BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF051A12

Length=669
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011096521.1|  PREDICTED: chlorophyll a-b binding protein 2...    353   2e-119   Sesamum indicum [beniseed]
ref|XP_004145734.1|  PREDICTED: chlorophyll a-b binding protein, ...    351   6e-119   Cucumis sativus [cucumbers]
ref|XP_006361530.1|  PREDICTED: chlorophyll a-b binding protein 3...    351   1e-118   Solanum tuberosum [potatoes]
ref|XP_009593856.1|  PREDICTED: chlorophyll a-b binding protein 4...    350   2e-118   Nicotiana tomentosiformis
ref|XP_008456347.1|  PREDICTED: chlorophyll a-b binding protein o...    350   2e-118   Cucumis melo [Oriental melon]
ref|XP_009795316.1|  PREDICTED: chlorophyll a-b binding protein 4...    350   3e-118   Nicotiana sylvestris
ref|XP_009795315.1|  PREDICTED: chlorophyll a-b binding protein 4...    349   6e-118   Nicotiana sylvestris
ref|XP_009628754.1|  PREDICTED: chlorophyll a-b binding protein 1...    348   7e-118   Nicotiana tomentosiformis
ref|XP_004170962.1|  PREDICTED: chlorophyll a-b binding protein o...    348   8e-118   
ref|XP_004134608.1|  PREDICTED: chlorophyll a-b binding protein o...    348   8e-118   
sp|P27492.1|CB21_TOBAC  RecName: Full=Chlorophyll a-b binding pro...    348   9e-118   Nicotiana tabacum [American tobacco]
ref|XP_009618329.1|  PREDICTED: chlorophyll a-b binding protein 4...    348   9e-118   Nicotiana tomentosiformis
ref|XP_004134603.1|  PREDICTED: chlorophyll a-b binding protein o...    348   9e-118   
ref|XP_009790936.1|  PREDICTED: chlorophyll a-b binding protein 4...    348   9e-118   Nicotiana sylvestris
ref|XP_009782924.1|  PREDICTED: chlorophyll a-b binding protein 5...    348   1e-117   Nicotiana sylvestris
ref|XP_009782922.1|  PREDICTED: chlorophyll a-b binding protein 5...    347   2e-117   Nicotiana sylvestris
ref|XP_009790934.1|  PREDICTED: chlorophyll a-b binding protein 4...    347   2e-117   Nicotiana sylvestris
ref|XP_009597417.1|  PREDICTED: chlorophyll a-b binding protein 5...    347   2e-117   Nicotiana tomentosiformis
sp|P08221.1|CB21_CUCSA  RecName: Full=Chlorophyll a-b binding pro...    347   3e-117   Cucumis sativus [cucumbers]
sp|P07369.1|CB2G_SOLLC  RecName: Full=Chlorophyll a-b binding pro...    347   4e-117   Solanum lycopersicum
ref|XP_011096520.1|  PREDICTED: chlorophyll a-b binding protein 2...    347   5e-117   Sesamum indicum [beniseed]
ref|XP_011085268.1|  PREDICTED: chlorophyll a-b binding protein 2...    347   5e-117   Sesamum indicum [beniseed]
gb|AAA34148.1|  chlorophyll a/b-binding protein Cab-3C                  346   5e-117   Solanum lycopersicum
ref|XP_009628755.1|  PREDICTED: chlorophyll a-b binding protein 4...    346   5e-117   Nicotiana tomentosiformis
ref|XP_006356077.1|  PREDICTED: chlorophyll a-b binding protein 3...    346   6e-117   Solanum tuberosum [potatoes]
sp|P27496.1|CB25_TOBAC  RecName: Full=Chlorophyll a-b binding pro...    346   6e-117   Nicotiana tabacum [American tobacco]
ref|XP_010916097.1|  PREDICTED: chlorophyll a-b binding protein o...    346   6e-117   Elaeis guineensis
ref|XP_009611577.1|  PREDICTED: chlorophyll a-b binding protein 4...    346   7e-117   Nicotiana tomentosiformis
ref|XP_010317413.1|  PREDICTED: chlorophyll a-b binding protein 3...    346   7e-117   
ref|XP_009606802.1|  PREDICTED: chlorophyll a-b binding protein 1...    346   7e-117   Nicotiana tomentosiformis
ref|XP_009782923.1|  PREDICTED: chlorophyll a-b binding protein 5...    346   7e-117   Nicotiana sylvestris
ref|XP_009795314.1|  PREDICTED: chlorophyll a-b binding protein 1...    346   8e-117   Nicotiana sylvestris
ref|XP_009772885.1|  PREDICTED: chlorophyll a-b binding protein 5...    346   8e-117   Nicotiana sylvestris
sp|P12470.1|CB25_NICPL  RecName: Full=Chlorophyll a-b binding pro...    346   9e-117   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_006356073.1|  PREDICTED: chlorophyll a-b binding protein 3...    345   1e-116   Solanum tuberosum [potatoes]
ref|XP_009782921.1|  PREDICTED: chlorophyll a-b binding protein 5...    345   1e-116   Nicotiana sylvestris
sp|P04783.1|CB25_PETSP  RecName: Full=Chlorophyll a-b binding pro...    345   1e-116   Petunia sp.
ref|XP_006356078.1|  PREDICTED: chlorophyll a-b binding protein 3...    345   1e-116   
ref|XP_009628757.1|  PREDICTED: chlorophyll a-b binding protein 1...    345   2e-116   Nicotiana tomentosiformis
ref|XP_006364025.1|  PREDICTED: chlorophyll a-b binding protein 5...    345   2e-116   Solanum tuberosum [potatoes]
ref|XP_009606800.1|  PREDICTED: chlorophyll a-b binding protein 5...    345   2e-116   Nicotiana tomentosiformis
ref|XP_006356075.1|  PREDICTED: chlorophyll a-b binding protein 3...    345   3e-116   Solanum tuberosum [potatoes]
ref|XP_002316737.1|  Chlorophyll a-b binding protein 2                  345   3e-116   Populus trichocarpa [western balsam poplar]
ref|XP_008439658.1|  PREDICTED: chlorophyll a-b binding protein o...    344   4e-116   Cucumis melo [Oriental melon]
ref|XP_008784387.1|  PREDICTED: chlorophyll a-b binding protein o...    344   5e-116   Phoenix dactylifera
gb|ABF17940.1|  putative chloroplast chlorophyll a/b-binding protein    344   5e-116   Carya cathayensis
sp|P27491.1|CB27_TOBAC  RecName: Full=Chlorophyll a-b binding pro...    343   6e-116   Nicotiana tabacum [American tobacco]
ref|XP_009396492.1|  PREDICTED: chlorophyll a-b binding protein o...    343   6e-116   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009775533.1|  PREDICTED: chlorophyll a-b binding protein 7...    343   6e-116   Nicotiana sylvestris
ref|XP_009782905.1|  PREDICTED: chlorophyll a-b binding protein 7...    343   7e-116   Nicotiana sylvestris
ref|XP_008779641.1|  PREDICTED: chlorophyll a-b binding protein o...    343   8e-116   Phoenix dactylifera
ref|XP_010243713.1|  PREDICTED: chlorophyll a-b binding protein o...    343   9e-116   Nelumbo nucifera [Indian lotus]
ref|XP_010052093.1|  PREDICTED: chlorophyll a-b binding protein o...    343   9e-116   Eucalyptus grandis [rose gum]
gb|ABB55370.1|  chlorophyll a-b binding protein 3C-like                 343   1e-115   Solanum tuberosum [potatoes]
ref|XP_002519724.1|  chlorophyll A/B binding protein, putative          343   1e-115   Ricinus communis
ref|XP_009618330.1|  PREDICTED: chlorophyll a-b binding protein 4...    342   2e-115   Nicotiana tomentosiformis
ref|XP_009421488.1|  PREDICTED: chlorophyll a-b binding protein o...    342   2e-115   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006356076.1|  PREDICTED: chlorophyll a-b binding protein 3...    342   3e-115   
ref|XP_011011531.1|  PREDICTED: chlorophyll a-b binding protein o...    342   3e-115   Populus euphratica
ref|XP_006356074.1|  PREDICTED: chlorophyll a-b binding protein 3...    342   3e-115   Solanum tuberosum [potatoes]
ref|XP_009782821.1|  PREDICTED: chlorophyll a-b binding protein 7...    342   3e-115   Nicotiana sylvestris
gb|KCW75952.1|  hypothetical protein EUGRSUZ_D00320                     342   4e-115   Eucalyptus grandis [rose gum]
ref|XP_009759685.1|  PREDICTED: chlorophyll a-b binding protein 4...    341   5e-115   Nicotiana sylvestris
emb|CAA78379.1|  chlorophyll a/b-binding protein PS II-Type I           341   6e-115   Solanum tuberosum [potatoes]
gb|KDP37945.1|  hypothetical protein JCGZ_04588                         341   6e-115   Jatropha curcas
ref|XP_006356080.1|  PREDICTED: chlorophyll a-b binding protein 3...    341   7e-115   Solanum tuberosum [potatoes]
sp|P12469.1|CB23_NICPL  RecName: Full=Chlorophyll a-b binding pro...    341   9e-115   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_004147416.1|  PREDICTED: chlorophyll a-b binding protein 4...    340   9e-115   Cucumis sativus [cucumbers]
gb|KCW75953.1|  hypothetical protein EUGRSUZ_D00321                     342   1e-114   Eucalyptus grandis [rose gum]
gb|AFC91647.1|  chloroplast chlorophyll A/B binding protein             340   1e-114   Hevea brasiliensis [jebe]
ref|XP_010247422.1|  PREDICTED: chlorophyll a-b binding protein o...    340   2e-114   Nelumbo nucifera [Indian lotus]
gb|KJB66916.1|  hypothetical protein B456_010G165100                    340   2e-114   Gossypium raimondii
ref|XP_010924306.1|  PREDICTED: chlorophyll a-b binding protein o...    340   2e-114   Elaeis guineensis
ref|XP_009395692.1|  PREDICTED: chlorophyll a-b binding protein o...    339   3e-114   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008444193.1|  PREDICTED: chlorophyll a-b binding protein o...    339   3e-114   Cucumis melo [Oriental melon]
sp|P04780.1|CB22_PETSP  RecName: Full=Chlorophyll a-b binding pro...    339   3e-114   Petunia sp.
ref|XP_010056879.1|  PREDICTED: chlorophyll a-b binding protein o...    339   3e-114   Eucalyptus grandis [rose gum]
ref|XP_004234241.1|  PREDICTED: uncharacterized protein LOC101245729    349   4e-114   
ref|XP_008800689.1|  PREDICTED: chlorophyll a-b binding protein o...    339   4e-114   Phoenix dactylifera
ref|XP_010052095.1|  PREDICTED: chlorophyll a-b binding protein o...    339   4e-114   Eucalyptus grandis [rose gum]
ref|XP_002524616.1|  chlorophyll A/B binding protein, putative          339   4e-114   Ricinus communis
sp|P04781.1|CB23_PETSP  RecName: Full=Chlorophyll a-b binding pro...    339   5e-114   Petunia sp.
gb|EYU28462.1|  hypothetical protein MIMGU_mgv1a012008mg                338   8e-114   Erythranthe guttata [common monkey flower]
gb|AHB24929.1|  chloroplast light-harvesting complex II chlorophy...    338   9e-114   Sedum alfredii
ref|XP_008439659.1|  PREDICTED: chlorophyll a-b binding protein o...    341   1e-113   
gb|AEQ67395.1|  chloroplast chlorophyll A/B binding protein             338   1e-113   Canarium album [Chinese white-olive]
emb|CAJ77391.1|  major chlorophyll a/b binding protein LHCb1.1          338   1e-113   Spinacia oleracea
ref|XP_010904844.1|  PREDICTED: chlorophyll a-b binding protein o...    338   2e-113   Elaeis guineensis
ref|XP_009630190.1|  PREDICTED: chlorophyll a-b binding protein 2...    337   2e-113   Nicotiana tomentosiformis
emb|CAJ77390.1|  major chlorophyll a/b binding protein LHCb1.2          337   2e-113   Spinacia oleracea
gb|EYU28187.1|  hypothetical protein MIMGU_mgv1a009948mg                340   2e-113   Erythranthe guttata [common monkey flower]
ref|XP_009598574.1|  PREDICTED: chlorophyll a-b binding protein 2...    337   2e-113   Nicotiana tomentosiformis
gb|AAT08651.1|  chloroplast chlorophyll A-B binding protein             336   2e-113   Hyacinthus orientalis [common hyacinth]
ref|XP_008356026.1|  PREDICTED: chlorophyll a-b binding protein o...    337   2e-113   Malus domestica [apple tree]
gb|ABD38707.1|  chloroplast chlorophyll a/b binding protein             337   2e-113   Pachysandra terminalis
ref|XP_010685893.1|  PREDICTED: chlorophyll a-b binding protein, ...    337   3e-113   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009775649.1|  PREDICTED: chlorophyll a-b binding protein 2...    337   3e-113   Nicotiana sylvestris
ref|XP_008364191.1|  PREDICTED: chlorophyll a-b binding protein o...    337   3e-113   
ref|XP_004294267.1|  PREDICTED: chlorophyll a-b binding protein o...    337   3e-113   Fragaria vesca subsp. vesca
sp|P12333.1|CB2A_SPIOL  RecName: Full=Chlorophyll a-b binding pro...    337   3e-113   Spinacia oleracea
ref|XP_010275593.1|  PREDICTED: chlorophyll a-b binding protein o...    337   3e-113   Nelumbo nucifera [Indian lotus]
gb|AAB61238.1|  chlorophyll a/b-binding protein                         337   3e-113   Mesembryanthemum crystallinum
gb|AIR93785.1|  chloroplast light harvesting chlorophyll A/B bind...    337   4e-113   Kalanchoe fedtschenkoi [lavender-scallops]
ref|XP_008229430.1|  PREDICTED: chlorophyll a-b binding protein o...    337   4e-113   Prunus mume [ume]
gb|ACO51067.1|  chloroplast chlorophyll A-B binding protein             336   5e-113   Gossypium hirsutum [American cotton]
gb|KJB69716.1|  hypothetical protein B456_011G041600                    336   6e-113   Gossypium raimondii
gb|AGJ50622.1|  chlorophyll a/b binding protein                         336   6e-113   Salicornia brachiata
gb|AAA18529.1|  chlorophyll A/B binding protein                         336   6e-113   Gossypium hirsutum [American cotton]
ref|XP_009786355.1|  PREDICTED: chlorophyll a-b binding protein 2...    336   6e-113   Nicotiana sylvestris
gb|KCW75954.1|  hypothetical protein EUGRSUZ_D00322                     339   6e-113   Eucalyptus grandis [rose gum]
ref|XP_008229463.1|  PREDICTED: chlorophyll a-b binding protein, ...    334   7e-113   Prunus mume [ume]
ref|XP_002307725.1|  Chlorophyll a-b binding protein 2                  336   7e-113   Populus trichocarpa [western balsam poplar]
ref|XP_002306927.1|  Chlorophyll a-b binding protein 2                  336   7e-113   Populus trichocarpa [western balsam poplar]
emb|CAX64458.1|  major chlorophyll a/b binding protein LHCb1.4 pr...    336   8e-113   Spinacia oleracea
gb|EYU28186.1|  hypothetical protein MIMGU_mgv1a012011mg                335   8e-113   Erythranthe guttata [common monkey flower]
gb|EYU28185.1|  hypothetical protein MIMGU_mgv1a012021mg                335   9e-113   Erythranthe guttata [common monkey flower]
sp|P04782.1|CB24_PETSP  RecName: Full=Chlorophyll a-b binding pro...    335   1e-112   Petunia sp.
ref|XP_008371581.1|  PREDICTED: chlorophyll a-b binding protein o...    335   1e-112   
dbj|BAA25389.1|  light harvesting chlorophyll a/b-binding protein       335   1e-112   Nicotiana sylvestris
ref|XP_009598577.1|  PREDICTED: chlorophyll a-b binding protein 2...    335   1e-112   Nicotiana tomentosiformis
ref|XP_008356022.1|  PREDICTED: chlorophyll a-b binding protein o...    335   2e-112   
gb|AHM26643.1|  a-b binding protein                                     335   2e-112   Pyrus x bretschneideri [bai li]
ref|XP_008364187.1|  PREDICTED: chlorophyll a-b binding protein o...    335   2e-112   
gb|AAB61237.1|  chlorophyll a/b-binding protein                         335   2e-112   Mesembryanthemum crystallinum
ref|XP_009775650.1|  PREDICTED: chlorophyll a-b binding protein 2...    335   2e-112   Nicotiana sylvestris
gb|ACN41907.1|  chlorophyll A/B binding protein                         335   2e-112   Gardenia jasminoides
ref|XP_010052094.1|  PREDICTED: chlorophyll a-b binding protein o...    340   2e-112   
ref|XP_009775645.1|  PREDICTED: chlorophyll a-b binding protein 2...    335   2e-112   Nicotiana sylvestris
ref|XP_008366007.1|  PREDICTED: chlorophyll a-b binding protein o...    335   2e-112   
gb|KJB57287.1|  hypothetical protein B456_009G156900                    335   2e-112   Gossypium raimondii
gb|AAA80593.1|  chlorophyll a/b binding protein                         334   3e-112   Solanum tuberosum [potatoes]
ref|XP_007211864.1|  hypothetical protein PRUPE_ppa010081mg             334   3e-112   Prunus persica
ref|XP_007211869.1|  hypothetical protein PRUPE_ppa010099mg             334   3e-112   Prunus persica
ref|XP_009416547.1|  PREDICTED: chlorophyll a-b binding protein o...    334   3e-112   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007217260.1|  hypothetical protein PRUPE_ppa010015mg             334   3e-112   Prunus persica
gb|ABF70112.1|  chlorophyll A-B binding protein (CAB), putative         334   3e-112   Musa balbisiana [starchy banana]
ref|XP_008371583.1|  PREDICTED: chlorophyll a-b binding protein o...    335   4e-112   
ref|XP_006467509.1|  PREDICTED: chlorophyll a-b binding protein 3...    334   4e-112   Citrus sinensis [apfelsine]
ref|XP_008229429.1|  PREDICTED: chlorophyll a-b binding protein o...    334   5e-112   Prunus mume [ume]
ref|XP_010231410.1|  PREDICTED: chlorophyll a-b binding protein o...    333   5e-112   Brachypodium distachyon [annual false brome]
gb|AAA33396.1|  light-harvesting chlorophyll a/b protein precursor      333   6e-112   Lemna gibba
gb|AAO45885.1|  chlorophyll a/b-binding protein precursor               332   6e-112   Citrus limon [lemon]
gb|ACR08639.1|  chloroplast chlorophyll A/B binding protein             333   7e-112   Mangifera indica
ref|NP_001266111.1|  chlorophyll a-b binding protein AB80, chloro...    333   8e-112   Cicer arietinum [garbanzo]
gb|AAB61236.1|  chlorophyll a/b-binding protein                         333   8e-112   Mesembryanthemum crystallinum
ref|XP_007025148.1|  Chlorophyll a-b binding protein, chloroplastic     333   8e-112   Theobroma cacao [chocolate]
gb|EYU38943.1|  hypothetical protein MIMGU_mgv1a012024mg                333   9e-112   Erythranthe guttata [common monkey flower]
gb|KDP37944.1|  hypothetical protein JCGZ_04587                         333   1e-111   Jatropha curcas
ref|XP_009389379.1|  PREDICTED: chlorophyll a-b binding protein o...    333   1e-111   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007215816.1|  hypothetical protein PRUPE_ppa010034mg             333   1e-111   Prunus persica
ref|XP_006365560.1|  PREDICTED: chlorophyll a-b binding protein 1...    333   1e-111   Solanum tuberosum [potatoes]
ref|XP_007025143.1|  Chlorophyll a-b binding protein, chloroplastic     333   1e-111   
ref|XP_006365573.1|  PREDICTED: chlorophyll a-b binding protein 1...    333   1e-111   
gb|EYU28183.1|  hypothetical protein MIMGU_mgv1a012019mg                333   1e-111   Erythranthe guttata [common monkey flower]
gb|AAA80591.1|  chlorophyll a/b binding protein                         333   1e-111   Solanum tuberosum [potatoes]
ref|NP_001240146.1|  chlorophyll a-b binding protein 21, chloropl...    332   1e-111   Glycine max [soybeans]
ref|XP_006449645.1|  hypothetical protein CICLE_v10016286mg             332   2e-111   
ref|XP_006449644.1|  hypothetical protein CICLE_v10016074mg             333   2e-111   
ref|XP_009377335.1|  PREDICTED: chlorophyll a-b binding protein o...    332   2e-111   Pyrus x bretschneideri [bai li]
ref|XP_009598575.1|  PREDICTED: chlorophyll a-b binding protein 2...    332   2e-111   Nicotiana tomentosiformis
ref|XP_006449643.1|  hypothetical protein CICLE_v10016287mg             332   3e-111   Citrus clementina [clementine]
ref|XP_011045092.1|  PREDICTED: chlorophyll a-b binding protein o...    332   3e-111   Populus euphratica
ref|XP_006365572.1|  PREDICTED: chlorophyll a-b binding protein 1...    332   3e-111   Solanum tuberosum [potatoes]
ref|XP_004233096.1|  PREDICTED: chlorophyll a-b binding protein 1...    332   4e-111   
ref|XP_006368026.1|  PREDICTED: chlorophyll a-b binding protein 1...    331   4e-111   Solanum tuberosum [potatoes]
emb|CDP06328.1|  unnamed protein product                                331   5e-111   Coffea canephora [robusta coffee]
ref|XP_010926397.1|  PREDICTED: chlorophyll a-b binding protein o...    331   5e-111   Elaeis guineensis
gb|AAC25775.1|  chlorophyll a/b binding protein                         331   5e-111   Medicago sativa [alfalfa]
ref|XP_009377344.1|  PREDICTED: chlorophyll a-b binding protein o...    331   6e-111   Pyrus x bretschneideri [bai li]
prf||1204205B  protein 1B,chlorophyll binding                           331   7e-111   Solanum lycopersicum
ref|XP_002285646.1|  PREDICTED: chlorophyll a-b binding protein o...    331   8e-111   Vitis vinifera
gb|AAH53854.1|  Unknown (protein for IMAGE:5194336)                     332   8e-111   Homo sapiens [man]
dbj|BAA24493.1|  chlorophyll a/b-binding protein                        330   8e-111   Fagus crenata
ref|XP_004303878.1|  PREDICTED: chlorophyll a-b binding protein o...    331   8e-111   Fragaria vesca subsp. vesca
gb|AFK40061.1|  unknown                                                 330   9e-111   Medicago truncatula
gb|ADL41158.1|  chloroplast light-harvesting chlorophyll a/b bind...    330   9e-111   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003548104.1|  PREDICTED: chlorophyll a-b binding protein 2...    330   9e-111   
gb|AFK40204.1|  unknown                                                 328   9e-111   Lotus japonicus
ref|XP_004302854.1|  PREDICTED: chlorophyll a-b binding protein o...    330   1e-110   Fragaria vesca subsp. vesca
ref|XP_003548106.1|  PREDICTED: chlorophyll a/b-binding protein p...    330   1e-110   
gb|AFI60242.1|  light harvesting chlorophyll a/b binding protein        330   1e-110   Panicum virgatum
gb|AAA80594.1|  chlorophyll a/b binding protein                         330   1e-110   Solanum tuberosum [potatoes]
ref|XP_004233101.1|  PREDICTED: chlorophyll a-b binding protein 1...    330   1e-110   
ref|XP_004303877.1|  PREDICTED: chlorophyll a-b binding protein o...    330   2e-110   Fragaria vesca subsp. vesca
gb|AAR10886.1|  chlorophyll a/b binding protein                         330   2e-110   Trifolium pratense [peavine clover]
gb|AEO51755.1|  chloroplast chlorophyll A/B binding protein             330   2e-110   Dimocarpus longan [longan]
emb|CDP06329.1|  unnamed protein product                                330   2e-110   Coffea canephora [robusta coffee]
gb|EYU28184.1|  hypothetical protein MIMGU_mgv1a011918mg                330   2e-110   Erythranthe guttata [common monkey flower]
gb|EMT29002.1|  Chlorophyll a-b binding protein, chloroplastic          330   2e-110   
gb|AFW90594.1|  chloroplast chlorophyll a/b binding protein             330   2e-110   Solanum tuberosum [potatoes]
gb|AAZ79657.1|  putative chlorophyll a/b-binding protein                329   2e-110   Fagus sylvatica
dbj|BAJ08392.1|  light harvesting chlorophyll a/b-binding protein...    329   2e-110   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAA80592.1|  chlorophyll a/b binding protein                         329   3e-110   Solanum tuberosum [potatoes]
ref|XP_011045093.1|  PREDICTED: chlorophyll a-b binding protein o...    329   3e-110   Populus euphratica
dbj|BAF95850.1|  putative chloroplast chlorophyll a/b binding pro...    328   3e-110   Vitis hybrid cultivar
gb|AGV54498.1|  LHCII type I chlorophyll a/b-binding protein            329   3e-110   Phaseolus vulgaris [French bean]
ref|XP_004961193.1|  PREDICTED: chlorophyll a-b binding protein M...    329   3e-110   Setaria italica
ref|XP_010316912.1|  PREDICTED: chlorophyll a-b binding protein 1...    329   3e-110   
ref|XP_007158464.1|  hypothetical protein PHAVU_002G154500g             329   4e-110   Phaseolus vulgaris [French bean]
dbj|BAJ93064.1|  predicted protein                                      329   4e-110   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ87673.1|  predicted protein                                      329   4e-110   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010316911.1|  PREDICTED: chlorophyll a-b binding protein 1...    329   4e-110   
gb|AAT08668.1|  chloroplast chlorophyll A-B binding protein 40          328   5e-110   Hyacinthus orientalis [common hyacinth]
ref|XP_010237260.1|  PREDICTED: chlorophyll a-b binding protein o...    328   6e-110   Brachypodium distachyon [annual false brome]
gb|AGV54521.1|  LHCII type I chlorophyll a/b-binding protein            328   6e-110   Phaseolus vulgaris [French bean]
gb|AAF26741.1|AF220527_1  chlorophyll a/b binding protein precursor     328   7e-110   Euphorbia esula [wolf's milk]
gb|EYU29602.1|  hypothetical protein MIMGU_mgv1a019986mg                328   7e-110   Erythranthe guttata [common monkey flower]
gb|ACU23974.1|  unknown                                                 328   8e-110   Glycine max [soybeans]
gb|AAF89206.1|AF279249_1  LHCII type I chlorophyll a/b-binding pr...    328   8e-110   Vigna radiata [mung bean]
gb|ABQ81856.1|  chloroplast chlorophyll a/b binding protein             328   9e-110   Phyllostachys edulis [kikko-chiku]
ref|XP_002283566.1|  PREDICTED: chlorophyll a-b binding protein o...    328   9e-110   Vitis vinifera
gb|AAB18209.1|  chlorophyll a/b-binding protein WCAB precursor          328   1e-109   Triticum aestivum [Canadian hard winter wheat]
sp|P04779.1|CB21_PETSP  RecName: Full=Chlorophyll a-b binding pro...    328   1e-109   Petunia sp.
gb|EYU29604.1|  hypothetical protein MIMGU_mgv1a023200mg                328   1e-109   Erythranthe guttata [common monkey flower]
ref|XP_010231015.1|  PREDICTED: chlorophyll a-b binding protein o...    327   1e-109   Brachypodium distachyon [annual false brome]
gb|ABQ81857.1|  chloroplast chlorophyll a/b binding protein             327   1e-109   Phyllostachys edulis [kikko-chiku]
gb|EMT29003.1|  Chlorophyll a-b binding protein, chloroplastic          327   1e-109   
emb|CDP06330.1|  unnamed protein product                                327   1e-109   Coffea canephora [robusta coffee]
gb|ABQ32304.1|  chloroplast light-harvesting chlorophyll a/b-bind...    327   1e-109   Artemisia annua [sweet Annie]
ref|XP_007151996.1|  hypothetical protein PHAVU_004G093000g             327   2e-109   Phaseolus vulgaris [French bean]
gb|ABW70800.1|  chloroplast light harvesting chlorophyll a/b bind...    327   2e-109   Populus euphratica
ref|XP_004293579.1|  PREDICTED: chlorophyll a-b binding protein o...    327   2e-109   Fragaria vesca subsp. vesca
gb|ACD64978.1|  chloroplast chlorophyll a/b-binding protein             327   2e-109   Ophiopogon japonicus
ref|XP_006856963.1|  hypothetical protein AMTR_s00189p00032350          327   2e-109   Amborella trichopoda
gb|AAB87573.1|  chlorophyll a/b binding protein of LHCII type I p...    327   2e-109   Panax ginseng [Asiatic ginseng]
ref|XP_008358195.1|  PREDICTED: chlorophyll a-b binding protein o...    327   2e-109   Malus domestica [apple tree]
ref|XP_006467511.1|  PREDICTED: chlorophyll a-b binding protein 3...    332   2e-109   
gb|EMS51039.1|  Chlorophyll a-b binding protein 3C, chloroplastic       327   2e-109   Triticum urartu
ref|XP_007151979.1|  hypothetical protein PHAVU_004G091600g             327   2e-109   Phaseolus vulgaris [French bean]
ref|XP_010666512.1|  PREDICTED: chlorophyll a-b binding protein, ...    327   2e-109   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010097596.1|  Chlorophyll a-b binding protein 40                 327   3e-109   Morus notabilis
dbj|BAJ89881.1|  predicted protein                                      327   3e-109   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS50796.1|  Chlorophyll a-b binding protein, chloroplastic          327   3e-109   Triticum urartu
sp|P12329.1|CB21_MAIZE  RecName: Full=Chlorophyll a-b binding pro...    327   3e-109   Zea mays [maize]
dbj|BAJ90643.1|  predicted protein                                      326   4e-109   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007151992.1|  hypothetical protein PHAVU_004G0927000g            324   4e-109   Phaseolus vulgaris [French bean]
gb|EMS57503.1|  Chlorophyll a-b binding protein, chloroplastic          326   5e-109   Triticum urartu
ref|XP_002515206.1|  chlorophyll A/B binding protein, putative          326   5e-109   Ricinus communis
gb|AAF89207.1|AF279250_1  LHCII type I chlorophyll a/b-binding pr...    326   6e-109   Vigna radiata [mung bean]
ref|XP_010666522.1|  PREDICTED: uncharacterized protein LOC104883672    338   7e-109   
gb|EMS50795.1|  Chlorophyll a-b binding protein, chloroplastic          327   7e-109   Triticum urartu
ref|XP_007151990.1|  hypothetical protein PHAVU_004G092600g             325   8e-109   Phaseolus vulgaris [French bean]
gb|AAW31511.1|  light-harvesting chlorophyll-a/b binding protein ...    325   8e-109   Pisum sativum [garden pea]
gb|ABN49454.2|  chloroplast chlorophyll a/b binding protein             325   8e-109   Pisum sativum [garden pea]
ref|XP_010097597.1|  Chlorophyll a-b binding protein 40                 325   9e-109   Morus notabilis
gb|EYU19649.1|  hypothetical protein MIMGU_mgv1a011927mg                325   9e-109   Erythranthe guttata [common monkey flower]
ref|XP_004957570.1|  PREDICTED: chlorophyll a-b binding protein 1...    325   9e-109   Setaria italica
sp|P07371.1|CB22_PEA  RecName: Full=Chlorophyll a-b binding prote...    325   1e-108   Pisum sativum [garden pea]
gb|EPS64140.1|  chlorophyll a-b binding protein 21, chloroplastic       325   1e-108   Genlisea aurea
gb|ABM66819.1|  chloroplast light-harvesting chlorophyll a/b bind...    325   1e-108   Bambusa oldhamii
ref|NP_001147639.1|  chlorophyll a-b binding protein 1, chloropla...    325   1e-108   
gb|AFV34722.1|  light harvesting chlorophyll a/b-binding protein 1-1    325   1e-108   Dendrocalamus latiflorus [sweet bamboo]
ref|XP_009363087.1|  PREDICTED: chlorophyll a-b binding protein o...    325   1e-108   
ref|NP_001241277.1|  uncharacterized protein LOC100805310               325   1e-108   Glycine max [soybeans]
gb|AES74698.2|  light-harvesting complex I chlorophyll A/B-bindin...    325   1e-108   Medicago truncatula
sp|P09756.1|CB23_SOYBN  RecName: Full=Chlorophyll a-b binding pro...    325   1e-108   Glycine max [soybeans]
gb|EYU19613.1|  hypothetical protein MIMGU_mgv1a011885mg                325   2e-108   Erythranthe guttata [common monkey flower]
gb|EMS50798.1|  Chlorophyll a-b binding protein, chloroplastic          326   2e-108   Triticum urartu
ref|XP_011460161.1|  PREDICTED: chlorophyll a-b binding protein o...    325   2e-108   Fragaria vesca subsp. vesca
gb|EMT04380.1|  Chlorophyll a-b binding protein, chloroplastic          329   2e-108   
gb|KHN28981.1|  Chlorophyll a-b binding protein 3, chloroplastic        324   2e-108   Glycine soja [wild soybean]
gb|EYU43278.1|  hypothetical protein MIMGU_mgv1a011933mg                324   2e-108   Erythranthe guttata [common monkey flower]
gb|EYU35814.1|  hypothetical protein MIMGU_mgv1a011908mg                324   2e-108   Erythranthe guttata [common monkey flower]
ref|XP_009400578.1|  PREDICTED: chlorophyll a-b binding protein o...    324   3e-108   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT02412.1|  Chlorophyll a-b binding protein, chloroplastic          324   3e-108   
gb|ADC35579.1|  chloroplast chlorophyll a/b binding protein             324   4e-108   Lycoris radiata [higanbana]
gb|EMS67016.1|  Chlorophyll a-b binding protein, chloroplastic          324   4e-108   Triticum urartu
ref|XP_009377327.1|  PREDICTED: chlorophyll a-b binding protein o...    324   4e-108   Pyrus x bretschneideri [bai li]
emb|CAG25596.1|  putative chlorophyll a/b binding protein               323   4e-108   Triticum turgidum subsp. durum
gb|EYU43289.1|  hypothetical protein MIMGU_mgv11b019945mg               324   4e-108   Erythranthe guttata [common monkey flower]
dbj|BAJ85110.1|  predicted protein                                      324   4e-108   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAA03104.1|  light-harvesting chlorophyll a/b-binding protein...    323   5e-108   Lactuca sativa [cultivated lettuce]
ref|XP_007221496.1|  hypothetical protein PRUPE_ppa010066mg             323   5e-108   Prunus persica
ref|XP_008343203.1|  PREDICTED: chlorophyll a-b binding protein o...    326   5e-108   
ref|XP_009360962.1|  PREDICTED: chlorophyll a-b binding protein o...    324   6e-108   Pyrus x bretschneideri [bai li]
dbj|BAK02173.1|  predicted protein                                      323   7e-108   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002455902.1|  hypothetical protein SORBIDRAFT_03g027040          323   7e-108   Sorghum bicolor [broomcorn]
ref|NP_001142284.1|  uncharacterized protein LOC100274453               323   1e-107   Zea mays [maize]
dbj|BAJ90772.1|  predicted protein                                      323   1e-107   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KEH25006.1|  light-harvesting complex I chlorophyll A/B-bindin...    323   1e-107   
sp|P92919.1|CB23_APIGR  RecName: Full=Chlorophyll a-b binding pro...    322   1e-107   
sp|P04784.1|CB21_WHEAT  RecName: Full=Chlorophyll a-b binding pro...    322   2e-107   
ref|XP_002455901.1|  hypothetical protein SORBIDRAFT_03g027030          322   2e-107   
ref|XP_002460622.1|  hypothetical protein SORBIDRAFT_02g032040          322   2e-107   
dbj|BAJ87045.1|  predicted protein                                      322   2e-107   
gb|AFW90512.1|  chlorophyll a/b-binding protein                         322   2e-107   
gb|KEH25005.1|  light-harvesting complex I chlorophyll A/B-bindin...    322   2e-107   
gb|EMS50797.1|  Chlorophyll a-b binding protein, chloroplastic          322   3e-107   
gb|ACU23816.1|  unknown                                                 322   3e-107   
ref|XP_004969083.1|  PREDICTED: chlorophyll a-b binding protein 2...    322   3e-107   
gb|AEY85026.1|  light-harvesting complex II protein                     322   3e-107   
gb|KEH25007.1|  light-harvesting complex I chlorophyll A/B-bindin...    321   4e-107   
gb|AHA84197.1|  chlorophyll a/b-binding protein                         321   4e-107   
gb|EMS45686.1|  Chlorophyll a-b binding protein, chloroplastic          321   4e-107   
gb|AAD21625.1|  putative chlorophyll a/b-binding protein                322   4e-107   
gb|EMT02225.1|  Chlorophyll a-b binding protein, chloroplastic          321   4e-107   
dbj|BAJ86427.1|  predicted protein                                      321   5e-107   
gb|AAA60965.1|  light-harvesting chlorophyll a/b binding protein ...    321   6e-107   
gb|ACN31249.1|  unknown                                                 320   6e-107   
gb|EMT04379.1|  Chlorophyll a-b binding protein, chloroplastic          320   7e-107   
ref|XP_003578592.1|  PREDICTED: chlorophyll a-b binding protein o...    320   7e-107   
sp|P08963.1|CB22_HORVU  RecName: Full=Chlorophyll a-b binding pro...    320   8e-107   
dbj|BAJ87240.1|  predicted protein                                      320   9e-107   
ref|XP_006365561.1|  PREDICTED: chlorophyll a-b binding protein 1...    320   1e-106   
ref|XP_006368025.1|  PREDICTED: chlorophyll a-b binding protein 1...    320   1e-106   
gb|AHA84168.1|  chlorophyll a/b-binding protein                         320   1e-106   
emb|CAA61432.1|  LHCII type I protein                                   320   1e-106   
ref|XP_007158961.1|  hypothetical protein PHAVU_002G196400g             320   1e-106   
gb|AEV59638.1|  chloroplast photosystem II light harvesting compl...    318   1e-106   
gb|AEV59641.1|  chloroplast photosystem II light harvesting compl...    318   2e-106   
sp|P27490.1|CB28_PEA  RecName: Full=Chlorophyll a-b binding prote...    320   2e-106   
gb|AEV59642.1|  chloroplast photosystem II light harvesting compl...    318   2e-106   
gb|AEV59640.1|  chloroplast photosystem II light harvesting compl...    318   2e-106   
gb|ACL50948.1|  putative chloroplast chlorophyll a/b binding protein    318   3e-106   
ref|XP_002275075.1|  PREDICTED: chlorophyll a-b binding protein o...    319   3e-106   
gb|EMT25652.1|  hypothetical protein F775_43704                         332   3e-106   
ref|XP_003633024.1|  PREDICTED: chlorophyll a-b binding protein o...    319   3e-106   
ref|XP_004489391.1|  PREDICTED: chlorophyll a-b binding protein 3...    319   3e-106   
emb|CAN78667.1|  hypothetical protein VITISV_031287                     319   4e-106   
ref|XP_010538237.1|  PREDICTED: chlorophyll a-b binding protein 1...    319   4e-106   
gb|AEV59639.1|  chloroplast photosystem II light harvesting compl...    318   4e-106   
gb|AFK39586.1|  unknown                                                 318   5e-106   
gb|AHB24928.1|  chloroplast chlorophyll a-b binding protein 2/3         318   5e-106   
gb|AAD27879.2|AF139467_1  LHCII type I chlorophyll a/b binding pr...    318   6e-106   
ref|XP_002302798.2|  hypothetical protein POPTR_0002s19010g             318   6e-106   
gb|AEV59645.1|  chloroplast photosystem II light harvesting compl...    317   6e-106   
ref|NP_001235283.1|  chlorophyll a/b-binding protein                    318   8e-106   
gb|EMS59660.1|  Chlorophyll a-b binding protein, chloroplastic          320   1e-105   
dbj|BAK03973.1|  predicted protein                                      318   1e-105   
gb|AEV59643.1|  chloroplast photosystem II light harvesting compl...    317   1e-105   
ref|XP_006415534.1|  hypothetical protein EUTSA_v10008479mg             317   1e-105   
ref|XP_004148579.1|  PREDICTED: chlorophyll a-b binding protein 3...    317   2e-105   
ref|XP_008675448.1|  PREDICTED: chlorophyll a-b binding protein o...    317   2e-105   
ref|NP_001148439.1|  chlorophyll a-b binding protein 2                  317   2e-105   
ref|NP_001043493.1|  Os01g0600900                                       317   2e-105   
ref|NP_001062939.1|  Os09g0346500                                       317   2e-105   
gb|AFW90565.1|  chlorophyll a-b binding protein 3C-like mRNA            315   3e-105   
tpg|DAA58853.1|  TPA: hypothetical protein ZEAMMB73_924562              316   3e-105   
gb|EMS51257.1|  Chlorophyll a-b binding protein 1, chloroplastic        317   3e-105   
ref|XP_010549470.1|  PREDICTED: chlorophyll a-b binding protein 1...    317   3e-105   
prf||1503276A  chlorophyll a/b binding protein                          315   4e-105   
sp|P12471.1|CB21_SOYBN  RecName: Full=Chlorophyll a-b binding pro...    315   5e-105   
gb|EMT09894.1|  Chlorophyll a-b binding protein, chloroplastic          316   6e-105   
gb|EYU43279.1|  hypothetical protein MIMGU_mgv1a011871mg                316   6e-105   
ref|XP_002890838.1|  hypothetical protein ARALYDRAFT_473204             315   8e-105   
dbj|BAA00536.1|  type I light-harvesting chlorophyll a/b-binding ...    315   9e-105   
ref|XP_002273106.2|  PREDICTED: chlorophyll a-b binding protein o...    315   1e-104   
ref|XP_006305533.1|  hypothetical protein CARUB_v10010022mg             315   1e-104   
emb|CDY66768.1|  BnaAnng22920D                                          315   1e-104   
ref|XP_006304391.1|  hypothetical protein CARUB_v10010908mg             315   1e-104   
emb|CAC38830.1|  chlorophyll a/b binding protein                        315   2e-104   
gb|EMS67017.1|  Chlorophyll a-b binding protein, chloroplastic          314   2e-104   
ref|XP_006660556.1|  PREDICTED: chlorophyll a-b binding protein 2...    314   3e-104   
ref|XP_009141380.1|  PREDICTED: chlorophyll a-b binding protein 1...    314   3e-104   
ref|XP_010499509.1|  PREDICTED: chlorophyll a-b binding protein 1...    314   3e-104   
ref|XP_006840304.1|  hypothetical protein AMTR_s00045p00069900          314   3e-104   
pdb|1RWT|A  Chain A, Crystal Structure Of Spinach Major Light-har...    313   3e-104   
emb|CDY26306.1|  BnaA09g26570D                                          314   3e-104   
ref|XP_002893588.1|  hypothetical protein ARALYDRAFT_473203             313   3e-104   
emb|CDY35271.1|  BnaC03g59520D                                          314   4e-104   
ref|NP_174286.1|  chlorophyll A/B binding protein 1                     314   4e-104   
ref|XP_010478366.1|  PREDICTED: chlorophyll a-b binding protein 1...    313   4e-104   
ref|XP_010460769.1|  PREDICTED: chlorophyll a-b binding protein 1...    313   4e-104   
ref|XP_010460768.1|  PREDICTED: chlorophyll a-b binding protein 2...    313   4e-104   
dbj|BAD97888.1|  CAB homologue1                                         312   5e-104   
gb|KFK36334.1|  hypothetical protein AALP_AA4G109200                    313   6e-104   
ref|XP_008447450.1|  PREDICTED: chlorophyll a-b binding protein o...    313   6e-104   
gb|AAU89255.1|  chloroplast light harvesting chlorophyll a/b bind...    313   6e-104   
gb|AIB04243.1|  chloroplast light harvesting chlorophyll a/b bind...    311   6e-104   
gb|ACI90635.1|  chloroplast light harvesting chlorophyll a/b bind...    313   7e-104   
gb|KFK44818.1|  hypothetical protein AALP_AA1G306800                    313   7e-104   
ref|XP_009102798.1|  PREDICTED: chlorophyll a-b binding protein 1...    313   7e-104   
gb|AAU89265.1|  chloroplast light harvesting chlorophyll a/b bind...    312   7e-104   
emb|CAA47950.1|  chlorophyll a/b binding protein                        313   1e-103   
gb|ABG29728.1|  chloroplast chlorophyll a/b binding protein             313   1e-103   
gb|KHN41291.1|  Chlorophyll a-b binding protein of LHCII type I, ...    311   1e-103   
ref|XP_006410587.1|  hypothetical protein EUTSA_v10017088mg             312   1e-103   
gb|ABK20976.1|  unknown                                                 313   1e-103   
ref|NP_564339.1|  chlorophyll A/B binding protein 3                     312   1e-103   
gb|AAU89263.1|  chloroplast light harvesting chlorophyll a/b bind...    311   2e-103   
ref|XP_010499505.1|  PREDICTED: chlorophyll a-b binding protein 2...    312   2e-103   
emb|CAA32108.1|  chlorophyll a/b-binding preprotein (AA -31 to 235)     312   2e-103   
ref|XP_006415537.1|  hypothetical protein EUTSA_v10008476mg             312   2e-103   
gb|ACF84273.1|  unknown                                                 312   2e-103   
emb|CAA57408.1|  light harvesting chlorophyll a /b-binding protei...    312   2e-103   
ref|XP_006844081.1|  hypothetical protein AMTR_s00006p00251360          312   2e-103   
ref|XP_010091411.1|  Chlorophyll a-b binding protein 16                 311   2e-103   
gb|AAU89264.1|  chloroplast light harvesting chlorophyll a/b bind...    311   2e-103   
gb|AAU89250.1|  chloroplast light harvesting chlorophyll a/b bind...    311   3e-103   
gb|AIB04244.1|  chloroplast light harvesting chlorophyll a/b bind...    310   3e-103   
emb|CDX99866.1|  BnaC05g22880D                                          311   3e-103   
emb|CAA57409.1|  light harvesting chlorophyll a /b-binding protei...    311   4e-103   
ref|XP_003618482.1|  Chlorophyll a/b-binding protein                    311   4e-103   
emb|CAH59405.1|  light harvesting protein 1                             310   4e-103   
gb|ACI90632.1|  chloroplast light harvesting chlorophyll a/b bind...    310   5e-103   
gb|ACN40194.1|  unknown                                                 311   5e-103   
ref|XP_006840305.1|  hypothetical protein AMTR_s00045p00070890          309   6e-103   
gb|ACI90636.1|  chloroplast light harvesting chlorophyll a/b bind...    310   6e-103   
gb|AAL38341.1|  chlorophyll a/b-binding protein                         310   7e-103   
gb|AAU89254.1|  chloroplast light harvesting chlorophyll a/b bind...    310   7e-103   
emb|CDX84316.1|  BnaC04g10780D                                          310   8e-103   
gb|ACI90631.1|  chloroplast light harvesting chlorophyll a/b bind...    310   9e-103   
gb|AAU89257.1|  chloroplast light harvesting chlorophyll a/b bind...    310   1e-102   
emb|CDY17247.1|  BnaA05g09410D                                          310   1e-102   
gb|AAU89261.1|  chloroplast light harvesting chlorophyll a/b bind...    310   1e-102   
gb|AAU89262.1|  chloroplast light harvesting chlorophyll a/b bind...    310   1e-102   
ref|XP_009143778.1|  PREDICTED: chlorophyll a-b binding protein 1...    310   1e-102   
ref|XP_010509751.1|  PREDICTED: chlorophyll a-b binding protein 1...    310   1e-102   
gb|AAL67432.1|AF458406_1  chlorophyll a/b binding protein               310   1e-102   
gb|AAY81729.1|  chloroplast putative light harvesting chlorophyll...    309   1e-102   
sp|P13851.1|CB21_SINAL  RecName: Full=Chlorophyll a-b binding pro...    310   2e-102   
gb|ACY66805.1|  chlorophyll a/b-binding protein                         310   2e-102   
gb|AAC78690.1|  chlorophyll a/b-binding protein                         310   2e-102   
gb|AAU89252.1|  chloroplast light harvesting chlorophyll a/b bind...    309   2e-102   
ref|XP_002440263.1|  hypothetical protein SORBIDRAFT_09g028720          309   2e-102   
ref|NP_001105545.1|  chlorophyll a-b binding protein M9, chloropl...    309   2e-102   
gb|ABK22510.1|  unknown                                                 310   2e-102   
gb|AAU89253.1|  chloroplast light harvesting chlorophyll a/b bind...    308   3e-102   
gb|AAU89256.1|  chloroplast light harvesting chlorophyll a/b bind...    308   3e-102   
gb|AAY81730.1|  chloroplast putative light harvesting chlorophyll...    308   3e-102   
gb|AAU89251.1|  chloroplast light harvesting chlorophyll a/b bind...    308   4e-102   
ref|XP_006293384.1|  hypothetical protein CARUB_v10023856mg             308   4e-102   
gb|AIW07979.1|  chloroplast light harvesting chlorophyll a/b bind...    308   4e-102   
ref|XP_010509756.1|  PREDICTED: chlorophyll a-b binding protein 1...    308   5e-102   
sp|P15193.1|CB2A_PINSY  RecName: Full=Chlorophyll a-b binding pro...    309   5e-102   
ref|XP_010504897.1|  PREDICTED: chlorophyll a-b binding protein 1...    308   5e-102   
ref|NP_565786.1|  photosystem II light harvesting complex protein...    308   5e-102   
emb|CDY17248.1|  BnaA05g09400D                                          308   5e-102   
ref|XP_002879498.1|  LHB1B1                                             308   6e-102   
emb|CDX79562.1|  BnaC03g18980D                                          308   6e-102   
emb|CDX98158.1|  BnaC07g09400D                                          308   6e-102   
sp|P24006.1|CB2A_PYRPY  RecName: Full=Chlorophyll a-b binding pro...    308   6e-102   
gb|AGU28448.1|  light-harvesting chlorophyll-protein complex II s...    308   6e-102   
ref|XP_006295385.1|  hypothetical protein CARUB_v10024479mg             308   7e-102   
gb|AFW81158.1|  light harvesting chlorophyll a/b binding protein3       309   7e-102   
ref|XP_009132986.1|  PREDICTED: chlorophyll a-b binding protein 1...    308   7e-102   
gb|ACF85694.1|  unknown                                                 308   7e-102   
gb|AIW08054.1|  chloroplast light harvesting chlorophyll a/b bind...    307   7e-102   
sp|P06671.1|CB22_MAIZE  RecName: Full=Chlorophyll a-b binding pro...    308   8e-102   
sp|P15194.1|CB2B_PINSY  RecName: Full=Chlorophyll a-b binding pro...    308   1e-101   
ref|XP_010374558.1|  PREDICTED: chlorophyll a-b binding protein o...    306   1e-101   
ref|NP_565787.1|  light-harvesting chlorophyll protein complex II...    307   1e-101   
gb|KFK44817.1|  hypothetical protein AALP_AA1G306700                    306   2e-101   
ref|WP_037445947.1|  hypothetical protein                               303   2e-101   
gb|ADV19258.1|  chlorophyll a/b-binding protein-like protein            305   2e-101   
ref|XP_010504898.1|  PREDICTED: chlorophyll a-b binding protein 1...    306   3e-101   
emb|CAA32109.1|  chlorophyll a/b-binding preprotein (AA -28 to 235)     306   4e-101   
ref|XP_011003152.1|  PREDICTED: chlorophyll a-b binding protein o...    306   5e-101   
gb|ACN40044.1|  unknown                                                 306   5e-101   
gb|AAM64379.1|  putative photosystem II type I chlorophyll a b bi...    305   6e-101   
pdb|1VCR|A  Chain A, An Icosahedral Assembly Of Light-Harvesting ...    304   6e-101   
gb|AAP44089.1|  chlorophyll a/b binding protein                         305   8e-101   
emb|CDX84315.1|  BnaC04g10770D                                          307   8e-101   
ref|NP_001105427.1|  light harvesting chlorophyll a /b binding pr...    305   8e-101   
gb|KFK36335.1|  hypothetical protein AALP_AA4G109300                    305   8e-101   
gb|KCW73782.1|  hypothetical protein EUGRSUZ_E02381                     304   1e-100   
ref|XP_009109634.1|  PREDICTED: chlorophyll a-b binding protein 2...    304   2e-100   
gb|EMT23952.1|  Chlorophyll a-b binding protein 1B, chloroplastic       303   3e-100   
ref|XP_002960494.1|  light-harvesting complex                           304   3e-100   
gb|KFK42335.1|  hypothetical protein AALP_AA2G243100                    303   3e-100   
ref|XP_002967230.1|  light-harvesting complex                           303   4e-100   
emb|CAA57407.1|  light harvesting chlorophyll a /b-binding protei...    304   4e-100   
gb|ABK23263.1|  unknown                                                 303   6e-100   
gb|ABK23849.1|  unknown                                                 303   7e-100   
gb|ABK26071.1|  unknown                                                 303   7e-100   
gb|AAG52048.1|AC022455_2  chlorophyll A-B-binding protein 2 precu...    302   9e-100   
ref|XP_009143774.1|  PREDICTED: chlorophyll a-b binding protein 1...    302   1e-99    
pdb|2BHW|A  Chain A, Pea Light-Harvesting Complex Ii At 2.5 Angst...    301   1e-99    
sp|P09755.1|CB22_SOYBN  RecName: Full=Chlorophyll a-b binding pro...    301   2e-99    
gb|ABK22330.1|  unknown                                                 301   3e-99    
gb|EYU28189.1|  hypothetical protein MIMGU_mgv1a020664mg                301   3e-99    
ref|XP_009102801.1|  PREDICTED: chlorophyll a-b binding protein 1...    301   4e-99    
gb|ACN40027.1|  unknown                                                 301   5e-99    
pdb|4LCZ|A  Chain A, Crystal Structure Of A Multilayer-packed Maj...    298   1e-98    
prf||1615137B  chlorophyll a/b binding protein P27                      298   2e-98    
gb|EMS53958.1|  Chlorophyll a-b binding protein 3C, chloroplastic       299   3e-98    
ref|XP_002881334.1|  chlorophyll A-B-binding protein 2 precursor        297   7e-98    
gb|AAT08647.1|  chloroplast chlorophyll A-B binding protein 3C          296   8e-98    
ref|XP_010412864.1|  PREDICTED: uncharacterized protein LOC104699228    307   8e-98    
ref|NP_001044090.1|  Os01g0720500                                       296   2e-97    
gb|EYU29603.1|  hypothetical protein MIMGU_mgv1a025305mg                295   5e-97    
gb|EMT02753.1|  Chlorophyll a-b binding protein 3C, chloroplastic       295   8e-97    
sp|P04159.1|CB21_PEA  RecName: Full=Chlorophyll a-b binding prote...    293   1e-96    
gb|ACG30091.1|  chlorophyll a-b binding protein 2                       293   1e-96    
gb|AGU28449.1|  chlorophyll A/B binding protein 1                       291   2e-96    
gb|AAB18404.1|  chlorophyll a/b binding protein                         291   3e-95    
ref|XP_010235395.1|  PREDICTED: chlorophyll a-b binding protein o...    291   3e-95    
gb|EMT11232.1|  Chlorophyll a-b binding protein, chloroplastic          292   6e-95    
emb|CAA27542.1|  chlorophyll a/b binding protein (LHCP AB 180)          289   7e-95    
ref|XP_001755762.1|  predicted protein                                  289   2e-94    
ref|XP_001779318.1|  predicted protein                                  288   3e-94    
sp|Q00827.1|CB48_MAIZE  RecName: Full=Chlorophyll a-b binding pro...    288   5e-94    
ref|XP_001774812.1|  predicted protein                                  288   5e-94    
ref|XP_001774452.1|  predicted protein                                  288   6e-94    
ref|XP_001751426.1|  predicted protein                                  288   6e-94    
gb|ABK26463.1|  unknown                                                 286   9e-94    
ref|XP_001761868.1|  predicted protein                                  287   1e-93    
ref|XP_001751359.1|  predicted protein                                  286   2e-93    
ref|XP_001754234.1|  predicted protein                                  286   2e-93    
ref|XP_004144543.1|  PREDICTED: chlorophyll a-b binding protein 1...    286   3e-93    



>ref|XP_011096521.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic-like 
[Sesamum indicum]
Length=286

 Score =   353 bits (906),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 168/184 (91%), Positives = 175/184 (95%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAG+AVK SPS PE TGN + +MRKT  KP+P SSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  32   FAGQAVKLSPSAPEITGNGRVSMRKTVAKPKPASSGSPWYGPDRVKYLGPFSGEPPSYLT  91

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  92   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  151

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQV+LMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  152  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGYRIAGGPLGEVTDPLYP  211

Query  656  GGSF  667
            GGSF
Sbjct  212  GGSF  215



>ref|XP_004145734.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004169747.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic-like 
[Cucumis sativus]
 gb|KGN46826.1| hypothetical protein Csa_6G139750 [Cucumis sativus]
Length=267

 Score =   351 bits (901),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 168/184 (91%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAG+AVK SP+  +  G  + TMRKTAGKP+PVSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   FAGQAVKLSPTASDLLGEGRITMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  72

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  132

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDP+YP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPIYP  192

Query  656  GGSF  667
            GGSF
Sbjct  193  GGSF  196



>ref|XP_006361530.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006361531.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
isoform X2 [Solanum tuberosum]
Length=267

 Score =   351 bits (900),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 168/184 (91%), Positives = 175/184 (95%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAVK SPS+ E TGN +FTMRKTA K +PVSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGKAVKLSPSSSEITGNGRFTMRKTATKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLT  72

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYP  192

Query  656  GGSF  667
            GGSF
Sbjct  193  GGSF  196



>ref|XP_009593856.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=267

 Score =   350 bits (898),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 168/184 (91%), Positives = 174/184 (95%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAVK SPS+ E TGN K TMRKTA K +PVSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGKAVKLSPSSSEITGNGKVTMRKTASKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLT  72

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYP  192

Query  656  GGSF  667
            GGSF
Sbjct  193  GGSF  196



>ref|XP_008456347.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Cucumis 
melo]
Length=267

 Score =   350 bits (897),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/184 (91%), Positives = 175/184 (95%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
             AG+AVK SP+  +  G  + TMRKTAGKP+PVSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   LAGQAVKLSPTASDLLGEGRITMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  72

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  132

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDP+YP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPIYP  192

Query  656  GGSF  667
            GGSF
Sbjct  193  GGSF  196



>ref|XP_009795316.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like 
[Nicotiana sylvestris]
 dbj|BAA25392.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris]
Length=267

 Score =   350 bits (897),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 167/184 (91%), Positives = 174/184 (95%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAVK SPS+ E TGN K TMRKTA K +PVSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGKAVKLSPSSSEITGNGKVTMRKTASKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLT  72

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGE+ DPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYP  192

Query  656  GGSF  667
            GGSF
Sbjct  193  GGSF  196



>ref|XP_009795315.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic 
[Nicotiana sylvestris]
Length=267

 Score =   349 bits (895),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 167/184 (91%), Positives = 174/184 (95%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAVK SPS+ E TGN K TMRKTA K +PVSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGKAVKLSPSSSEITGNGKVTMRKTASKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLT  72

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGE+ DPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYP  192

Query  656  GGSF  667
            GGSF
Sbjct  193  GGSF  196



>ref|XP_009628754.1| PREDICTED: chlorophyll a-b binding protein 16, chloroplastic 
[Nicotiana tomentosiformis]
Length=266

 Score =   348 bits (894),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 167/184 (91%), Positives = 174/184 (95%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAVK SPS+ E TGN K TMRKTA K +PVSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  12   FAGKAVKLSPSSSEITGNGKVTMRKTASKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLT  71

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  72   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  131

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGE+ DPLYP
Sbjct  132  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYP  191

Query  656  GGSF  667
            GGSF
Sbjct  192  GGSF  195



>ref|XP_004170962.1| PREDICTED: chlorophyll a-b binding protein of LHCII type I, chloroplastic-like 
[Cucumis sativus]
 gb|KGN49375.1| hypothetical protein Csa_6G522690 [Cucumis sativus]
Length=265

 Score =   348 bits (894),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 169/184 (92%), Positives = 175/184 (95%), Gaps = 2/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
             AG+AVK SP+ PE  GNAKFTMRKTA K   VSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   LAGQAVKLSPTAPEIQGNAKFTMRKTASKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLT  70

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  130

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+TDP+YP
Sbjct  131  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPIYP  190

Query  656  GGSF  667
            GGSF
Sbjct  191  GGSF  194



>ref|XP_004134608.1| PREDICTED: chlorophyll a-b binding protein of LHCII type I, chloroplastic-like 
[Cucumis sativus]
Length=265

 Score =   348 bits (894),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 169/184 (92%), Positives = 175/184 (95%), Gaps = 2/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
             AG+AVK SP+ PE  GNAKFTMRKTA K   VSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   LAGQAVKLSPNAPEIQGNAKFTMRKTASKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLT  70

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  130

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+TDP+YP
Sbjct  131  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPIYP  190

Query  656  GGSF  667
            GGSF
Sbjct  191  GGSF  194



>sp|P27492.1|CB21_TOBAC RecName: Full=Chlorophyll a-b binding protein 16, chloroplastic; 
AltName: Full=LHCII type I CAB-16; Short=LHCP; Flags: Precursor 
[Nicotiana tabacum]
 emb|CAA36955.1| unnamed protein product [Nicotiana tabacum]
Length=266

 Score =   348 bits (894),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 167/184 (91%), Positives = 174/184 (95%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAVK SPS+ E TGN K TMRKTA K +PVSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  12   FAGKAVKLSPSSSEVTGNGKVTMRKTASKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLT  71

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  72   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  131

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGE+ DPLYP
Sbjct  132  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYP  191

Query  656  GGSF  667
            GGSF
Sbjct  192  GGSF  195



>ref|XP_009618329.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like 
[Nicotiana tomentosiformis]
 ref|XP_009628756.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=267

 Score =   348 bits (894),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 166/184 (90%), Positives = 174/184 (95%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAVK SPS+ E TGN K TMRKTA K +PVSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGKAVKLSPSSSEITGNGKVTMRKTASKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLT  72

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNG+KFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGIKFGEAVW  132

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGE+ DPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYP  192

Query  656  GGSF  667
            GGSF
Sbjct  193  GGSF  196



>ref|XP_004134603.1| PREDICTED: chlorophyll a-b binding protein of LHCII type I, chloroplastic-like 
isoform 1 [Cucumis sativus]
 ref|XP_004134604.1| PREDICTED: chlorophyll a-b binding protein of LHCII type I, chloroplastic-like 
isoform 2 [Cucumis sativus]
 ref|XP_004134605.1| PREDICTED: chlorophyll a-b binding protein of LHCII type I, chloroplastic-like 
isoform 3 [Cucumis sativus]
 gb|KGN49374.1| hypothetical protein Csa_6G522680 [Cucumis sativus]
Length=265

 Score =   348 bits (893),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 169/184 (92%), Positives = 175/184 (95%), Gaps = 2/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
             AG+AVK SP+ PE  GNAKFTMRKTA K   VSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   LAGQAVKLSPNAPEIQGNAKFTMRKTASKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLT  70

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  130

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+TDP+YP
Sbjct  131  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPIYP  190

Query  656  GGSF  667
            GGSF
Sbjct  191  GGSF  194



>ref|XP_009790936.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like 
[Nicotiana sylvestris]
Length=267

 Score =   348 bits (893),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 167/184 (91%), Positives = 174/184 (95%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAVK SPS+ E TGN K TMRKTA K +PVSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGKAVKLSPSSSEITGNGKVTMRKTATKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLT  72

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGE+ DPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYP  192

Query  656  GGSF  667
            GGSF
Sbjct  193  GGSF  196



>ref|XP_009782924.1| PREDICTED: chlorophyll a-b binding protein 50, chloroplastic-like 
[Nicotiana sylvestris]
Length=267

 Score =   348 bits (892),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 166/184 (90%), Positives = 173/184 (94%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            F GKAVK SPS+ E TGN K TMRKTA K +PVSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FVGKAVKLSPSSSEITGNGKVTMRKTASKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLT  72

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGE+ DPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYP  192

Query  656  GGSF  667
            GGSF
Sbjct  193  GGSF  196



>ref|XP_009782922.1| PREDICTED: chlorophyll a-b binding protein 50, chloroplastic 
[Nicotiana sylvestris]
Length=267

 Score =   347 bits (891),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 166/184 (90%), Positives = 173/184 (94%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAVK SPS+ E TGN K TMRKT  K +PVSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGKAVKLSPSSSEITGNGKVTMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLT  72

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGE+ DPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYP  192

Query  656  GGSF  667
            GGSF
Sbjct  193  GGSF  196



>ref|XP_009790934.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like 
[Nicotiana sylvestris]
 dbj|BAA25396.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris]
Length=267

 Score =   347 bits (891),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 166/184 (90%), Positives = 173/184 (94%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            F GKAVK SPS+ E TGN K TMRKTA K +PVSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FVGKAVKLSPSSSEITGNGKVTMRKTATKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLT  72

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGE+ DPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYP  192

Query  656  GGSF  667
            GGSF
Sbjct  193  GGSF  196



>ref|XP_009597417.1| PREDICTED: chlorophyll a-b binding protein 50, chloroplastic 
[Nicotiana tomentosiformis]
Length=267

 Score =   347 bits (891),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 166/184 (90%), Positives = 173/184 (94%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAVK SPS+ E TGN K TMRKT  K +PVSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGKAVKLSPSSSEITGNGKVTMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLT  72

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGE+ DPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYP  192

Query  656  GGSF  667
            GGSF
Sbjct  193  GGSF  196



>sp|P08221.1|CB21_CUCSA RecName: Full=Chlorophyll a-b binding protein of LHCII type I, 
chloroplastic; Short=CAB; Short=LHCP; Flags: Precursor, partial 
[Cucumis sativus]
 gb|AAA33124.1| chlorophyll a/b-binding protein, partial [Cucumis sativus]
Length=255

 Score =   347 bits (889),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 169/184 (92%), Positives = 175/184 (95%), Gaps = 2/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
             AG+AVK SP+ PE  GNAKFTMRKTA K   VSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  3    LAGQAVKLSPNAPEIQGNAKFTMRKTASKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLT  60

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  61   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  120

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+TDP+YP
Sbjct  121  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPIYP  180

Query  656  GGSF  667
            GGSF
Sbjct  181  GGSF  184



>sp|P07369.1|CB2G_SOLLC RecName: Full=Chlorophyll a-b binding protein 3C, chloroplastic; 
AltName: Full=LHCII type I CAB-3C; Short=LHCP; Flags: Precursor 
[Solanum lycopersicum]
 prf||1204205G protein 3C,chlorophyll binding
Length=267

 Score =   347 bits (889),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 166/184 (90%), Positives = 173/184 (94%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAVK SPS+ E TGN + TMRKTA K +P SSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGKAVKLSPSSSEITGNGRVTMRKTATKAKPASSGSPWYGPDRVKYLGPFSGESPSYLT  72

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYP  192

Query  656  GGSF  667
            GGSF
Sbjct  193  GGSF  196



>ref|XP_011096520.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic 
[Sesamum indicum]
Length=265

 Score =   347 bits (889),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 168/184 (91%), Positives = 174/184 (95%), Gaps = 2/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAG+AVK SPS PE TGN + +MRKT  KP  VSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   FAGQAVKLSPSAPEITGNGRVSMRKTVAKP--VSSGSPWYGPDRVKYLGPFSGEPPSYLT  70

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQV+LMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  131  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGYRIAGGPLGEVTDPLYP  190

Query  656  GGSF  667
            GGSF
Sbjct  191  GGSF  194



>ref|XP_011085268.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic-like 
[Sesamum indicum]
Length=265

 Score =   347 bits (889),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 169/184 (92%), Positives = 174/184 (95%), Gaps = 2/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAG+AVK SPST E TGN + +MRKT  KP  VSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   FAGQAVKLSPSTSEITGNGRVSMRKTVAKP--VSSGSPWYGPDRVKYLGPFSGEPPSYLT  70

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  131  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYP  190

Query  656  GGSF  667
            GGSF
Sbjct  191  GGSF  194



>gb|AAA34148.1| chlorophyll a/b-binding protein Cab-3C [Solanum lycopersicum]
Length=267

 Score =   346 bits (888),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 166/184 (90%), Positives = 173/184 (94%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAVK SPS+ E TGN + TMRKTA K +P SSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGKAVKLSPSSSEITGNGRVTMRKTATKAKPASSGSPWYGPDRVKYLGPFSGESPSYLT  72

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYP  192

Query  656  GGSF  667
            GGSF
Sbjct  193  GGSF  196



>ref|XP_009628755.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic 
[Nicotiana tomentosiformis]
 sp|P27495.1|CB24_TOBAC RecName: Full=Chlorophyll a-b binding protein 40, chloroplastic; 
AltName: Full=LHCII type I CAB-40; Short=LHCP; Flags: Precursor 
[Nicotiana tabacum]
 emb|CAA36958.1| unnamed protein product [Nicotiana tabacum]
Length=267

 Score =   346 bits (888),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 166/184 (90%), Positives = 173/184 (94%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAVK SPS+ E TGN K TMRKTA K + VSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGKAVKLSPSSSEITGNGKVTMRKTASKAKTVSSGSPWYGPDRVKYLGPFSGESPSYLT  72

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGE+ DPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYP  192

Query  656  GGSF  667
            GGSF
Sbjct  193  GGSF  196



>ref|XP_006356077.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
[Solanum tuberosum]
Length=267

 Score =   346 bits (888),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 165/184 (90%), Positives = 173/184 (94%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAVK SPS+ E TGN + TMRKTA K +P SSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGKAVKLSPSSSEITGNGRVTMRKTAAKAKPASSGSPWYGPDRVKYLGPFSGESPSYLT  72

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETF+KNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFSKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYP  192

Query  656  GGSF  667
            GGSF
Sbjct  193  GGSF  196



>sp|P27496.1|CB25_TOBAC RecName: Full=Chlorophyll a-b binding protein 50, chloroplastic; 
AltName: Full=LHCII type I CAB-50; Short=LHCP; Flags: Precursor 
[Nicotiana tabacum]
 emb|CAA36956.1| unnamed protein product [Nicotiana tabacum]
Length=267

 Score =   346 bits (888),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 165/184 (90%), Positives = 173/184 (94%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAVK SPS+ E TGN K TMRKT  K +P+SSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGKAVKLSPSSSEITGNGKVTMRKTVTKAKPLSSGSPWYGPDRVKYLGPFSGESPSYLT  72

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGE+ DPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYP  192

Query  656  GGSF  667
            GGSF
Sbjct  193  GGSF  196



>ref|XP_010916097.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Elaeis guineensis]
Length=266

 Score =   346 bits (888),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 166/184 (90%), Positives = 173/184 (94%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAVK SPS  E  G  + TMRKT  KP+PV++GSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  12   FAGKAVKLSPSASEINGEGRITMRKTVPKPKPVAAGSPWYGPDRVKYLGPFSGEPPSYLT  71

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  72   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  131

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQV+LMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  132  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGYRIAGGPLGEVTDPLYP  191

Query  656  GGSF  667
            GGSF
Sbjct  192  GGSF  195



>ref|XP_009611577.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=262

 Score =   346 bits (887),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 165/184 (90%), Positives = 173/184 (94%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            F GKAVK SPS+ E TGN K TMRKTA K +PVSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  8    FVGKAVKLSPSSSEITGNGKATMRKTASKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLT  67

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  68   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  127

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGA+EGYR+AGGPLGE+ DPLYP
Sbjct  128  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAIEGYRVAGGPLGEVVDPLYP  187

Query  656  GGSF  667
            GGSF
Sbjct  188  GGSF  191



>ref|XP_010317413.1| PREDICTED: chlorophyll a-b binding protein 3A, chloroplastic-like 
[Solanum lycopersicum]
Length=267

 Score =   346 bits (888),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 164/184 (89%), Positives = 173/184 (94%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGK VK +PS+ E +GN + TMRKTA KP+P SSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGKTVKLAPSSSEISGNGRITMRKTAAKPKPASSGSPWYGPDRVKYLGPFSGESPSYLT  72

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYP  192

Query  656  GGSF  667
            GGSF
Sbjct  193  GGSF  196



>ref|XP_009606802.1| PREDICTED: chlorophyll a-b binding protein 16, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=266

 Score =   346 bits (887),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 165/184 (90%), Positives = 173/184 (94%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAVK SPS+ E TGN K TMRKTA K +P+SSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  12   FAGKAVKLSPSSSEITGNGKVTMRKTASKAKPLSSGSPWYGPDRVKYLGPFSGESPSYLT  71

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  72   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  131

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FK G+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGE+ DPLYP
Sbjct  132  FKVGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVIDPLYP  191

Query  656  GGSF  667
            GGSF
Sbjct  192  GGSF  195



>ref|XP_009782923.1| PREDICTED: chlorophyll a-b binding protein 50, chloroplastic-like 
[Nicotiana sylvestris]
Length=267

 Score =   346 bits (888),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 165/184 (90%), Positives = 172/184 (93%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            F GKAVK SPS+ E TGN K TMRKT  K +PVSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FVGKAVKLSPSSSEITGNGKVTMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLT  72

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGE+ DPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYP  192

Query  656  GGSF  667
            GGSF
Sbjct  193  GGSF  196



>ref|XP_009795314.1| PREDICTED: chlorophyll a-b binding protein 16, chloroplastic-like 
[Nicotiana sylvestris]
 dbj|BAA25393.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris]
Length=266

 Score =   346 bits (887),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 165/184 (90%), Positives = 173/184 (94%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAVK SPS+ E TGN K TMRKTA K +PVSSGS WYGPDRVKYLGPFSGE PSYLT
Sbjct  12   FAGKAVKLSPSSSEITGNGKVTMRKTASKAKPVSSGSLWYGPDRVKYLGPFSGESPSYLT  71

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  72   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  131

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQV+LMGAVEGYR+AGGPLGE+ DPLYP
Sbjct  132  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRVAGGPLGEVVDPLYP  191

Query  656  GGSF  667
            GGSF
Sbjct  192  GGSF  195



>ref|XP_009772885.1| PREDICTED: chlorophyll a-b binding protein 50, chloroplastic-like 
[Nicotiana sylvestris]
Length=267

 Score =   346 bits (887),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 165/184 (90%), Positives = 172/184 (93%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            F GKAVK SPS+ E TGN K TMRKT  K +PVSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FVGKAVKLSPSSSEITGNGKVTMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLT  72

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGE+ DPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYP  192

Query  656  GGSF  667
            GGSF
Sbjct  193  GGSF  196



>sp|P12470.1|CB25_NICPL RecName: Full=Chlorophyll a-b binding protein E, chloroplastic; 
AltName: Full=LHCII type I CAB-E; Short=LHCP; Flags: Precursor 
[Nicotiana plumbaginifolia]
 gb|AAA34056.1| chlorophyll a/b-binding protein-E [Nicotiana plumbaginifolia]
Length=266

 Score =   346 bits (887),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 166/184 (90%), Positives = 173/184 (94%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAVK SPS+ E TGN K TMRKTA K +PVSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  12   FAGKAVKLSPSSSEVTGNGKVTMRKTANKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLT  71

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  72   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  131

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AG PLGE+ DPLYP
Sbjct  132  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGEPLGEVVDPLYP  191

Query  656  GGSF  667
            GGSF
Sbjct  192  GGSF  195



>ref|XP_006356073.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
[Solanum tuberosum]
Length=267

 Score =   345 bits (886),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 164/184 (89%), Positives = 172/184 (93%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            F GKAVK SPS+ E TGN + TMRKTA K +P SSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FVGKAVKLSPSSSEITGNGRITMRKTAAKAKPASSGSPWYGPDRVKYLGPFSGEAPSYLT  72

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEA+W
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAIW  132

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYP  192

Query  656  GGSF  667
            GGSF
Sbjct  193  GGSF  196



>ref|XP_009782921.1| PREDICTED: chlorophyll a-b binding protein 50, chloroplastic-like 
[Nicotiana sylvestris]
Length=267

 Score =   345 bits (886),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 165/184 (90%), Positives = 172/184 (93%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAVK SPS+ E  GN K TMRKT  K +PVSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGKAVKLSPSSSEIIGNGKVTMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLT  72

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGE+ DPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYP  192

Query  656  GGSF  667
            GGSF
Sbjct  193  GGSF  196



>sp|P04783.1|CB25_PETSP RecName: Full=Chlorophyll a-b binding protein 91R, chloroplastic; 
AltName: Full=LHCII type I CAB-91R; Short=LHCP; Flags: 
Precursor [Petunia sp.]
 emb|CAA26209.1| unnamed protein product [Petunia sp.]
Length=267

 Score =   345 bits (886),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 166/184 (90%), Positives = 173/184 (94%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAVKFSPS+ E TGN K TMRKT  K +PVSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGKAVKFSPSSSEITGNGKATMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLT  72

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTA LSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAELSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGE+ DPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYP  192

Query  656  GGSF  667
            GGSF
Sbjct  193  GGSF  196



>ref|XP_006356078.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
[Solanum tuberosum]
Length=267

 Score =   345 bits (886),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 165/184 (90%), Positives = 173/184 (94%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAVK SPS+ E TGN + TMRKTA K +P SSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGKAVKLSPSSSEVTGNGRVTMRKTATKAKPASSGSPWYGPDRVKYLGPFSGESPSYLT  72

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETF+KNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFSKNRELEVIHGRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYP  192

Query  656  GGSF  667
            GGSF
Sbjct  193  GGSF  196



>ref|XP_009628757.1| PREDICTED: chlorophyll a-b binding protein 16, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=266

 Score =   345 bits (885),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 165/184 (90%), Positives = 172/184 (93%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAV+ SPS+ E  GN K TMRKT  K +PVSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  12   FAGKAVRLSPSSSEIIGNGKVTMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLT  71

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  72   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  131

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  132  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYP  191

Query  656  GGSF  667
            GGSF
Sbjct  192  GGSF  195



>ref|XP_006364025.1| PREDICTED: chlorophyll a-b binding protein 50, chloroplastic-like 
[Solanum tuberosum]
Length=267

 Score =   345 bits (885),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 165/184 (90%), Positives = 172/184 (93%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAVK SPS+ E TGN K  MRKT  K +P+SSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGKAVKLSPSSSEITGNGKVMMRKTVTKAKPISSGSPWYGPDRVKYLGPFSGESPSYLT  72

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYP  192

Query  656  GGSF  667
            GGSF
Sbjct  193  GGSF  196



>ref|XP_009606800.1| PREDICTED: chlorophyll a-b binding protein 50, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=267

 Score =   345 bits (884),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 164/184 (89%), Positives = 172/184 (93%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAVK SPS+ E TGN K TMRKT  K +PVSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGKAVKLSPSSSEITGNGKVTMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLT  72

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAML ALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLAALGCVFPELLARNGVKFGEAVW  132

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR++GGPLGE+ DPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVSGGPLGEVVDPLYP  192

Query  656  GGSF  667
            GGSF
Sbjct  193  GGSF  196



>ref|XP_006356075.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
isoform X1 [Solanum tuberosum]
Length=267

 Score =   345 bits (884),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 164/184 (89%), Positives = 173/184 (94%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAVK SPS+ E TGN + TMRKTA K +P SSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGKAVKLSPSSSEITGNGRVTMRKTATKAKPASSGSPWYGPDRVKYLGPFSGESPSYLT  72

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETF+KNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFSKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQ+ILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQNILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYP  192

Query  656  GGSF  667
            GGSF
Sbjct  193  GGSF  196



>ref|XP_002316737.1| Chlorophyll a-b binding protein 2 [Populus trichocarpa]
 gb|EEE97349.1| Chlorophyll a-b binding protein 2 [Populus trichocarpa]
Length=264

 Score =   345 bits (884),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 169/184 (92%), Positives = 174/184 (95%), Gaps = 3/184 (2%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAVK SPS+PE  GN + +MRKT    +PVSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   FAGKAVKLSPSSPELMGNGRVSMRKTT---KPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  69

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  129

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWA QVVLMGAVEGYRIAGGPLGEITDP+YP
Sbjct  130  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWATQVVLMGAVEGYRIAGGPLGEITDPIYP  189

Query  656  GGSF  667
            GGSF
Sbjct  190  GGSF  193



>ref|XP_008439658.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Cucumis melo]
Length=265

 Score =   344 bits (882),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 167/184 (91%), Positives = 173/184 (94%), Gaps = 2/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
             AGKAVK SP+ PE  G  + TMRKTA KP  VSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   LAGKAVKLSPNAPEIQGTGRITMRKTATKP--VSSGSPWYGPDRVKYLGPFSGEPPSYLT  70

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  130

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+TDP+YP
Sbjct  131  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPIYP  190

Query  656  GGSF  667
            GGSF
Sbjct  191  GGSF  194



>ref|XP_008784387.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Phoenix dactylifera]
Length=266

 Score =   344 bits (882),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 165/184 (90%), Positives = 172/184 (93%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
             AGKAVK +PS  E  G  + TMRKT  +P+PV+SGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  12   LAGKAVKLAPSASEILGEGRITMRKTFSRPKPVASGSPWYGPDRVKYLGPFSGEPPSYLT  71

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  72   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  131

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  132  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYP  191

Query  656  GGSF  667
            GGSF
Sbjct  192  GGSF  195



>gb|ABF17940.1| putative chloroplast chlorophyll a/b-binding protein [Carya cathayensis]
Length=267

 Score =   344 bits (882),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 162/184 (88%), Positives = 175/184 (95%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
             AG+A+K +PS+ +  G  + TMRKTAG+P+PVSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   LAGQAIKLAPSSSDLLGEGRVTMRKTAGRPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  72

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+TDP+YP
Sbjct  133  FKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVTDPIYP  192

Query  656  GGSF  667
            GGSF
Sbjct  193  GGSF  196



>sp|P27491.1|CB27_TOBAC RecName: Full=Chlorophyll a-b binding protein 7, chloroplastic; 
AltName: Full=LHCII type I CAB-7; Short=LHCP; Flags: Precursor 
[Nicotiana tabacum]
 emb|CAA41187.1| chlorophyll a /b binding protein [Nicotiana tabacum]
Length=267

 Score =   343 bits (881),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 164/184 (89%), Positives = 172/184 (93%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAG AVK SPS+ E TGN K  MRKT  K +PVSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGNAVKLSPSSSEITGNGKAIMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLT  72

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGA+EGYR+AGGPLGE+TDPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAIEGYRVAGGPLGEVTDPLYP  192

Query  656  GGSF  667
            GGSF
Sbjct  193  GGSF  196



>ref|XP_009396492.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Musa acuminata subsp. malaccensis]
Length=266

 Score =   343 bits (881),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 164/184 (89%), Positives = 173/184 (94%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAG+AVK +PS  +  G  + TMRKT  KP+PV+SGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  12   FAGQAVKLAPSASDVLGGGRVTMRKTGAKPKPVASGSPWYGPDRVKYLGPFSGEPPSYLT  71

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  72   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  131

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQV+LMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  132  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGYRIAGGPLGEVTDPLYP  191

Query  656  GGSF  667
            GGSF
Sbjct  192  GGSF  195



>ref|XP_009775533.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic [Nicotiana 
sylvestris]
 dbj|BAA25395.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris]
Length=267

 Score =   343 bits (881),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 164/184 (89%), Positives = 172/184 (93%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAG AVK SPS+ E TGN K  MRKT  K +PVSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGNAVKLSPSSSEITGNGKAIMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLT  72

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGA+EGYR+AGGPLGE+TDPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAIEGYRVAGGPLGEVTDPLYP  192

Query  656  GGSF  667
            GGSF
Sbjct  193  GGSF  196



>ref|XP_009782905.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic-like 
[Nicotiana sylvestris]
Length=267

 Score =   343 bits (881),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 164/184 (89%), Positives = 172/184 (93%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAG AVK SPS+ E TGN K  MRKT  K +PVSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGNAVKLSPSSSEITGNGKAIMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLT  72

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGA+EGYR+AGGPLGE+TDPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAIEGYRVAGGPLGEVTDPLYP  192

Query  656  GGSF  667
            GGSF
Sbjct  193  GGSF  196



>ref|XP_008779641.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Phoenix dactylifera]
Length=266

 Score =   343 bits (881),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 162/184 (88%), Positives = 173/184 (94%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
             AGKAVK +PS  +  G  + TMRK+ G+P+P++SGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  12   LAGKAVKLAPSASDIIGEGRITMRKSVGRPKPIASGSPWYGPDRVKYLGPFSGEPPSYLT  71

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  72   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  131

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQV+LMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  132  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGYRIAGGPLGEVTDPLYP  191

Query  656  GGSF  667
            GGSF
Sbjct  192  GGSF  195



>ref|XP_010243713.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Nelumbo nucifera]
Length=267

 Score =   343 bits (880),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 164/184 (89%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
             AGKAVK +PS  E  G  + TMRKT  KP+PVSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   LAGKAVKLAPSASELLGEGRITMRKTVAKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  72

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWA QV+LMGAVEGYR+AGGPLGE+TDPLYP
Sbjct  133  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWATQVILMGAVEGYRVAGGPLGEVTDPLYP  192

Query  656  GGSF  667
            GGSF
Sbjct  193  GGSF  196



>ref|XP_010052093.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Eucalyptus grandis]
 gb|KCW75951.1| hypothetical protein EUGRSUZ_D00319 [Eucalyptus grandis]
Length=265

 Score =   343 bits (880),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 165/184 (90%), Positives = 173/184 (94%), Gaps = 2/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
             AG+AVK SPSTPE  GN + +MRKT GKP  VSSGSPWYGPDR KYLGPFSGEPPSYLT
Sbjct  13   LAGQAVKLSPSTPELLGNGRVSMRKTVGKP--VSSGSPWYGPDRAKYLGPFSGEPPSYLT  70

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNG+KFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGIKFGEAVW  130

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAGAQIFSEGGLDYLGNP+LIHAQSILAIWACQV+LMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  131  FKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVILMGAVEGYRIAGGPLGEVTDPLYP  190

Query  656  GGSF  667
            GGSF
Sbjct  191  GGSF  194



>gb|ABB55370.1| chlorophyll a-b binding protein 3C-like [Solanum tuberosum]
Length=267

 Score =   343 bits (880),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 164/184 (89%), Positives = 172/184 (93%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAVK SPS+ E TGN + TMRK+  K +P SSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGKAVKLSPSSSEITGNGRITMRKSVAKAKPASSGSPWYGPDRVKYLGPFSGEAPSYLT  72

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYP  192

Query  656  GGSF  667
            GGSF
Sbjct  193  GGSF  196



>ref|XP_002519724.1| chlorophyll A/B binding protein, putative [Ricinus communis]
 gb|EEF42697.1| chlorophyll A/B binding protein, putative [Ricinus communis]
Length=265

 Score =   343 bits (879),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 166/184 (90%), Positives = 173/184 (94%), Gaps = 2/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAVK SPS PE  GN + +MRKTA K   VSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   FAGKAVKLSPSAPELMGNGRVSMRKTAAKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLT  70

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYR+AGGPLGE+TDP+YP
Sbjct  131  FKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVTDPIYP  190

Query  656  GGSF  667
            GGSF
Sbjct  191  GGSF  194



>ref|XP_009618330.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=265

 Score =   342 bits (878),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 167/184 (91%), Positives = 173/184 (94%), Gaps = 2/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAVK SPS  E TGN K TMRKTA K +PVSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGKAVKLSPS--ETTGNGKVTMRKTASKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLT  70

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGE+ DPLYP
Sbjct  131  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYP  190

Query  656  GGSF  667
            GGSF
Sbjct  191  GGSF  194



>ref|XP_009421488.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Musa acuminata subsp. malaccensis]
Length=266

 Score =   342 bits (877),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 163/184 (89%), Positives = 172/184 (93%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
             AGKAVK +PS  +  G  + TMRK+A + +PVSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  12   LAGKAVKLAPSASDILGEGRITMRKSAARSKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  71

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  72   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  131

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQV+LMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  132  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGYRIAGGPLGEVTDPLYP  191

Query  656  GGSF  667
            GGSF
Sbjct  192  GGSF  195



>ref|XP_006356076.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
isoform X2 [Solanum tuberosum]
Length=267

 Score =   342 bits (877),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 162/184 (88%), Positives = 172/184 (93%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAVK SPS+ E TGN + TMRK+  K +P SSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGKAVKLSPSSSEVTGNGRVTMRKSVAKAKPASSGSPWYGPDRVKYLGPFSGESPSYLT  72

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETF+KNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFSKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQ+ILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQNILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYP  192

Query  656  GGSF  667
            GGSF
Sbjct  193  GGSF  196



>ref|XP_011011531.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Populus euphratica]
 ref|XP_011016419.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Populus euphratica]
Length=264

 Score =   342 bits (877),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 167/184 (91%), Positives = 173/184 (94%), Gaps = 3/184 (2%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
             AGKAVK +PS+PE  GN + +MRKT    +PVSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   LAGKAVKLTPSSPELMGNGRVSMRKTT---KPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  69

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  129

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWA QVVLMGAVEGYRIAGGPLGEITDP+YP
Sbjct  130  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWATQVVLMGAVEGYRIAGGPLGEITDPIYP  189

Query  656  GGSF  667
            GGSF
Sbjct  190  GGSF  193



>ref|XP_006356074.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
[Solanum tuberosum]
Length=267

 Score =   342 bits (877),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 164/184 (89%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGK VK SPS+ E TGN + TMRKT  K +P SSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGKTVKLSPSSYEITGNGRVTMRKTTTKAKPASSGSPWYGPDRVKYLGPFSGEAPSYLT  72

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYP  192

Query  656  GGSF  667
            GGSF
Sbjct  193  GGSF  196



>ref|XP_009782821.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic-like 
[Nicotiana sylvestris]
Length=267

 Score =   342 bits (877),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 163/184 (89%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
             AG AVK SPS+ E TGN K  MRKT  K +PVSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   LAGNAVKLSPSSSEITGNGKAIMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLT  72

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGA+EGYR+AGGPLGE+TDPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAIEGYRVAGGPLGEVTDPLYP  192

Query  656  GGSF  667
            GGSF
Sbjct  193  GGSF  196



>gb|KCW75952.1| hypothetical protein EUGRSUZ_D00320 [Eucalyptus grandis]
Length=265

 Score =   342 bits (876),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 164/184 (89%), Positives = 173/184 (94%), Gaps = 2/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
             AG+AVK SPSTPE  GN + +MRKT GKP  VSSGSPWYGPDR K+LGPFSGEPPSYLT
Sbjct  13   LAGQAVKLSPSTPELLGNGRVSMRKTVGKP--VSSGSPWYGPDRAKHLGPFSGEPPSYLT  70

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNG+KFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGIKFGEAVW  130

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAGAQIFSEGGLDYLGNP+LIHAQSILAIWACQV+LMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  131  FKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVILMGAVEGYRIAGGPLGEVTDPLYP  190

Query  656  GGSF  667
            GGSF
Sbjct  191  GGSF  194



>ref|XP_009759685.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like 
[Nicotiana sylvestris]
 dbj|BAA25394.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris]
Length=267

 Score =   341 bits (875),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 164/184 (89%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAVK SPS+ E  GN K TMRKT  K +PVSSGSPWYGPDRVKYLGPFSG  PSYLT
Sbjct  13   FAGKAVKLSPSSYEIIGNGKVTMRKTVIKAKPVSSGSPWYGPDRVKYLGPFSGNSPSYLT  72

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGE+ DPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYP  192

Query  656  GGSF  667
            GGSF
Sbjct  193  GGSF  196



>emb|CAA78379.1| chlorophyll a/b-binding protein PS II-Type I [Solanum tuberosum]
Length=267

 Score =   341 bits (875),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 164/184 (89%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAVK SPS+ E TGN +FTMRKTA K +PVSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGKAVKLSPSSSEITGNGRFTMRKTAAKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLT  72

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GE PGDYGWDTAGLSADPETFAKNRELEVIH RWA+L  LGCVFPELLSRNGVKFGEAVW
Sbjct  73   GEKPGDYGWDTAGLSADPETFAKNRELEVIHCRWAILERLGCVFPELLSRNGVKFGEAVW  132

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FK G+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  133  FKVGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYP  192

Query  656  GGSF  667
            GGSF
Sbjct  193  GGSF  196



>gb|KDP37945.1| hypothetical protein JCGZ_04588 [Jatropha curcas]
Length=265

 Score =   341 bits (875),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 166/184 (90%), Positives = 171/184 (93%), Gaps = 2/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
             AGKAVK  PS PE  GN + TMRKTA K   VSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   LAGKAVKLGPSAPELMGNGRVTMRKTASKN--VSSGSPWYGPDRVKYLGPFSGEPPSYLT  70

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYR+AGGPLGE+TDP+YP
Sbjct  131  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVTDPIYP  190

Query  656  GGSF  667
            GGSF
Sbjct  191  GGSF  194



>ref|XP_006356080.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
[Solanum tuberosum]
Length=267

 Score =   341 bits (874),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 162/184 (88%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGK VK SPS+ E TGN + TMRK+A K +P S GSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGKTVKLSPSSSEITGNGRVTMRKSAAKAKPASFGSPWYGPDRVKYLGPFSGEAPSYLT  72

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETF+KNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFSKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYP  192

Query  656  GGSF  667
            GGSF
Sbjct  193  GGSF  196



>sp|P12469.1|CB23_NICPL RecName: Full=Chlorophyll a-b binding protein C, chloroplastic; 
AltName: Full=LHCII type I CAB-C; Short=LHCP; Flags: Precursor 
[Nicotiana plumbaginifolia]
 gb|AAA34055.1| chlorophyll a/b-binding protein-C [Nicotiana plumbaginifolia]
Length=267

 Score =   341 bits (874),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 162/184 (88%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAVK SPS+ E TGN K TMRKTA K +PVSS SPWYGP+RVKYLGPFSGE PSYLT
Sbjct  13   FAGKAVKLSPSSSEITGNGKVTMRKTASKAKPVSSSSPWYGPNRVKYLGPFSGESPSYLT  72

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FK G+QIFS+GGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AG PLGE+ DPLYP
Sbjct  133  FKGGSQIFSQGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGEPLGEVVDPLYP  192

Query  656  GGSF  667
            GGSF
Sbjct  193  GGSF  196



>ref|XP_004147416.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like 
[Cucumis sativus]
 gb|KGN65549.1| Chlorophyll A/B binding protein [Cucumis sativus]
Length=265

 Score =   340 bits (873),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 166/184 (90%), Positives = 174/184 (95%), Gaps = 2/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGK VK +PS+PE  GN++ TMRK+A K   VSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   FAGKVVKLTPSSPELFGNSRVTMRKSATKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLT  70

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  130

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSLIHAQSILAIWA QVVLMGAVEGYRIAGGPLGE+TDP+YP
Sbjct  131  FKAGSQIFSEGGLDYLGNPSLIHAQSILAIWASQVVLMGAVEGYRIAGGPLGEVTDPIYP  190

Query  656  GGSF  667
            GGSF
Sbjct  191  GGSF  194



>gb|KCW75953.1| hypothetical protein EUGRSUZ_D00321 [Eucalyptus grandis]
Length=300

 Score =   342 bits (876),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 164/184 (89%), Positives = 171/184 (93%), Gaps = 2/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
             AG+AVK SPSTPE  GN + +MRK   KP  VSSGSPWYGPDR KYLGPFSGEPPSYLT
Sbjct  48   LAGQAVKLSPSTPELLGNGRISMRKAVRKP--VSSGSPWYGPDRAKYLGPFSGEPPSYLT  105

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  106  GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  165

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAGAQIFSEGGLDYLGNP+LIHAQSILAIWACQV+LMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  166  FKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVILMGAVEGYRIAGGPLGEVTDPLYP  225

Query  656  GGSF  667
            GGSF
Sbjct  226  GGSF  229



>gb|AFC91647.1| chloroplast chlorophyll A/B binding protein [Hevea brasiliensis]
Length=265

 Score =   340 bits (872),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 166/184 (90%), Positives = 173/184 (94%), Gaps = 2/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAVK +PS P   GNA+ +MRK+ GKP  VSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   FAGKAVKLTPSAPGLMGNARVSMRKSVGKP--VSSGSPWYGPDRVKYLGPFSGEPPSYLT  70

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWA QVVLMGAVEGYRIAGGPLGE+TDP+YP
Sbjct  131  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWAVQVVLMGAVEGYRIAGGPLGEVTDPIYP  190

Query  656  GGSF  667
            GGSF
Sbjct  191  GGSF  194



>ref|XP_010247422.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Nelumbo nucifera]
Length=268

 Score =   340 bits (872),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 165/185 (89%), Positives = 172/185 (93%), Gaps = 1/185 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPE-FTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYL  292
            FAGKAVK +PS  E   G  + TMRKT  KP+PVSSGSPWYGPDRVKYLGPFSGEPPSYL
Sbjct  13   FAGKAVKLAPSASEKLLGEGRVTMRKTVAKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYL  72

Query  293  TGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAV  472
            TGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAV
Sbjct  73   TGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAV  132

Query  473  WFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLY  652
            WFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWA QV+LMGAVEGYR+AGGPLGE+TDPLY
Sbjct  133  WFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWATQVILMGAVEGYRVAGGPLGEVTDPLY  192

Query  653  PGGSF  667
            PGGSF
Sbjct  193  PGGSF  197



>gb|KJB66916.1| hypothetical protein B456_010G165100 [Gossypium raimondii]
Length=265

 Score =   340 bits (871),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 164/184 (89%), Positives = 173/184 (94%), Gaps = 2/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAVKFSPSTP+  GN + +MRKTA KP   +SGSPWYGPDRV YLGP SGEPPSYLT
Sbjct  13   FAGKAVKFSPSTPKIQGNGRVSMRKTATKP--AASGSPWYGPDRVLYLGPLSGEPPSYLT  70

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSLIHAQSILAIWACQV+LMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  131  FKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGYRIAGGPLGEVTDPLYP  190

Query  656  GGSF  667
            GGSF
Sbjct  191  GGSF  194



>ref|XP_010924306.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Elaeis 
guineensis]
Length=264

 Score =   340 bits (871),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 166/184 (90%), Positives = 171/184 (93%), Gaps = 2/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
             AGKAVK +PST    G  + TMRKT GKP  VSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  12   LAGKAVKLAPSTSPILGEGRVTMRKTVGKP--VSSGSPWYGPDRVKYLGPFSGEPPSYLT  69

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  129

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYR+AGGPLGE+TDPLYP
Sbjct  130  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVTDPLYP  189

Query  656  GGSF  667
            GGSF
Sbjct  190  GGSF  193



>ref|XP_009395692.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Musa acuminata subsp. malaccensis]
Length=266

 Score =   339 bits (870),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 164/184 (89%), Positives = 169/184 (92%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
             AGKAVKF PS  +  G  + TMRKT  KP+   SGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  12   LAGKAVKFGPSVADVLGGGRVTMRKTGAKPKSAPSGSPWYGPDRVKYLGPFSGEPPSYLT  71

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  72   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLSRNGVKFGEAVW  131

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQV+LMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  132  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGYRIAGGPLGEVTDPLYP  191

Query  656  GGSF  667
            GGSF
Sbjct  192  GGSF  195



>ref|XP_008444193.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Cucumis melo]
Length=265

 Score =   339 bits (870),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 165/184 (90%), Positives = 173/184 (94%), Gaps = 2/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
             AGKAVK +PS+PE  GN++  MRK+A K   VSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   LAGKAVKLTPSSPELFGNSRVNMRKSAAKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLT  70

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  130

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSLIHAQSILAIWA QVVLMGAVEGYRIAGGPLGE+TDP+YP
Sbjct  131  FKAGSQIFSEGGLDYLGNPSLIHAQSILAIWASQVVLMGAVEGYRIAGGPLGEVTDPIYP  190

Query  656  GGSF  667
            GGSF
Sbjct  191  GGSF  194



>sp|P04780.1|CB22_PETSP RecName: Full=Chlorophyll a-b binding protein 22L, chloroplastic; 
AltName: Full=LHCII type I CAB-22L; Short=LHCP; Flags: 
Precursor [Petunia sp.]
 emb|CAA26212.1| unnamed protein product [Petunia sp.]
Length=267

 Score =   339 bits (870),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 162/184 (88%), Positives = 170/184 (92%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGK VK SPS+ E TGN K TMRKTA K +PVSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGKVVKLSPSSSEITGNGKATMRKTATKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLT  72

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPEL +RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELFARNGVKFGEAVW  132

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
             KAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQV+LMGAVEGYR+AGGPLG + DPLYP
Sbjct  133  LKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVLLMGAVEGYRVAGGPLGVVVDPLYP  192

Query  656  GGSF  667
            GGSF
Sbjct  193  GGSF  196



>ref|XP_010056879.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Eucalyptus grandis]
Length=265

 Score =   339 bits (870),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 165/184 (90%), Positives = 171/184 (93%), Gaps = 2/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
             AGKAV+ SPSTPE  G  + TMRKT  K   VSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   LAGKAVQLSPSTPELFGKGRVTMRKTVTKQ--VSSGSPWYGPDRVKYLGPFSGEPPSYLT  70

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQV+LMGAVEGYR+AGGPLGE+TDPLYP
Sbjct  131  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGYRVAGGPLGEVTDPLYP  190

Query  656  GGSF  667
            GGSF
Sbjct  191  GGSF  194



>ref|XP_004234241.1| PREDICTED: uncharacterized protein LOC101245729 [Solanum lycopersicum]
Length=554

 Score =   349 bits (896),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 166/184 (90%), Positives = 174/184 (95%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAVK SPS+ E +GN + TMRKTA KP+P SSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGKAVKLSPSSSEISGNGRITMRKTAAKPKPASSGSPWYGPDRVKYLGPFSGESPSYLT  72

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYP  192

Query  656  GGSF  667
            GGSF
Sbjct  193  GGSF  196


 Score =   347 bits (889),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 166/184 (90%), Positives = 173/184 (94%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAVK SPS+ E TGN + TMRKTA K +P SSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  300  FAGKAVKLSPSSSEITGNGRVTMRKTATKAKPASSGSPWYGPDRVKYLGPFSGESPSYLT  359

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  360  GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  419

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  420  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYP  479

Query  656  GGSF  667
            GGSF
Sbjct  480  GGSF  483



>ref|XP_008800689.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Phoenix 
dactylifera]
Length=264

 Score =   339 bits (869),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 165/184 (90%), Positives = 171/184 (93%), Gaps = 2/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAVK +PST    G  + TMRKT GKP P  SGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  12   FAGKAVKLAPSTSTILGEGRVTMRKTIGKPVP--SGSPWYGPDRVKYLGPFSGEPPSYLT  69

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  129

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAGAQIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGE+TDPLYP
Sbjct  130  FKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVTDPLYP  189

Query  656  GGSF  667
            GGSF
Sbjct  190  GGSF  193



>ref|XP_010052095.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Eucalyptus 
grandis]
Length=264

 Score =   339 bits (869),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 163/184 (89%), Positives = 171/184 (93%), Gaps = 3/184 (2%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAVK SP+TP+  GN + TMRK     +P SSGSPWYGPDR KYLGPFSGEPPSYLT
Sbjct  13   FAGKAVKLSPATPDLLGNGRVTMRKAV---KPASSGSPWYGPDRAKYLGPFSGEPPSYLT  69

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  129

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQV+LMGAVEGYR+AGGPLGE+TDPLYP
Sbjct  130  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGYRVAGGPLGEVTDPLYP  189

Query  656  GGSF  667
            GGSF
Sbjct  190  GGSF  193



>ref|XP_002524616.1| chlorophyll A/B binding protein, putative [Ricinus communis]
 gb|EEF37824.1| chlorophyll A/B binding protein, putative [Ricinus communis]
Length=265

 Score =   339 bits (869),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 165/184 (90%), Positives = 172/184 (93%), Gaps = 2/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAVK SPS PE  GN + +MRKTA K   VSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   FAGKAVKLSPSAPELMGNGRVSMRKTAAKN--VSSGSPWYGPDRVKYLGPFSGEPPSYLT  70

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSLIHAQSILAIWA QVVLMGAVEGYR+AGGPLGE+TDP+YP
Sbjct  131  FKAGSQIFSEGGLDYLGNPSLIHAQSILAIWASQVVLMGAVEGYRVAGGPLGEVTDPIYP  190

Query  656  GGSF  667
            GGSF
Sbjct  191  GGSF  194



>sp|P04781.1|CB23_PETSP RecName: Full=Chlorophyll a-b binding protein 22R, chloroplastic; 
AltName: Full=LHCII type I CAB-22R; Short=LHCP; Flags: 
Precursor [Petunia sp.]
 emb|CAA26213.1| unnamed protein product [Petunia sp.]
Length=267

 Score =   339 bits (869),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 161/184 (88%), Positives = 168/184 (91%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAVK S S+ E TGN K TMRKT  K +P SS SPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGKAVKLSSSSSEITGNGKVTMRKTVTKAKPASSSSPWYGPDRVKYLGPFSGEAPSYLT  72

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFP DYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPEL +RNG+KFGEAVW
Sbjct  73   GEFPSDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELFARNGIKFGEAVW  132

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAGAQIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGE+ DPLYP
Sbjct  133  FKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVIDPLYP  192

Query  656  GGSF  667
            GGSF
Sbjct  193  GGSF  196



>gb|EYU28462.1| hypothetical protein MIMGU_mgv1a012008mg [Erythranthe guttata]
Length=264

 Score =   338 bits (867),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 163/184 (89%), Positives = 173/184 (94%), Gaps = 3/184 (2%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAG+AVK   STPEFTGN + +MRKTA KP+P SSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGQAVK---STPEFTGNGRISMRKTAAKPKPASSGSPWYGPDRVKYLGPFSGEAPSYLT  69

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETF+KNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFSKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  129

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIW  QVVLMGA+EGYRIAGGPLGE+ DPLYP
Sbjct  130  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWGVQVVLMGAIEGYRIAGGPLGEVVDPLYP  189

Query  656  GGSF  667
            GGSF
Sbjct  190  GGSF  193



>gb|AHB24929.1| chloroplast light-harvesting complex II chlorophyll a/b binding 
protein 1 [Sedum alfredii]
Length=267

 Score =   338 bits (867),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 161/184 (88%), Positives = 170/184 (92%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
             AG+AVK +P+  +  GN+K TMRKTA K +P  S SPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   LAGQAVKLTPTVSDLYGNSKVTMRKTAAKSKPTVSSSPWYGPDRVKYLGPFSGEAPSYLT  72

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  132

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  133  FKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVTDPLYP  192

Query  656  GGSF  667
            GGSF
Sbjct  193  GGSF  196



>ref|XP_008439659.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Cucumis melo]
Length=338

 Score =   341 bits (874),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 166/184 (90%), Positives = 172/184 (93%), Gaps = 2/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
             AGKAVK SP+ PE  G  + TMRKTA K   VSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  86   LAGKAVKLSPNAPEIQGTGRITMRKTATKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLT  143

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  144  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  203

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+TDP+YP
Sbjct  204  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPIYP  263

Query  656  GGSF  667
            GGSF
Sbjct  264  GGSF  267



>gb|AEQ67395.1| chloroplast chlorophyll A/B binding protein [Canarium album]
Length=264

 Score =   338 bits (867),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 165/184 (90%), Positives = 169/184 (92%), Gaps = 3/184 (2%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAVK SPS PE  GN +  MRKT  KP    SGSPWYGPDRVKYLGP SGEPPSYLT
Sbjct  13   FAGKAVKLSPSAPELMGNGRVNMRKTFNKP---PSGSPWYGPDRVKYLGPLSGEPPSYLT  69

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  129

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQV+LMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  130  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGYRIAGGPLGEVTDPLYP  189

Query  656  GGSF  667
            GGSF
Sbjct  190  GGSF  193



>emb|CAJ77391.1| major chlorophyll a/b binding protein LHCb1.1 [Spinacia oleracea]
 emb|CAX64457.1| major chlorophyll a/b binding protein LHCb1.1 precursor [Spinacia 
oleracea]
Length=267

 Score =   338 bits (867),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 159/184 (86%), Positives = 172/184 (93%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            F GKAVK +PST +  G  + +MRK+AGKP+ VSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FGGKAVKLNPSTSDMIGEGRISMRKSAGKPKNVSSGSPWYGPDRVKYLGPFSGEAPSYLT  72

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETF+KNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFSKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQV+LMGAVEGYR+AGGPLGE+ DPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRVAGGPLGEVVDPLYP  192

Query  656  GGSF  667
            GGSF
Sbjct  193  GGSF  196



>ref|XP_010904844.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Elaeis guineensis]
Length=266

 Score =   338 bits (866),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 160/184 (87%), Positives = 169/184 (92%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
             AGKAVK +PS  +  G  + TMRK+ G+  PV S SPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  12   LAGKAVKLAPSASDIIGEGRITMRKSVGRSRPVVSDSPWYGPDRVKYLGPFSGEPPSYLT  71

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  72   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  131

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQV+LMGAVEGYR+AGGPLGE+TDPLYP
Sbjct  132  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGYRVAGGPLGEVTDPLYP  191

Query  656  GGSF  667
            GGSF
Sbjct  192  GGSF  195



>ref|XP_009630190.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic 
[Nicotiana tomentosiformis]
 sp|P27493.1|CB22_TOBAC RecName: Full=Chlorophyll a-b binding protein 21, chloroplastic; 
AltName: Full=LHCII type I CAB-21; Short=LHCP; Flags: Precursor 
[Nicotiana tabacum]
 emb|CAA36957.1| unnamed protein product [Nicotiana tabacum]
Length=265

 Score =   337 bits (865),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 161/184 (88%), Positives = 171/184 (93%), Gaps = 2/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAG+AVK SPS PE TGN + +MRKT  KP  V+S SPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGQAVKLSPSAPEITGNGRVSMRKTVAKP--VASSSPWYGPDRVKYLGPFSGESPSYLT  70

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQV+LMGAVEGYR+AGGPLGE+ DPLYP
Sbjct  131  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRVAGGPLGEVVDPLYP  190

Query  656  GGSF  667
            GGSF
Sbjct  191  GGSF  194



>emb|CAJ77390.1| major chlorophyll a/b binding protein LHCb1.2 [Spinacia oleracea]
Length=267

 Score =   337 bits (865),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 160/184 (87%), Positives = 170/184 (92%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
             AGKA+K  P+  E  G  + TMRKTAGKP+ VSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   LAGKAIKLGPTASEILGEGRVTMRKTAGKPKNVSSGSPWYGPDRVKYLGPFSGEAPSYLT  72

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETF+KNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFSKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQV+LMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRIAGGPLGEVVDPLYP  192

Query  656  GGSF  667
            GGSF
Sbjct  193  GGSF  196



>gb|EYU28187.1| hypothetical protein MIMGU_mgv1a009948mg [Erythranthe guttata]
Length=326

 Score =   340 bits (871),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 177/210 (84%), Positives = 190/210 (90%), Gaps = 3/210 (1%)
 Frame = +2

Query  38   HTSLVFAFHF*RstmaastmalsspsFAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVS  217
            H+  +    F  +TMAAS+MALSSPSFAG+AVK   STPEFTGN + +MRKTA KP+P S
Sbjct  49   HSLQIHILSFDNTTMAASSMALSSPSFAGQAVK---STPEFTGNGRVSMRKTAAKPKPAS  105

Query  218  SGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRW  397
            SGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRW
Sbjct  106  SGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRW  165

Query  398  AMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQ  577
            AMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIW  Q
Sbjct  166  AMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWGVQ  225

Query  578  VVLMGAVEGYRIAGGPLGEITDPLYPGGSF  667
            VVLMGA+EGYRIAGGPLGE+ DPLYPG SF
Sbjct  226  VVLMGAIEGYRIAGGPLGEVVDPLYPGASF  255



>ref|XP_009598574.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=265

 Score =   337 bits (865),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 161/184 (88%), Positives = 171/184 (93%), Gaps = 2/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAG+AVK SPS PE TGN + +MRKT  KP  V+S SPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGQAVKLSPSAPEITGNGRVSMRKTVAKP--VASSSPWYGPDRVKYLGPFSGESPSYLT  70

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQV+LMGAVEGYR+AGGPLGE+ DPLYP
Sbjct  131  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRVAGGPLGEVVDPLYP  190

Query  656  GGSF  667
            GGSF
Sbjct  191  GGSF  194



>gb|AAT08651.1| chloroplast chlorophyll A-B binding protein [Hyacinthus orientalis]
Length=239

 Score =   336 bits (862),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 160/184 (87%), Positives = 172/184 (93%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
             AG AVK +PS+   +G+ +FTMRKTAGKP+ VSSGSPWYGP+RVKYLGPFSGE PSYLT
Sbjct  24   LAGTAVKLTPSSSVVSGDGRFTMRKTAGKPKTVSSGSPWYGPERVKYLGPFSGEAPSYLT  83

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  84   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  143

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYR+AGGPLGE+ DPLYP
Sbjct  144  FKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVLLMGAVEGYRVAGGPLGEVVDPLYP  203

Query  656  GGSF  667
            GGSF
Sbjct  204  GGSF  207



>ref|XP_008356026.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Malus 
domestica]
 ref|XP_008364190.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Malus domestica]
Length=265

 Score =   337 bits (864),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 166/184 (90%), Positives = 171/184 (93%), Gaps = 2/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAV+ SP   E  GN + +MRKTA K   VSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   FAGKAVQLSPGATELFGNGRVSMRKTATKK--VSSGSPWYGPDRVKYLGPFSGEPPSYLT  70

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  130

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QVVLMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  131  FKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVLMGAVEGYRIAGGPLGEVTDPLYP  190

Query  656  GGSF  667
            GGSF
Sbjct  191  GGSF  194



>gb|ABD38707.1| chloroplast chlorophyll a/b binding protein [Pachysandra terminalis]
Length=267

 Score =   337 bits (864),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 161/184 (88%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
             AGKAVK +PS  E  G  + +MRKT G+P+PVSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   LAGKAVKLAPSASELLGVGRVSMRKTGGRPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  72

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  133  FKAGAQIFSEGGLDYLGNPNLVHAQSILAIWATQVLLMGAVEGYRIAGGPLGEVIDPLYP  192

Query  656  GGSF  667
            GGSF
Sbjct  193  GGSF  196



>ref|XP_010685893.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic [Beta 
vulgaris subsp. vulgaris]
Length=267

 Score =   337 bits (864),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 159/184 (86%), Positives = 170/184 (92%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
             AGK +K  P+  E  G  + TMRKTAGKP+P+SSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   LAGKPIKLGPTPSEILGEGRITMRKTAGKPKPISSGSPWYGPDRVKYLGPFSGEAPSYLT  72

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQV+LMGAVEGYR+AGGPLGE+ DPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRVAGGPLGEVVDPLYP  192

Query  656  GGSF  667
            GGSF
Sbjct  193  GGSF  196



>ref|XP_009775649.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic-like 
[Nicotiana sylvestris]
 dbj|BAA25390.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris]
Length=265

 Score =   337 bits (864),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 161/184 (88%), Positives = 171/184 (93%), Gaps = 2/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAG+AVK SPS PE TGN + +MRKT  KP  V+S SPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGQAVKLSPSAPEITGNGRVSMRKTVAKP--VASSSPWYGPDRVKYLGPFSGESPSYLT  70

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFS+GGLDYLGNPSLIHAQSILAIWACQV+LMGAVEGYR+AGGPLGE+ DPLYP
Sbjct  131  FKAGSQIFSDGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGYRVAGGPLGEVVDPLYP  190

Query  656  GGSF  667
            GGSF
Sbjct  191  GGSF  194



>ref|XP_008364191.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Malus domestica]
 ref|XP_009360860.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Pyrus 
x bretschneideri]
Length=264

 Score =   337 bits (863),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 166/184 (90%), Positives = 171/184 (93%), Gaps = 2/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAV+ SP   E  GN + +MRKTA K   VSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  12   FAGKAVQLSPGATELFGNGRVSMRKTATKK--VSSGSPWYGPDRVKYLGPFSGEPPSYLT  69

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  129

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QVVLMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  130  FKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVLMGAVEGYRIAGGPLGEVTDPLYP  189

Query  656  GGSF  667
            GGSF
Sbjct  190  GGSF  193



>ref|XP_004294267.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Fragaria vesca subsp. vesca]
Length=267

 Score =   337 bits (864),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 163/184 (89%), Positives = 169/184 (92%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
             AG+AVK SPST    G  + TMRKTA K + VSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   LAGQAVKLSPSTSTLFGEGRVTMRKTAAKSKNVSSGSPWYGPDRVKYLGPFSGEAPSYLT  72

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  132

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  133  FKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVVDPLYP  192

Query  656  GGSF  667
            GGSF
Sbjct  193  GGSF  196



>sp|P12333.1|CB2A_SPIOL RecName: Full=Chlorophyll a-b binding protein, chloroplastic; 
AltName: Full=LHCII type I CAB; Short=LHCP; Flags: Precursor 
[Spinacia oleracea]
 emb|CAA32526.1| chlorophyll a/b binding protein precursor [Spinacia oleracea]
 emb|CAJ77389.3| major chlorophyll a/b binding protein LHCb1.3 [Spinacia oleracea]
Length=267

 Score =   337 bits (864),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 160/184 (87%), Positives = 168/184 (91%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
             AGKAVK  P+  E  G  + TMRKTAGKP+ V S SPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   LAGKAVKLGPTASEIIGEGRITMRKTAGKPKTVQSSSPWYGPDRVKYLGPFSGESPSYLT  72

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQV+LMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRIAGGPLGEVVDPLYP  192

Query  656  GGSF  667
            GGSF
Sbjct  193  GGSF  196



>ref|XP_010275593.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Nelumbo 
nucifera]
Length=269

 Score =   337 bits (864),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 164/186 (88%), Positives = 171/186 (92%), Gaps = 2/186 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPE--FTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSY  289
             AGKAVK +PS       G  + TMRKT  KP+PVSSGSPWYGPDRVKYLGPFSGEPPSY
Sbjct  13   LAGKAVKLAPSAASELLLGQGRVTMRKTVVKPKPVSSGSPWYGPDRVKYLGPFSGEPPSY  72

Query  290  LTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEA  469
            LTGEFPGDYGWDTAGLSADPETFAKNRELEVIH+RWAMLGALGCVFPELL+RNGVKFGEA
Sbjct  73   LTGEFPGDYGWDTAGLSADPETFAKNRELEVIHARWAMLGALGCVFPELLARNGVKFGEA  132

Query  470  VWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPL  649
            VWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWA QV+LMGAVEGYRIAGGPLGE+TDPL
Sbjct  133  VWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWATQVILMGAVEGYRIAGGPLGEVTDPL  192

Query  650  YPGGSF  667
            YPGGSF
Sbjct  193  YPGGSF  198



>gb|AAB61238.1| chlorophyll a/b-binding protein [Mesembryanthemum crystallinum]
Length=267

 Score =   337 bits (863),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 159/184 (86%), Positives = 170/184 (92%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
             AGKAVK +P+T +  G  + TMRKTAGK + VSS SPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   LAGKAVKLNPTTSQILGEGRITMRKTAGKTKNVSSDSPWYGPDRVKYLGPFSGEAPSYLT  72

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAGAQIFSEGGLDYLGNPSL+HAQSILAIWACQV+LMGA+EGYR+AGGPLGE+ DPLYP
Sbjct  133  FKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAIEGYRVAGGPLGEVIDPLYP  192

Query  656  GGSF  667
            GGSF
Sbjct  193  GGSF  196



>gb|AIR93785.1| chloroplast light harvesting chlorophyll A/B binding protein 
[Kalanchoe fedtschenkoi]
Length=267

 Score =   337 bits (863),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 159/184 (86%), Positives = 170/184 (92%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
             AG+A+K +PS  +  G  + +MRKT  KP+PVSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   LAGQAIKLAPSASDILGEGRISMRKTGAKPKPVSSGSPWYGPDRVKYLGPFSGEAPSYLT  72

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  132

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYR+AGGPLGE+ DPLYP
Sbjct  133  FKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRVAGGPLGEVVDPLYP  192

Query  656  GGSF  667
            GGSF
Sbjct  193  GGSF  196



>ref|XP_008229430.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Prunus mume]
Length=267

 Score =   337 bits (863),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 163/184 (89%), Positives = 168/184 (91%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
             AG+AVK   S     G  + TMRKTA KP+ VSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   LAGQAVKLGSSVSNIVGEGRVTMRKTASKPKNVSSGSPWYGPDRVKYLGPFSGEAPSYLT  72

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  132

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QVVLMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  133  FKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVLMGAVEGYRIAGGPLGEVTDPLYP  192

Query  656  GGSF  667
            GGSF
Sbjct  193  GGSF  196



>gb|ACO51067.1| chloroplast chlorophyll A-B binding protein [Gossypium hirsutum]
Length=264

 Score =   336 bits (862),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 163/184 (89%), Positives = 171/184 (93%), Gaps = 3/184 (2%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAVKFSPSTPE  G  + +MRKT    +PV SGSPWYGPDRV YLGP SGEPPSYLT
Sbjct  13   FAGKAVKFSPSTPEIQGTGRVSMRKTT---KPVPSGSPWYGPDRVLYLGPLSGEPPSYLT  69

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  129

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSLIHAQSILAIWACQV+LMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  130  FKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGYRIAGGPLGEVTDPLYP  189

Query  656  GGSF  667
            GGSF
Sbjct  190  GGSF  193



>gb|KJB69716.1| hypothetical protein B456_011G041600 [Gossypium raimondii]
Length=264

 Score =   336 bits (862),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 163/184 (89%), Positives = 171/184 (93%), Gaps = 3/184 (2%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAVKFSPSTPE  G  + +MRKT    +PV SGSPWYGPDRV YLGP SGEPPSYLT
Sbjct  13   FAGKAVKFSPSTPEIRGTGRVSMRKTT---KPVPSGSPWYGPDRVLYLGPLSGEPPSYLT  69

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  129

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSLIHAQSILAIWACQV+LMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  130  FKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGYRIAGGPLGEVTDPLYP  189

Query  656  GGSF  667
            GGSF
Sbjct  190  GGSF  193



>gb|AGJ50622.1| chlorophyll a/b binding protein [Salicornia brachiata]
Length=267

 Score =   336 bits (862),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 159/184 (86%), Positives = 169/184 (92%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
             AGK +K  P+  E  G  + TMRKTAGKP+ V+SGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   LAGKPIKLGPNAAEILGEGRVTMRKTAGKPKQVASGSPWYGPDRVKYLGPFSGEPPSYLT  72

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GE PGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GELPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSLIHAQSILAIWACQV+LMGAVEGYR+AGGPLGE+ DPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGYRVAGGPLGEVVDPLYP  192

Query  656  GGSF  667
            GGSF
Sbjct  193  GGSF  196



>gb|AAA18529.1| chlorophyll A/B binding protein [Gossypium hirsutum]
Length=264

 Score =   336 bits (861),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 163/184 (89%), Positives = 171/184 (93%), Gaps = 3/184 (2%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAVKFSPSTPE  G  + +MRKT    +PV SGSPWYGPDRV YLGP SGEPPSYLT
Sbjct  13   FAGKAVKFSPSTPEIQGTGRVSMRKTT---KPVPSGSPWYGPDRVLYLGPLSGEPPSYLT  69

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  129

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSLIHAQSILAIWACQV+LMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  130  FKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGYRIAGGPLGEVTDPLYP  189

Query  656  GGSF  667
            GGSF
Sbjct  190  GGSF  193



>ref|XP_009786355.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic-like 
[Nicotiana sylvestris]
 dbj|BAA25388.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris]
Length=265

 Score =   336 bits (861),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 161/184 (88%), Positives = 170/184 (92%), Gaps = 2/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAG+AVK SPS  E TGN + +MRKTA KP  VSS SPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGQAVKLSPSASEITGNGRVSMRKTAAKP--VSSSSPWYGPDRVKYLGPFSGESPSYLT  70

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
             EFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  71   SEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQV+LMGAVEGYR+AGGPLGE+ DPLYP
Sbjct  131  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRVAGGPLGEVVDPLYP  190

Query  656  GGSF  667
            GGSF
Sbjct  191  GGSF  194



>gb|KCW75954.1| hypothetical protein EUGRSUZ_D00322 [Eucalyptus grandis]
Length=358

 Score =   339 bits (870),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 163/184 (89%), Positives = 171/184 (93%), Gaps = 3/184 (2%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAVK SP+TP+  GN + TMRK     +P SSGSPWYGPDR KYLGPFSGEPPSYLT
Sbjct  107  FAGKAVKLSPATPDLLGNGRVTMRKAV---KPASSGSPWYGPDRAKYLGPFSGEPPSYLT  163

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  164  GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  223

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQV+LMGAVEGYR+AGGPLGE+TDPLYP
Sbjct  224  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGYRVAGGPLGEVTDPLYP  283

Query  656  GGSF  667
            GGSF
Sbjct  284  GGSF  287



>ref|XP_008229463.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic-like 
[Prunus mume]
Length=215

 Score =   334 bits (856),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 161/184 (88%), Positives = 167/184 (91%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
             AG+AVK   S     G  + TMRKTA K + VSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   LAGQAVKLGSSVSNIVGEGRVTMRKTASKSKNVSSGSPWYGPDRVKYLGPFSGEAPSYLT  72

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  132

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYR+AGGPLGEITDPLYP
Sbjct  133  FKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRVAGGPLGEITDPLYP  192

Query  656  GGSF  667
            GGSF
Sbjct  193  GGSF  196



>ref|XP_002307725.1| Chlorophyll a-b binding protein 2 [Populus trichocarpa]
 gb|ABK94788.1| unknown [Populus trichocarpa]
 gb|EEE94721.1| Chlorophyll a-b binding protein 2 [Populus trichocarpa]
Length=264

 Score =   336 bits (861),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 164/184 (89%), Positives = 171/184 (93%), Gaps = 3/184 (2%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
             AGKAVK +PS+ E  GN + +MRKT    +PV SGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   LAGKAVKLNPSSSEIMGNGRVSMRKTT---KPVPSGSPWYGPDRVKYLGPFSGEPPSYLT  69

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  129

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWA QVVLMGAVEGYRIAGGPLGE+TDP+YP
Sbjct  130  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWATQVVLMGAVEGYRIAGGPLGEVTDPIYP  189

Query  656  GGSF  667
            GGSF
Sbjct  190  GGSF  193



>ref|XP_002306927.1| Chlorophyll a-b binding protein 2 [Populus trichocarpa]
 gb|ABK95787.1| unknown [Populus trichocarpa]
 gb|ABK96559.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ABK96723.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ABK96730.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE93923.1| Chlorophyll a-b binding protein 2 [Populus trichocarpa]
Length=264

 Score =   336 bits (861),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 164/184 (89%), Positives = 171/184 (93%), Gaps = 3/184 (2%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
             AGKAVK +PS+ E  GN + +MRKT    +PV SGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   LAGKAVKLNPSSSEIMGNGRVSMRKTT---KPVPSGSPWYGPDRVKYLGPFSGEPPSYLT  69

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  129

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWA QVVLMGAVEGYRIAGGPLGE+TDP+YP
Sbjct  130  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWATQVVLMGAVEGYRIAGGPLGEVTDPIYP  189

Query  656  GGSF  667
            GGSF
Sbjct  190  GGSF  193



>emb|CAX64458.1| major chlorophyll a/b binding protein LHCb1.4 precursor [Spinacia 
oleracea]
Length=267

 Score =   336 bits (861),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 159/184 (86%), Positives = 169/184 (92%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
             AGKA+K  P+  E     + TMRKTAGKP+ VSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   LAGKAIKLGPTASEILSEGRVTMRKTAGKPKNVSSGSPWYGPDRVKYLGPFSGEAPSYLT  72

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETF+KNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFSKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQV+LMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRIAGGPLGEVVDPLYP  192

Query  656  GGSF  667
            GGSF
Sbjct  193  GGSF  196



>gb|EYU28186.1| hypothetical protein MIMGU_mgv1a012011mg [Erythranthe guttata]
Length=264

 Score =   335 bits (860),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 162/184 (88%), Positives = 172/184 (93%), Gaps = 3/184 (2%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAG+AVK   STPEFT   +F+MRKTA KP+P SSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGQAVK---STPEFTTTGRFSMRKTAAKPKPASSGSPWYGPDRVKYLGPFSGEAPSYLT  69

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETF+KNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFSKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  129

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIW  QVVLMGA+EGYRIAGGPLGE+ DPLYP
Sbjct  130  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWGVQVVLMGAIEGYRIAGGPLGEVVDPLYP  189

Query  656  GGSF  667
            GGSF
Sbjct  190  GGSF  193



>gb|EYU28185.1| hypothetical protein MIMGU_mgv1a012021mg [Erythranthe guttata]
Length=264

 Score =   335 bits (860),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 162/184 (88%), Positives = 172/184 (93%), Gaps = 3/184 (2%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAG+AVK   STPEFT   +F+MRKTA KP+P +SGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGQAVK---STPEFTTTGRFSMRKTAAKPKPAASGSPWYGPDRVKYLGPFSGEAPSYLT  69

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  129

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIW  QVVLMGA+EGYRIAGGPLGE+ DPLYP
Sbjct  130  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWGVQVVLMGAIEGYRIAGGPLGEVVDPLYP  189

Query  656  GGSF  667
            GGSF
Sbjct  190  GGSF  193



>sp|P04782.1|CB24_PETSP RecName: Full=Chlorophyll a-b binding protein 25, chloroplastic; 
AltName: Full=LHCII type I CAB-25; Short=LHCP; Flags: Precursor 
[Petunia sp.]
 emb|CAA26211.1| unnamed protein product [Petunia sp.]
Length=266

 Score =   335 bits (860),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 162/184 (88%), Positives = 170/184 (92%), Gaps = 1/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAV   PS+ + TGN K TMRKT  K +PVSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGKAVNV-PSSSQITGNGKATMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLT  71

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPEL +RNGVKFGEAVW
Sbjct  72   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELFARNGVKFGEAVW  131

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGE+ DPLYP
Sbjct  132  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVIDPLYP  191

Query  656  GGSF  667
            GGSF
Sbjct  192  GGSF  195



>ref|XP_008371581.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Malus 
domestica]
Length=265

 Score =   335 bits (860),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 165/184 (90%), Positives = 170/184 (92%), Gaps = 2/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAV+ SP   E  GN + +MRKTA K   VSSGSPWYGPDRVKYLGPFSGEPPSYL 
Sbjct  13   FAGKAVQLSPGATELFGNGRVSMRKTATKQ--VSSGSPWYGPDRVKYLGPFSGEPPSYLK  70

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  130

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QVVLMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  131  FKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVLMGAVEGYRIAGGPLGEVTDPLYP  190

Query  656  GGSF  667
            GGSF
Sbjct  191  GGSF  194



>dbj|BAA25389.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris]
Length=265

 Score =   335 bits (860),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 161/184 (88%), Positives = 170/184 (92%), Gaps = 2/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAG+AVK SPS  E TGN + +MRKT  KP  V+S SPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGQAVKLSPSASEITGNGRVSMRKTVAKP--VASSSPWYGPDRVKYLGPFSGESPSYLT  70

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSLIHAQSILAIWACQV+LMGAVEGYR+AGGPLGE+ DPLYP
Sbjct  131  FKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGYRVAGGPLGEVVDPLYP  190

Query  656  GGSF  667
            GGSF
Sbjct  191  GGSF  194



>ref|XP_009598577.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=265

 Score =   335 bits (860),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 161/184 (88%), Positives = 170/184 (92%), Gaps = 2/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAG+AVK SPS  E TGN + +MRKT  KP  V+S SPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGQAVKLSPSASEITGNGRVSMRKTVAKP--VASSSPWYGPDRVKYLGPFSGESPSYLT  70

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSLIHAQSILAIWACQV+LMGAVEGYR+AGGPLGE+ DPLYP
Sbjct  131  FKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGYRVAGGPLGEVVDPLYP  190

Query  656  GGSF  667
            GGSF
Sbjct  191  GGSF  194



>ref|XP_008356022.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Malus domestica]
Length=265

 Score =   335 bits (859),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 165/184 (90%), Positives = 170/184 (92%), Gaps = 2/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAV+ SP   E  GN + +MRKTA K   VSSGSPWYGPDRVKYLGPFSGEPPSYL 
Sbjct  13   FAGKAVQLSPGATELFGNGRVSMRKTATKQ--VSSGSPWYGPDRVKYLGPFSGEPPSYLK  70

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  130

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QVVLMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  131  FKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVLMGAVEGYRIAGGPLGEVTDPLYP  190

Query  656  GGSF  667
            GGSF
Sbjct  191  GGSF  194



>gb|AHM26643.1| a-b binding protein [Pyrus x bretschneideri]
Length=264

 Score =   335 bits (859),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 165/184 (90%), Positives = 170/184 (92%), Gaps = 2/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAV+ SP   E  GN + +MRKTA K   VSSGSPWYGPDRVKYLGPFSGEPPSYL 
Sbjct  12   FAGKAVQLSPGATELFGNGRVSMRKTATKQ--VSSGSPWYGPDRVKYLGPFSGEPPSYLK  69

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  129

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QVVLMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  130  FKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVLMGAVEGYRIAGGPLGEVTDPLYP  189

Query  656  GGSF  667
            GGSF
Sbjct  190  GGSF  193



>ref|XP_008364187.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Malus domestica]
Length=265

 Score =   335 bits (859),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 165/184 (90%), Positives = 170/184 (92%), Gaps = 2/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAV+ SP   E  GN + +MRKTA K   VSSGSPWYGPDRVKYLGPFSGEPPSYL 
Sbjct  13   FAGKAVQLSPGATELFGNGRVSMRKTATKQ--VSSGSPWYGPDRVKYLGPFSGEPPSYLK  70

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  130

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QVVLMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  131  FKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVLMGAVEGYRIAGGPLGEVTDPLYP  190

Query  656  GGSF  667
            GGSF
Sbjct  191  GGSF  194



>gb|AAB61237.1| chlorophyll a/b-binding protein [Mesembryanthemum crystallinum]
Length=267

 Score =   335 bits (859),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 158/184 (86%), Positives = 168/184 (91%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
             AGK VK +P+  E  G  + TMRKTAGK + VSS SPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   LAGKMVKLAPTASEILGEGRITMRKTAGKTKSVSSDSPWYGPDRVKYLGPFSGESPSYLT  72

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETF KNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFTKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAGAQIFSEGGLDYLGNPSL+HAQSILAIWACQV+LMGA+EGYR+AGGPLGE+TDPLYP
Sbjct  133  FKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAIEGYRVAGGPLGEVTDPLYP  192

Query  656  GGSF  667
            GGSF
Sbjct  193  GGSF  196



>ref|XP_009775650.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic 
[Nicotiana sylvestris]
Length=265

 Score =   335 bits (859),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 160/184 (87%), Positives = 170/184 (92%), Gaps = 2/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAG+AVK SPS  E TGN + +MRKT  KP  V+S SPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGQAVKLSPSASEITGNGRVSMRKTVAKP--VASSSPWYGPDRVKYLGPFSGESPSYLT  70

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQV+LMGAVEGYR+AGGPLGE+ DPLYP
Sbjct  131  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRVAGGPLGEVVDPLYP  190

Query  656  GGSF  667
            GGSF
Sbjct  191  GGSF  194



>gb|ACN41907.1| chlorophyll A/B binding protein [Gardenia jasminoides]
Length=264

 Score =   335 bits (858),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 161/184 (88%), Positives = 170/184 (92%), Gaps = 3/184 (2%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAG+AVK SPS PE  GN + +M++T     PVSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   FAGQAVKLSPSAPELMGNGRISMKRTT---RPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  69

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAM GALGCVFPELLSRNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMPGALGCVFPELLSRNGVKFGEAVW  129

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIF EGGLDYLGNPSLIHAQSILAIWACQV+LMGAVEGYRIAGGPLGE+TDP+YP
Sbjct  130  FKAGSQIFQEGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGYRIAGGPLGEVTDPIYP  189

Query  656  GGSF  667
            GGSF
Sbjct  190  GGSF  193



>ref|XP_010052094.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Eucalyptus grandis]
Length=400

 Score =   340 bits (871),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 164/184 (89%), Positives = 171/184 (93%), Gaps = 2/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
             AG+AVK SPSTPE  GN + +MRK   KP  VSSGSPWYGPDR KYLGPFSGEPPSYLT
Sbjct  13   LAGQAVKLSPSTPELLGNGRISMRKAVRKP--VSSGSPWYGPDRAKYLGPFSGEPPSYLT  70

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAGAQIFSEGGLDYLGNP+LIHAQSILAIWACQV+LMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  131  FKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVILMGAVEGYRIAGGPLGEVTDPLYP  190

Query  656  GGSF  667
            GGSF
Sbjct  191  GGSF  194


 Score =   135 bits (341),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 75/136 (55%), Positives = 87/136 (64%), Gaps = 20/136 (15%)
 Frame = +2

Query  320  WDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNG----------VKFGEA  469
            +D  GL+ DPE FA+ +  E+ + R AM    G     +++  G                
Sbjct  194  FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVSNN  253

Query  470  VW----------FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAG  619
             W          F AGAQIFSEGGLDYLGNP+LIHAQSILAIWACQV+LMGAVEGYRIAG
Sbjct  254  AWAYATNFVPGNFFAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVILMGAVEGYRIAG  313

Query  620  GPLGEITDPLYPGGSF  667
            GPLGE+TDPLYPGGSF
Sbjct  314  GPLGEVTDPLYPGGSF  329



>ref|XP_009775645.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic-like 
[Nicotiana sylvestris]
 dbj|BAA25391.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris]
Length=265

 Score =   335 bits (858),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 160/184 (87%), Positives = 170/184 (92%), Gaps = 2/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAG+AVK SPS  E TGN + +MRKT  KP  V+S SPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGQAVKLSPSASEITGNGRVSMRKTVAKP--VASSSPWYGPDRVKYLGPFSGEAPSYLT  70

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQV+LMGAVEGYR+AGGPLGE+ DPLYP
Sbjct  131  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRVAGGPLGEVVDPLYP  190

Query  656  GGSF  667
            GGSF
Sbjct  191  GGSF  194



>ref|XP_008366007.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Malus 
domestica]
Length=265

 Score =   335 bits (858),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 165/184 (90%), Positives = 170/184 (92%), Gaps = 2/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAV+ SP   E  GN + +MRK A K   VSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   FAGKAVQLSPGATELFGNGRVSMRKXATKK--VSSGSPWYGPDRVKYLGPFSGEPPSYLT  70

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  130

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QVVLMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  131  FKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVLMGAVEGYRIAGGPLGEVTDPLYP  190

Query  656  GGSF  667
            GGSF
Sbjct  191  GGSF  194



>gb|KJB57287.1| hypothetical protein B456_009G156900 [Gossypium raimondii]
Length=265

 Score =   335 bits (858),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 162/184 (88%), Positives = 170/184 (92%), Gaps = 2/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAVK SPS P+  GN + +MRKTA K  P  SGSPWYGPDRV YLGP SGEPPSYLT
Sbjct  13   FAGKAVKLSPSAPKIQGNGRVSMRKTATKAAP--SGSPWYGPDRVLYLGPLSGEPPSYLT  70

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSLIHAQSILAIWACQV+LMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  131  FKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGYRIAGGPLGEVTDPLYP  190

Query  656  GGSF  667
            GGSF
Sbjct  191  GGSF  194



>gb|AAA80593.1| chlorophyll a/b binding protein [Solanum tuberosum]
Length=265

 Score =   334 bits (857),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 162/184 (88%), Positives = 168/184 (91%), Gaps = 2/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAG+AVK SPST E TGN + TMRK   K  P  S SPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGQAVKLSPSTSEITGNGRITMRKAVAKSAP--SSSPWYGPDRVKYLGPFSGESPSYLT  70

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  131  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVIDPLYP  190

Query  656  GGSF  667
            GGSF
Sbjct  191  GGSF  194



>ref|XP_007211864.1| hypothetical protein PRUPE_ppa010081mg [Prunus persica]
 ref|XP_008225346.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Prunus mume]
 gb|EMJ13063.1| hypothetical protein PRUPE_ppa010081mg [Prunus persica]
Length=265

 Score =   334 bits (857),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 164/184 (89%), Positives = 170/184 (92%), Gaps = 2/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAV+ +P   E  GN + +MRKT  K   VSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   FAGKAVQLAPGATELFGNGRVSMRKTGAKQ--VSSGSPWYGPDRVKYLGPFSGEPPSYLT  70

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  130

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QVVLMGAVEGYRIAGGPLGEITDPLYP
Sbjct  131  FKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVLMGAVEGYRIAGGPLGEITDPLYP  190

Query  656  GGSF  667
            GGSF
Sbjct  191  GGSF  194



>ref|XP_007211869.1| hypothetical protein PRUPE_ppa010099mg [Prunus persica]
 ref|XP_008225347.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Prunus 
mume]
 gb|EMJ13068.1| hypothetical protein PRUPE_ppa010099mg [Prunus persica]
Length=264

 Score =   334 bits (857),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 164/184 (89%), Positives = 170/184 (92%), Gaps = 2/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAV+ +P   E  GN + +MRKT  K   VSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  12   FAGKAVQLAPGATELFGNGRVSMRKTGAKQ--VSSGSPWYGPDRVKYLGPFSGEPPSYLT  69

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  129

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QVVLMGAVEGYRIAGGPLGEITDPLYP
Sbjct  130  FKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVLMGAVEGYRIAGGPLGEITDPLYP  189

Query  656  GGSF  667
            GGSF
Sbjct  190  GGSF  193



>ref|XP_009416547.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Musa acuminata subsp. malaccensis]
 gb|ABF69952.1| chlorophyll A-B binding protein (CAB), putative [Musa acuminata]
Length=265

 Score =   334 bits (857),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 163/184 (89%), Positives = 168/184 (91%), Gaps = 1/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAVK +PS     G  + TMRK  GKP   SSGSPWYGPDRVKYLGP SGEPPSYLT
Sbjct  12   FAGKAVKLAPSASGVLGQGRVTMRKAGGKPA-ASSGSPWYGPDRVKYLGPLSGEPPSYLT  70

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQV+LMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  131  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGYRIAGGPLGEVTDPLYP  190

Query  656  GGSF  667
            GGSF
Sbjct  191  GGSF  194



>ref|XP_007217260.1| hypothetical protein PRUPE_ppa010015mg [Prunus persica]
 gb|AAA50310.1| light-harvesting chlorophyll a/b-binding protein [Prunus persica]
 gb|EMJ18459.1| hypothetical protein PRUPE_ppa010015mg [Prunus persica]
Length=267

 Score =   334 bits (857),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 161/184 (88%), Positives = 167/184 (91%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
             AG+AVK   S     G  + TMRKTA K + VSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   LAGQAVKLGSSVSNIVGEGRITMRKTASKSKNVSSGSPWYGPDRVKYLGPFSGEAPSYLT  72

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  132

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYR+AGGPLGEITDPLYP
Sbjct  133  FKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRVAGGPLGEITDPLYP  192

Query  656  GGSF  667
            GGSF
Sbjct  193  GGSF  196



>gb|ABF70112.1| chlorophyll A-B binding protein (CAB), putative [Musa balbisiana]
Length=267

 Score =   334 bits (857),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 161/185 (87%), Positives = 170/185 (92%), Gaps = 1/185 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVS-SGSPWYGPDRVKYLGPFSGEPPSYL  292
             AGKAVK +PS  +  G  + TMRK+  K +P + SGSPWYGPDRVKYLGPFSGEPPSYL
Sbjct  12   LAGKAVKLAPSASDVLGEGRVTMRKSTAKAKPAAASGSPWYGPDRVKYLGPFSGEPPSYL  71

Query  293  TGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAV  472
            TGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAV
Sbjct  72   TGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAV  131

Query  473  WFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLY  652
            WFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQV+LMGAVEGYRIAGGPLGE+TDPLY
Sbjct  132  WFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGYRIAGGPLGEVTDPLY  191

Query  653  PGGSF  667
            PGGSF
Sbjct  192  PGGSF  196



>ref|XP_008371583.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Malus domestica]
 ref|XP_008356023.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Malus domestica]
 ref|XP_008364186.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Malus domestica]
Length=291

 Score =   335 bits (859),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 165/184 (90%), Positives = 170/184 (92%), Gaps = 2/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAV+ SP   E  GN + +MRKTA K   VSSGSPWYGPDRVKYLGPFSGEPPSYL 
Sbjct  39   FAGKAVQLSPGATELFGNGRVSMRKTATKQ--VSSGSPWYGPDRVKYLGPFSGEPPSYLK  96

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  97   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  156

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QVVLMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  157  FKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVLMGAVEGYRIAGGPLGEVTDPLYP  216

Query  656  GGSF  667
            GGSF
Sbjct  217  GGSF  220



>ref|XP_006467509.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
[Citrus sinensis]
Length=264

 Score =   334 bits (856),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 163/184 (89%), Positives = 169/184 (92%), Gaps = 2/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            F GKAV  +PS  E +   + +MRKTA K   VSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  12   FVGKAVNLAPSGNELSNGGRISMRKTASKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLT  69

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  129

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  130  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYP  189

Query  656  GGSF  667
            GGSF
Sbjct  190  GGSF  193



>ref|XP_008229429.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Prunus mume]
Length=267

 Score =   334 bits (856),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 161/184 (88%), Positives = 167/184 (91%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
             AG+AVK   S     G  + TMRKTA K + VSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   LAGQAVKLGSSVSNIVGEGRVTMRKTASKSKNVSSGSPWYGPDRVKYLGPFSGEAPSYLT  72

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  132

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYR+AGGPLGEITDPLYP
Sbjct  133  FKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRVAGGPLGEITDPLYP  192

Query  656  GGSF  667
            GGSF
Sbjct  193  GGSF  196



>ref|XP_010231410.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Brachypodium 
distachyon]
Length=266

 Score =   333 bits (855),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 163/184 (89%), Positives = 171/184 (93%), Gaps = 1/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAVK  PS+  F G A+ TMRKTA K +PVSSGSPWYG DRV YLGP SGEPPSYLT
Sbjct  13   FAGKAVKNLPSSALF-GEARVTMRKTAAKAKPVSSGSPWYGSDRVLYLGPLSGEPPSYLT  71

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELE+IHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  72   GEFPGDYGWDTAGLSADPETFAKNRELELIHSRWAMLGALGCVFPELLARNGVKFGEAVW  131

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGEI DPLYP
Sbjct  132  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEIVDPLYP  191

Query  656  GGSF  667
            GGSF
Sbjct  192  GGSF  195



>gb|AAA33396.1| light-harvesting chlorophyll a/b protein precursor [Lemna gibba]
Length=266

 Score =   333 bits (855),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 159/184 (86%), Positives = 170/184 (92%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
              GKAVK +P+  E  G  + +MRKTAGKP+PVSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  12   LVGKAVKLAPAASEVFGEGRVSMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEAPSYLT  71

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEF GDYGWDTAGLSADPETFAKNRELEVIH+RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  72   GEFAGDYGWDTAGLSADPETFAKNRELEVIHARWAMLGALGCVFPELLARNGVKFGEAVW  131

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWA QVVLMGAVEGYR+AGGPLGE+ DPLYP
Sbjct  132  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVVLMGAVEGYRVAGGPLGEVVDPLYP  191

Query  656  GGSF  667
            GGSF
Sbjct  192  GGSF  195



>gb|AAO45885.1| chlorophyll a/b-binding protein precursor [Citrus limon]
Length=216

 Score =   332 bits (850),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 162/184 (88%), Positives = 168/184 (91%), Gaps = 2/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            F GKAV  +PS  E +   + +MRKT  K   VSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  12   FVGKAVNLAPSGNELSNGGRISMRKTGSKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLT  69

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  129

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  130  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYP  189

Query  656  GGSF  667
            GGSF
Sbjct  190  GGSF  193



>gb|ACR08639.1| chloroplast chlorophyll A/B binding protein [Mangifera indica]
Length=264

 Score =   333 bits (854),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 161/184 (88%), Positives = 170/184 (92%), Gaps = 3/184 (2%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAVK SP+  E  GN + +MR+TA   +P  SGSPWYGPDRVKYL PFSGEPPSYLT
Sbjct  13   FAGKAVKLSPAPRELMGNGRVSMRRTA---KPTPSGSPWYGPDRVKYLSPFSGEPPSYLT  69

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  129

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQV+LMGAVEGYR+AGGPLGE+TDPLYP
Sbjct  130  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGYRVAGGPLGEVTDPLYP  189

Query  656  GGSF  667
            GGSF
Sbjct  190  GGSF  193



>ref|NP_001266111.1| chlorophyll a-b binding protein AB80, chloroplastic-like [Cicer 
arietinum]
 emb|CAA10284.1| chlorophyll a/b binding protein [Cicer arietinum]
Length=266

 Score =   333 bits (854),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 163/184 (89%), Positives = 171/184 (93%), Gaps = 1/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
             AGK VK SPS+ E  G ++FTMRK+A   +  SSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   LAGKPVKLSPSSQEL-GASRFTMRKSATTKKVASSGSPWYGPDRVKYLGPFSGEPPSYLT  71

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  72   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  131

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWA QVVLMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  132  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVVLMGAVEGYRIAGGPLGEVTDPLYP  191

Query  656  GGSF  667
            GGSF
Sbjct  192  GGSF  195



>gb|AAB61236.1| chlorophyll a/b-binding protein [Mesembryanthemum crystallinum]
Length=267

 Score =   333 bits (854),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 159/184 (86%), Positives = 168/184 (91%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAVK SP+  E  G  + TMRK AGK +  +  SPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGKAVKLSPTASETLGEGRITMRKAAGKSKVATIDSPWYGPDRVKYLGPFSGESPSYLT  72

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAGAQIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGA+EGYR+AGGPLGE+TDPLYP
Sbjct  133  FKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAIEGYRVAGGPLGEVTDPLYP  192

Query  656  GGSF  667
            GGSF
Sbjct  193  GGSF  196



>ref|XP_007025148.1| Chlorophyll a-b binding protein, chloroplastic [Theobroma cacao]
 gb|EOY27770.1| Chlorophyll a-b binding protein, chloroplastic [Theobroma cacao]
Length=264

 Score =   333 bits (854),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 162/184 (88%), Positives = 171/184 (93%), Gaps = 3/184 (2%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKA+KFSPSTPE  G+ + +MRKT  KP    SGSPWYGPDRV YLGP SG+PPSYLT
Sbjct  13   FAGKALKFSPSTPEIQGSGRVSMRKTGTKP---PSGSPWYGPDRVLYLGPLSGDPPSYLT  69

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  129

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  130  FKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYP  189

Query  656  GGSF  667
            GGSF
Sbjct  190  GGSF  193



>gb|EYU38943.1| hypothetical protein MIMGU_mgv1a012024mg [Erythranthe guttata]
Length=264

 Score =   333 bits (854),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 161/184 (88%), Positives = 172/184 (93%), Gaps = 3/184 (2%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAG+AVK   STPE TGN + +MRKTA KP+P SSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGQAVK---STPEITGNGRISMRKTAAKPKPASSGSPWYGPDRVKYLGPFSGEAPSYLT  69

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETF+KNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFSKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  129

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIW  QV+LMGAVEGYRIAGGPLG++ DPLYP
Sbjct  130  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWGFQVLLMGAVEGYRIAGGPLGDVVDPLYP  189

Query  656  GGSF  667
            GGSF
Sbjct  190  GGSF  193



>gb|KDP37944.1| hypothetical protein JCGZ_04587 [Jatropha curcas]
Length=260

 Score =   333 bits (853),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 164/184 (89%), Positives = 169/184 (92%), Gaps = 2/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
             AGKAVK  PS PE  GN + TMRKTA K   VSSGSPWYGPD VK LGPFSGEPPSYLT
Sbjct  8    LAGKAVKLGPSPPELMGNGRVTMRKTASKN--VSSGSPWYGPDGVKNLGPFSGEPPSYLT  65

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  66   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  125

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYR+AGGPLGE+TDP+YP
Sbjct  126  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVTDPIYP  185

Query  656  GGSF  667
            GGSF
Sbjct  186  GGSF  189



>ref|XP_009389379.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Musa acuminata subsp. malaccensis]
Length=267

 Score =   333 bits (854),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 160/185 (86%), Positives = 170/185 (92%), Gaps = 1/185 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVS-SGSPWYGPDRVKYLGPFSGEPPSYL  292
             AGKAVK +PS  +  G  + TMRK+  K +P + SGSPWYGPDRVKYLGPFSGEPPSYL
Sbjct  12   LAGKAVKLAPSASDVLGEGRVTMRKSTAKAKPAAASGSPWYGPDRVKYLGPFSGEPPSYL  71

Query  293  TGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAV  472
            TGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAV
Sbjct  72   TGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAV  131

Query  473  WFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLY  652
            WFKAG+QIFSEGGLDYLGNPSLIHAQSILAIWACQV+LMGAVEGYRIAGGPLGE+TDPLY
Sbjct  132  WFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGYRIAGGPLGEVTDPLY  191

Query  653  PGGSF  667
            PGGSF
Sbjct  192  PGGSF  196



>ref|XP_007215816.1| hypothetical protein PRUPE_ppa010034mg [Prunus persica]
 gb|EMJ17015.1| hypothetical protein PRUPE_ppa010034mg [Prunus persica]
Length=267

 Score =   333 bits (854),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 160/184 (87%), Positives = 167/184 (91%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
             AG+AVK   S     G  + TMRKTA + + VSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   LAGQAVKLGSSVSNIVGEGRVTMRKTASRSKNVSSGSPWYGPDRVKYLGPFSGEAPSYLT  72

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  132

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  133  FKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVTDPLYP  192

Query  656  GGSF  667
            GGSF
Sbjct  193  GGSF  196



>ref|XP_006365560.1| PREDICTED: chlorophyll a-b binding protein 1B, chloroplastic-like 
[Solanum tuberosum]
Length=265

 Score =   333 bits (853),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 161/184 (88%), Positives = 167/184 (91%), Gaps = 2/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAG+AVK SPS  E TGN + TMRK   K  P  S SPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGQAVKLSPSASEITGNGRITMRKAVAKSAP--SSSPWYGPDRVKYLGPFSGESPSYLT  70

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  131  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYP  190

Query  656  GGSF  667
            GGSF
Sbjct  191  GGSF  194



>ref|XP_007025143.1| Chlorophyll a-b binding protein, chloroplastic [Theobroma cacao]
 gb|EOY27765.1| Chlorophyll a-b binding protein, chloroplastic [Theobroma cacao]
Length=264

 Score =   333 bits (853),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 162/184 (88%), Positives = 169/184 (92%), Gaps = 3/184 (2%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAVK SP TPE  GN + +MRKT  +P    SGSPWYGPDRV YLGP SGEPPSYLT
Sbjct  13   FAGKAVKLSPLTPEIQGNGRVSMRKTGTRP---PSGSPWYGPDRVLYLGPLSGEPPSYLT  69

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  129

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  130  FKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYP  189

Query  656  GGSF  667
            GGSF
Sbjct  190  GGSF  193



>ref|XP_006365573.1| PREDICTED: chlorophyll a-b binding protein 1B, chloroplastic-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006365574.1| PREDICTED: chlorophyll a-b binding protein 1B, chloroplastic-like 
isoform X2 [Solanum tuberosum]
Length=265

 Score =   333 bits (853),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 161/184 (88%), Positives = 167/184 (91%), Gaps = 2/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAG+AVK SPS  E TGN + TMRK   K  P  S SPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGQAVKLSPSASEITGNGRITMRKAVAKSAP--SSSPWYGPDRVKYLGPFSGESPSYLT  70

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  131  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYP  190

Query  656  GGSF  667
            GGSF
Sbjct  191  GGSF  194



>gb|EYU28183.1| hypothetical protein MIMGU_mgv1a012019mg [Erythranthe guttata]
 gb|EYU28188.1| hypothetical protein MIMGU_mgv1a012022mg [Erythranthe guttata]
Length=264

 Score =   333 bits (853),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 160/184 (87%), Positives = 171/184 (93%), Gaps = 3/184 (2%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAG+AVK   STPEFT + + +MRKTA KP+P +S SPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGQAVK---STPEFTSSGRISMRKTAAKPKPAASSSPWYGPDRVKYLGPFSGEAPSYLT  69

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  129

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIW  QVVLMGA+EGYRIAGGPLGE+ DPLYP
Sbjct  130  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWGVQVVLMGAIEGYRIAGGPLGEVVDPLYP  189

Query  656  GGSF  667
            GGSF
Sbjct  190  GGSF  193



>gb|AAA80591.1| chlorophyll a/b binding protein [Solanum tuberosum]
Length=265

 Score =   333 bits (853),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 161/184 (88%), Positives = 167/184 (91%), Gaps = 2/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAG+AVK SPS  E +GN + TMRK   K  P  S SPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGQAVKLSPSASEISGNGRITMRKAVAKSAP--SSSPWYGPDRVKYLGPFSGESPSYLT  70

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLSRNGVKFGEAVW  130

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  131  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYP  190

Query  656  GGSF  667
            GGSF
Sbjct  191  GGSF  194



>ref|NP_001240146.1| chlorophyll a-b binding protein 21, chloroplastic-like [Glycine 
max]
 gb|AAA50172.1| photosystem II type I chlorophyll a/b-binding protein [Glycine 
max]
 gb|ACU18421.1| unknown [Glycine max]
 gb|KHN41285.1| Chlorophyll a-b binding protein 21, chloroplastic [Glycine soja]
Length=264

 Score =   332 bits (852),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 163/184 (89%), Positives = 172/184 (93%), Gaps = 3/184 (2%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
             AG+A+K +PSTPE  G  + +MRKTA K   VSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   LAGQAIKLAPSTPEL-GVGRVSMRKTASKT--VSSGSPWYGPDRVKYLGPFSGEPPSYLT  69

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  129

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSLIHAQSILAIWA QV+LMGAVEGYRIAGGPLGE+TDP+YP
Sbjct  130  FKAGSQIFSEGGLDYLGNPSLIHAQSILAIWATQVILMGAVEGYRIAGGPLGEVTDPIYP  189

Query  656  GGSF  667
            GGSF
Sbjct  190  GGSF  193



>ref|XP_006449645.1| hypothetical protein CICLE_v10016286mg [Citrus clementina]
 gb|ESR62885.1| hypothetical protein CICLE_v10016286mg [Citrus clementina]
Length=264

 Score =   332 bits (852),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 163/184 (89%), Positives = 168/184 (91%), Gaps = 2/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            F GKAV  +PS  E     + +MRKTA K   VSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  12   FVGKAVNLAPSGNELGNGGRISMRKTASKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLT  69

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  129

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  130  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYP  189

Query  656  GGSF  667
            GGSF
Sbjct  190  GGSF  193



>ref|XP_006449644.1| hypothetical protein CICLE_v10016074mg [Citrus clementina]
 gb|ESR62884.1| hypothetical protein CICLE_v10016074mg [Citrus clementina]
Length=303

 Score =   333 bits (855),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 162/184 (88%), Positives = 168/184 (91%), Gaps = 2/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            F GKAV  +PS  E +   + +MRKT  K   VSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  51   FVGKAVNLAPSGNELSNGGRISMRKTGSKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLT  108

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  109  GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  168

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  169  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYP  228

Query  656  GGSF  667
            GGSF
Sbjct  229  GGSF  232



>ref|XP_009377335.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Pyrus x bretschneideri]
Length=267

 Score =   332 bits (852),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 157/184 (85%), Positives = 168/184 (91%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
             +G+AVK +PS+    G  + TMRKTA K + VSSGSPWYGPDR KYLGPFSGE PSYLT
Sbjct  13   LSGQAVKLNPSSSNLLGEGRVTMRKTAAKSKKVSSGSPWYGPDRAKYLGPFSGESPSYLT  72

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGC+FPELLSRNGVKFGEA W
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCIFPELLSRNGVKFGEATW  132

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAGAQIFS+GGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYR+AGGPLGEITDPLYP
Sbjct  133  FKAGAQIFSQGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRVAGGPLGEITDPLYP  192

Query  656  GGSF  667
            GGSF
Sbjct  193  GGSF  196



>ref|XP_009598575.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=265

 Score =   332 bits (851),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 160/184 (87%), Positives = 169/184 (92%), Gaps = 2/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAG+AVK SPS  E TG  + +MRKT  KP  V+S SPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGQAVKLSPSASEITGYGRVSMRKTVAKP--VASSSPWYGPDRVKYLGPFSGESPSYLT  70

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQV+LMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  131  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRIAGGPLGEVVDPLYP  190

Query  656  GGSF  667
            GGSF
Sbjct  191  GGSF  194



>ref|XP_006449643.1| hypothetical protein CICLE_v10016287mg [Citrus clementina]
 ref|XP_006467513.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
isoform X1 [Citrus sinensis]
 ref|XP_006467514.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
isoform X2 [Citrus sinensis]
 gb|ESR62883.1| hypothetical protein CICLE_v10016287mg [Citrus clementina]
 gb|KDO78114.1| hypothetical protein CISIN_1g024654mg [Citrus sinensis]
Length=264

 Score =   332 bits (850),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 162/184 (88%), Positives = 168/184 (91%), Gaps = 2/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            F GKAV  +PS  E +   + +MRKT  K   VSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  12   FVGKAVNLAPSGNELSNGGRISMRKTGSKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLT  69

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  129

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  130  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYP  189

Query  656  GGSF  667
            GGSF
Sbjct  190  GGSF  193



>ref|XP_011045092.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Populus 
euphratica]
Length=263

 Score =   332 bits (850),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 164/184 (89%), Positives = 171/184 (93%), Gaps = 4/184 (2%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
             AGKAVK +PS+ E  GN + +MRKT    +PV SGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   LAGKAVKLNPSSSEI-GNGRISMRKTT---KPVPSGSPWYGPDRVKYLGPFSGEPPSYLT  68

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  69   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  128

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWA QVVLMGAVEGYRIAGGPLGE+TDP+YP
Sbjct  129  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWATQVVLMGAVEGYRIAGGPLGEVTDPIYP  188

Query  656  GGSF  667
            GGSF
Sbjct  189  GGSF  192



>ref|XP_006365572.1| PREDICTED: chlorophyll a-b binding protein 1B, chloroplastic-like 
[Solanum tuberosum]
 gb|AAA80589.1| chlorophyll a/b binding protein [Solanum tuberosum]
Length=265

 Score =   332 bits (850),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 160/184 (87%), Positives = 167/184 (91%), Gaps = 2/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAG+AVK SPS  E +GN + TMRK   K  P  S SPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGQAVKLSPSASEISGNGRITMRKAVAKSAP--SSSPWYGPDRVKYLGPFSGESPSYLT  70

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  131  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYP  190

Query  656  GGSF  667
            GGSF
Sbjct  191  GGSF  194



>ref|XP_004233096.1| PREDICTED: chlorophyll a-b binding protein 1C, chloroplastic 
[Solanum lycopersicum]
 ref|XP_004233099.1| PREDICTED: chlorophyll a-b binding protein 1C, chloroplastic 
[Solanum lycopersicum]
 ref|XP_004233100.1| PREDICTED: chlorophyll a-b binding protein 1C, chloroplastic 
[Solanum lycopersicum]
 ref|XP_010316910.1| PREDICTED: chlorophyll a-b binding protein 1C, chloroplastic 
[Solanum lycopersicum]
 ref|XP_010316913.1| PREDICTED: chlorophyll a-b binding protein 1C, chloroplastic 
[Solanum lycopersicum]
 sp|P07370.1|CB2B_SOLLC RecName: Full=Chlorophyll a-b binding protein 1B, chloroplastic; 
AltName: Full=LHCII type I CAB-1B; Short=LHCP; Flags: Precursor 
[Solanum lycopersicum]
 gb|AAA34147.1| chlorophyll a/b-binding protein Cab-1B [Solanum lycopersicum]
Length=265

 Score =   332 bits (850),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 160/184 (87%), Positives = 167/184 (91%), Gaps = 2/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAG+AVK SPS  E +GN + TMRK   K  P  S SPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGQAVKLSPSASEISGNGRITMRKAVAKSAP--SSSPWYGPDRVKYLGPFSGESPSYLT  70

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  131  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYP  190

Query  656  GGSF  667
            GGSF
Sbjct  191  GGSF  194



>ref|XP_006368026.1| PREDICTED: chlorophyll a-b binding protein 1B, chloroplastic-like 
[Solanum tuberosum]
Length=265

 Score =   331 bits (849),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 160/184 (87%), Positives = 167/184 (91%), Gaps = 2/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAG+AVK SPS  E +GN + TMRK   K  P  S SPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGQAVKLSPSASEISGNGRITMRKAVSKSAP--SSSPWYGPDRVKYLGPFSGESPSYLT  70

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  131  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYP  190

Query  656  GGSF  667
            GGSF
Sbjct  191  GGSF  194



>emb|CDP06328.1| unnamed protein product [Coffea canephora]
Length=264

 Score =   331 bits (849),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 158/184 (86%), Positives = 170/184 (92%), Gaps = 3/184 (2%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAVK +PS PE  GN + +M++T+    P  SGSPWYGPDRVKYLGPFSG+PPSYLT
Sbjct  13   FAGKAVKLNPSAPELMGNGRISMKRTS---RPAPSGSPWYGPDRVKYLGPFSGDPPSYLT  69

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLSRNGVKFGEAVW  129

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIF EGGL+YLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLG++TDP+YP
Sbjct  130  FKAGSQIFQEGGLNYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGDVTDPIYP  189

Query  656  GGSF  667
            GGSF
Sbjct  190  GGSF  193



>ref|XP_010926397.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Elaeis guineensis]
Length=264

 Score =   331 bits (849),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 161/184 (88%), Positives = 168/184 (91%), Gaps = 2/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
             AGKAVK +PS     GN + TMRKT+ K  P  SGSPWYGPDRVKYLGP SGEPPSYLT
Sbjct  12   LAGKAVKLAPSASPILGNGRVTMRKTSTKRVP--SGSPWYGPDRVKYLGPLSGEPPSYLT  69

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  129

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQV+LMGAVEGYR+AGGPLGE+TDPLYP
Sbjct  130  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGYRVAGGPLGEVTDPLYP  189

Query  656  GGSF  667
            GGSF
Sbjct  190  GGSF  193



>gb|AAC25775.1| chlorophyll a/b binding protein [Medicago sativa]
Length=266

 Score =   331 bits (849),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 161/184 (88%), Positives = 170/184 (92%), Gaps = 1/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
             AGK VK +PS+ E  G A+FTMRK+A   +  SSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   LAGKPVKLTPSSQEL-GAARFTMRKSATTKKVASSGSPWYGPDRVKYLGPFSGEPPSYLT  71

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  72   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  131

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  132  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVVDPLYP  191

Query  656  GGSF  667
            GGSF
Sbjct  192  GGSF  195



>ref|XP_009377344.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Pyrus x bretschneideri]
Length=267

 Score =   331 bits (849),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 159/184 (86%), Positives = 166/184 (90%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
             AG+AVK S ST    G  + TMRKTA K + VS GSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   LAGQAVKLSKSTSTLRGEGRITMRKTAAKSKNVSCGSPWYGPDRVKYLGPFSGESPSYLT  72

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGC+FPELLSRN VKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCIFPELLSRNRVKFGEAVW  132

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  133  FKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVTDPLYP  192

Query  656  GGSF  667
            GG F
Sbjct  193  GGKF  196



>prf||1204205B protein 1B,chlorophyll binding
Length=265

 Score =   331 bits (848),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 159/184 (86%), Positives = 167/184 (91%), Gaps = 2/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAG+AVK SPS  E +GN + TMRK   K  P  S SPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGQAVKLSPSASEISGNGRITMRKAVAKSAP--SSSPWYGPDRVKYLGPFSGESPSYLT  70

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFS+GGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  131  FKAGSQIFSQGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYP  190

Query  656  GGSF  667
            GGSF
Sbjct  191  GGSF  194



>ref|XP_002285646.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Vitis 
vinifera]
 emb|CAN73057.1| hypothetical protein VITISV_007597 [Vitis vinifera]
Length=267

 Score =   331 bits (848),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 157/184 (85%), Positives = 168/184 (91%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
             AGKA+K +PS  +  G  + TMRKT G+ +PVSSGSPWYG DRVKYLGPFSGEPPSYLT
Sbjct  13   LAGKALKLAPSASDLLGEGRVTMRKTGGRAKPVSSGSPWYGTDRVKYLGPFSGEPPSYLT  72

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA QV+LMGAVEGYRI GGPLGE+ DPLYP
Sbjct  133  FKAGAQIFSEGGLDYLGNPNLVHAQSILAIWASQVILMGAVEGYRIGGGPLGEVVDPLYP  192

Query  656  GGSF  667
            GGSF
Sbjct  193  GGSF  196



>gb|AAH53854.1| Unknown (protein for IMAGE:5194336), partial [Homo sapiens]
 gb|AAI11385.1| Unknown (protein for IMAGE:5198300), partial [Homo sapiens]
Length=287

 Score =   332 bits (850),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 162/184 (88%), Positives = 170/184 (92%), Gaps = 1/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAVK  PS+  F G A+ TMRKTA K +PVSSGSPWYG DRV YLGP SG+PPSYLT
Sbjct  34   FAGKAVKDLPSSALF-GEARVTMRKTAAKAKPVSSGSPWYGSDRVLYLGPLSGDPPSYLT  92

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  93   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  152

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGEI DPLYP
Sbjct  153  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEIVDPLYP  212

Query  656  GGSF  667
            GGSF
Sbjct  213  GGSF  216



>dbj|BAA24493.1| chlorophyll a/b-binding protein [Fagus crenata]
Length=264

 Score =   330 bits (847),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 163/184 (89%), Positives = 171/184 (93%), Gaps = 3/184 (2%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
             AGKAVK +PSTPE     + +MRK+A +   VSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   LAGKAVKLAPSTPELN-VGRVSMRKSASRN--VSSGSPWYGPDRVKYLGPFSGEPPSYLT  69

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  129

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWA QV+LMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  130  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWATQVILMGAVEGYRIAGGPLGEVTDPLYP  189

Query  656  GGSF  667
            GGSF
Sbjct  190  GGSF  193



>ref|XP_004303878.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Fragaria vesca subsp. vesca]
Length=267

 Score =   331 bits (848),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 158/184 (86%), Positives = 167/184 (91%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
             AG+AV+ SP+     G  + TMRKT  K + VSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   LAGQAVQLSPAASNIFGEGRITMRKTGAKSKAVSSGSPWYGPDRVKYLGPFSGEAPSYLT  72

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  133  FKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVVDPLYP  192

Query  656  GGSF  667
            GGSF
Sbjct  193  GGSF  196



>gb|AFK40061.1| unknown [Medicago truncatula]
 gb|KEH31368.1| light-harvesting complex I chlorophyll A/B-binding protein [Medicago 
truncatula]
Length=266

 Score =   330 bits (847),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 161/184 (88%), Positives = 169/184 (92%), Gaps = 1/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
             AGK VK +PS+ E  G A+FTMRK A   +  SSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   LAGKPVKLTPSSQEL-GAARFTMRKAATTKKVASSGSPWYGPDRVKYLGPFSGEPPSYLT  71

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  72   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  131

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  132  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVVDPLYP  191

Query  656  GGSF  667
            GGSF
Sbjct  192  GGSF  195



>gb|ADL41158.1| chloroplast light-harvesting chlorophyll a/b binding protein 
[Triticum aestivum]
Length=266

 Score =   330 bits (847),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 162/184 (88%), Positives = 170/184 (92%), Gaps = 1/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAVK  PS+  F G A+ TMRKTA K +PVSSGSPWYG DRV YLGP SG+PPSYLT
Sbjct  13   FAGKAVKDLPSSALF-GEARVTMRKTAAKAKPVSSGSPWYGSDRVLYLGPLSGDPPSYLT  71

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  72   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  131

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGEI DPLYP
Sbjct  132  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEIVDPLYP  191

Query  656  GGSF  667
            GGSF
Sbjct  192  GGSF  195



>ref|XP_003548104.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic-like 
[Glycine max]
Length=264

 Score =   330 bits (847),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 161/184 (88%), Positives = 172/184 (93%), Gaps = 3/184 (2%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
             AG+A+K +PSTP+  G  + +MRKTA K   V+SGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   LAGQAIKLAPSTPQL-GVGRVSMRKTASKT--VTSGSPWYGPDRVKYLGPFSGEPPSYLT  69

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  129

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSLIHAQSILAIWA QV+LMGAVEGYRIAGGPLGE+TDP+YP
Sbjct  130  FKAGSQIFSEGGLDYLGNPSLIHAQSILAIWATQVILMGAVEGYRIAGGPLGEVTDPIYP  189

Query  656  GGSF  667
            GGSF
Sbjct  190  GGSF  193



>gb|AFK40204.1| unknown [Lotus japonicus]
Length=202

 Score =   328 bits (841),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 158/184 (86%), Positives = 169/184 (92%), Gaps = 3/184 (2%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
             AG+A+K +PS  +     + TMRKT  K +PVSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   LAGQAIKLAPSVQD---TGRITMRKTTTKSKPVSSGSPWYGPDRVKYLGPFSGESPSYLT  69

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  129

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  130  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVTDPLYP  189

Query  656  GGSF  667
            GGSF
Sbjct  190  GGSF  193



>ref|XP_004302854.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Fragaria vesca subsp. vesca]
Length=267

 Score =   330 bits (847),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 159/183 (87%), Positives = 168/183 (92%), Gaps = 0/183 (0%)
 Frame = +2

Query  119  AGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLTG  298
            AG+AVK +PS+    G  + TMRKTA K + VSSGS WYGPDRVKYLGPFSGE PSYLTG
Sbjct  14   AGQAVKLNPSSSNINGEGRVTMRKTASKSKTVSSGSLWYGPDRVKYLGPFSGEAPSYLTG  73

Query  299  EFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWF  478
            EFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVWF
Sbjct  74   EFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWF  133

Query  479  KAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPG  658
            KAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+ DPLYPG
Sbjct  134  KAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVIDPLYPG  193

Query  659  GSF  667
            GSF
Sbjct  194  GSF  196



>ref|XP_003548106.1| PREDICTED: chlorophyll a/b-binding protein precursor isoform 
1 [Glycine max]
 gb|KHN41288.1| Chlorophyll a-b binding protein 21, chloroplastic [Glycine soja]
Length=264

 Score =   330 bits (847),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 161/184 (88%), Positives = 172/184 (93%), Gaps = 3/184 (2%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
             AG+A+K +PSTP+  G  + +MRKTA K   VSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   LAGQAIKLAPSTPQL-GVGRVSMRKTASKT--VSSGSPWYGPDRVKYLGPFSGEPPSYLT  69

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  129

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSLIHAQSILAIWA QV+LMGAVEGYRIAGGPLGE+TDP+YP
Sbjct  130  FKAGSQIFSEGGLDYLGNPSLIHAQSILAIWATQVILMGAVEGYRIAGGPLGEVTDPIYP  189

Query  656  GGSF  667
            GGSF
Sbjct  190  GGSF  193



>gb|AFI60242.1| light harvesting chlorophyll a/b binding protein, partial [Panicum 
virgatum]
Length=260

 Score =   330 bits (846),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 162/184 (88%), Positives = 168/184 (91%), Gaps = 3/184 (2%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAV    S     G A+ TMRKTA KP+P +SGSPWYGPDRV YLGP SGEPPSYLT
Sbjct  9    FAGKAVNVPSS---LFGEARVTMRKTAAKPKPAASGSPWYGPDRVLYLGPLSGEPPSYLT  65

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  66   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  125

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  126  FKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYP  185

Query  656  GGSF  667
            GGSF
Sbjct  186  GGSF  189



>gb|AAA80594.1| chlorophyll a/b binding protein [Solanum tuberosum]
Length=265

 Score =   330 bits (846),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 159/184 (86%), Positives = 166/184 (90%), Gaps = 2/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAG+AVK SPS  E +GN + TMRK   K  P  S SPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGQAVKLSPSASEISGNGRITMRKAVAKSAP--SSSPWYGPDRVKYLGPFSGESPSYLT  70

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGE VW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEVVW  130

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  131  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYP  190

Query  656  GGSF  667
            GGSF
Sbjct  191  GGSF  194



>ref|XP_004233101.1| PREDICTED: chlorophyll a-b binding protein 1B, chloroplastic-like 
[Solanum lycopersicum]
Length=265

 Score =   330 bits (846),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 159/184 (86%), Positives = 166/184 (90%), Gaps = 2/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            F G+AVK SPS  E +GN + TMRK   K  P  S SPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FVGQAVKLSPSASEISGNGRITMRKAVAKSAP--SSSPWYGPDRVKYLGPFSGESPSYLT  70

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  131  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYP  190

Query  656  GGSF  667
            GGSF
Sbjct  191  GGSF  194



>ref|XP_004303877.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Fragaria vesca subsp. vesca]
Length=267

 Score =   330 bits (846),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 159/184 (86%), Positives = 166/184 (90%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
             AG+AVK   ST    G  + TMRKTA K + VSS SPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   LAGQAVKLGSSTSNLLGEGRVTMRKTAAKSKNVSSVSPWYGPDRVKYLGPFSGEAPSYLT  72

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  133  FKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVVDPLYP  192

Query  656  GGSF  667
            GGSF
Sbjct  193  GGSF  196



>gb|AAR10886.1| chlorophyll a/b binding protein [Trifolium pratense]
Length=266

 Score =   330 bits (846),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 162/184 (88%), Positives = 169/184 (92%), Gaps = 1/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
             AGK VK +PS+ E  G AKFTMRK A   +  SSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   LAGKPVKLTPSSQEL-GVAKFTMRKGATTKKVASSGSPWYGPDRVKYLGPFSGEPPSYLT  71

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  72   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  131

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  132  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVVDPLYP  191

Query  656  GGSF  667
            GGSF
Sbjct  192  GGSF  195



>gb|AEO51755.1| chloroplast chlorophyll A/B binding protein [Dimocarpus longan]
Length=263

 Score =   330 bits (845),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 160/184 (87%), Positives = 169/184 (92%), Gaps = 3/184 (2%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            F GKAV+ +P+  +  GN + TMRKT  +   VSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  12   FIGKAVQLAPTGNDLMGNGRVTMRKTGRQ---VSSGSPWYGPDRVKYLGPFSGEPPSYLT  68

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWD AGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  69   GEFPGDYGWDAAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  128

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLG++TDPLYP
Sbjct  129  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGKVTDPLYP  188

Query  656  GGSF  667
            GGSF
Sbjct  189  GGSF  192



>emb|CDP06329.1| unnamed protein product [Coffea canephora]
Length=264

 Score =   330 bits (845),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 158/184 (86%), Positives = 172/184 (93%), Gaps = 3/184 (2%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAVK +PS PE  GN + +M++T+ +P P  SGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   FAGKAVKLNPSAPELMGNGRISMKRTS-RPSP--SGSPWYGPDRVKYLGPFSGEPPSYLT  69

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELLSRNGV+FGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLSRNGVQFGEAVW  129

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIF EGGL+YLGNP+LIHAQSILAIWACQVVLMGAVEGYRIAGGPLG++TDP+YP
Sbjct  130  FKAGSQIFQEGGLNYLGNPNLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGDVTDPIYP  189

Query  656  GGSF  667
            GGSF
Sbjct  190  GGSF  193



>gb|EYU28184.1| hypothetical protein MIMGU_mgv1a011918mg [Erythranthe guttata]
Length=266

 Score =   330 bits (845),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 159/184 (86%), Positives = 169/184 (92%), Gaps = 1/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAG+AVK SP     TG  + +MRKT+ KP+P SSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGQAVKLSPEVTG-TGTGRISMRKTSAKPKPASSGSPWYGPDRVKYLGPFSGEAPSYLT  71

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  72   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  131

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIW  QVVLMGA+EGYRIAGGPLGE+ DPLYP
Sbjct  132  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWGVQVVLMGAIEGYRIAGGPLGEVVDPLYP  191

Query  656  GGSF  667
            GGSF
Sbjct  192  GGSF  195



>gb|EMT29002.1| Chlorophyll a-b binding protein, chloroplastic [Aegilops tauschii]
Length=266

 Score =   330 bits (845),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 162/184 (88%), Positives = 169/184 (92%), Gaps = 1/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAVK  PS+  F G A+ TMRKTA K + V+SGSPWYG DRV YLGP SGEPPSYLT
Sbjct  13   FAGKAVKNLPSSSVF-GEARVTMRKTAAKAKQVASGSPWYGSDRVLYLGPLSGEPPSYLT  71

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  72   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  131

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGEI DPLYP
Sbjct  132  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEIIDPLYP  191

Query  656  GGSF  667
            GGSF
Sbjct  192  GGSF  195



>gb|AFW90594.1| chloroplast chlorophyll a/b binding protein [Solanum tuberosum]
Length=276

 Score =   330 bits (845),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 159/184 (86%), Positives = 166/184 (90%), Gaps = 2/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAG+AVK SPS  E +GN + TMRK   K  P  S SPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGQAVKLSPSASEISGNGRITMRKAVAKSAP--SSSPWYGPDRVKYLGPFSGESPSYLT  70

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGC FPELL+RNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCDFPELLARNGVKFGEAVW  130

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  131  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYP  190

Query  656  GGSF  667
            GGSF
Sbjct  191  GGSF  194



>gb|AAZ79657.1| putative chlorophyll a/b-binding protein [Fagus sylvatica]
Length=260

 Score =   329 bits (844),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 163/184 (89%), Positives = 171/184 (93%), Gaps = 3/184 (2%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
             AGKAVK +PSTPE     + +MRK+A +   VSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  10   LAGKAVKLAPSTPELN-VGRVSMRKSASRN--VSSGSPWYGPDRVKYLGPFSGEPPSYLT  66

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  67   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  126

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWA QV+LMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  127  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWATQVLLMGAVEGYRIAGGPLGEVTDPLYP  186

Query  656  GGSF  667
            GGSF
Sbjct  187  GGSF  190



>dbj|BAJ08392.1| light harvesting chlorophyll a/b-binding protein Lhcb1 [Hordeum 
vulgare subsp. vulgare]
Length=266

 Score =   329 bits (844),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 161/184 (88%), Positives = 169/184 (92%), Gaps = 1/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAVK  PS+  F G A+ TMRKTA K +PVSS SPWYG DRV YLGP SG+PPSYLT
Sbjct  13   FAGKAVKDLPSSALF-GEARVTMRKTAAKAKPVSSSSPWYGSDRVLYLGPLSGDPPSYLT  71

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  72   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  131

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGEI DPLYP
Sbjct  132  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEIVDPLYP  191

Query  656  GGSF  667
            GGSF
Sbjct  192  GGSF  195



>gb|AAA80592.1| chlorophyll a/b binding protein [Solanum tuberosum]
Length=265

 Score =   329 bits (844),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 159/184 (86%), Positives = 166/184 (90%), Gaps = 2/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAG+AVK SPS  E TGN + TMRK   K  P  S SPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGQAVKLSPSASEITGNGRITMRKAVAKSAP--SSSPWYGPDRVKYLGPFSGESPSYLT  70

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIF EGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ +PLYP
Sbjct  131  FKAGSQIFREGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVNPLYP  190

Query  656  GGSF  667
            GGSF
Sbjct  191  GGSF  194



>ref|XP_011045093.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Populus euphratica]
Length=263

 Score =   329 bits (844),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 163/184 (89%), Positives = 170/184 (92%), Gaps = 4/184 (2%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
             AGKAVK +P + E  GN + +MRKT    +PV SGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   LAGKAVKLNPFS-EIMGNGRISMRKTT---KPVPSGSPWYGPDRVKYLGPFSGEPPSYLT  68

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  69   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  128

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWA QVVLMGAVEGYRIAGGPLGE+TDP+YP
Sbjct  129  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWATQVVLMGAVEGYRIAGGPLGEVTDPIYP  188

Query  656  GGSF  667
            GGSF
Sbjct  189  GGSF  192



>dbj|BAF95850.1| putative chloroplast chlorophyll a/b binding protein [Vitis hybrid 
cultivar]
Length=234

 Score =   328 bits (841),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 156/184 (85%), Positives = 167/184 (91%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
             AGKA + +PS  +  G  + TMRKT G+ +PVSSGSPWYG DRVKYLGPFSGEPPSYLT
Sbjct  11   LAGKAFQLAPSASDLLGEGRVTMRKTGGRAKPVSSGSPWYGTDRVKYLGPFSGEPPSYLT  70

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA QV+LMGAVEGYRI GGPLGE+ DPLYP
Sbjct  131  FKAGAQIFSEGGLDYLGNPNLVHAQSILAIWASQVILMGAVEGYRIGGGPLGEVVDPLYP  190

Query  656  GGSF  667
            GGSF
Sbjct  191  GGSF  194



>gb|AGV54498.1| LHCII type I chlorophyll a/b-binding protein [Phaseolus vulgaris]
Length=264

 Score =   329 bits (844),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 160/184 (87%), Positives = 171/184 (93%), Gaps = 3/184 (2%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
             AG+A+K SPSTP+ +   + +MRKTA K   VSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   LAGQAIKLSPSTPDLS-TGRISMRKTASKS--VSSGSPWYGPDRVKYLGPFSGEAPSYLT  69

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  129

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+TDP+YP
Sbjct  130  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVLLMGAVEGYRIAGGPLGEVTDPIYP  189

Query  656  GGSF  667
            GGSF
Sbjct  190  GGSF  193



>ref|XP_004961193.1| PREDICTED: chlorophyll a-b binding protein M9, chloroplastic-like 
[Setaria italica]
Length=264

 Score =   329 bits (844),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 161/184 (88%), Positives = 167/184 (91%), Gaps = 3/184 (2%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            F GKAV    S     G A+ TMRKTA KP+P +SGSPWYGPDRV YLGP SGEPPSYLT
Sbjct  13   FVGKAVNVPSS---LFGEARVTMRKTAAKPKPAASGSPWYGPDRVLYLGPLSGEPPSYLT  69

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  129

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  130  FKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYP  189

Query  656  GGSF  667
            GGSF
Sbjct  190  GGSF  193



>ref|XP_010316912.1| PREDICTED: chlorophyll a-b binding protein 1A, chloroplastic 
[Solanum lycopersicum]
Length=265

 Score =   329 bits (844),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 160/184 (87%), Positives = 167/184 (91%), Gaps = 2/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAG+AVK SPS  E +GN + TMRK   K  P  S SPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGQAVKLSPSASENSGNGRITMRKAVAKSAP--SSSPWYGPDRVKYLGPFSGESPSYLT  70

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  131  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYP  190

Query  656  GGSF  667
            GGSF
Sbjct  191  GGSF  194



>ref|XP_007158464.1| hypothetical protein PHAVU_002G154500g [Phaseolus vulgaris]
 ref|XP_007158466.1| hypothetical protein PHAVU_002G154700g [Phaseolus vulgaris]
 gb|ESW30458.1| hypothetical protein PHAVU_002G154500g [Phaseolus vulgaris]
 gb|ESW30460.1| hypothetical protein PHAVU_002G154700g [Phaseolus vulgaris]
Length=264

 Score =   329 bits (843),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 160/184 (87%), Positives = 171/184 (93%), Gaps = 3/184 (2%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
             AG+A+K SPSTP+ +   + +MRKTA K   VSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   LAGQAIKLSPSTPDLS-TGRISMRKTASKS--VSSGSPWYGPDRVKYLGPFSGEAPSYLT  69

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  129

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+TDP+YP
Sbjct  130  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVLLMGAVEGYRIAGGPLGEVTDPIYP  189

Query  656  GGSF  667
            GGSF
Sbjct  190  GGSF  193



>dbj|BAJ93064.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=266

 Score =   329 bits (843),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 162/184 (88%), Positives = 169/184 (92%), Gaps = 1/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAVK  PS+  F G A+ TMRKTA K + V+SGSPWYG DRV YLGP SGEPPSYLT
Sbjct  13   FAGKAVKNLPSSSLF-GEARVTMRKTAAKVKQVASGSPWYGSDRVLYLGPLSGEPPSYLT  71

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  72   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  131

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGEI DPLYP
Sbjct  132  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEIVDPLYP  191

Query  656  GGSF  667
            GGSF
Sbjct  192  GGSF  195



>dbj|BAJ87673.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=266

 Score =   329 bits (843),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 162/184 (88%), Positives = 168/184 (91%), Gaps = 1/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAVK  PS P   G A+ TMRKTA K + VSSGSPWYG DRV YLGP SGEPPSYLT
Sbjct  13   FAGKAVKNLPS-PAHIGEARVTMRKTAVKAKQVSSGSPWYGSDRVLYLGPLSGEPPSYLT  71

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  72   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  131

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNP+L+HAQSILAIWACQVVLMGAVEGYRIAGGPLGEI DPLYP
Sbjct  132  FKAGSQIFSEGGLDYLGNPNLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEIVDPLYP  191

Query  656  GGSF  667
            GGSF
Sbjct  192  GGSF  195



>ref|XP_010316911.1| PREDICTED: chlorophyll a-b binding protein 1B, chloroplastic-like 
[Solanum lycopersicum]
Length=265

 Score =   329 bits (843),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 159/184 (86%), Positives = 165/184 (90%), Gaps = 2/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAG+AVK  PS  E TGN + TMRK   K  P  S SPWYGPDRVKYLGPFSGE PSYL 
Sbjct  13   FAGQAVKLLPSASEITGNGRITMRKAVAKSAP--SSSPWYGPDRVKYLGPFSGESPSYLN  70

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  131  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYP  190

Query  656  GGSF  667
            GGSF
Sbjct  191  GGSF  194



>gb|AAT08668.1| chloroplast chlorophyll A-B binding protein 40 [Hyacinthus orientalis]
Length=237

 Score =   328 bits (840),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 157/180 (87%), Positives = 168/180 (93%), Gaps = 0/180 (0%)
 Frame = +2

Query  128  AVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFP  307
            AVK +PS+   +G+ +FTMRKT  KP+ VSSGSPWYGPDRVKYLGPFSGE PSYLTGEFP
Sbjct  2    AVKLTPSSSGVSGDGRFTMRKTVAKPKTVSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFP  61

Query  308  GDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAG  487
            GDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG
Sbjct  62   GDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG  121

Query  488  AQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSF  667
            +QIFSEGGLDYLGNPSL+HAQSILAIWA QVVLMGAVEGYR+AGGPLGE+ DPLYPGGSF
Sbjct  122  SQIFSEGGLDYLGNPSLVHAQSILAIWATQVVLMGAVEGYRVAGGPLGEVVDPLYPGGSF  181



>ref|XP_010237260.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Brachypodium distachyon]
Length=266

 Score =   328 bits (842),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 161/184 (88%), Positives = 169/184 (92%), Gaps = 1/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAVK  PS+  F G A+ TMRKTA K +PV SGSPWYG DRV YLGP SG+PPSYLT
Sbjct  13   FAGKAVKNLPSSALF-GEARVTMRKTAAKAKPVPSGSPWYGADRVLYLGPLSGQPPSYLT  71

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  72   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  131

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  132  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYP  191

Query  656  GGSF  667
            GGSF
Sbjct  192  GGSF  195



>gb|AGV54521.1| LHCII type I chlorophyll a/b-binding protein [Phaseolus vulgaris]
Length=264

 Score =   328 bits (841),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 160/184 (87%), Positives = 171/184 (93%), Gaps = 3/184 (2%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
             AG+A+K SPSTP+ +   + +MRKTA K   VSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   LAGQAIKLSPSTPDLS-TGRISMRKTASKS--VSSGSPWYGPDRVKYLGPFSGEAPSYLT  69

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  129

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+TDP+YP
Sbjct  130  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVLLMGAVEGYRIAGGPLGEVTDPIYP  189

Query  656  GGSF  667
            GGSF
Sbjct  190  GGSF  193



>gb|AAF26741.1|AF220527_1 chlorophyll a/b binding protein precursor [Euphorbia esula]
Length=268

 Score =   328 bits (842),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 162/185 (88%), Positives = 171/185 (92%), Gaps = 2/185 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTP-EFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYL  292
            FAG+AVK SPS+  E  GN + +MRK A K +   SGSPWYGPDRVKYLGPFSGEPPSYL
Sbjct  14   FAGQAVKLSPSSASELMGNGRVSMRKAATK-KVAPSGSPWYGPDRVKYLGPFSGEPPSYL  72

Query  293  TGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAV  472
            TGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAV
Sbjct  73   TGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAV  132

Query  473  WFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLY  652
            WFKAG+QIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DP+Y
Sbjct  133  WFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPIY  192

Query  653  PGGSF  667
            PGGSF
Sbjct  193  PGGSF  197



>gb|EYU29602.1| hypothetical protein MIMGU_mgv1a019986mg [Erythranthe guttata]
Length=260

 Score =   328 bits (841),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 160/185 (86%), Positives = 171/185 (92%), Gaps = 4/185 (2%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGN-AKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYL  292
            FAG+AVK SP   E T N ++ +MRKTA KP+P SSGSPWYGPDRVKYLGPFSGE PSYL
Sbjct  8    FAGQAVKLSP---EITANYSRVSMRKTAAKPKPASSGSPWYGPDRVKYLGPFSGEAPSYL  64

Query  293  TGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAV  472
            TGEFPGDYGWDTAGLSADPETF+KNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAV
Sbjct  65   TGEFPGDYGWDTAGLSADPETFSKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAV  124

Query  473  WFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLY  652
            WFKAG+QIFSEGGLDYLGNPSL+HAQSILAIW  QVVLMGA+EGYRIAGGPLGE+ DPLY
Sbjct  125  WFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWGVQVVLMGAIEGYRIAGGPLGEVVDPLY  184

Query  653  PGGSF  667
            PGGSF
Sbjct  185  PGGSF  189



>gb|ACU23974.1| unknown [Glycine max]
Length=264

 Score =   328 bits (841),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 160/184 (87%), Positives = 171/184 (93%), Gaps = 3/184 (2%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
             AG+A+K +PSTP+  G  + +MRKTA K   V+SGSPWYGPDRVKYLGPFSGEPPSY T
Sbjct  13   LAGQAIKLAPSTPQL-GVGRVSMRKTASKT--VTSGSPWYGPDRVKYLGPFSGEPPSYRT  69

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  129

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSLIHAQSILAIWA QV+LMGAVEGYRIAGGPLGE+TDP+YP
Sbjct  130  FKAGSQIFSEGGLDYLGNPSLIHAQSILAIWATQVILMGAVEGYRIAGGPLGEVTDPIYP  189

Query  656  GGSF  667
            GGSF
Sbjct  190  GGSF  193



>gb|AAF89206.1|AF279249_1 LHCII type I chlorophyll a/b-binding protein [Vigna radiata]
Length=264

 Score =   328 bits (841),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 160/184 (87%), Positives = 171/184 (93%), Gaps = 3/184 (2%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
             AG+A+K SPSTPE +G  + +MRK A K   VSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   LAGQAIKLSPSTPELSG-GRISMRKAASKS--VSSGSPWYGPDRVKYLGPFSGEAPSYLT  69

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  129

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSLIHAQSILAIWA QV+LMGAVEGYRIAGGPLGE+TDP+YP
Sbjct  130  FKAGSQIFSEGGLDYLGNPSLIHAQSILAIWATQVILMGAVEGYRIAGGPLGEVTDPIYP  189

Query  656  GGSF  667
            GGSF
Sbjct  190  GGSF  193



>gb|ABQ81856.1| chloroplast chlorophyll a/b binding protein [Phyllostachys edulis]
Length=265

 Score =   328 bits (841),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 162/184 (88%), Positives = 171/184 (93%), Gaps = 2/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAVK  PS+  F G+A+ TMRKT  KP+ V+SGSPWYGPDRV YLGP SGEPPSYLT
Sbjct  13   FAGKAVKNMPSSALF-GDARMTMRKTGAKPK-VASGSPWYGPDRVLYLGPLSGEPPSYLT  70

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEF GDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGV+FGEAVW
Sbjct  71   GEFAGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVQFGEAVW  130

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  131  FKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYP  190

Query  656  GGSF  667
            GGSF
Sbjct  191  GGSF  194



>ref|XP_002283566.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Vitis 
vinifera]
 emb|CAN74831.1| hypothetical protein VITISV_023674 [Vitis vinifera]
Length=270

 Score =   328 bits (841),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 158/186 (85%), Positives = 168/186 (90%), Gaps = 2/186 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTG--NAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSY  289
             AG+AVK +P+  E       + TMRK+  K + VSSGSPWYGPDRVKYLGPFSGEPPSY
Sbjct  14   LAGQAVKLAPNVTELLAGDQGRVTMRKSVAKSKAVSSGSPWYGPDRVKYLGPFSGEPPSY  73

Query  290  LTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEA  469
            LTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELLSRNGVKFGEA
Sbjct  74   LTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLSRNGVKFGEA  133

Query  470  VWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPL  649
            VWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+TDPL
Sbjct  134  VWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVTDPL  193

Query  650  YPGGSF  667
            YPGGSF
Sbjct  194  YPGGSF  199



>gb|AAB18209.1| chlorophyll a/b-binding protein WCAB precursor [Triticum aestivum]
Length=266

 Score =   328 bits (840),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 160/184 (87%), Positives = 167/184 (91%), Gaps = 1/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAVK  PS     G A+ TMRKTA K + VSSGSPWYG DRV YLGP SGEPPSYLT
Sbjct  13   FAGKAVKNVPSL-ALLGEARVTMRKTAAKAKQVSSGSPWYGADRVLYLGPLSGEPPSYLT  71

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETF+KNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  72   GEFPGDYGWDTAGLSADPETFSKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  131

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGEI DPLYP
Sbjct  132  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEIVDPLYP  191

Query  656  GGSF  667
            GGSF
Sbjct  192  GGSF  195



>sp|P04779.1|CB21_PETSP RecName: Full=Chlorophyll a-b binding protein 13, chloroplastic; 
AltName: Full=LHCII type I CAB-13; Short=LHCP; Flags: Precursor 
[Petunia sp.]
 emb|CAA26210.1| unnamed protein product [Petunia sp.]
Length=266

 Score =   328 bits (840),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 158/184 (86%), Positives = 166/184 (90%), Gaps = 1/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAV   PS+ E T N K TMRKT  K +PVSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGKAVNV-PSSSEITRNGKVTMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLT  71

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADP TFAKNR+LEVIH RW MLGALGCVFPEL +RNGVKFGEAVW
Sbjct  72   GEFPGDYGWDTAGLSADPATFAKNRKLEVIHCRWTMLGALGCVFPELFARNGVKFGEAVW  131

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIF EGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGE+ DPLYP
Sbjct  132  FKAGSQIFKEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVIDPLYP  191

Query  656  GGSF  667
            GGSF
Sbjct  192  GGSF  195



>gb|EYU29604.1| hypothetical protein MIMGU_mgv1a023200mg [Erythranthe guttata]
 gb|EYU30287.1| hypothetical protein MIMGU_mgv1a011913mg [Erythranthe guttata]
 gb|EYU30288.1| hypothetical protein MIMGU_mgv1a020332mg [Erythranthe guttata]
Length=267

 Score =   328 bits (840),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 160/185 (86%), Positives = 171/185 (92%), Gaps = 4/185 (2%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGN-AKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYL  292
            FAG+AVK SP   E T N ++ +MRKTA KP+P SSGSPWYGPDRVKYLGPFSGE PSYL
Sbjct  15   FAGQAVKLSP---EITANYSRVSMRKTAAKPKPASSGSPWYGPDRVKYLGPFSGEAPSYL  71

Query  293  TGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAV  472
            TGEFPGDYGWDTAGLSADPETF+KNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAV
Sbjct  72   TGEFPGDYGWDTAGLSADPETFSKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAV  131

Query  473  WFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLY  652
            WFKAG+QIFSEGGLDYLGNPSL+HAQSILAIW  QVVLMGA+EGYRIAGGPLGE+ DPLY
Sbjct  132  WFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWGVQVVLMGAIEGYRIAGGPLGEVVDPLY  191

Query  653  PGGSF  667
            PGGSF
Sbjct  192  PGGSF  196



>ref|XP_010231015.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Brachypodium distachyon]
Length=263

 Score =   327 bits (839),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 160/184 (87%), Positives = 167/184 (91%), Gaps = 4/184 (2%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAVK  P+     G A+ TMRKT  K +PVSSGSPWYG DRV YLGP SGEPPSYLT
Sbjct  13   FAGKAVKNLPAL----GEARITMRKTVAKAKPVSSGSPWYGSDRVLYLGPLSGEPPSYLT  68

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  69   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  128

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGEI DPLYP
Sbjct  129  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEIVDPLYP  188

Query  656  GGSF  667
            GGSF
Sbjct  189  GGSF  192



>gb|ABQ81857.1| chloroplast chlorophyll a/b binding protein [Phyllostachys edulis]
Length=265

 Score =   327 bits (839),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 162/184 (88%), Positives = 170/184 (92%), Gaps = 2/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAVK  PS+  F G A+ TMRKT  KP+  +SGSPWYGPDRV YLGP SGEPPSYLT
Sbjct  13   FAGKAVKNVPSSALF-GEARVTMRKTGAKPK-ATSGSPWYGPDRVLYLGPLSGEPPSYLT  70

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGV+FGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVQFGEAVW  130

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  131  FKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYP  190

Query  656  GGSF  667
            GGSF
Sbjct  191  GGSF  194



>gb|EMT29003.1| Chlorophyll a-b binding protein, chloroplastic [Aegilops tauschii]
Length=266

 Score =   327 bits (839),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 161/184 (88%), Positives = 168/184 (91%), Gaps = 1/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAVK  PS+  F G+A+ TMRKTA K + V SGSPWYG DRV YLGP SGEPPSYL 
Sbjct  13   FAGKAVKNLPSSSLF-GDARVTMRKTAAKAKQVVSGSPWYGSDRVLYLGPLSGEPPSYLN  71

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  72   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  131

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGEI DPLYP
Sbjct  132  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEIVDPLYP  191

Query  656  GGSF  667
            GGSF
Sbjct  192  GGSF  195



>emb|CDP06330.1| unnamed protein product [Coffea canephora]
Length=264

 Score =   327 bits (839),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 156/184 (85%), Positives = 169/184 (92%), Gaps = 3/184 (2%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAVK +PS PE  GN + +M++T+    P  SGSPWYG DRVKYLGPFSGEPPSYLT
Sbjct  13   FAGKAVKLNPSAPELMGNGRISMKRTS---RPAPSGSPWYGRDRVKYLGPFSGEPPSYLT  69

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELLSRNGV+FGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLSRNGVQFGEAVW  129

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIF +GGL+YLGNP+LIHAQSILAIWACQVVLMGAVEGYRIAGGPLGE+TDP+YP
Sbjct  130  FKAGSQIFQQGGLNYLGNPNLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPIYP  189

Query  656  GGSF  667
            GGSF
Sbjct  190  GGSF  193



>gb|ABQ32304.1| chloroplast light-harvesting chlorophyll a/b-binding protein 
[Artemisia annua]
Length=254

 Score =   327 bits (838),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 158/183 (86%), Positives = 167/183 (91%), Gaps = 0/183 (0%)
 Frame = +2

Query  119  AGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLTG  298
            AG+AVK +PS  E  GN + +MRKTA   +   SGSPWYGPDRVKYLGPFSGE PSYLTG
Sbjct  1    AGQAVKAAPSNSELLGNGRVSMRKTAAPKKVAPSGSPWYGPDRVKYLGPFSGEAPSYLTG  60

Query  299  EFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWF  478
            EFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVWF
Sbjct  61   EFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWF  120

Query  479  KAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPG  658
            KAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+ DPLYPG
Sbjct  121  KAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVVDPLYPG  180

Query  659  GSF  667
            GSF
Sbjct  181  GSF  183



>ref|XP_007151996.1| hypothetical protein PHAVU_004G093000g [Phaseolus vulgaris]
 gb|ESW23990.1| hypothetical protein PHAVU_004G093000g [Phaseolus vulgaris]
Length=264

 Score =   327 bits (839),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 158/184 (86%), Positives = 172/184 (93%), Gaps = 3/184 (2%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
             AG+A+K SP+TP+ +G  + +MRKTA K   VSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   LAGQAIKLSPATPDLSG-GRISMRKTASKS--VSSGSPWYGPDRVKYLGPFSGEAPSYLT  69

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            G+FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  70   GQFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  129

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+TDP+YP
Sbjct  130  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVTDPIYP  189

Query  656  GGSF  667
            GGSF
Sbjct  190  GGSF  193



>gb|ABW70800.1| chloroplast light harvesting chlorophyll a/b binding protein 
[Populus euphratica]
Length=263

 Score =   327 bits (839),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 163/184 (89%), Positives = 169/184 (92%), Gaps = 4/184 (2%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
             AGKAVK +P + E  GN   +MRKT    +PV SGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   LAGKAVKLNPFS-EIMGNGCISMRKTT---KPVPSGSPWYGPDRVKYLGPFSGEPPSYLT  68

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  69   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  128

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWA QVVLMGAVEGYRIAGGPLGE+TDP+YP
Sbjct  129  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWATQVVLMGAVEGYRIAGGPLGEVTDPIYP  188

Query  656  GGSF  667
            GGSF
Sbjct  189  GGSF  192



>ref|XP_004293579.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Fragaria 
vesca subsp. vesca]
Length=263

 Score =   327 bits (839),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 162/184 (88%), Positives = 170/184 (92%), Gaps = 4/184 (2%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAV+ +P+  E  G  + +MRKT GK   VSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   FAGKAVQLAPT--EVFGTGRISMRKTVGKA--VSSGSPWYGPDRVKYLGPFSGEPPSYLT  68

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  69   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  128

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QVVLMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  129  FKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVLMGAVEGYRIAGGPLGEVEDPLYP  188

Query  656  GGSF  667
            GGSF
Sbjct  189  GGSF  192



>gb|ACD64978.1| chloroplast chlorophyll a/b-binding protein [Ophiopogon japonicus]
Length=264

 Score =   327 bits (839),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 162/185 (88%), Positives = 169/185 (91%), Gaps = 4/185 (2%)
 Frame = +2

Query  116  FAGKAVKFSPS-TPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYL  292
             AGKAVK +PS   E  GN + +MRKT    + VSSGSPWYGPDRVKYLGPFSGEPPSYL
Sbjct  12   LAGKAVKLAPSPASELMGNGRISMRKTG---KSVSSGSPWYGPDRVKYLGPFSGEPPSYL  68

Query  293  TGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAV  472
            TGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAV
Sbjct  69   TGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAV  128

Query  473  WFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLY  652
            WFKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QVVLMGAVEGYRIAGGPLGE+TDPLY
Sbjct  129  WFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWASQVVLMGAVEGYRIAGGPLGEVTDPLY  188

Query  653  PGGSF  667
            PGGSF
Sbjct  189  PGGSF  193



>ref|XP_006856963.1| hypothetical protein AMTR_s00189p00032350 [Amborella trichopoda]
 gb|ERN18430.1| hypothetical protein AMTR_s00189p00032350 [Amborella trichopoda]
Length=268

 Score =   327 bits (839),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 161/187 (86%), Positives = 171/187 (91%), Gaps = 3/187 (2%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEF--TGNAKFTMRKTAGKP-EPVSSGSPWYGPDRVKYLGPFSGEPPS  286
            FAGKA+  SP++ E   +G  + +MRK  GKP + VSSGSPWYGPDRVKYLGP SGEPPS
Sbjct  11   FAGKALALSPASSELLGSGEGRVSMRKPVGKPSKAVSSGSPWYGPDRVKYLGPLSGEPPS  70

Query  287  YLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGE  466
            YLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELLSRNGVKFGE
Sbjct  71   YLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLSRNGVKFGE  130

Query  467  AVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDP  646
            AVWFKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+TDP
Sbjct  131  AVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWASQVILMGAVEGYRIAGGPLGEVTDP  190

Query  647  LYPGGSF  667
            LYPGGSF
Sbjct  191  LYPGGSF  197



>gb|AAB87573.1| chlorophyll a/b binding protein of LHCII type I precursor [Panax 
ginseng]
Length=266

 Score =   327 bits (839),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 159/184 (86%), Positives = 169/184 (92%), Gaps = 1/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAG AVK +PS+ E  G+ + +MRKT  KP   SSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGMAVKVAPSSSELFGSGRISMRKTGKKPA-ASSGSPWYGPDRVKYLGPFSGEAPSYLT  71

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  72   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  131

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  132  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVVDPLYP  191

Query  656  GGSF  667
            GGSF
Sbjct  192  GGSF  195



>ref|XP_008358195.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Malus domestica]
Length=265

 Score =   327 bits (839),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 165/187 (88%), Positives = 171/187 (91%), Gaps = 5/187 (3%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFT---GNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPS  286
            F GKA+  +  T EF+   GN + +MRKTA KP  VSSGSPWYGPDRVKYLGPFSGE PS
Sbjct  10   FTGKAIPLNTQT-EFSAVQGNGRVSMRKTAKKPA-VSSGSPWYGPDRVKYLGPFSGEAPS  67

Query  287  YLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGE  466
            YLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGE
Sbjct  68   YLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGE  127

Query  467  AVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDP  646
            AVWFKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QVVLMGAVEGYRIAGGPLGEITDP
Sbjct  128  AVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVLMGAVEGYRIAGGPLGEITDP  187

Query  647  LYPGGSF  667
            LYPGGSF
Sbjct  188  LYPGGSF  194



>ref|XP_006467511.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
[Citrus sinensis]
Length=399

 Score =   332 bits (851),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 162/184 (88%), Positives = 168/184 (91%), Gaps = 2/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            F G AV  +PS  E +   + +MRKTA K   VSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  12   FVGMAVNLAPSGNELSNGGRISMRKTASKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLT  69

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  129

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGE+TDPLYP
Sbjct  130  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYP  189

Query  656  GGSF  667
            GGSF
Sbjct  190  GGSF  193


 Score =   135 bits (341),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 88/136 (65%), Gaps = 20/136 (15%)
 Frame = +2

Query  320  WDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLS---------------RNGV  454
            +D  GL+ DPE FA+ +  E+ + R AM    G     +++                N  
Sbjct  193  FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN  252

Query  455  KFGEAVWFK-----AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAG  619
             +  A  F      AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAG
Sbjct  253  AWAYATNFVPGKKFAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAG  312

Query  620  GPLGEITDPLYPGGSF  667
            GPLGE+TDPLYPGGSF
Sbjct  313  GPLGEVTDPLYPGGSF  328



>gb|EMS51039.1| Chlorophyll a-b binding protein 3C, chloroplastic [Triticum urartu]
Length=265

 Score =   327 bits (838),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 160/184 (87%), Positives = 168/184 (91%), Gaps = 1/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGK+VK   S+  F G A+ TMRKTA K +PVSSGSPWYG DRV YLGP SGEPPSYLT
Sbjct  12   FAGKSVKNVASSALF-GEARVTMRKTAAKAKPVSSGSPWYGADRVLYLGPLSGEPPSYLT  70

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKF EAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFREAVW  130

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  131  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYP  190

Query  656  GGSF  667
            GGSF
Sbjct  191  GGSF  194



>ref|XP_007151979.1| hypothetical protein PHAVU_004G091600g [Phaseolus vulgaris]
 gb|ESW23973.1| hypothetical protein PHAVU_004G091600g [Phaseolus vulgaris]
Length=264

 Score =   327 bits (838),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 158/184 (86%), Positives = 172/184 (93%), Gaps = 3/184 (2%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
             AG+A+K SP+TP+ +G  + +MRKTA K   VSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   LAGQAIKLSPATPDISG-GRISMRKTASKS--VSSGSPWYGPDRVKYLGPFSGEAPSYLT  69

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            G+FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  70   GQFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  129

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+TDP+YP
Sbjct  130  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVTDPIYP  189

Query  656  GGSF  667
            GGSF
Sbjct  190  GGSF  193



>ref|XP_010666512.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic-like 
[Beta vulgaris subsp. vulgaris]
Length=268

 Score =   327 bits (838),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 158/185 (85%), Positives = 167/185 (90%), Gaps = 1/185 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPV-SSGSPWYGPDRVKYLGPFSGEPPSYL  292
             AGKAVK  P+  E  G  + TMRKT GK +P  SS SPWYGPDRVKYLGPFSGE PSYL
Sbjct  13   LAGKAVKLGPTAWEILGEGRVTMRKTGGKTKPAASSSSPWYGPDRVKYLGPFSGEAPSYL  72

Query  293  TGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAV  472
            TGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAV
Sbjct  73   TGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAV  132

Query  473  WFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLY  652
            WFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQV+LMGAVEGYR+AGGPLGE+ DPLY
Sbjct  133  WFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRVAGGPLGEVVDPLY  192

Query  653  PGGSF  667
            PGGSF
Sbjct  193  PGGSF  197



>ref|XP_010097596.1| Chlorophyll a-b binding protein 40 [Morus notabilis]
 gb|EXB69297.1| Chlorophyll a-b binding protein 40 [Morus notabilis]
Length=265

 Score =   327 bits (838),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 158/184 (86%), Positives = 170/184 (92%), Gaps = 2/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAV+ +P+  + TG  + +MRKT  +    SSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  13   FAGKAVELTPTANKVTGGGRVSMRKTGSRG--ASSGSPWYGPDRVKYLGPFSGEPPSYLT  70

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  130

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSLIHAQSILAIWA QV+LMGAVEGYRIAGGPLGE+TDP+YP
Sbjct  131  FKAGSQIFSEGGLDYLGNPSLIHAQSILAIWASQVILMGAVEGYRIAGGPLGEVTDPIYP  190

Query  656  GGSF  667
            GGSF
Sbjct  191  GGSF  194



>dbj|BAJ89881.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=266

 Score =   327 bits (838),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 159/184 (86%), Positives = 168/184 (91%), Gaps = 1/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAVK  PS+  F G A+ TMRKT  K + VSSGSPWYG DRV YLGP SGEPPSYLT
Sbjct  13   FAGKAVKNVPSSALF-GEARVTMRKTTAKAKQVSSGSPWYGADRVLYLGPLSGEPPSYLT  71

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETF+KNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  72   GEFPGDYGWDTAGLSADPETFSKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  131

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIF+EGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGEI DPLYP
Sbjct  132  FKAGSQIFNEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEIVDPLYP  191

Query  656  GGSF  667
            GGSF
Sbjct  192  GGSF  195



>gb|EMS50796.1| Chlorophyll a-b binding protein, chloroplastic [Triticum urartu]
Length=266

 Score =   327 bits (837),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 160/184 (87%), Positives = 167/184 (91%), Gaps = 1/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAVK  PS   F G A+ TMRKTA K + VSSGSPWYG DRV YLGP SGEPPSYLT
Sbjct  13   FAGKAVKNVPSLALF-GEARVTMRKTAAKAKQVSSGSPWYGADRVLYLGPLSGEPPSYLT  71

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETF+KNRELEVIH RWAMLGALGCVFPELL+RN VKFGEAVW
Sbjct  72   GEFPGDYGWDTAGLSADPETFSKNRELEVIHCRWAMLGALGCVFPELLARNDVKFGEAVW  131

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGEI DPLYP
Sbjct  132  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEIVDPLYP  191

Query  656  GGSF  667
            GGSF
Sbjct  192  GGSF  195



>sp|P12329.1|CB21_MAIZE RecName: Full=Chlorophyll a-b binding protein 1, chloroplastic; 
AltName: Full=LHCII type I CAB-1; Short=LHCP; Flags: Precursor 
[Zea mays]
 emb|CAA32900.1| unnamed protein product [Zea mays]
 gb|ACF83754.1| unknown [Zea mays]
 gb|ACG25538.1| chlorophyll a-b binding protein 2 [Zea mays]
 gb|ACG28560.1| chlorophyll a-b binding protein 2 [Zea mays]
 tpg|DAA62636.1| TPA: light harvesting chlorophyll a/b binding protein2 [Zea mays]
Length=262

 Score =   327 bits (837),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 161/168 (96%), Gaps = 0/168 (0%)
 Frame = +2

Query  164  GNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  343
            G  + TMRKT GKP+  +SGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  24   GEGRITMRKTVGKPKVAASGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  83

Query  344  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  523
            DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  84   DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYL  143

Query  524  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSF  667
            GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYPGGSF
Sbjct  144  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSF  191



>dbj|BAJ90643.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86302.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=265

 Score =   326 bits (836),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 159/184 (86%), Positives = 168/184 (91%), Gaps = 1/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGK+VK   S+  F G A+ TMRKTA K + VSSGSPWYG DRV YLGP SGEPPSYLT
Sbjct  12   FAGKSVKNVASSALF-GEARVTMRKTAAKAKQVSSGSPWYGADRVLYLGPLSGEPPSYLT  70

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  130

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFS+GGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  131  FKAGSQIFSDGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYP  190

Query  656  GGSF  667
            GGSF
Sbjct  191  GGSF  194



>ref|XP_007151992.1| hypothetical protein PHAVU_004G0927000g, partial [Phaseolus vulgaris]
 gb|ESW23986.1| hypothetical protein PHAVU_004G0927000g, partial [Phaseolus vulgaris]
Length=206

 Score =   324 bits (830),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 157/184 (85%), Positives = 171/184 (93%), Gaps = 3/184 (2%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
             AG+A+K SP+TP+ +G  + +MRKTA K   VSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   LAGQAIKLSPATPDISGG-RISMRKTASKS--VSSGSPWYGPDRVKYLGPFSGEAPSYLT  69

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            G+FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  70   GQFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  129

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+TDP+Y 
Sbjct  130  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVTDPIYS  189

Query  656  GGSF  667
            GGSF
Sbjct  190  GGSF  193



>gb|EMS57503.1| Chlorophyll a-b binding protein, chloroplastic [Triticum urartu]
Length=266

 Score =   326 bits (836),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 161/184 (88%), Positives = 167/184 (91%), Gaps = 1/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAVK  PS P   G A+ TMRKT  K + VSSGSPWYG +RV YLGP SGEPPSYLT
Sbjct  13   FAGKAVKNVPS-PALFGEARVTMRKTTAKAKQVSSGSPWYGANRVLYLGPLSGEPPSYLT  71

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  72   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  131

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGEI DPLYP
Sbjct  132  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEIVDPLYP  191

Query  656  GGSF  667
            GGSF
Sbjct  192  GGSF  195



>ref|XP_002515206.1| chlorophyll A/B binding protein, putative [Ricinus communis]
 gb|EEF47190.1| chlorophyll A/B binding protein, putative [Ricinus communis]
Length=267

 Score =   326 bits (836),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 164/188 (87%), Positives = 168/188 (89%), Gaps = 5/188 (3%)
 Frame = +2

Query  116  FAGKAVKFSPST----PEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPP  283
            F GKAV  S  T       + N + TMRKTAGKP   SSGSPWYGPDRVKYLGPFSGEPP
Sbjct  10   FTGKAVPLSAQTELPATVRSSNGRVTMRKTAGKPA-ASSGSPWYGPDRVKYLGPFSGEPP  68

Query  284  SYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFG  463
            SYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFG
Sbjct  69   SYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFG  128

Query  464  EAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITD  643
            EAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWA QVVLMGAVEGYRIAGGPLGE+TD
Sbjct  129  EAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWATQVVLMGAVEGYRIAGGPLGEVTD  188

Query  644  PLYPGGSF  667
            PLYPGGSF
Sbjct  189  PLYPGGSF  196



>gb|AAF89207.1|AF279250_1 LHCII type I chlorophyll a/b-binding protein [Vigna radiata]
Length=264

 Score =   326 bits (835),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 159/184 (86%), Positives = 171/184 (93%), Gaps = 3/184 (2%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
             AG+A+K SPSTP+ +G  + +MRKTA K   VSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   LAGQAIKLSPSTPDLSG-GRISMRKTASKS--VSSGSPWYGPDRVKYLGPFSGEAPSYLT  69

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALG VFPELL+RNGVKFGEAVW
Sbjct  70   GEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGSVFPELLARNGVKFGEAVW  129

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSLIHAQSILAIWA QV+LMGAVEGYRIAGGPLGE+TDP+YP
Sbjct  130  FKAGSQIFSEGGLDYLGNPSLIHAQSILAIWASQVILMGAVEGYRIAGGPLGEVTDPIYP  189

Query  656  GGSF  667
            GGSF
Sbjct  190  GGSF  193



>ref|XP_010666522.1| PREDICTED: uncharacterized protein LOC104883672 [Beta vulgaris 
subsp. vulgaris]
Length=624

 Score =   338 bits (866),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 160/184 (87%), Positives = 169/184 (92%), Gaps = 0/184 (0%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
             AGKAV   P+  E  G  + TMRKTAGKP+ VSSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  370  LAGKAVNLGPNASEILGEGRITMRKTAGKPKQVSSGSPWYGPDRVKYLGPFSGEAPSYLT  429

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  430  GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW  489

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQV+LMGAVEGYR+AGGPLGE+ DPLYP
Sbjct  490  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRVAGGPLGEVVDPLYP  549

Query  656  GGSF  667
            GGSF
Sbjct  550  GGSF  553


 Score =   328 bits (840),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 158/185 (85%), Positives = 167/185 (90%), Gaps = 1/185 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPV-SSGSPWYGPDRVKYLGPFSGEPPSYL  292
             AGKAVK  P+  E  G  + TMRKT GK +P  SS SPWYGPDRVKYLGPFSGE PSYL
Sbjct  13   LAGKAVKLGPTAWEILGEGRVTMRKTGGKTKPAASSSSPWYGPDRVKYLGPFSGEAPSYL  72

Query  293  TGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAV  472
            TGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAV
Sbjct  73   TGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAV  132

Query  473  WFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLY  652
            WFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQV+LMGAVEGYR+AGGPLGE+ DPLY
Sbjct  133  WFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRVAGGPLGEVVDPLY  192

Query  653  PGGSF  667
            PGGSF
Sbjct  193  PGGSF  197



>gb|EMS50795.1| Chlorophyll a-b binding protein, chloroplastic [Triticum urartu]
Length=312

 Score =   327 bits (839),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 161/184 (88%), Positives = 167/184 (91%), Gaps = 1/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAVK  PS   F G A+ TMRKTA K + VSSGSPWYG DRV YLGP SGEPPSYLT
Sbjct  13   FAGKAVKNVPSLALF-GEARVTMRKTAAKAKQVSSGSPWYGADRVLYLGPLSGEPPSYLT  71

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGV FGEAVW
Sbjct  72   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVNFGEAVW  131

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGEI DPLYP
Sbjct  132  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEIVDPLYP  191

Query  656  GGSF  667
            GGSF
Sbjct  192  GGSF  195



>ref|XP_007151990.1| hypothetical protein PHAVU_004G092600g [Phaseolus vulgaris]
 ref|XP_007151998.1| hypothetical protein PHAVU_004G093200g [Phaseolus vulgaris]
 gb|ESW23984.1| hypothetical protein PHAVU_004G092600g [Phaseolus vulgaris]
 gb|ESW23992.1| hypothetical protein PHAVU_004G093200g [Phaseolus vulgaris]
Length=264

 Score =   325 bits (834),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 157/184 (85%), Positives = 171/184 (93%), Gaps = 3/184 (2%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
             AG+A+K SP+TP+ +G  + +MRKTA K   VSSGSPWYGPDR KYLGPFSGE PSYLT
Sbjct  13   LAGQAIKLSPATPDLSG-GRISMRKTASKS--VSSGSPWYGPDRAKYLGPFSGEAPSYLT  69

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            G+FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  70   GQFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  129

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+TDP+YP
Sbjct  130  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVTDPIYP  189

Query  656  GGSF  667
            GGSF
Sbjct  190  GGSF  193



>gb|AAW31511.1| light-harvesting chlorophyll-a/b binding protein Lhcb1 [Pisum 
sativum]
Length=266

 Score =   325 bits (834),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 158/184 (86%), Positives = 168/184 (91%), Gaps = 1/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
              GK VK +PS+ E  G A+FTMRK+A   +  SSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   LTGKPVKLNPSSQEL-GGARFTMRKSATTKKVASSGSPWYGPDRVKYLGPFSGESPSYLT  71

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETF+KNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  72   GEFPGDYGWDTAGLSADPETFSKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  131

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  132  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVVDPLYP  191

Query  656  GGSF  667
            GGSF
Sbjct  192  GGSF  195



>gb|ABN49454.2| chloroplast chlorophyll a/b binding protein [Pisum sativum]
Length=266

 Score =   325 bits (834),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 158/184 (86%), Positives = 168/184 (91%), Gaps = 1/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
              GK VK +PS+ E  G A+FTMRK+A   +  SSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   LTGKPVKLNPSSQEL-GGARFTMRKSATTKKVASSGSPWYGPDRVKYLGPFSGESPSYLT  71

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETF+KNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  72   GEFPGDYGWDTAGLSADPETFSKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  131

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  132  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVVDPLYP  191

Query  656  GGSF  667
            GGSF
Sbjct  192  GGSF  195



>ref|XP_010097597.1| Chlorophyll a-b binding protein 40 [Morus notabilis]
 gb|EXB69298.1| Chlorophyll a-b binding protein 40 [Morus notabilis]
Length=265

 Score =   325 bits (834),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 157/184 (85%), Positives = 168/184 (91%), Gaps = 2/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAV+ +P+    TG  + +MRKT  +    SSGSPWYGPDRVKYLGP SGEPPSYLT
Sbjct  13   FAGKAVELTPTANRVTGGGRVSMRKTGSRV--ASSGSPWYGPDRVKYLGPLSGEPPSYLT  70

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  130

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSLIHAQSILAIWA QV+LMGAVEGYRIAGGPLGE+TDP+YP
Sbjct  131  FKAGSQIFSEGGLDYLGNPSLIHAQSILAIWASQVILMGAVEGYRIAGGPLGEVTDPIYP  190

Query  656  GGSF  667
            GGSF
Sbjct  191  GGSF  194



>gb|EYU19649.1| hypothetical protein MIMGU_mgv1a011927mg [Erythranthe guttata]
Length=266

 Score =   325 bits (834),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 157/184 (85%), Positives = 166/184 (90%), Gaps = 1/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAG+AV  SP      G  + +MRKTA KP+P SS SPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGQAVNLSPEISTANG-GRISMRKTAAKPKPASSSSPWYGPDRVKYLGPFSGEAPSYLT  71

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  72   GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  131

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIW  QVVLMGA+EGYRIAGGPLGE+ DPLYP
Sbjct  132  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWGVQVVLMGAIEGYRIAGGPLGEVVDPLYP  191

Query  656  GGSF  667
            GGSF
Sbjct  192  GGSF  195



>ref|XP_004957570.1| PREDICTED: chlorophyll a-b binding protein 1, chloroplastic-like 
[Setaria italica]
Length=261

 Score =   325 bits (834),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 155/168 (92%), Positives = 161/168 (96%), Gaps = 0/168 (0%)
 Frame = +2

Query  164  GNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  343
            G  + TMRKTA KP+  +SGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  23   GEGRITMRKTAAKPKVAASGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  82

Query  344  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  523
            DPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  83   DPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYL  142

Query  524  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSF  667
            GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYPGGSF
Sbjct  143  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSF  190



>sp|P07371.1|CB22_PEA RecName: Full=Chlorophyll a-b binding protein AB80, chloroplastic; 
AltName: Full=LHCII type I CAB-AB80; Short=LHCP; Flags: 
Precursor [Pisum sativum]
 gb|AAA63413.1| cab precursor [Pisum sativum]
 gb|AAA33651.1| polypeptide 15 precursor [Pisum sativum]
 prf||1006296A protein,chlorophyll a/b binding
Length=269

 Score =   325 bits (834),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 158/184 (86%), Positives = 169/184 (92%), Gaps = 1/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
             AGK +K +PS+ E  G A+FTMRK+A   +  SSGSPWYGPDRVKYLGPFSGE PSYLT
Sbjct  16   LAGKQLKLNPSSQEL-GAARFTMRKSATTKKVASSGSPWYGPDRVKYLGPFSGESPSYLT  74

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETF+KNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  75   GEFPGDYGWDTAGLSADPETFSKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  134

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  135  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVVDPLYP  194

Query  656  GGSF  667
            GGSF
Sbjct  195  GGSF  198



>gb|EPS64140.1| chlorophyll a-b binding protein 21, chloroplastic [Genlisea aurea]
Length=265

 Score =   325 bits (833),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 158/184 (86%), Positives = 170/184 (92%), Gaps = 2/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAG+AVK SPSTPE +G  + +MR+T  K  P SS SPWYGPDRVKYLGPFSGE PSYLT
Sbjct  13   FAGQAVKLSPSTPELSGKGRISMRRTVTK-TPASS-SPWYGPDRVKYLGPFSGEAPSYLT  70

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH+RWAMLGALG +FPELL++NGVKFGEAVW
Sbjct  71   GEFPGDYGWDTAGLSADPETFAKNRELEVIHARWAMLGALGIIFPELLAKNGVKFGEAVW  130

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWA QV+LMGAVEGYR+AGGPLGE+TDPLYP
Sbjct  131  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWAVQVILMGAVEGYRVAGGPLGEVTDPLYP  190

Query  656  GGSF  667
            GGSF
Sbjct  191  GGSF  194



>gb|ABM66819.1| chloroplast light-harvesting chlorophyll a/b binding protein 
[Bambusa oldhamii]
Length=265

 Score =   325 bits (833),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 162/184 (88%), Positives = 169/184 (92%), Gaps = 2/184 (1%)
 Frame = +2

Query  116  FAGKAVKFSPSTPEFTGNAKFTMRKTAGKPEPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  295
            FAGKAVK  PS+  F G A+ TMRKT  KP+  +SGSPWYGPDRV YLGP SGEPPSYLT
Sbjct  13   FAGKAVKNVPSSGLF-GEARMTMRKTGAKPK-AASGSPWYGPDRVLYLGPLSGEPPSYLT  70

Query  296  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  475
            GEF GDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  71   GEFAGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  130

Query  476  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYP  655
            FKAG+QIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYP
Sbjct  131  FKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYP  190

Query  656  GGSF  667
            GGSF
Sbjct  191  GGSF  194



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1064095936780