 137/218 (63%), Gaps = 28/218 (13%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFAS S DRTAR+WS D I PLRI AGHLSDV+CV++H N +YIATGSSDKTVRLWDVQS
Sbjct  657  YFASCSMDRTARLWSTDHITPLRIYAGHLSDVECVRFHPNHHYIATGSSDKTVRLWDVQS  716

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G+C+RIF GH   +  LA S +GRY+ S  +D  I +WDL +G+ +  LVGH+  V +L 
Sbjct  717  GKCIRIFTGHFHGVKCLAFSRNGRYLTSSGDDQYINIWDLQAGKRLETLVGHSDSVTSLD  776

Query  315  FSCEGSLLASGSADCTVKLWDVTT--------------STK--MPKSEENKSGSTNRLRS  184
            FSCE S+LASG  D TV+ WD+ T              ST+   P+   N     + L+ 
Sbjct  777  FSCESSILASGGMDGTVRFWDMQTLSAKSILPFTARNDSTRKLYPEPSSNVGKHVHYLQP  836

Query  183  ------------LKTLPTKSTPLYALRFSRRNLLFAAG  106
                        LKTL TK TP+Y LRF+RRNLL   G
Sbjct  837  DALKNLQSSQFLLKTLRTKQTPVYKLRFTRRNLLLCGG  874


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 58/125 (46%), Gaps = 7/125 (6%)
 Frame = -3

Query  606  IMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSM-ILSLAMSPD  430
            I  GH + V    +  +  +  T S+D T+RLW + +   V ++  H    +  +     
Sbjct  595  IFRGHSNAVYGSSFSPDSRFALTSSADSTIRLWSLAAQSNVVVYRSHSGYPVWDVEYGHF  654

Query  429  GRYMASGDEDGKIMVWDLASGRCITPL---VGHASCVWTLAFSCEGSLLASGSADCTVKL  259
            G Y AS   D    +W   S   ITPL    GH S V  + F      +A+GS+D TV+L
Sbjct  655  GYYFASCSMDRTARLW---STDHITPLRIYAGHLSDVECVRFHPNHHYIATGSSDKTVRL  711

Query  258  WDVTT  244
            WDV +
Sbjct  712  WDVQS  716



>ref|XP_008177989.1| PREDICTED: transcription initiation factor TFIID subunit 5 [Chrysemys 
picta bellii]
Length=787

 Score =   211 bits (536),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 101/200 (51%), Positives = 135/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NYIATGS+D+TVRLWDV +
Sbjct  586  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYIATGSADRTVRLWDVLN  645

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   V+ L 
Sbjct  646  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVYALR  705

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD     +  ++++    +G  N   +     L T  TKST
Sbjct  706  FSRDGEILASGSMDNTVRLWDAVKVFEDLETDDFTTATGHINLPENSQDLLLGTYMTKST  765

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL A+GA+S
Sbjct  766  PVIHLHFTRRNLLLASGAYS  785


 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 52/186 (28%), Positives = 76/186 (41%), Gaps = 17/186 (9%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  507  SDDVLERIMDEKTASELKILYGHSGPVYGTSFSPDRNYLLSCSEDGTVRLWSLQTFTCLV  566

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  567  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNS  626

Query  300  SLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRFSRRNL  121
            + +A+GSAD TV+LWDV                      ++       P+++L FS    
Sbjct  627  NYIATGSADRTVRLWDVLNGN-----------------CVRIFTGHKGPIHSLAFSPNGR  669

Query  120  LFAAGA  103
              A GA
Sbjct  670  FLATGA  675



>gb|KIK47871.1| hypothetical protein CY34DRAFT_171675 [Suillus luteus UH-Slu-Lm8-n1]
Length=509

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 106/203 (52%), Positives = 132/203 (65%), Gaps = 11/203 (5%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFA+AS DRTAR+WS DR   LRI AGHLSDVDCV++H N  Y+ATGSSD T RLWD Q 
Sbjct  301  YFATASRDRTARLWSTDRTSCLRIYAGHLSDVDCVRFHPNSLYLATGSSDWTARLWDAQR  360

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVR+FIGH+  + +LA+SPDGRY+AS  ED  I +WDL SGR I  + GH + V++L+
Sbjct  361  GACVRVFIGHQGSLSTLAISPDGRYLASAGEDLAINLWDLGSGRRIKKMTGHTASVYSLS  420

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRS-----------LKTLP  169
            FS E S+L SG AD TV+ WDV  +    KS E+    +   R+           L T P
Sbjct  421  FSAESSMLVSGGADWTVRCWDVRGAGGPSKSRESGVAESTITRTIDDENNETSDLLATFP  480

Query  168  TKSTPLYALRFSRRNLLFAAGAF  100
            TK TP+  + F+ RNL   AG F
Sbjct  481  TKRTPITNVHFTPRNLCLVAGNF  503


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/136 (24%), Positives = 53/136 (39%), Gaps = 29/136 (21%)
 Frame = -3

Query  576  CVQWHANCNYIATGSSDKTVRLWDVQS-----------------------GECVRIFIGH  466
            C  +  +   +A G S+  +RLW +++                       G   R  +GH
Sbjct  179  CCTFSPDLTLMAAGFSESYIRLWSLKNEKLKGLRNDFSLTGSLSKIQQKEGNTTRKLVGH  238

Query  465  RSMILSLAMSPDG------RYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCE  304
               + SL+  P G      RY+ S   D    +W L +   +    GH + VW + +S  
Sbjct  239  SGPVYSLSFDPLGGSAAPPRYLLSASADATTRLWSLDTMTNVVAFRGHQNPVWDVQWSPM  298

Query  303  GSLLASGSADCTVKLW  256
            G   A+ S D T +LW
Sbjct  299  GIYFATASRDRTARLW  314



>gb|EPQ15170.1| Transcription initiation factor TFIID subunit 5 [Myotis brandtii]
Length=588

 Score =   208 bits (529),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/200 (50%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV+C ++H N NY+ATGS+D+TVRLWDV +
Sbjct  387  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVNCTRFHPNSNYVATGSADRTVRLWDVLN  446

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SL  SP+GR++A+G  DG++++WD+  G  +  L GH   V +L 
Sbjct  447  GNCVRIFTGHKGPIHSLTFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVCSLR  506

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  507  FSRDGEILASGSMDNTVRLWDAVKAFEDLETDDFTTATGHINLPENSQELLLGTYMTKST  566

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNL+ AAGA+S
Sbjct  567  PVVHLHFTRRNLVLAAGAYS  586


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 52/186 (28%), Positives = 76/186 (41%), Gaps = 17/186 (9%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  308  SDDVLERIMDEKTASELKILYGHSGPVYGASFSPDRNYLLSSSEDGTVRLWSLQTFTCLV  367

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  368  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVNCTRFHPNS  427

Query  300  SLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRFSRRNL  121
            + +A+GSAD TV+LWDV                      ++       P+++L FS    
Sbjct  428  NYVATGSADRTVRLWDVLNGN-----------------CVRIFTGHKGPIHSLTFSPNGR  470

Query  120  LFAAGA  103
              A GA
Sbjct  471  FLATGA  476



>gb|KDO27296.1| hypothetical protein SPRG_07546 [Saprolegnia parasitica CBS 223.65]
Length=732

 Score =   210 bits (534),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 100/206 (49%), Positives = 135/206 (66%), Gaps = 15/206 (7%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFASAS DRTAR+WS DR+QPLRI AGHLSDV+ V +H N NY+ATGS+DK+VR+WDVQS
Sbjct  521  YFASASMDRTARLWSTDRVQPLRIFAGHLSDVETVAFHPNHNYLATGSTDKSVRIWDVQS  580

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G+C+R+F GH   + ++A SP+GRY+AS  ED  + VWDL  G+ +  L+GH+  +++L 
Sbjct  581  GQCIRVFTGHYGAVHTVAFSPNGRYLASAGEDAFVNVWDLHMGKRVDTLLGHSKAIYSLM  640

Query  315  FSCEGSLLASGSADCTVKLWD-------------VTTSTKMPKSEENKSGSTNRLRSLKT  175
            FS E S++ SG AD TV+LWD             V    K  +   N    +  L  LKT
Sbjct  641  FSQESSMIVSGGADHTVRLWDMHRLGHDAMSEKQVAVHVKQKRKTNNHVHGSRAL--LKT  698

Query  174  LPTKSTPLYALRFSRRNLLFAAGAFS  97
              TK TP+  ++F+ RN+L   G+F 
Sbjct  699  FTTKQTPVVRVQFTPRNMLLVGGSFQ  724



>ref|XP_007057933.1| PREDICTED: transcription initiation factor TFIID subunit 5 [Chelonia 
mydas]
Length=675

 Score =   209 bits (532),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 135/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NYIATGS+D+TVRLWDV +
Sbjct  474  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYIATGSADRTVRLWDVLN  533

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   V+ L 
Sbjct  534  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVYALR  593

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD     +  ++++    +G  N   +     L T  TKST
Sbjct  594  FSRDGEILASGSMDNTVRLWDAVKVFEDLETDDFTTATGHINLPENSQDLLLGTYMTKST  653

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  + F+RRNLL A+GA+S
Sbjct  654  PVIHIHFTRRNLLLASGAYS  673


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/186 (28%), Positives = 76/186 (41%), Gaps = 17/186 (9%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  395  SDDVLERIMDEKTASELKILYGHSGPVYGTSFSPDRNYLLSCSEDGTVRLWSLQTFTCLV  454

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  455  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNS  514

Query  300  SLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRFSRRNL  121
            + +A+GSAD TV+LWDV                      ++       P+++L FS    
Sbjct  515  NYIATGSADRTVRLWDVLNGN-----------------CVRIFTGHKGPIHSLAFSPNGR  557

Query  120  LFAAGA  103
              A GA
Sbjct  558  FLATGA  563



>ref|XP_007650816.1| PREDICTED: transcription initiation factor TFIID subunit 5 [Cricetulus 
griseus]
 ref|XP_007628912.1| PREDICTED: transcription initiation factor TFIID subunit 5 [Cricetulus 
griseus]
Length=588

 Score =   207 bits (528),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/200 (50%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV+C ++H N NY+ATGS+D+TVRLWDV +
Sbjct  387  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVNCTRFHPNSNYVATGSADRTVRLWDVLN  446

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SL  SP+GR++A+G  DG++++WD+  G  +  L GH   V +L 
Sbjct  447  GNCVRIFTGHKGPIHSLTFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVCSLR  506

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  507  FSRDGEILASGSMDNTVRLWDAIKAFEDLETDDFTTATGHINLPENSQELLLGTYMTKST  566

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNL+ AAGA+S
Sbjct  567  PVVHLHFTRRNLVLAAGAYS  586


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 52/186 (28%), Positives = 76/186 (41%), Gaps = 17/186 (9%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  308  SDDVLERIMDEKTASELKILYGHSGPVYGASFSPDRNYLLSSSEDGTVRLWSLQTFTCLV  367

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  368  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVNCTRFHPNS  427

Query  300  SLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRFSRRNL  121
            + +A+GSAD TV+LWDV                      ++       P+++L FS    
Sbjct  428  NYVATGSADRTVRLWDVLNGN-----------------CVRIFTGHKGPIHSLTFSPNGR  470

Query  120  LFAAGA  103
              A GA
Sbjct  471  FLATGA  476



>ref|XP_008684798.1| PREDICTED: transcription initiation factor TFIID subunit 5 [Ursus 
maritimus]
Length=616

 Score =   208 bits (529),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/200 (50%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV+C ++H N NY+ATGS+D+TVRLWDV +
Sbjct  415  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVNCTRFHPNSNYVATGSADRTVRLWDVLN  474

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SL  SP+GR++A+G  DG++++WD+  G  +  L GH   V +L 
Sbjct  475  GNCVRIFTGHKGPIHSLTFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVCSLR  534

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  535  FSRDGEILASGSMDNTVRLWDAVKAFEDLETDDFTTATGHINLPENSQELLLGTYMTKST  594

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNL+ AAGA+S
Sbjct  595  PVVHLHFTRRNLVLAAGAYS  614


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 52/186 (28%), Positives = 76/186 (41%), Gaps = 17/186 (9%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  336  SDDVLERIMDEKTASELKILYGHSGPVYGASFSPDRNYLLSSSEDGTVRLWSLQTFTCLV  395

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  396  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVNCTRFHPNS  455

Query  300  SLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRFSRRNL  121
            + +A+GSAD TV+LWDV                      ++       P+++L FS    
Sbjct  456  NYVATGSADRTVRLWDVLNGN-----------------CVRIFTGHKGPIHSLTFSPNGR  498

Query  120  LFAAGA  103
              A GA
Sbjct  499  FLATGA  504



>ref|XP_002672490.1| transcription initiation factor TFIID subunit [Naegleria gruberi]
 gb|EFC39746.1| transcription initiation factor TFIID subunit [Naegleria gruberi]
Length=716

 Score =   209 bits (533),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/207 (47%), Positives = 138/207 (67%), Gaps = 16/207 (8%)
 Frame = -3

Query  672  FASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSG  493
            FA+ASHDRTAR+W  DR+ P+R+ AGHL+DV+CV++H NCNY+ATGSSDKTVRLWDVQ+G
Sbjct  506  FATASHDRTARLWVTDRVTPVRVFAGHLADVECVKFHPNCNYVATGSSDKTVRLWDVQTG  565

Query  492  ECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAF  313
            EC+R+FIGH   I +LA S DGRY AS  +DG+++VWD+ SG+     +GH   VW+L F
Sbjct  566  ECMRMFIGHHGSINTLAFSHDGRYCASAGDDGQVLVWDIGSGKIAYKFIGHTKPVWSLDF  625

Query  312  SCEGSLLASGSADCTVKLWDVTTST---------------KMPKSEENKSGSTNRLRSLK  178
            +   + LAS S D TV++W +  +                K  K E +K    ++    K
Sbjct  626  NRNDTFLASASLDSTVRVWSMFDTIDTGSVEGSQSAAQILKEKKLELDKHKIISK-EPYK  684

Query  177  TLPTKSTPLYALRFSRRNLLFAAGAFS  97
            T  +K TP+Y+L+F++++ + A G F+
Sbjct  685  TYYSKQTPVYSLKFTQQDFMVAGGVFT  711


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 63/120 (53%), Gaps = 0/120 (0%)
 Frame = -3

Query  603  MAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIFIGHRSMILSLAMSPDGR  424
            + GH   V  + ++++  ++ + S D TVRLW+V + E V ++ GH+  + +++ SP   
Sbjct  445  LIGHSGPVYSLSFNSDQQWLLSSSEDCTVRLWNVNNAESVVVYKGHQYAVWNVSFSPTDY  504

Query  423  YMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSLLASGSADCTVKLWDVTT  244
              A+   D    +W       +    GH + V  + F    + +A+GS+D TV+LWDV T
Sbjct  505  MFATASHDRTARLWVTDRVTPVRVFAGHLADVECVKFHPNCNYVATGSSDKTVRLWDVQT  564



>gb|KIK28401.1| hypothetical protein PISMIDRAFT_7425 [Pisolithus microcarpus 
441]
Length=801

 Score =   210 bits (535),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 108/216 (50%), Positives = 132/216 (61%), Gaps = 26/216 (12%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YFA+AS DRTAR+WS DR   LRI  GHLSDVDCV++H N  Y+ATGSSD T RLWDVQ 
Sbjct  578  YFATASRDRTARLWSTDRTTALRIYVGHLSDVDCVRFHPNSLYLATGSSDWTARLWDVQR  637

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVR+FIGH+  + +LA+SPDGRY+AS  ED  I +WDL SGR I  + GHA+ +++LA
Sbjct  638  GTCVRVFIGHQGTLSALAISPDGRYLASAGEDLAINLWDLGSGRRIKKMTGHAASIYSLA  697

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRS----------------  184
            FS E SLL SG AD TV+ WDV ++    K  EN    +   R                 
Sbjct  698  FSAESSLLVSGGADWTVRCWDVRSAGSQAKPHENGVNESQMFRPAEEGNETYDSFLALKQ  757

Query  183  ----------LKTLPTKSTPLYALRFSRRNLLFAAG  106
                      L T PTK TP+  + F+ RNL  AAG
Sbjct  758  DFSLRNSTDLLATFPTKRTPVINVHFTPRNLCLAAG  793



>gb|EPZ34266.1| TFIID subunit, WD40-associated region domain-containing protein 
[Rozella allomycis CSF55]
Length=610

 Score =   208 bits (529),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 97/194 (50%), Positives = 131/194 (68%), Gaps = 13/194 (7%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S S+DRTAR+WS++ +QPLRI AGHLSDVDCVQ+H N NY+ATGSSDKT RLWD+ +
Sbjct  430  YFVSGSNDRTARLWSVETVQPLRIFAGHLSDVDCVQFHPNSNYVATGSSDKTARLWDISN  489

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            GECVRIF GH   I +L  SPDG+ +A+  +D  +++WDL +GR +  L GH   ++T+ 
Sbjct  490  GECVRIFSGHSDTIRALTFSPDGKLLATASDDRIVILWDLNTGRKVKTLDGHHGMIYTID  549

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            FS  G+LL SG AD  V +WDV       K EE       R+  LK   TK TP+Y +++
Sbjct  550  FSKCGNLLTSGGADSQVCIWDV-------KREE------ERITPLKIFHTKQTPVYCVQY  596

Query  135  SRRNLLFAAGAFSK  94
            + +N++   GAF +
Sbjct  597  TNKNVMLVGGAFQQ  610


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/143 (26%), Positives = 54/143 (38%), Gaps = 30/143 (21%)
 Frame = -3

Query  582  VDCVQWHANCNYIATGSSDKTVRL------------------------------WDVQSG  493
            ++CV + +N   IA G SD  + +                              +    G
Sbjct  305  LNCVSFSSNSTLIAAGYSDSYIEITSLTNKKLKGLKTSAEIGLIGVDEVVDLDQFKETEG  364

Query  492  ECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAF  313
               +  IGH   + +   S D R++ S  +DG I +W L     +    GH   VW + F
Sbjct  365  SDSKRLIGHSGPVYATDFSFDNRFLLSCSQDGTIRLWSLDLFSNVVVYKGHNYPVWDVKF  424

Query  312  SCEGSLLASGSADCTVKLWDVTT  244
            S  G    SGS D T +LW V T
Sbjct  425  SPNGHYFVSGSNDRTARLWSVET  447



>ref|XP_006120928.1| PREDICTED: transcription initiation factor TFIID subunit 5, partial 
[Pelodiscus sinensis]
Length=620

 Score =   208 bits (529),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 134/200 (67%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV C ++H N NYIATGS+D+TVRLWDV +
Sbjct  419  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYIATGSADRTVRLWDVLN  478

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G     L GH   ++ L 
Sbjct  479  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMAGELKGHTDTIYALR  538

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD     +  ++++    +G  N   +     L T  TKST
Sbjct  539  FSRDGEILASGSMDNTVRLWDAVKVFEDLETDDFTTATGHINLPENSQDLLLGTYMTKST  598

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL A+GA+S
Sbjct  599  PVIHLHFTRRNLLLASGAYS  618


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/186 (28%), Positives = 76/186 (41%), Gaps = 17/186 (9%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  340  SDDVLERIMDERTASELKILYGHSGPVYGTSFSPDRNYLLSCSEDGTVRLWSLQTFTCLV  399

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  400  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNS  459

Query  300  SLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRFSRRNL  121
            + +A+GSAD TV+LWDV                      ++       P+++L FS    
Sbjct  460  NYIATGSADRTVRLWDVLNGN-----------------CVRIFTGHKGPIHSLAFSPNGR  502

Query  120  LFAAGA  103
              A GA
Sbjct  503  FLATGA  508



>ref|XP_006021378.1| PREDICTED: transcription initiation factor TFIID subunit 5 [Alligator 
sinensis]
Length=762

 Score =   210 bits (534),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLR+ AGHL+DV C ++H N NYIATGS+D+TVRLWDV +
Sbjct  561  YFVSGGHDRVARLWATDHYQPLRMFAGHLADVTCSRFHPNSNYIATGSADRTVRLWDVLN  620

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   ++ L 
Sbjct  621  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTIYALR  680

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TVKLWD   + +  ++++    +G  N   +     L T  +KST
Sbjct  681  FSRDGEILASGSMDNTVKLWDAVKAFEDLETDDFTTATGHINLPENSQDLLLGTYMSKST  740

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGA+S
Sbjct  741  PVIHLHFTRRNLLLAAGAYS  760


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/186 (28%), Positives = 76/186 (41%), Gaps = 17/186 (9%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  482  SDDVLERIMDEKTASELKILYGHSGPVYGTSFSPDRNYLLSSSEDGTVRLWSLQTFTCLV  541

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  542  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRMFAGHLADVTCSRFHPNS  601

Query  300  SLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRFSRRNL  121
            + +A+GSAD TV+LWDV                      ++       P+++L FS    
Sbjct  602  NYIATGSADRTVRLWDVLNGN-----------------CVRIFTGHKGPIHSLAFSPNGR  644

Query  120  LFAAGA  103
              A GA
Sbjct  645  FLATGA  650



>ref|XP_005878281.1| PREDICTED: transcription initiation factor TFIID subunit 5 [Myotis 
brandtii]
Length=619

 Score =   208 bits (529),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 99/200 (50%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV+C ++H N NY+ATGS+D+TVRLWDV +
Sbjct  418  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVNCTRFHPNSNYVATGSADRTVRLWDVLN  477

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SL  SP+GR++A+G  DG++++WD+  G  +  L GH   V +L 
Sbjct  478  GNCVRIFTGHKGPIHSLTFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVCSLR  537

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  538  FSRDGEILASGSMDNTVRLWDAVKAFEDLETDDFTTATGHINLPENSQELLLGTYMTKST  597

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNL+ AAGA+S
Sbjct  598  PVVHLHFTRRNLVLAAGAYS  617


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 52/186 (28%), Positives = 76/186 (41%), Gaps = 17/186 (9%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  339  SDDVLERIMDEKTASELKILYGHSGPVYGASFSPDRNYLLSSSEDGTVRLWSLQTFTCLV  398

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  399  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVNCTRFHPNS  458

Query  300  SLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRFSRRNL  121
            + +A+GSAD TV+LWDV                      ++       P+++L FS    
Sbjct  459  NYVATGSADRTVRLWDVLNGN-----------------CVRIFTGHKGPIHSLTFSPNGR  501

Query  120  LFAAGA  103
              A GA
Sbjct  502  FLATGA  507



>ref|XP_006790718.1| PREDICTED: transcription initiation factor TFIID subunit 5-like 
isoform X2 [Neolamprologus brichardi]
Length=750

 Score =   209 bits (533),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/200 (48%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI +GHL+D+ C ++H N NY+ATGSSD+T+R+WDV S
Sbjct  550  YFVSGGHDRVARLWATDHYQPLRIFSGHLADITCTRFHPNSNYVATGSSDRTIRVWDVLS  609

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+G+++ASG  DG++++WD+  G  +  L GH   +++L 
Sbjct  610  GNCVRIFTGHKGPIHSLAFSPNGKFLASGATDGRVLLWDIGHGLMVGELKGHTDTIYSLR  669

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGS-------TNRLRSLKTLPTKST  157
            FS +G +LASGS D TV+LWD   +    ++++  + +        ++   L T  TKST
Sbjct  670  FSRDGEILASGSMDNTVRLWDAMKAFDDLETDDFTAATGHIHLQDNSQELLLGTYTTKST  729

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGAF+
Sbjct  730  PVIHLHFTRRNLLLAAGAFN  749


 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 62/196 (32%), Positives = 89/196 (45%), Gaps = 17/196 (9%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            Y  S+S D T R+WS+     L    GH   V   Q+     Y  +G  D+  RLW    
Sbjct  508  YLLSSSEDGTVRLWSLLTFTCLVAYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDH  567

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
             + +RIF GH + I      P+  Y+A+G  D  I VWD+ SG C+    GH   + +LA
Sbjct  568  YQPLRIFSGHLADITCTRFHPNSNYVATGSSDRTIRVWDVLSGNCVRIFTGHKGPIHSLA  627

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            FS  G  LASG+ D  V LWD+     + +                 L   +  +Y+LRF
Sbjct  628  FSPNGKFLASGATDGRVLLWDIGHGLMVGE-----------------LKGHTDTIYSLRF  670

Query  135  SRRNLLFAAGAFSKSA  88
            SR   + A+G+   + 
Sbjct  671  SRDGEILASGSMDNTV  686


 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 54/209 (26%), Positives = 84/209 (40%), Gaps = 36/209 (17%)
 Frame = -3

Query  654  DRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIF  475
            D T R+WS   + P ++          V+  A+ N I   S D   R+ D ++    +I 
Sbjct  442  DSTVRVWS---VTPKKLRK--------VKSAADLNLIDKESDDVLERIMDEKTASESKIM  490

Query  474  IGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSL  295
             GH   +  ++ SPD  Y+ S  EDG + +W L +  C+    GH   VW   FS  G  
Sbjct  491  YGHSGPVYGISFSPDRNYLLSSSEDGTVRLWSLLTFTCLVAYKGHNYPVWDTQFSPYGYY  550

Query  294  LASGSADCTVKLW----------------DVTTSTKMPKSEENKSGSTNRL---------  190
              SG  D   +LW                D+T +   P S    +GS++R          
Sbjct  551  FVSGGHDRVARLWATDHYQPLRIFSGHLADITCTRFHPNSNYVATGSSDRTIRVWDVLSG  610

Query  189  RSLKTLPTKSTPLYALRFSRRNLLFAAGA  103
              ++       P+++L FS      A+GA
Sbjct  611  NCVRIFTGHKGPIHSLAFSPNGKFLASGA  639



>ref|XP_006790717.1| PREDICTED: transcription initiation factor TFIID subunit 5-like 
isoform X1 [Neolamprologus brichardi]
Length=749

 Score =   209 bits (533),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/200 (48%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI +GHL+D+ C ++H N NY+ATGSSD+T+R+WDV S
Sbjct  549  YFVSGGHDRVARLWATDHYQPLRIFSGHLADITCTRFHPNSNYVATGSSDRTIRVWDVLS  608

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+G+++ASG  DG++++WD+  G  +  L GH   +++L 
Sbjct  609  GNCVRIFTGHKGPIHSLAFSPNGKFLASGATDGRVLLWDIGHGLMVGELKGHTDTIYSLR  668

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGS-------TNRLRSLKTLPTKST  157
            FS +G +LASGS D TV+LWD   +    ++++  + +        ++   L T  TKST
Sbjct  669  FSRDGEILASGSMDNTVRLWDAMKAFDDLETDDFTAATGHIHLQDNSQELLLGTYTTKST  728

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNLL AAGAF+
Sbjct  729  PVIHLHFTRRNLLLAAGAFN  748


 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 62/196 (32%), Positives = 89/196 (45%), Gaps = 17/196 (9%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            Y  S+S D T R+WS+     L    GH   V   Q+     Y  +G  D+  RLW    
Sbjct  507  YLLSSSEDGTVRLWSLLTFTCLVAYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDH  566

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
             + +RIF GH + I      P+  Y+A+G  D  I VWD+ SG C+    GH   + +LA
Sbjct  567  YQPLRIFSGHLADITCTRFHPNSNYVATGSSDRTIRVWDVLSGNCVRIFTGHKGPIHSLA  626

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRF  136
            FS  G  LASG+ D  V LWD+     + +                 L   +  +Y+LRF
Sbjct  627  FSPNGKFLASGATDGRVLLWDIGHGLMVGE-----------------LKGHTDTIYSLRF  669

Query  135  SRRNLLFAAGAFSKSA  88
            SR   + A+G+   + 
Sbjct  670  SRDGEILASGSMDNTV  685


 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 54/209 (26%), Positives = 84/209 (40%), Gaps = 36/209 (17%)
 Frame = -3

Query  654  DRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVRIF  475
            D T R+WS   + P ++          V+  A+ N I   S D   R+ D ++    +I 
Sbjct  441  DSTVRVWS---VTPKKLRK--------VKSAADLNLIDKESDDVLERIMDEKTASESKIM  489

Query  474  IGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEGSL  295
             GH   +  ++ SPD  Y+ S  EDG + +W L +  C+    GH   VW   FS  G  
Sbjct  490  YGHSGPVYGISFSPDRNYLLSSSEDGTVRLWSLLTFTCLVAYKGHNYPVWDTQFSPYGYY  549

Query  294  LASGSADCTVKLW----------------DVTTSTKMPKSEENKSGSTNRL---------  190
              SG  D   +LW                D+T +   P S    +GS++R          
Sbjct  550  FVSGGHDRVARLWATDHYQPLRIFSGHLADITCTRFHPNSNYVATGSSDRTIRVWDVLSG  609

Query  189  RSLKTLPTKSTPLYALRFSRRNLLFAAGA  103
              ++       P+++L FS      A+GA
Sbjct  610  NCVRIFTGHKGPIHSLAFSPNGKFLASGA  638



>ref|XP_001378650.2| PREDICTED: transcription initiation factor TFIID subunit 5 [Monodelphis 
domestica]
Length=825

 Score =   210 bits (534),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 137/200 (69%), Gaps = 7/200 (4%)
 Frame = -3

Query  675  YFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQS  496
            YF S  HDR AR+W+ D  QPLRI AGHL+DV+C ++H N NY+ATGS+D+TVRLWDV +
Sbjct  624  YFVSGGHDRVARLWATDHYQPLRIFAGHLADVNCTRFHPNSNYVATGSADRTVRLWDVLN  683

Query  495  GECVRIFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLA  316
            G CVRIF GH+  I SLA SP+GR++A+G  DG++++WD+  G  +  L GH   V +L 
Sbjct  684  GNCVRIFTGHKGPIHSLAFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVCSLK  743

Query  315  FSCEGSLLASGSADCTVKLWDVTTSTKMPKSEE--NKSGSTNRLRS-----LKTLPTKST  157
            FS +G +LASGS D TV+LWD   + +  ++++    +G  N   +     L T  TKST
Sbjct  744  FSRDGEILASGSMDNTVRLWDAIKAFEDLETDDFTTATGHINLPENSQDLLLGTYMTKST  803

Query  156  PLYALRFSRRNLLFAAGAFS  97
            P+  L F+RRNL+ AAGA+S
Sbjct  804  PVVHLHFTRRNLVLAAGAYS  823


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/186 (28%), Positives = 76/186 (41%), Gaps = 17/186 (9%)
 Frame = -3

Query  660  SHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQSGECVR  481
            S D   RI        L+I+ GH   V    +  + NY+ + S D TVRLW +Q+  C+ 
Sbjct  545  SDDVLERIMDEKTASELKILYGHSGPVYGASFSPDRNYLLSSSEDGTVRLWSLQTFTCLV  604

Query  480  IFIGHRSMILSLAMSPDGRYMASGDEDGKIMVWDLASGRCITPLVGHASCVWTLAFSCEG  301
             + GH   +     SP G Y  SG  D    +W     + +    GH + V    F    
Sbjct  605  GYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVNCTRFHPNS  664

Query  300  SLLASGSADCTVKLWDVTTSTKMPKSEENKSGSTNRLRSLKTLPTKSTPLYALRFSRRNL  121
            + +A+GSAD TV+LWDV                      ++       P+++L FS    
Sbjct  665  NYVATGSADRTVRLWDVLNGN-----------------CVRIFTGHKGPIHSLAFSPNGR  707

Query  120  LFAAGA  103
              A GA
Sbjct  708  FLATGA  713



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1091035074420