BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF050P16

Length=629
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP08481.1|  unnamed protein product                                317   1e-103   Coffea canephora [robusta coffee]
ref|XP_011090165.1|  PREDICTED: serine--glyoxylate aminotransferase     315   4e-103   Sesamum indicum [beniseed]
ref|XP_010277598.1|  PREDICTED: serine--glyoxylate aminotransferase     313   4e-102   Nelumbo nucifera [Indian lotus]
ref|XP_011080387.1|  PREDICTED: serine--glyoxylate aminotransfera...    310   5e-101   Sesamum indicum [beniseed]
ref|XP_003600160.1|  Alanine glyoxylate aminotransferase                309   1e-100   
ref|XP_003600159.1|  Alanine glyoxylate aminotransferase                308   2e-100   Medicago truncatula
gb|KDO44954.1|  hypothetical protein CISIN_1g0157291mg                  306   3e-100   Citrus sinensis [apfelsine]
gb|EPS59280.1|  serine-glyoxylate aminotransferase                      308   4e-100   Genlisea aurea
ref|XP_004499480.1|  PREDICTED: serine--glyoxylate aminotransfera...    308   4e-100   
gb|AGV54322.1|  serine glyoxylate aminotransferase 2                    307   6e-100   Phaseolus vulgaris [French bean]
ref|XP_007146302.1|  hypothetical protein PHAVU_006G029100g             307   6e-100   Phaseolus vulgaris [French bean]
gb|KDO44953.1|  hypothetical protein CISIN_1g0157291mg                  307   7e-100   Citrus sinensis [apfelsine]
ref|XP_006470731.1|  PREDICTED: serine--glyoxylate aminotransfera...    307   7e-100   Citrus sinensis [apfelsine]
ref|XP_010045046.1|  PREDICTED: serine--glyoxylate aminotransferase     307   9e-100   Eucalyptus grandis [rose gum]
gb|AFK40703.1|  unknown                                                 306   1e-99    Medicago truncatula
ref|XP_006446249.1|  hypothetical protein CICLE_v10015490mg             306   1e-99    Citrus clementina [clementine]
ref|XP_008227244.1|  PREDICTED: serine--glyoxylate aminotransferase     306   1e-99    Prunus mume [ume]
ref|NP_001265946.1|  Hop-interacting protein THI032                     306   2e-99    Solanum lycopersicum
ref|XP_006349776.1|  PREDICTED: serine--glyoxylate aminotransfera...    306   2e-99    Solanum tuberosum [potatoes]
ref|XP_009342610.1|  PREDICTED: serine--glyoxylate aminotransferase     306   2e-99    Pyrus x bretschneideri [bai li]
ref|XP_008363560.1|  PREDICTED: serine--glyoxylate aminotransferase     305   3e-99    Malus domestica [apple tree]
ref|XP_006584642.1|  PREDICTED: enzymatic resistance protein isof...    305   3e-99    Glycine max [soybeans]
ref|NP_001237048.1|  enzymatic resistance protein                       305   4e-99    
gb|ACJ61247.1|  serine glyoxylate aminotransferase 3                    305   4e-99    Glycine max [soybeans]
ref|XP_006843377.1|  hypothetical protein AMTR_s00053p00093890          305   5e-99    Amborella trichopoda
ref|XP_006369572.1|  hypothetical protein POPTR_0001s26020g             302   5e-99    
ref|XP_004291746.1|  PREDICTED: serine--glyoxylate aminotransferase     304   9e-99    Fragaria vesca subsp. vesca
ref|XP_009619693.1|  PREDICTED: serine--glyoxylate aminotransferase     303   2e-98    Nicotiana tomentosiformis
ref|XP_009775939.1|  PREDICTED: serine--glyoxylate aminotransferase     303   2e-98    Nicotiana sylvestris
ref|XP_008359496.1|  PREDICTED: serine--glyoxylate aminotransferase     303   2e-98    
ref|XP_010938608.1|  PREDICTED: serine--glyoxylate aminotransfera...    303   2e-98    Elaeis guineensis
ref|NP_001276276.1|  serine--glyoxylate aminotransferase-like           303   2e-98    Glycine max [soybeans]
gb|KHN28521.1|  Serine--glyoxylate aminotransferase                     303   2e-98    Glycine soja [wild soybean]
ref|XP_007212264.1|  hypothetical protein PRUPE_ppa006653mg             303   2e-98    Prunus persica
ref|XP_011032100.1|  PREDICTED: serine--glyoxylate aminotransfera...    303   3e-98    Populus euphratica
ref|XP_002313371.1|  aminotransferase 2 family protein                  303   3e-98    
gb|ABA00460.1|  serine-glyoxylate aminotransferase                      303   3e-98    Spirodela polyrhiza
ref|XP_011043786.1|  PREDICTED: serine--glyoxylate aminotransferase     303   4e-98    Populus euphratica
ref|XP_008812510.1|  PREDICTED: serine--glyoxylate aminotransferase     302   6e-98    Phoenix dactylifera
ref|XP_002298306.1|  hypothetical protein POPTR_0001s26020g             302   7e-98    Populus trichocarpa [western balsam poplar]
gb|ACJ61246.1|  serine glyoxylate aminotransferase 2                    301   8e-98    Glycine max [soybeans]
ref|XP_009338530.1|  PREDICTED: serine--glyoxylate aminotransfera...    301   8e-98    
gb|ABK96624.1|  unknown                                                 301   9e-98    Populus trichocarpa x Populus deltoides
ref|XP_006369573.1|  hypothetical protein POPTR_0001s26020g             301   9e-98    
gb|AGL09526.1|  alanine-glyoxylate aminotransferase                     297   1e-97    Peperomia prostrata
gb|AGT38285.1|  serine--glyoxylate aminotransferase                     301   2e-97    Gossypium hirsutum [American cotton]
ref|XP_007015204.1|  Alanine:glyoxylate aminotransferase isoform 1      301   2e-97    
dbj|BAJ33858.1|  unnamed protein product                                301   2e-97    Eutrema halophilum
gb|AGL09527.1|  alanine-glyoxylate aminotransferase                     296   2e-97    Piper nigrum
gb|KDP35982.1|  hypothetical protein JCGZ_08377                         300   4e-97    Jatropha curcas
ref|XP_009410322.1|  PREDICTED: serine--glyoxylate aminotransfera...    300   5e-97    Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY37208.1|  BnaA09g08290D                                          300   5e-97    Brassica napus [oilseed rape]
gb|ABQ81925.1|  aminotransferase 2                                      300   6e-97    Cucumis melo [Oriental melon]
ref|XP_010094254.1|  Serine--glyoxylate aminotransferase                298   6e-97    Morus notabilis
gb|KHG29969.1|  Serine--glyoxylate aminotransferase -like protein       299   7e-97    Gossypium arboreum [tree cotton]
ref|XP_008449670.1|  PREDICTED: serine--glyoxylate aminotransfera...    299   7e-97    Cucumis melo [Oriental melon]
gb|AAL62332.1|AF461048_1  aminotransferase 2                            299   8e-97    Cucumis melo [Oriental melon]
ref|NP_001284445.1|  serine--glyoxylate aminotransferase-like           299   9e-97    Cucumis melo [Oriental melon]
emb|CDX81443.1|  BnaC09g08540D                                          299   1e-96    
ref|XP_006409690.1|  hypothetical protein EUTSA_v10022711mg             298   1e-96    
ref|XP_009112244.1|  PREDICTED: serine--glyoxylate aminotransferase     298   2e-96    Brassica rapa
gb|KJB54389.1|  hypothetical protein B456_009G074800                    298   2e-96    Gossypium raimondii
gb|ABQ81922.1|  aminotransferase 2                                      298   2e-96    Cucumis sativus [cucumbers]
gb|AGL09524.1|  alanine-glyoxylate aminotransferase                     294   2e-96    Calycanthus occidentalis [California-allspice]
ref|XP_004140203.1|  PREDICTED: serine--glyoxylate aminotransfera...    298   3e-96    Cucumis sativus [cucumbers]
emb|CDX89604.1|  BnaC03g45180D                                          297   4e-96    
ref|XP_009136209.1|  PREDICTED: serine--glyoxylate aminotransfera...    297   5e-96    Brassica rapa
gb|KHG14448.1|  Serine--glyoxylate aminotransferase -like protein       297   5e-96    Gossypium arboreum [tree cotton]
gb|AGL09530.1|  alanine-glyoxylate aminotransferase                     293   6e-96    Xymalos monospora
ref|XP_010909203.1|  PREDICTED: serine--glyoxylate aminotransferase     297   7e-96    Elaeis guineensis
gb|ABQ81924.1|  aminotransferase 2                                      296   9e-96    Cucumis sativus [cucumbers]
ref|XP_002531124.1|  serine-pyruvate aminotransferase, putative         296   2e-95    Ricinus communis
gb|AAL47679.1|  aminotransferase 1                                      296   2e-95    Cucumis melo [Oriental melon]
ref|XP_006297832.1|  hypothetical protein CARUB_v10013869mg             295   3e-95    Capsella rubella
gb|AAQ56192.1|  aminotransferase 1                                      295   3e-95    Cucumis melo [Oriental melon]
ref|XP_009415566.1|  PREDICTED: serine--glyoxylate aminotransferase     295   4e-95    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002885871.1|  hypothetical protein ARALYDRAFT_480305             295   5e-95    
ref|NP_001284450.1|  serine--glyoxylate aminotransferase                294   8e-95    Cucumis melo [Oriental melon]
gb|AAQ56193.1|  aminotransferase 2                                      294   8e-95    Cucumis melo [Oriental melon]
ref|XP_010488837.1|  PREDICTED: serine--glyoxylate aminotransfera...    294   1e-94    Camelina sativa [gold-of-pleasure]
ref|XP_010518509.1|  PREDICTED: serine--glyoxylate aminotransfera...    294   1e-94    Camelina sativa [gold-of-pleasure]
ref|XP_004139054.1|  PREDICTED: serine--glyoxylate aminotransfera...    293   2e-94    Cucumis sativus [cucumbers]
ref|NP_178969.1|  alanine--glyoxylate aminotransferase                  293   2e-94    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010557501.1|  PREDICTED: serine--glyoxylate aminotransferase     293   2e-94    Tarenaya hassleriana [spider flower]
gb|AAB95218.1|  putative serine-glyoxylate aminotransferase             293   2e-94    Fritillaria agrestis
ref|XP_010467178.1|  PREDICTED: serine--glyoxylate aminotransfera...    294   4e-94    Camelina sativa [gold-of-pleasure]
ref|XP_010673724.1|  PREDICTED: serine--glyoxylate aminotransferase     292   6e-94    Beta vulgaris subsp. vulgaris [field beet]
gb|AGL09523.1|  alanine-glyoxylate aminotransferase                     287   1e-93    Asarum caudatum
gb|ABR26028.1|  serine-glyoxylate aminotransferase                      283   2e-93    Oryza sativa Indica Group [Indian rice]
dbj|BAJ90006.1|  predicted protein                                      288   2e-92    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003574732.2|  PREDICTED: serine--glyoxylate aminotransferase     290   2e-92    Brachypodium distachyon [annual false brome]
gb|EMS66805.1|  Serine--glyoxylate aminotransferase                     286   1e-91    Triticum urartu
ref|XP_004973838.1|  PREDICTED: serine--glyoxylate aminotransfera...    286   1e-91    Setaria italica
ref|XP_002279236.1|  PREDICTED: serine--glyoxylate aminotransferase     286   1e-91    Vitis vinifera
emb|CAN84001.1|  hypothetical protein VITISV_007680                     286   1e-91    Vitis vinifera
ref|XP_004973837.1|  PREDICTED: serine--glyoxylate aminotransfera...    286   3e-91    
ref|NP_001062170.1|  Os08g0502700                                       284   5e-91    
ref|XP_006659561.1|  PREDICTED: serine--glyoxylate aminotransfera...    284   1e-90    Oryza brachyantha
ref|XP_002444789.1|  hypothetical protein SORBIDRAFT_07g028080          281   9e-90    Sorghum bicolor [broomcorn]
gb|AGL09528.1|  alanine-glyoxylate aminotransferase                     275   8e-89    Saururus cernuus [swamp lily]
ref|XP_004491262.1|  PREDICTED: serine--glyoxylate aminotransfera...    276   1e-87    Cicer arietinum [garbanzo]
ref|XP_003617296.1|  Alanine glyoxylate aminotransferase                273   2e-86    Medicago truncatula
gb|ABF70331.1|  aminotransferase 1                                      271   5e-86    Cucumis sativus [cucumbers]
tpg|DAA47863.1|  TPA: hypothetical protein ZEAMMB73_595389              268   4e-85    
ref|NP_001148339.1|  LOC100281949                                       268   7e-85    Zea mays [maize]
gb|AGL09525.1|  alanine-glyoxylate aminotransferase                     253   2e-80    Manekia incurva
gb|AGL09531.1|  alanine-glyoxylate aminotransferase                     249   6e-79    Zippelia begoniifolia
gb|AGL09529.1|  alanine-glyoxylate aminotransferase                     248   1e-78    Thottea sp. JN-2013
gb|ABR16109.1|  unknown                                                 248   3e-77    Picea sitchensis
gb|ACN39798.1|  unknown                                                 248   5e-77    Picea sitchensis
ref|XP_008666464.1|  PREDICTED: serine--glyoxylate aminotransfera...    242   8e-77    Zea mays [maize]
gb|ABK24112.1|  unknown                                                 248   8e-77    Picea sitchensis
tpg|DAA47874.1|  TPA: hypothetical protein ZEAMMB73_131074              242   5e-76    
ref|XP_001783551.1|  predicted protein                                  243   9e-75    
emb|CBI24214.3|  unnamed protein product                                241   2e-74    Vitis vinifera
ref|XP_001755667.1|  predicted protein                                  241   3e-74    
gb|AEX09293.1|  alanine glyoxylate aminotransferase                     237   3e-73    Peperomia rupiseda
gb|AEX09262.1|  alanine glyoxylate aminotransferase                     236   4e-73    Peperomia aff. ovatopeltata JN-2011
ref|XP_002983655.1|  hypothetical protein SELMODRAFT_228964             238   5e-73    
gb|AEX09255.1|  alanine glyoxylate aminotransferase                     237   5e-73    Peperomia bracteata
ref|XP_002990557.1|  hypothetical protein SELMODRAFT_448066             238   6e-73    Selaginella moellendorffii
gb|AEX09248.1|  alanine glyoxylate aminotransferase                     236   6e-73    Peperomia questionis
gb|AEX09252.1|  alanine glyoxylate aminotransferase                     236   7e-73    Peperomia exclamationis
gb|AEX09287.1|  alanine glyoxylate aminotransferase                     235   1e-72    Peperomia cerrateae
gb|AEX09282.1|  alanine glyoxylate aminotransferase                     235   1e-72    Peperomia cerrateae
gb|AEX09251.1|  alanine glyoxylate aminotransferase                     235   1e-72    Peperomia schizandra
gb|AEX09288.1|  alanine glyoxylate aminotransferase                     235   1e-72    Peperomia parvisagittata
gb|AEX09308.1|  alanine glyoxylate aminotransferase                     235   1e-72    Peperomia polycephala
gb|AEX09305.1|  alanine glyoxylate aminotransferase                     235   2e-72    Peperomia pseudoverruculosa
gb|AEX09250.1|  alanine glyoxylate aminotransferase                     235   2e-72    Peperomia schizandra
gb|AEX09246.1|  alanine glyoxylate aminotransferase                     234   2e-72    Peperomia elatior
gb|AEX09249.1|  alanine glyoxylate aminotransferase                     235   3e-72    Peperomia aff. gracillima JN-2011
gb|AEX09273.1|  alanine glyoxylate aminotransferase                     235   3e-72    Peperomia cerrateae
gb|AEX09245.1|  alanine glyoxylate aminotransferase                     234   4e-72    Peperomia putlaensis
gb|AEX09310.1|  alanine glyoxylate aminotransferase                     233   5e-72    Peperomia wernerrauhii
gb|AEX09266.1|  alanine glyoxylate aminotransferase                     234   6e-72    Peperomia peruviana
gb|AEX09263.1|  alanine glyoxylate aminotransferase                     234   6e-72    Peperomia putlaensis
gb|AEX09268.1|  alanine glyoxylate aminotransferase                     234   6e-72    Peperomia peruviana
gb|AEX09244.1|  alanine glyoxylate aminotransferase                     233   6e-72    Peperomia basiradicans
gb|AEX09274.1|  alanine glyoxylate aminotransferase                     234   7e-72    Peperomia peruviana
gb|AEX09302.1|  alanine glyoxylate aminotransferase                     233   7e-72    Peperomia sp. JN-2011
gb|AEX09283.1|  alanine glyoxylate aminotransferase                     233   7e-72    Peperomia peruviana
gb|AEX09301.1|  alanine glyoxylate aminotransferase                     234   7e-72    Peperomia sp. JN-2011
gb|AEX09286.1|  alanine glyoxylate aminotransferase                     234   7e-72    Peperomia cyclaminoides
gb|AEX09300.1|  alanine glyoxylate aminotransferase                     234   8e-72    Peperomia parvifolia
gb|AEX09295.1|  alanine glyoxylate aminotransferase                     233   8e-72    Peperomia pugnicaudex
gb|AEX09306.1|  alanine glyoxylate aminotransferase                     234   8e-72    Peperomia peruviana
gb|AEX09277.1|  alanine glyoxylate aminotransferase                     233   9e-72    Peperomia cyclaminoides
gb|AEX09253.1|  alanine glyoxylate aminotransferase                     233   1e-71    Peperomia bracteata
gb|AEX09257.1|  alanine glyoxylate aminotransferase                     233   1e-71    Peperomia bracteata
gb|AEX09275.1|  alanine glyoxylate aminotransferase                     233   1e-71    Peperomia parvisagittata
gb|AEX09270.1|  alanine glyoxylate aminotransferase                     233   1e-71    Peperomia verruculosa
gb|AEX09311.1|  alanine glyoxylate aminotransferase                     233   1e-71    Peperomia andina
gb|AEX09298.1|  alanine glyoxylate aminotransferase                     233   1e-71    Peperomia cerrateae
gb|AEX09260.1|  alanine glyoxylate aminotransferase                     232   2e-71    Peperomia aff. ovatopeltata JN-2011
gb|AEX09309.1|  alanine glyoxylate aminotransferase                     232   2e-71    Peperomia wernerrauhii
gb|AEX09256.1|  alanine glyoxylate aminotransferase                     232   3e-71    Peperomia bracteata
gb|AEX09304.1|  alanine glyoxylate aminotransferase                     232   3e-71    Peperomia chutanka
gb|AEX09258.1|  alanine glyoxylate aminotransferase                     232   3e-71    Peperomia bracteata
gb|AEX09292.1|  alanine glyoxylate aminotransferase                     231   4e-71    Peperomia klopfensteinii
gb|AEX09299.1|  alanine glyoxylate aminotransferase                     231   6e-71    Peperomia cerrateae
gb|AEX09254.1|  alanine glyoxylate aminotransferase                     231   8e-71    Peperomia bracteata
gb|AEX09242.1|  alanine glyoxylate aminotransferase                     230   8e-71    Peperomia aff. pinoi JN-2011
ref|XP_001763095.1|  predicted protein                                  231   3e-70    
gb|AEX09294.1|  alanine glyoxylate aminotransferase                     229   4e-70    Peperomia sp. JN-2011
gb|AEX09267.1|  alanine glyoxylate aminotransferase                     228   1e-69    Peperomia radiatinervosa
gb|AEX09276.1|  alanine glyoxylate aminotransferase                     228   2e-69    Peperomia parvisagittata
gb|ADO24297.1|  aminotransferase                                        215   8e-68    Valeriana jatamansi
gb|EYU35937.1|  hypothetical protein MIMGU_mgv1a026291mg                220   1e-66    Erythranthe guttata [common monkey flower]
gb|ADG26437.1|  putative aminotransferase                               209   2e-65    Valeriana jatamansi
gb|EMT09291.1|  Serine--glyoxylate aminotransferase                     213   1e-64    
gb|AEX09303.1|  alanine glyoxylate aminotransferase                     215   1e-64    Peperomia ayacuchoana
ref|XP_002970880.1|  hypothetical protein SELMODRAFT_147375             216   2e-64    Selaginella moellendorffii
ref|XP_002969615.1|  hypothetical protein SELMODRAFT_267279             216   2e-64    Selaginella moellendorffii
gb|AEX09259.1|  alanine glyoxylate aminotransferase                     214   2e-64    Peperomia bracteata
gb|AEX09307.1|  alanine glyoxylate aminotransferase                     213   8e-64    Peperomia verruculosa
gb|AEX09291.1|  alanine glyoxylate aminotransferase                     211   1e-63    Peperomia jalcaensis
gb|AEX09284.1|  alanine glyoxylate aminotransferase                     211   2e-63    Peperomia peruviana
gb|AEX09272.1|  alanine glyoxylate aminotransferase                     211   3e-63    Peperomia cyclaminoides
gb|AEX09265.1|  alanine glyoxylate aminotransferase                     211   4e-63    Peperomia radiatinervosa
gb|AEX09264.1|  alanine glyoxylate aminotransferase                     209   2e-62    Peperomia radiatinervosa
gb|AEX09285.1|  alanine glyoxylate aminotransferase                     206   2e-61    Peperomia radiatinervosa
gb|AEX09271.1|  alanine glyoxylate aminotransferase                     202   7e-60    Peperomia peruviana
gb|AEX09261.1|  alanine glyoxylate aminotransferase                     198   2e-58    Peperomia aff. ovatopeltata JN-2011
gb|AEX09247.1|  alanine glyoxylate aminotransferase                     198   2e-58    Peperomia cavispicata
gb|AEX09281.1|  alanine glyoxylate aminotransferase                     195   3e-57    Peperomia cyclaminoides
ref|XP_005709273.1|  serine--glyoxylate transaminase                    196   1e-56    Galdieria sulphuraria
gb|AEX09269.1|  alanine glyoxylate aminotransferase                     194   1e-56    Peperomia peruviana
gb|AEX09243.1|  alanine glyoxylate aminotransferase                     192   1e-56    Peperomia sp. JN-2011
gb|AEX09290.1|  alanine glyoxylate aminotransferase                     193   2e-56    Peperomia dolabella
gb|AEX09280.1|  alanine glyoxylate aminotransferase                     192   6e-56    Peperomia peruviana
ref|WP_017485211.1|  serine--glyoxylate aminotransferase                192   2e-55    Methylobacterium sp. MB200
gb|AEX09289.1|  alanine glyoxylate aminotransferase                     190   2e-55    Peperomia gigantea
gb|ACN36238.1|  unknown                                                 190   2e-55    Zea mays [maize]
ref|WP_015950680.1|  serine--glyoxylate aminotransferase                190   1e-54    Methylorubrum extorquens
ref|WP_026610206.1|  serine--glyoxylate aminotransferase                190   2e-54    Methylocaldum szegediense
ref|XP_005648727.1|  serine glyoxylate aminotransferase                 191   2e-54    Coccomyxa subellipsoidea C-169
ref|WP_010960683.1|  serine--glyoxylate aminotransferase                189   2e-54    Methylococcus capsulatus
ref|WP_020188076.1|  hypothetical protein                               189   3e-54    Methylopila sp. 73B
ref|WP_012453656.1|  serine--glyoxylate aminotransferase                189   3e-54    Methylorubrum populi
ref|WP_012253362.1|  serine--glyoxylate aminotransferase                189   4e-54    Methylobacteriaceae
ref|WP_003597639.1|  serine--glyoxylate aminotransferase                189   4e-54    Methylobacteriaceae
ref|WP_041930245.1|  serine--glyoxylate aminotransferase                188   7e-54    
ref|WP_026362994.1|  serine--glyoxylate aminotransferase                188   9e-54    Methylopila sp. M107
gb|ABM96214.1|  serine-glyoxylate aminotransferase                      188   9e-54    Methylibium petroleiphilum PM1
dbj|BAQ46928.1|  serine--glyoxylate aminotransferase                    187   3e-53    Methylobacterium aquaticum
ref|WP_014149643.1|  serine--glyoxylate aminotransferase                186   4e-53    Methylomicrobium alcaliphilum
ref|WP_018238561.1|  serine--glyoxylate aminotransferase                186   4e-53    Ensifer sp. BR816
ref|WP_014762956.1|  serine--glyoxylate aminotransferase                186   5e-53    Sinorhizobium fredii
ref|WP_036230592.1|  MULTISPECIES: serine--glyoxylate aminotransf...    186   5e-53    Methylibium
ref|WP_017840623.1|  serine--glyoxylate aminotransferase                186   6e-53    Methylomicrobium buryatense
ref|WP_027156802.1|  serine--glyoxylate aminotransferase                185   8e-53    Methylobacter luteus
ref|WP_037416404.1|  serine--glyoxylate aminotransferase                184   3e-52    Sinorhizobium sp. CCBAU 05631
ref|WP_003535479.1|  serine--glyoxylate aminotransferase                183   5e-52    Sinorhizobium meliloti
ref|WP_034858116.1|  serine--glyoxylate aminotransferase                183   5e-52    Ensifer sojae
ref|WP_007559580.1|  serine--glyoxylate aminotransferase                183   7e-52    Methylobacterium
ref|WP_027147316.1|  MULTISPECIES: serine--glyoxylate aminotransf...    182   8e-52    Methylobacter
ref|WP_026597137.1|  serine--glyoxylate aminotransferase                182   1e-51    Methylobacterium sp. 77
ref|WP_014329402.1|  serine--glyoxylate aminotransferase                182   1e-51    Sinorhizobium fredii
ref|WP_036253086.1|  serine--glyoxylate aminotransferase                182   1e-51    Methylobacter sp. BBA5.1
ref|WP_026622911.1|  serine--glyoxylate aminotransferase                182   1e-51    Ensifer sp. WSM1721
ref|WP_018410273.1|  serine--glyoxylate aminotransferase                182   1e-51    Methyloversatilis thermotolerans
ref|WP_031434945.1|  serine--glyoxylate aminotransferase                182   2e-51    Methylomarinum vadi
ref|WP_027999163.1|  serine--glyoxylate aminotransferase                182   2e-51    Sinorhizobium arboris
ref|WP_028755163.1|  serine--glyoxylate aminotransferase                182   2e-51    Rhizobium leucaenae
ref|WP_022947294.1|  serine--glyoxylate aminotransferase                182   2e-51    Methylohalobius crimeensis
ref|XP_003617694.1|  Alanine glyoxylate aminotransferase                181   2e-51    
ref|WP_040961132.1|  serine--glyoxylate aminotransferase                182   2e-51    Sinorhizobium fredii
ref|WP_005371842.1|  MULTISPECIES: serine--glyoxylate aminotransf...    181   3e-51    Methylomicrobium agile
ref|WP_027172630.1|  serine--glyoxylate aminotransferase                181   3e-51    Methylobacterium
ref|WP_026175686.1|  serine--glyoxylate aminotransferase                181   3e-51    Methylobacterium sp. 88A
ref|WP_026616975.1|  serine--glyoxylate aminotransferase                181   3e-51    Sinorhizobium/Ensifer group
ref|WP_018329867.1|  serine--glyoxylate aminotransferase                181   3e-51    Rhizobium giardinii
ref|WP_037384071.1|  serine--glyoxylate aminotransferase                181   5e-51    Sinorhizobium americanum
ref|WP_006890572.1|  serine--glyoxylate aminotransferase                181   5e-51    Methylobacter tundripaludum
ref|WP_037131645.1|  serine--glyoxylate aminotransferase                181   5e-51    Rhizobium sp. CF097
ref|WP_031437003.1|  serine--glyoxylate aminotransferase                180   6e-51    Methylobacter tundripaludum
ref|WP_012709136.1|  serine--glyoxylate aminotransferase                181   6e-51    Sinorhizobium fredii
ref|WP_028223486.1|  serine--glyoxylate aminotransferase                181   6e-51    Paraburkholderia oxyphila
ref|WP_015933415.1|  serine--glyoxylate aminotransferase                181   7e-51    Methylobacterium nodulans
ref|WP_026608295.1|  serine--glyoxylate aminotransferase                181   7e-51    Methylocapsa acidiphila
ref|WP_012320605.1|  MULTISPECIES: serine--glyoxylate aminotransf...    181   7e-51    Methylobacterium
ref|WP_040580464.1|  serine--glyoxylate aminotransferase                180   1e-50    
ref|WP_035937801.1|  serine--glyoxylate aminotransferase                180   1e-50    Caballeronia glathei
ref|WP_026223456.1|  serine--glyoxylate aminotransferase                179   1e-50    Methylosarcina fibrata
ref|WP_012590731.1|  serine--glyoxylate aminotransferase                179   1e-50    Methylocella silvestris
ref|XP_001702107.1|  serine glyoxylate aminotransferase                 180   2e-50    Chlamydomonas reinhardtii
ref|WP_027168976.1|  serine--glyoxylate aminotransferase                179   2e-50    Mesorhizobium sp. WSM3224
ref|XP_001702106.1|  serine glyoxylate aminotransferase                 180   3e-50    Chlamydomonas reinhardtii
ref|WP_024298006.1|  serine--glyoxylate aminotransferase                179   3e-50    Methylosarcina lacus
ref|WP_007585769.1|  serine--glyoxylate aminotransferase                179   3e-50    Paraburkholderia hospita
ref|WP_035994918.1|  serine--glyoxylate aminotransferase                179   3e-50    Paraburkholderia caribensis
ref|WP_042306504.1|  serine--glyoxylate aminotransferase                179   3e-50    Paraburkholderia terrae
ref|WP_007742731.1|  serine--glyoxylate aminotransferase                179   3e-50    Burkholderiaceae
ref|WP_020092657.1|  serine--glyoxylate aminotransferase                179   3e-50    Methylobacterium
ref|WP_010687105.1|  Aminotransferase class V                           179   3e-50    Methylobacterium mesophilicum
ref|WP_042673896.1|  serine--glyoxylate aminotransferase                179   3e-50    Methylobacterium sp. B34
ref|WP_028367172.1|  serine--glyoxylate aminotransferase                179   4e-50    Burkholderia sp. UYPR1.413
ref|WP_043385155.1|  MULTISPECIES: serine--glyoxylate aminotransf...    178   4e-50    Methylobacterium
ref|WP_006203221.1|  serine--glyoxylate aminotransferase                178   5e-50    Mesorhizobium amorphae
ref|WP_035525480.1|  serine--glyoxylate aminotransferase                179   6e-50    Paraburkholderia sacchari
gb|AIQ91949.1|  Aminotransferase class V                                179   6e-50    Methylobacterium oryzae CBMB20
ref|XP_002953765.1|  hypothetical protein VOLCADRAFT_75980              179   6e-50    Volvox carteri f. nagariensis
ref|WP_026190999.1|  serine--glyoxylate aminotransferase                178   6e-50    Methylobacterium sp. WSM2598
ref|WP_012336184.1|  serine--glyoxylate aminotransferase                178   6e-50    Methylobacterium sp. 4-46
gb|KJB83533.1|  hypothetical protein B456_013G252200                    176   7e-50    Gossypium raimondii
ref|WP_023496630.1|  serine--glyoxylate aminotransferase SgaA           177   7e-50    Methyloglobulus morosus
ref|WP_012405153.1|  serine--glyoxylate aminotransferase                178   7e-50    Paraburkholderia phymatum
ref|WP_027061369.1|  serine--glyoxylate aminotransferase                177   8e-50    Mesorhizobium loti
ref|WP_027029542.1|  serine--glyoxylate aminotransferase                177   8e-50    Mesorhizobium loti
ref|WP_028212654.1|  serine--glyoxylate aminotransferase                178   9e-50    Paraburkholderia mimosarum
ref|WP_013819317.1|  serine--glyoxylate aminotransferase                177   9e-50    Methylomonas methanica
ref|WP_036271184.1|  serine--glyoxylate aminotransferase                177   9e-50    Methyloversatilis universalis
ref|WP_043355705.1|  serine--glyoxylate aminotransferase                177   1e-49    Methylobacterium
ref|WP_023829410.1|  serine--glyoxylate aminotransferase                177   2e-49    Mesorhizobium sp. L103C120A0
ref|XP_003615391.1|  Alanine glyoxylate aminotransferase                175   3e-49    
ref|WP_040969922.1|  serine--glyoxylate aminotransferase                176   3e-49    Mesorhizobium sp. ORS 3324
ref|WP_019867322.1|  serine--glyoxylate aminotransferase                176   3e-49    Methylovulum miyakonense
ref|WP_036260471.1|  serine--glyoxylate aminotransferase                176   3e-49    Methylocapsa aurea
ref|WP_023805485.1|  serine--glyoxylate aminotransferase                176   4e-49    
ref|WP_023670792.1|  serine--glyoxylate aminotransferase                176   4e-49    
ref|WP_023714322.1|  serine--glyoxylate aminotransferase                176   5e-49    
ref|WP_008058631.1|  serine--glyoxylate aminotransferase                176   5e-49    
ref|WP_023818017.1|  serine--glyoxylate aminotransferase                175   6e-49    
ref|WP_023690293.1|  serine--glyoxylate aminotransferase                175   6e-49    
ref|WP_023712721.1|  MULTISPECIES: serine--glyoxylate aminotransf...    175   6e-49    
ref|WP_043363897.1|  serine--glyoxylate aminotransferase                175   6e-49    
ref|WP_027051273.1|  serine--glyoxylate aminotransferase                175   7e-49    
ref|WP_029644281.1|  serine--glyoxylate aminotransferase                175   7e-49    
ref|WP_023700366.1|  serine--glyoxylate aminotransferase                175   7e-49    
ref|WP_027146511.1|  serine--glyoxylate aminotransferase                175   8e-49    
ref|WP_023822176.1|  serine--glyoxylate aminotransferase                175   9e-49    
ref|WP_015317366.1|  serine--glyoxylate aminotransferase                175   1e-48    
gb|ADO24296.1|  aminotransferase                                        166   1e-48    
ref|XP_005851882.1|  hypothetical protein CHLNCDRAFT_33614              176   1e-48    
ref|WP_024925735.1|  MULTISPECIES: serine--glyoxylate aminotransf...    174   1e-48    
ref|WP_023685219.1|  serine--glyoxylate aminotransferase                174   1e-48    
ref|WP_023690974.1|  MULTISPECIES: serine--glyoxylate aminotransf...    174   1e-48    
ref|WP_023698325.1|  serine--glyoxylate aminotransferase                174   1e-48    
ref|WP_023731220.1|  MULTISPECIES: serine--glyoxylate aminotransf...    174   1e-48    
ref|WP_023706127.1|  MULTISPECIES: serine--glyoxylate aminotransf...    174   2e-48    
ref|WP_042643125.1|  serine--glyoxylate aminotransferase                174   2e-48    
ref|WP_041003840.1|  serine--glyoxylate aminotransferase                174   2e-48    
ref|WP_041007618.1|  serine--glyoxylate aminotransferase                174   2e-48    
ref|WP_040981991.1|  serine--glyoxylate aminotransferase                174   2e-48    
ref|WP_023753463.1|  MULTISPECIES: serine--glyoxylate aminotransf...    174   3e-48    
ref|WP_043774228.1|  serine--glyoxylate aminotransferase                174   3e-48    
ref|WP_023741624.1|  serine--glyoxylate aminotransferase                173   3e-48    
ref|WP_023746858.1|  MULTISPECIES: serine--glyoxylate aminotransf...    173   3e-48    
ref|WP_023833857.1|  serine--glyoxylate aminotransferase                173   4e-48    
ref|WP_023739129.1|  MULTISPECIES: serine--glyoxylate aminotransf...    173   4e-48    
ref|WP_013894918.1|  serine--glyoxylate aminotransferase                173   4e-48    
ref|WP_032930697.1|  serine--glyoxylate aminotransferase                173   5e-48    
ref|WP_023827347.1|  serine--glyoxylate aminotransferase                172   6e-48    
ref|WP_027044922.1|  serine--glyoxylate aminotransferase                172   6e-48    
ref|WP_041011880.1|  serine--glyoxylate aminotransferase                172   7e-48    
ref|WP_018267457.1|  serine--glyoxylate aminotransferase                172   7e-48    
ref|WP_015314900.1|  serine--glyoxylate aminotransferase                172   8e-48    
ref|WP_019858769.1|  serine--glyoxylate aminotransferase                172   8e-48    
ref|WP_023763335.1|  serine--glyoxylate aminotransferase                172   1e-47    
ref|WP_010910076.1|  serine--glyoxylate aminotransferase                172   1e-47    
ref|WP_023782620.1|  serine--glyoxylate aminotransferase                171   2e-47    
ref|WP_031597721.1|  serine--glyoxylate aminotransferase                171   2e-47    
ref|WP_037283573.1|  serine--glyoxylate aminotransferase                171   2e-47    
ref|WP_003613273.1|  serine--glyoxylate aminotransferase                171   2e-47    
ref|WP_026227793.1|  serine--glyoxylate aminotransferase                171   2e-47    
ref|WP_036293367.1|  serine--glyoxylate aminotransferase                171   2e-47    
ref|WP_023779196.1|  serine--glyoxylate aminotransferase                171   3e-47    
ref|WP_018405893.1|  serine--glyoxylate aminotransferase                171   3e-47    
ref|WP_029648781.1|  serine--glyoxylate aminotransferase                170   5e-47    
ref|WP_024878012.1|  MULTISPECIES: serine--glyoxylate aminotransf...    170   5e-47    
ref|WP_014890662.1|  serine--glyoxylate aminotransferase                170   5e-47    
ref|WP_023769804.1|  MULTISPECIES: serine--glyoxylate aminotransf...    170   5e-47    
ref|WP_013529882.1|  serine--glyoxylate aminotransferase                170   5e-47    
ref|WP_028097617.1|  serine--glyoxylate aminotransferase                170   5e-47    
ref|WP_009211467.1|  serine--glyoxylate aminotransferase                170   6e-47    
ref|WP_037268413.1|  serine--glyoxylate aminotransferase                170   7e-47    
ref|WP_037245168.1|  serine--glyoxylate aminotransferase                170   8e-47    
ref|WP_014955398.1|  serine--glyoxylate aminotransferase                169   8e-47    
ref|WP_009817966.1|  serine--glyoxylate aminotransferase                170   9e-47    
gb|ACJ84853.1|  unknown                                                 159   2e-46    
ref|WP_024351906.1|  serine--glyoxylate aminotransferase                169   2e-46    
ref|WP_040618186.1|  serine--glyoxylate aminotransferase                168   4e-46    
ref|WP_020085137.1|  serine--glyoxylate aminotransferase                167   5e-46    
ref|WP_023434100.1|  Serine--glyoxylate aminotransferase                167   6e-46    
ref|WP_016921634.1|  serine--glyoxylate aminotransferase                167   7e-46    
ref|WP_038511699.1|  serine--glyoxylate aminotransferase                167   1e-45    
ref|WP_036274731.1|  serine--glyoxylate aminotransferase                167   1e-45    
ref|WP_013949995.1|  MULTISPECIES: serine--glyoxylate aminotransf...    167   1e-45    
gb|AFZ62596.1|  serine-glyoxylate aminotransferase                      167   1e-45    
ref|WP_020482091.1|  serine--glyoxylate aminotransferase                166   1e-45    
ref|WP_041319044.1|  serine--glyoxylate aminotransferase                166   1e-45    
ref|WP_026604426.1|  serine--glyoxylate aminotransferase                166   1e-45    
ref|WP_037133426.1|  serine--glyoxylate aminotransferase                166   1e-45    
ref|WP_027163728.1|  serine--glyoxylate aminotransferase                166   1e-45    
ref|WP_024505109.1|  serine--glyoxylate aminotransferase                166   2e-45    
ref|WP_043847105.1|  serine--glyoxylate aminotransferase                166   2e-45    
gb|AHJ64409.1|  Serine-pyruvate aminotransferase                        167   2e-45    
ref|WP_008280158.1|  serine--glyoxylate aminotransferase                166   2e-45    
ref|WP_020592928.1|  hypothetical protein                               166   2e-45    
ref|WP_033156535.1|  serine--glyoxylate aminotransferase                166   3e-45    
ref|WP_036284904.1|  serine--glyoxylate aminotransferase                166   3e-45    
ref|WP_011630756.1|  serine--glyoxylate aminotransferase                165   3e-45    
ref|WP_038515723.1|  serine--glyoxylate aminotransferase                165   4e-45    
gb|AHJ61786.1|  Serine-pyruvate aminotransferase                        166   6e-45    
gb|AHJ67030.1|  hypothetical protein GbCGDNIH2_0048                     165   7e-45    
sp|O08374.2|SGAA_HYPME  RecName: Full=Serine--glyoxylate aminotra...    164   8e-45    
ref|WP_037336675.1|  serine--glyoxylate aminotransferase                162   7e-44    
ref|WP_006005059.1|  serine--glyoxylate aminotransferase                161   1e-43    
ref|WP_033390460.1|  serine--glyoxylate aminotransferase                161   1e-43    
ref|WP_005162865.1|  Serine--glyoxylate aminotransferase                160   2e-43    
ref|WP_006344742.1|  serine--glyoxylate aminotransferase                160   2e-43    
ref|WP_013217108.1|  serine--glyoxylate aminotransferase                160   3e-43    
ref|WP_020636555.1|  serine--glyoxylate aminotransferase                160   3e-43    
ref|WP_015599474.1|  serine--glyoxylate aminotransferase                160   4e-43    
gb|KIZ03753.1|  serine--glyoxylate transaminase                         159   9e-43    
ref|WP_010239996.1|  serine--glyoxylate aminotransferase                159   1e-42    
ref|WP_044852944.1|  serine--glyoxylate aminotransferase                159   1e-42    
ref|WP_028431641.1|  serine--glyoxylate aminotransferase                158   1e-42    
ref|WP_038514775.1|  serine--glyoxylate aminotransferase                157   2e-42    
ref|WP_025312373.1|  serine--glyoxylate aminotransferase                157   3e-42    
ref|WP_019140317.1|  serine--glyoxylate aminotransferase                157   3e-42    
ref|WP_043870950.1|  serine--glyoxylate aminotransferase                157   3e-42    
ref|WP_007815045.1|  serine--glyoxylate aminotransferase                157   4e-42    
ref|XP_005539023.1|  serine-glyoxylate aminotransferase                 157   8e-42    
ref|WP_042195193.1|  serine--glyoxylate aminotransferase                155   3e-41    
ref|WP_029016266.1|  serine--glyoxylate aminotransferase                155   3e-41    
ref|WP_037429329.1|  hypothetical protein                               148   4e-41    
ref|WP_010968118.1|  serine--glyoxylate aminotransferase                154   5e-41    
ref|WP_037126267.1|  serine--glyoxylate aminotransferase                154   6e-41    
ref|WP_006219842.1|  serine--glyoxylate aminotransferase                154   8e-41    
ref|WP_014743098.1|  serine--glyoxylate aminotransferase                153   1e-40    
ref|WP_037263007.1|  serine--glyoxylate aminotransferase                153   1e-40    
ref|WP_026641447.1|  serine--glyoxylate aminotransferase                153   1e-40    
ref|WP_006224393.1|  serine--glyoxylate aminotransferase                153   2e-40    
ref|WP_026847044.1|  serine--glyoxylate aminotransferase                152   2e-40    
ref|WP_040829642.1|  serine--glyoxylate aminotransferase                152   2e-40    
ref|WP_037437029.1|  hypothetical protein                               146   2e-40    
ref|WP_017971680.1|  serine--glyoxylate aminotransferase                152   3e-40    
ref|WP_037057439.1|  serine--glyoxylate aminotransferase                152   3e-40    
ref|WP_024570173.1|  MULTISPECIES: serine--glyoxylate aminotransf...    152   3e-40    
emb|CAD13310.1|  serine-glyoxylate aminotransferase                     152   3e-40    
ref|WP_036336347.1|  serine--glyoxylate aminotransferase                152   3e-40    
ref|WP_040742470.1|  serine--glyoxylate aminotransferase                152   3e-40    
ref|WP_030358204.1|  MULTISPECIES: serine--glyoxylate aminotransf...    152   4e-40    
ref|WP_016574932.1|  Serine-glyoxylate aminotransferase                 152   4e-40    
ref|WP_013046086.1|  serine--glyoxylate aminotransferase                152   5e-40    
ref|WP_030566583.1|  serine--glyoxylate aminotransferase                151   5e-40    
ref|WP_008641541.1|  MULTISPECIES: Serine-glyoxylate aminotransfe...    151   6e-40    
ref|WP_016640027.1|  putative Serine--glyoxylate aminotransferase       151   8e-40    
ref|WP_028435927.1|  serine--glyoxylate aminotransferase                151   9e-40    
ref|WP_014869675.1|  serine--glyoxylate aminotransferase                151   9e-40    
ref|WP_007351739.1|  serine--glyoxylate aminotransferase                150   1e-39    
ref|WP_008943383.1|  serine--glyoxylate aminotransferase                151   1e-39    
ref|WP_011520033.1|  serine--glyoxylate aminotransferase                151   1e-39    
ref|WP_019452138.1|  serine--glyoxylate aminotransferase                151   1e-39    
ref|WP_030670113.1|  serine--glyoxylate aminotransferase                150   1e-39    
ref|XP_011399157.1|  Serine-glyoxylate aminotransferase                 150   1e-39    
ref|WP_015895604.1|  serine--glyoxylate aminotransferase                150   1e-39    
gb|ABZ06421.1|  putative aminotransferase class-V                       149   1e-39    
ref|WP_019015661.1|  hypothetical protein                               150   2e-39    
ref|WP_034483968.1|  serine--glyoxylate aminotransferase                150   2e-39    
ref|WP_042083882.1|  serine--glyoxylate aminotransferase                150   2e-39    
ref|WP_012177563.1|  serine--glyoxylate aminotransferase                150   2e-39    
ref|WP_020666968.1|  serine--glyoxylate aminotransferase                150   2e-39    
ref|WP_042997765.1|  serine--glyoxylate aminotransferase                150   3e-39    
ref|WP_039689210.1|  serine--glyoxylate aminotransferase                149   3e-39    
gb|EST32977.1|  serine--glyoxylate aminotransferase                     149   3e-39    
ref|WP_043769964.1|  serine--glyoxylate aminotransferase                149   3e-39    
ref|WP_031228637.1|  serine--glyoxylate aminotransferase                149   3e-39    
ref|WP_020084034.1|  serine--glyoxylate aminotransferase                149   4e-39    
ref|WP_044456571.1|  serine--glyoxylate aminotransferase                149   5e-39    
ref|WP_039396834.1|  serine--glyoxylate aminotransferase                149   5e-39    
ref|WP_029455333.1|  serine--glyoxylate aminotransferase                149   5e-39    
ref|WP_042112271.1|  serine--glyoxylate aminotransferase                149   5e-39    
ref|WP_018260236.1|  serine--glyoxylate aminotransferase                149   5e-39    
ref|WP_034505845.1|  serine--glyoxylate aminotransferase                149   6e-39    
gb|ACF06940.1|  aminotransferase class V                                147   6e-39    
ref|WP_012333270.1|  serine--glyoxylate aminotransferase                149   6e-39    
ref|WP_033449479.1|  serine--glyoxylate aminotransferase                149   7e-39    
ref|WP_015040670.1|  serine--glyoxylate aminotransferase                149   7e-39    
ref|WP_003815469.1|  serine--glyoxylate aminotransferase                149   8e-39    
ref|WP_010929438.1|  serine--glyoxylate aminotransferase                149   8e-39    
ref|WP_039596641.1|  serine--glyoxylate aminotransferase                149   8e-39    
ref|WP_006156375.1|  serine--glyoxylate aminotransferase                149   8e-39    
ref|WP_040808396.1|  serine--glyoxylate aminotransferase                148   8e-39    
ref|WP_037399714.1|  serine--glyoxylate aminotransferase                141   8e-39    
ref|WP_015929396.1|  serine--glyoxylate aminotransferase                148   8e-39    
ref|WP_008546137.1|  serine--glyoxylate aminotransferase                148   9e-39    
ref|WP_028356096.1|  serine--glyoxylate aminotransferase                148   1e-38    
ref|WP_029048453.1|  serine--glyoxylate aminotransferase                148   1e-38    
ref|WP_040651093.1|  serine--glyoxylate aminotransferase                148   1e-38    
ref|WP_011513322.1|  MULTISPECIES: serine--glyoxylate aminotransf...    148   1e-38    
ref|WP_010808567.1|  aminotransferase class V                           148   1e-38    
ref|WP_014906063.1|  MULTISPECIES: serine--glyoxylate aminotransf...    148   1e-38    
ref|WP_014982904.1|  serine--glyoxylate aminotransferase                147   1e-38    
ref|WP_011569032.1|  serine--glyoxylate aminotransferase                148   1e-38    
ref|WP_013695939.1|  serine--glyoxylate aminotransferase                147   2e-38    
ref|WP_013961473.1|  serine--glyoxylate aminotransferase                147   2e-38    
ref|WP_008757940.1|  serine--glyoxylate aminotransferase                147   2e-38    
ref|WP_043145413.1|  serine--glyoxylate aminotransferase                147   2e-38    
ref|WP_035864362.1|  serine--glyoxylate aminotransferase                147   2e-38    
ref|WP_007004225.1|  serine--glyoxylate aminotransferase                147   2e-38    
ref|WP_028796360.1|  serine--glyoxylate aminotransferase                147   2e-38    
ref|WP_029895536.1|  serine--glyoxylate aminotransferase                147   2e-38    
ref|WP_038008200.1|  MULTISPECIES: serine--glyoxylate aminotransf...    147   3e-38    
ref|WP_033449717.1|  serine--glyoxylate aminotransferase                147   3e-38    
ref|WP_033453548.1|  serine--glyoxylate aminotransferase                147   3e-38    
ref|WP_004567895.1|  serine--glyoxylate aminotransferase                147   3e-38    
ref|WP_003817883.1|  serine--glyoxylate aminotransferase                147   3e-38    
gb|EAQ23658.1|  probable serine-glyoxylate aminotransferase             148   3e-38    
ref|WP_029454537.1|  serine--glyoxylate aminotransferase                147   3e-38    
ref|WP_043355494.1|  serine--glyoxylate aminotransferase                147   3e-38    
ref|WP_022540099.1|  serine--glyoxylate aminotransferase                147   4e-38    
gb|AIU26350.1|  serine--glyoxylate aminotransferase                     147   4e-38    
ref|WP_028232152.1|  serine--glyoxylate aminotransferase                147   4e-38    
ref|WP_011454286.1|  serine--glyoxylate aminotransferase                146   5e-38    
ref|WP_008840237.1|  class V aminotransferase                           142   5e-38    
ref|WP_037459311.1|  serine--glyoxylate aminotransferase                146   5e-38    
ref|WP_028923528.1|  serine--glyoxylate aminotransferase                146   5e-38    
ref|WP_037249159.1|  serine--glyoxylate aminotransferase                146   5e-38    
ref|WP_016417666.1|  serine--glyoxylate aminotransferase                146   6e-38    
ref|WP_042259673.1|  serine--glyoxylate aminotransferase                146   6e-38    
ref|WP_042793828.1|  serine--glyoxylate aminotransferase                146   7e-38    
ref|WP_039365002.1|  serine--glyoxylate aminotransferase                146   7e-38    
ref|WP_008279759.1|  serine--glyoxylate aminotransferase                146   7e-38    
ref|WP_020683672.1|  hypothetical protein                               145   8e-38    
gb|AAY68344.1|  putative serine-pyruvate aminotransferase               145   8e-38    
ref|WP_039404613.1|  serine--glyoxylate aminotransferase                145   9e-38    
gb|ERL97602.1|  serine-pyruvate aminotransferase/archaeal asparta...    146   1e-37    
ref|WP_043547949.1|  serine--glyoxylate aminotransferase                145   1e-37    
ref|WP_023871906.1|  MULTISPECIES: serine--glyoxylate aminotransf...    145   1e-37    
ref|WP_030485989.1|  serine--glyoxylate aminotransferase                145   1e-37    
ref|WP_028957602.1|  serine--glyoxylate aminotransferase                145   1e-37    
ref|WP_037308357.1|  serine--glyoxylate aminotransferase                145   1e-37    
ref|WP_037276810.1|  serine--glyoxylate aminotransferase                145   1e-37    
ref|WP_027284153.1|  serine--glyoxylate aminotransferase                145   1e-37    
ref|WP_044591882.1|  serine--glyoxylate aminotransferase                145   1e-37    
ref|WP_007811273.1|  serine--glyoxylate aminotransferase                145   1e-37    
ref|WP_043619319.1|  serine--glyoxylate aminotransferase                145   1e-37    



>emb|CDP08481.1| unnamed protein product [Coffea canephora]
Length=401

 Score =   317 bits (811),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 149/158 (94%), Positives = 154/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYVN PGRNHLFVPGPVNIPDQ+IRAM RNNEDYRSPA+PA+TK LLEDVKKIFKT SG
Sbjct  1    MDYVNGPGRNHLFVPGPVNIPDQIIRAMNRNNEDYRSPAIPAMTKILLEDVKKIFKTESG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDV+ESEWGQG
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVIESEWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLAT  629
            ANLD+LASKLAEDTAHTIKAICIVHNETATGVTNNLAT
Sbjct  121  ANLDILASKLAEDTAHTIKAICIVHNETATGVTNNLAT  158



>ref|XP_011090165.1| PREDICTED: serine--glyoxylate aminotransferase [Sesamum indicum]
Length=401

 Score =   315 bits (808),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 151/158 (96%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGRNHLFVPGPVNIPDQV+RAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPDQVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNF VDVVESEWGQG
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFKVDVVESEWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLAT  629
            ANLDVLASK+AED AHTIKAICIVHNETATGVTNNLAT
Sbjct  121  ANLDVLASKIAEDKAHTIKAICIVHNETATGVTNNLAT  158



>ref|XP_010277598.1| PREDICTED: serine--glyoxylate aminotransferase [Nelumbo nucifera]
 ref|XP_010277599.1| PREDICTED: serine--glyoxylate aminotransferase [Nelumbo nucifera]
Length=401

 Score =   313 bits (801),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 150/158 (95%), Positives = 154/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV APGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPAVPALTKTLLEDVKKIFKTT+G
Sbjct  1    MDYVYAPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTTG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDV+ESEWGQG
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVIESEWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLAT  629
            ANLD+LASKLA DTAHTIKAICIVHNETATGVTNNLAT
Sbjct  121  ANLDILASKLAADTAHTIKAICIVHNETATGVTNNLAT  158



>ref|XP_011080387.1| PREDICTED: serine--glyoxylate aminotransferase-like [Sesamum 
indicum]
Length=401

 Score =   310 bits (794),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 147/158 (93%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGRNHLFVPGPVNIP+QVIRAM RNNEDYRSPAVPALTKTLLEDVKKIFKT SG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEQVIRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTASG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFLIPTTGTGAWESALTNTLSPGDRIV+FLIGQFSLLWIDQQQRLNFNVDVVESEWGQG
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIVTFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLAT  629
            ANL++LASK+AED  HTIKAICIVHNETATGVTNNLAT
Sbjct  121  ANLEILASKIAEDREHTIKAICIVHNETATGVTNNLAT  158



>ref|XP_003600160.1| Alanine glyoxylate aminotransferase [Medicago truncatula]
 gb|AES70411.1| serine-glyoxylate aminotransferase-like protein [Medicago truncatula]
Length=408

 Score =   309 bits (792),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 144/157 (92%), Positives = 153/157 (97%), Gaps = 0/157 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYVN PGRNHLFVPGPVNIPDQVIRAM+RNNEDYRSPA+PALTKTLLEDVKKIFKTT+G
Sbjct  1    MDYVNGPGRNHLFVPGPVNIPDQVIRAMSRNNEDYRSPAIPALTKTLLEDVKKIFKTTTG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFLIPTTGTGAWESALTNTLSPGDRIVSF+IGQFSLLW+DQQQRL FNVDVVESEWG+G
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIVSFVIGQFSLLWVDQQQRLKFNVDVVESEWGRG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            A+LD+L SKLA D+AHTIKAICIVHNETATGVTNNLA
Sbjct  121  ADLDILESKLASDSAHTIKAICIVHNETATGVTNNLA  157



>ref|XP_003600159.1| Alanine glyoxylate aminotransferase [Medicago truncatula]
 gb|AES70410.1| serine-glyoxylate aminotransferase-like protein [Medicago truncatula]
Length=401

 Score =   308 bits (789),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 144/157 (92%), Positives = 153/157 (97%), Gaps = 0/157 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYVN PGRNHLFVPGPVNIPDQVIRAM+RNNEDYRSPA+PALTKTLLEDVKKIFKTT+G
Sbjct  1    MDYVNGPGRNHLFVPGPVNIPDQVIRAMSRNNEDYRSPAIPALTKTLLEDVKKIFKTTTG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFLIPTTGTGAWESALTNTLSPGDRIVSF+IGQFSLLW+DQQQRL FNVDVVESEWG+G
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIVSFVIGQFSLLWVDQQQRLKFNVDVVESEWGRG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            A+LD+L SKLA D+AHTIKAICIVHNETATGVTNNLA
Sbjct  121  ADLDILESKLASDSAHTIKAICIVHNETATGVTNNLA  157



>gb|KDO44954.1| hypothetical protein CISIN_1g0157291mg [Citrus sinensis]
Length=367

 Score =   306 bits (785),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 145/157 (92%), Positives = 153/157 (97%), Gaps = 0/157 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY+ APG+NHLFVPGPV+IPDQVIRAM RNNEDYRSPAVPALTKTLLED+KKIFKTTSG
Sbjct  1    MDYMYAPGKNHLFVPGPVHIPDQVIRAMNRNNEDYRSPAVPALTKTLLEDIKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFLIPTTGTGAWESALTNTLSPGDRI+SFLIGQFSLLWIDQQQRLNFNVDVVES+WG+G
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIISFLIGQFSLLWIDQQQRLNFNVDVVESDWGEG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            A LDVLASKLA DTAHTIKAICIVHNETATGVTNNL+
Sbjct  121  AKLDVLASKLAADTAHTIKAICIVHNETATGVTNNLS  157



>gb|EPS59280.1| serine-glyoxylate aminotransferase [Genlisea aurea]
Length=401

 Score =   308 bits (788),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 146/158 (92%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGRNHLFVPGPVNIP+QVIRAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEQVIRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWG+G
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGRG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLAT  629
            A+LD+LASK+A+D  H IKAICIVHNETATGVTNNLAT
Sbjct  121  ADLDILASKIAQDKDHAIKAICIVHNETATGVTNNLAT  158



>ref|XP_004499480.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cicer arietinum]
Length=401

 Score =   308 bits (788),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 145/157 (92%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYVN PGRNHLFVPGPVNIPDQVIRAM+RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVNGPGRNHLFVPGPVNIPDQVIRAMSRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFL PT GTGAWESALTNTLSPGDR VSFLIGQFSLLWIDQQQRL FNVDVVESEWG+G
Sbjct  61   TPFLFPTXGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQQQRLKFNVDVVESEWGKG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            ANLD+L SKLA D+AHTIKAICIVHNETATGVTNNLA
Sbjct  121  ANLDILESKLASDSAHTIKAICIVHNETATGVTNNLA  157



>gb|AGV54322.1| serine glyoxylate aminotransferase 2 [Phaseolus vulgaris]
Length=401

 Score =   307 bits (787),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 145/157 (92%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY NAPGRNHLFVPGPVNIPDQ+IRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTT+G
Sbjct  1    MDYFNAPGRNHLFVPGPVNIPDQIIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTTG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
             PFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVES+WGQG
Sbjct  61   IPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVESDWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            A LDVL SK+A DTAHTIKAICIVHNETATGVTNNLA
Sbjct  121  AKLDVLESKIASDTAHTIKAICIVHNETATGVTNNLA  157



>ref|XP_007146302.1| hypothetical protein PHAVU_006G029100g [Phaseolus vulgaris]
 ref|XP_007146303.1| hypothetical protein PHAVU_006G029100g [Phaseolus vulgaris]
 gb|ESW18296.1| hypothetical protein PHAVU_006G029100g [Phaseolus vulgaris]
 gb|ESW18297.1| hypothetical protein PHAVU_006G029100g [Phaseolus vulgaris]
Length=401

 Score =   307 bits (787),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 145/157 (92%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY NAPGRNHLFVPGPVNIPDQ+IRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTT+G
Sbjct  1    MDYFNAPGRNHLFVPGPVNIPDQIIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTTG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
             PFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVES+WGQG
Sbjct  61   IPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVESDWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            A LDVL SK+A DTAHTIKAICIVHNETATGVTNNLA
Sbjct  121  AKLDVLESKIASDTAHTIKAICIVHNETATGVTNNLA  157



>gb|KDO44953.1| hypothetical protein CISIN_1g0157291mg [Citrus sinensis]
Length=401

 Score =   307 bits (786),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 145/157 (92%), Positives = 153/157 (97%), Gaps = 0/157 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY+ APG+NHLFVPGPV+IPDQVIRAM RNNEDYRSPAVPALTKTLLED+KKIFKTTSG
Sbjct  1    MDYMYAPGKNHLFVPGPVHIPDQVIRAMNRNNEDYRSPAVPALTKTLLEDIKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFLIPTTGTGAWESALTNTLSPGDRI+SFLIGQFSLLWIDQQQRLNFNVDVVES+WG+G
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIISFLIGQFSLLWIDQQQRLNFNVDVVESDWGEG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            A LDVLASKLA DTAHTIKAICIVHNETATGVTNNL+
Sbjct  121  AKLDVLASKLAADTAHTIKAICIVHNETATGVTNNLS  157



>ref|XP_006470731.1| PREDICTED: serine--glyoxylate aminotransferase-like [Citrus sinensis]
Length=401

 Score =   307 bits (786),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 145/157 (92%), Positives = 153/157 (97%), Gaps = 0/157 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY+ APG+NHLFVPGPV+IPDQVIRAM RNNEDYRSPAVPALTKTLLED+KKIFKTTSG
Sbjct  1    MDYMYAPGKNHLFVPGPVHIPDQVIRAMNRNNEDYRSPAVPALTKTLLEDIKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFLIPTTGTGAWESALTNTLSPGDRI+SFLIGQFSLLWIDQQQRLNFNVDVVES+WG+G
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIISFLIGQFSLLWIDQQQRLNFNVDVVESDWGEG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            A LDVLASKLA DTAHTIKAICIVHNETATGVTNNL+
Sbjct  121  AKLDVLASKLAADTAHTIKAICIVHNETATGVTNNLS  157



>ref|XP_010045046.1| PREDICTED: serine--glyoxylate aminotransferase [Eucalyptus grandis]
 ref|XP_010045047.1| PREDICTED: serine--glyoxylate aminotransferase [Eucalyptus grandis]
 gb|KCW87200.1| hypothetical protein EUGRSUZ_B03720 [Eucalyptus grandis]
Length=401

 Score =   307 bits (786),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 144/157 (92%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGRNHLFVPGPVNIPDQVIRAM RNNEDYRSPA+PALTK LLEDVKKIFKTT+G
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPDQVIRAMNRNNEDYRSPAIPALTKILLEDVKKIFKTTTG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFLIPTTGTGAWESALTNTLSPGDR +SF+IGQFSLLWIDQQQRL FNVDVVESEWGQG
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRTISFMIGQFSLLWIDQQQRLGFNVDVVESEWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            ANLD+LASKLA DTAHTIKA+CIVHNETATGVTNNLA
Sbjct  121  ANLDILASKLAADTAHTIKAVCIVHNETATGVTNNLA  157



>gb|AFK40703.1| unknown [Medicago truncatula]
Length=401

 Score =   306 bits (785),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 143/157 (91%), Positives = 152/157 (97%), Gaps = 0/157 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYVN PGRNHLFVPGPVNIPDQVIRAM+RNNEDYRSPA+PALTKTLLEDVKKIFKTT+G
Sbjct  1    MDYVNGPGRNHLFVPGPVNIPDQVIRAMSRNNEDYRSPAIPALTKTLLEDVKKIFKTTTG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFLIPTTGTGAWES LTNTLSPGDRIVSF+IGQFSLLW+DQQQRL FNVDVVESEWG+G
Sbjct  61   TPFLIPTTGTGAWESVLTNTLSPGDRIVSFVIGQFSLLWVDQQQRLKFNVDVVESEWGRG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            A+LD+L SKLA D+AHTIKAICIVHNETATGVTNNLA
Sbjct  121  ADLDILESKLASDSAHTIKAICIVHNETATGVTNNLA  157



>ref|XP_006446249.1| hypothetical protein CICLE_v10015490mg [Citrus clementina]
 ref|XP_006446250.1| hypothetical protein CICLE_v10015490mg [Citrus clementina]
 gb|ESR59489.1| hypothetical protein CICLE_v10015490mg [Citrus clementina]
 gb|ESR59490.1| hypothetical protein CICLE_v10015490mg [Citrus clementina]
Length=401

 Score =   306 bits (784),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 145/157 (92%), Positives = 152/157 (97%), Gaps = 0/157 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY+ APG+NHLFVPGPV IPDQVIRAM RNNEDYRSPAVPALTKTLLED+KKIFKTTSG
Sbjct  1    MDYMYAPGKNHLFVPGPVQIPDQVIRAMNRNNEDYRSPAVPALTKTLLEDIKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFLIPTTGTGAWESALTNTLSPGDRI+SFLIGQFSLLWIDQQQRLNFNVDVVES+WG+G
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIISFLIGQFSLLWIDQQQRLNFNVDVVESDWGEG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            A LDVLASKLA DTAHTIKAICIVHNETATGVTNNL+
Sbjct  121  AKLDVLASKLAADTAHTIKAICIVHNETATGVTNNLS  157



>ref|XP_008227244.1| PREDICTED: serine--glyoxylate aminotransferase [Prunus mume]
Length=401

 Score =   306 bits (784),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 145/157 (92%), Positives = 151/157 (96%), Gaps = 0/157 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGRNHLFVPGPVNIP+ V+RAM RNNEDYRSPAVPA+TK LLEDVKKIFKTT+G
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAVPAMTKILLEDVKKIFKTTTG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPF+IPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNF VDVVESEWGQG
Sbjct  61   TPFMIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFKVDVVESEWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            ANLD+LASKLAEDTAHTIKAICIVHNETATGVTNNLA
Sbjct  121  ANLDILASKLAEDTAHTIKAICIVHNETATGVTNNLA  157



>ref|NP_001265946.1| Hop-interacting protein THI032 [Solanum lycopersicum]
 ref|XP_010314658.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010314659.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010314661.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010314662.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010314663.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 gb|AEW69795.1| Hop-interacting protein THI032 [Solanum lycopersicum]
Length=401

 Score =   306 bits (783),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 144/158 (91%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYVN PGRNHLFVPGPVNIP+QV+RAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVNGPGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFL PTTGTGAWESALTNTLSPGDR VSFLIGQFSLLWIDQQ+RLNF+VDVVES+WGQG
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQQKRLNFDVDVVESDWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLAT  629
            ANL+VLASK+AED +HTIKA+CIVHNETATGVTNNLAT
Sbjct  121  ANLEVLASKIAEDKSHTIKAVCIVHNETATGVTNNLAT  158



>ref|XP_006349776.1| PREDICTED: serine--glyoxylate aminotransferase-like [Solanum 
tuberosum]
Length=401

 Score =   306 bits (783),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 144/158 (91%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYVN PGRNHLFVPGPVNIP+QV+RAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVNGPGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFL PTTGTGAWESALTNTLSPGDR VSFLIGQFSLLWIDQQ+RLNF+VDVVES+WGQG
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQQKRLNFDVDVVESDWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLAT  629
            ANL+VLASK+AED +HTIKA+CIVHNETATGVTNNLAT
Sbjct  121  ANLEVLASKIAEDKSHTIKAVCIVHNETATGVTNNLAT  158



>ref|XP_009342610.1| PREDICTED: serine--glyoxylate aminotransferase [Pyrus x bretschneideri]
 ref|XP_009342611.1| PREDICTED: serine--glyoxylate aminotransferase [Pyrus x bretschneideri]
Length=401

 Score =   306 bits (783),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 145/157 (92%), Positives = 151/157 (96%), Gaps = 0/157 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGRNHLFVPGPVNIP+ V+RAM RNNEDYRSPAVPA+TKTLLEDVK+IFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAVPAMTKTLLEDVKQIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPF+IPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVESEWGQG
Sbjct  61   TPFMIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVESEWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            ANLDVL SK+AEDTAHTIKAICIVHNETATGVTNNLA
Sbjct  121  ANLDVLESKIAEDTAHTIKAICIVHNETATGVTNNLA  157



>ref|XP_008363560.1| PREDICTED: serine--glyoxylate aminotransferase [Malus domestica]
Length=401

 Score =   305 bits (782),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 145/157 (92%), Positives = 151/157 (96%), Gaps = 0/157 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGRNHLFVPGPVNIP+ V+RAM RNNEDYRSPAVPA+TKTLLEDVKKIFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAVPAMTKTLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPF+IPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVES+WGQG
Sbjct  61   TPFMIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVESDWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            ANLDVL SK+AEDTAHTIKAICIVHNETATGVTNNLA
Sbjct  121  ANLDVLESKIAEDTAHTIKAICIVHNETATGVTNNLA  157



>ref|XP_006584642.1| PREDICTED: enzymatic resistance protein isoform X1 [Glycine max]
 gb|ACE63506.1| alanine:glyoxylate aminotransferase [Vigna radiata]
 gb|ACU23313.1| unknown [Glycine max]
 gb|KHM99689.1| Serine--glyoxylate aminotransferase [Glycine soja]
Length=401

 Score =   305 bits (782),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 143/157 (91%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY NAPGRNHLFVPGPVNIPDQ+IRAM RNNEDYRSPA+PA+TKTLLEDVKKIFKTT+G
Sbjct  1    MDYFNAPGRNHLFVPGPVNIPDQIIRAMNRNNEDYRSPAIPAMTKTLLEDVKKIFKTTTG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVESEWG G
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVESEWGHG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            A LDVL SK+A DT+HTIKAICIVHNETATGVTN+LA
Sbjct  121  AKLDVLESKIASDTSHTIKAICIVHNETATGVTNDLA  157



>ref|NP_001237048.1| enzymatic resistance protein [Glycine max]
 gb|AAZ94162.1| enzymatic resistance protein [Glycine max]
Length=401

 Score =   305 bits (781),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 143/157 (91%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY NAPGRNHLFVPGPVNIPDQ+IRAM RNNEDYRSPA+PA+TKTLLEDVKKIFKTT+G
Sbjct  1    MDYFNAPGRNHLFVPGPVNIPDQIIRAMNRNNEDYRSPAIPAMTKTLLEDVKKIFKTTTG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVESEWG G
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVESEWGHG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            A LDVL SK+A DT+HTIKAICIVHNETATGVTN+LA
Sbjct  121  AKLDVLESKIASDTSHTIKAICIVHNETATGVTNDLA  157



>gb|ACJ61247.1| serine glyoxylate aminotransferase 3 [Glycine max]
Length=401

 Score =   305 bits (781),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 143/157 (91%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY NAPGRNHLFVPGPVNIPDQ+IRAM RNNEDYRSPA+PA+TKTLLEDVKKIFKTT+G
Sbjct  1    MDYFNAPGRNHLFVPGPVNIPDQIIRAMNRNNEDYRSPAIPAMTKTLLEDVKKIFKTTTG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVESEWG G
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVESEWGHG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            A LDVL SK+A DT+HTIKAICIVHNETATGVTN+LA
Sbjct  121  AKLDVLESKIASDTSHTIKAICIVHNETATGVTNDLA  157



>ref|XP_006843377.1| hypothetical protein AMTR_s00053p00093890 [Amborella trichopoda]
 gb|ERN05052.1| hypothetical protein AMTR_s00053p00093890 [Amborella trichopoda]
Length=401

 Score =   305 bits (781),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 145/158 (92%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY+  PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYMYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFLIPTTGTGAWESALTNTLSP DRIVSFL+GQFSLLWIDQQQRLNFNVDV+ESEWGQG
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPRDRIVSFLMGQFSLLWIDQQQRLNFNVDVIESEWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLAT  629
            ANLD LASKLAED  HTIKAICIVHNETATGVTNNLAT
Sbjct  121  ANLDALASKLAEDRGHTIKAICIVHNETATGVTNNLAT  158



>ref|XP_006369572.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|ERP66141.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
Length=321

 Score =   302 bits (774),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 141/157 (90%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY   PGRNHLFVPGPVNIP+ V+RAM RNNEDYRSPAVPA+TKTLLEDVKKIFKTTSG
Sbjct  1    MDYFYGPGRNHLFVPGPVNIPESVLRAMNRNNEDYRSPAVPAMTKTLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPF+IPTTGTGAWESALTNTLSPGDR VSF+IGQFSLLWIDQQ+RL FNVDVVES+WGQG
Sbjct  61   TPFIIPTTGTGAWESALTNTLSPGDRTVSFMIGQFSLLWIDQQKRLGFNVDVVESDWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            ANLD+LASKLAEDTAHTIKA+CIVHNETATGVTNNLA
Sbjct  121  ANLDILASKLAEDTAHTIKAVCIVHNETATGVTNNLA  157



>ref|XP_004291746.1| PREDICTED: serine--glyoxylate aminotransferase [Fragaria vesca 
subsp. vesca]
Length=401

 Score =   304 bits (779),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 144/158 (91%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MD V APGRNHLFVPGPVNIP+ V+RAM RNNEDYRSPA+PA+TK LLEDVKKIFKTT+G
Sbjct  1    MDNVYAPGRNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAIPAMTKILLEDVKKIFKTTTG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPF+IPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNF VDVVESEWGQG
Sbjct  61   TPFMIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFKVDVVESEWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLAT  629
            ANLD+LASKLAEDTAHTIKA+CIVHNETATGVTNNLAT
Sbjct  121  ANLDILASKLAEDTAHTIKAVCIVHNETATGVTNNLAT  158



>ref|XP_009619693.1| PREDICTED: serine--glyoxylate aminotransferase [Nicotiana tomentosiformis]
Length=401

 Score =   303 bits (777),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 143/158 (91%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYVN PGRNHLFVPGPVNIP+QV+RAM RNNEDYRSPAVPALTK LLEDVKKIFKTTSG
Sbjct  1    MDYVNGPGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKVLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQ+RLNF+VDVVES+WGQG
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFDVDVVESDWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLAT  629
            A+L+ LASK+A D +HTIKAICIVHNETATGVTNNLAT
Sbjct  121  ADLEALASKIAADKSHTIKAICIVHNETATGVTNNLAT  158



>ref|XP_009775939.1| PREDICTED: serine--glyoxylate aminotransferase [Nicotiana sylvestris]
Length=401

 Score =   303 bits (777),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 143/158 (91%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYVN PGRNHLFVPGPVNIP+QV+RAM RNNEDYRSPAVPALTK LLEDVKKIFKTTSG
Sbjct  1    MDYVNGPGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKVLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQ+RLNF+VDVVES+WGQG
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFDVDVVESDWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLAT  629
            A+L+ LASK+A D +HTIKAICIVHNETATGVTNNLAT
Sbjct  121  ADLEALASKIAADKSHTIKAICIVHNETATGVTNNLAT  158



>ref|XP_008359496.1| PREDICTED: serine--glyoxylate aminotransferase [Malus domestica]
 ref|XP_008359497.1| PREDICTED: serine--glyoxylate aminotransferase [Malus domestica]
Length=401

 Score =   303 bits (777),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 143/157 (91%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGRNHLFVPGPVNIP+ V+R+M RNNEDYRSPAVPA+TKTLLEDVKKIFKTT+G
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEAVLRSMNRNNEDYRSPAVPAMTKTLLEDVKKIFKTTTG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFLIPTTGTGAWESALTNTLSPGDR VSFLIGQFSLLWIDQQQRL FNVDVVESEWGQG
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQQQRLKFNVDVVESEWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            ANLD+L SK+AEDTAHTIKAICIVHNETATGVTNNLA
Sbjct  121  ANLDILESKIAEDTAHTIKAICIVHNETATGVTNNLA  157



>ref|XP_010938608.1| PREDICTED: serine--glyoxylate aminotransferase-like [Elaeis guineensis]
Length=401

 Score =   303 bits (776),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 145/158 (92%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPAVPALTKTL+EDVKKIFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAVPALTKTLIEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL F+VDV+ESEWG+G
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFDVDVIESEWGRG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLAT  629
            ANLD+LA KLA DTAHTIKAICIVHNETATGVTNNLAT
Sbjct  121  ANLDMLAMKLATDTAHTIKAICIVHNETATGVTNNLAT  158



>ref|NP_001276276.1| serine--glyoxylate aminotransferase-like [Glycine max]
 gb|ACU18294.1| unknown [Glycine max]
Length=401

 Score =   303 bits (776),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 142/157 (90%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY NAPGRNHLFVPGPVNIPDQ+IRAM RNNEDYRSPA+PA+TKTLLEDVKKIFKT +G
Sbjct  1    MDYFNAPGRNHLFVPGPVNIPDQIIRAMNRNNEDYRSPAIPAMTKTLLEDVKKIFKTITG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
             PFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVESEWGQG
Sbjct  61   IPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVESEWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            A LDVL SK+A DT+HTIKAICIVHNETATGVTN+LA
Sbjct  121  AKLDVLESKIASDTSHTIKAICIVHNETATGVTNDLA  157



>gb|KHN28521.1| Serine--glyoxylate aminotransferase [Glycine soja]
Length=401

 Score =   303 bits (776),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 142/157 (90%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY NAPGRNHLFVPGPVNIPDQ+IRAM RNNEDYRSPA+PA+TKTLLEDVKKIFKT +G
Sbjct  1    MDYFNAPGRNHLFVPGPVNIPDQIIRAMNRNNEDYRSPAIPAMTKTLLEDVKKIFKTITG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
             PFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVESEWGQG
Sbjct  61   IPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVESEWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            A LDVL SK+A DT+HTIKAICIVHNETATGVTN+LA
Sbjct  121  AKLDVLESKIASDTSHTIKAICIVHNETATGVTNDLA  157



>ref|XP_007212264.1| hypothetical protein PRUPE_ppa006653mg [Prunus persica]
 gb|EMJ13463.1| hypothetical protein PRUPE_ppa006653mg [Prunus persica]
Length=401

 Score =   303 bits (776),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 144/157 (92%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGRNHLFVPGPVNIP+ V+RAM RNNEDYRSPAVPA+TK LLEDVKKIFKTT+G
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAVPAMTKILLEDVKKIFKTTTG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            T F+IPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNF VDVVESEWGQG
Sbjct  61   TSFMIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFKVDVVESEWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            ANLD+LASKLAEDTAHTIKAICIVHNETATGVTNNLA
Sbjct  121  ANLDILASKLAEDTAHTIKAICIVHNETATGVTNNLA  157



>ref|XP_011032100.1| PREDICTED: serine--glyoxylate aminotransferase-like [Populus 
euphratica]
Length=401

 Score =   303 bits (776),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 144/157 (92%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY   PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPAVPA+TKTLLEDVKKIFKTTSG
Sbjct  1    MDYFYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAVPAMTKTLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
             PFLIPTTGTGAWESALTNTLSPGDR VSFLIGQFSLLWIDQQQRL FNVDVVES+WGQG
Sbjct  61   IPFLIPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQQQRLGFNVDVVESDWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            ANLD+LASKLAEDTAHTIKA+CIVHNETATGVTNNLA
Sbjct  121  ANLDILASKLAEDTAHTIKAVCIVHNETATGVTNNLA  157



>ref|XP_002313371.1| aminotransferase 2 family protein [Populus trichocarpa]
 gb|EEE87326.1| aminotransferase 2 family protein [Populus trichocarpa]
Length=401

 Score =   303 bits (775),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 144/157 (92%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY   PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPAVPA+TKTLLEDVKKIFKTTSG
Sbjct  1    MDYFYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAVPAMTKTLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
             PFLIPTTGTGAWESALTNTLSPGDR VSFLIGQFSLLWIDQQQRL FNVDVVES+WGQG
Sbjct  61   IPFLIPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQQQRLGFNVDVVESDWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            ANLD+LASKLAEDTAHTIKA+CIVHNETATGVTNNLA
Sbjct  121  ANLDILASKLAEDTAHTIKAVCIVHNETATGVTNNLA  157



>gb|ABA00460.1| serine-glyoxylate aminotransferase [Spirodela polyrhiza]
Length=401

 Score =   303 bits (775),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 146/158 (92%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVES+WG G
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESDWGLG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLAT  629
            ANLDVLA KLA D +H+IKAICIVHNETATGVTNNLAT
Sbjct  121  ANLDVLAEKLAADHSHSIKAICIVHNETATGVTNNLAT  158



>ref|XP_011043786.1| PREDICTED: serine--glyoxylate aminotransferase [Populus euphratica]
 ref|XP_011043787.1| PREDICTED: serine--glyoxylate aminotransferase [Populus euphratica]
 ref|XP_011043788.1| PREDICTED: serine--glyoxylate aminotransferase [Populus euphratica]
Length=401

 Score =   303 bits (775),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 142/157 (90%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY   PGRNHLFVPGPVNIP+ V+RAM RNNEDYRSPAVPA+TKTLLEDVKKIFKTTSG
Sbjct  1    MDYFYGPGRNHLFVPGPVNIPESVLRAMNRNNEDYRSPAVPAMTKTLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPF+IPTTGTGAWESALTNTLSPGDR VSFLIGQFSLLWIDQQ+RL FNVDVVES+WGQG
Sbjct  61   TPFIIPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQQKRLGFNVDVVESDWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            ANLD+LASKLAEDTAHTIKA+CIVHNETATGVTNNLA
Sbjct  121  ANLDILASKLAEDTAHTIKAVCIVHNETATGVTNNLA  157



>ref|XP_008812510.1| PREDICTED: serine--glyoxylate aminotransferase [Phoenix dactylifera]
 ref|XP_008812512.1| PREDICTED: serine--glyoxylate aminotransferase [Phoenix dactylifera]
 ref|XP_008812513.1| PREDICTED: serine--glyoxylate aminotransferase [Phoenix dactylifera]
 ref|XP_008812514.1| PREDICTED: serine--glyoxylate aminotransferase [Phoenix dactylifera]
Length=401

 Score =   302 bits (773),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 144/157 (92%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL F+VDV+ESEWGQG
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFDVDVIESEWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            ANLD+LA KLA D AHTIKAICIVHNETATGVTNNL+
Sbjct  121  ANLDILAMKLAADRAHTIKAICIVHNETATGVTNNLS  157



>ref|XP_002298306.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 ref|XP_006369570.1| aminotransferase 2 family protein [Populus trichocarpa]
 ref|XP_006369571.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|EEE83111.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|ERP66139.1| aminotransferase 2 family protein [Populus trichocarpa]
 gb|ERP66140.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
Length=401

 Score =   302 bits (773),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 141/157 (90%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY   PGRNHLFVPGPVNIP+ V+RAM RNNEDYRSPAVPA+TKTLLEDVKKIFKTTSG
Sbjct  1    MDYFYGPGRNHLFVPGPVNIPESVLRAMNRNNEDYRSPAVPAMTKTLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPF+IPTTGTGAWESALTNTLSPGDR VSF+IGQFSLLWIDQQ+RL FNVDVVES+WGQG
Sbjct  61   TPFIIPTTGTGAWESALTNTLSPGDRTVSFMIGQFSLLWIDQQKRLGFNVDVVESDWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            ANLD+LASKLAEDTAHTIKA+CIVHNETATGVTNNLA
Sbjct  121  ANLDILASKLAEDTAHTIKAVCIVHNETATGVTNNLA  157



>gb|ACJ61246.1| serine glyoxylate aminotransferase 2 [Glycine max]
Length=401

 Score =   301 bits (772),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 141/157 (90%), Positives = 148/157 (94%), Gaps = 0/157 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY NAPGRNHLFVPGPVNIPDQ+IRAM RNNEDYRSPA+PA+TKTLLEDVKKIFKT +G
Sbjct  1    MDYFNAPGRNHLFVPGPVNIPDQIIRAMNRNNEDYRSPAIPAMTKTLLEDVKKIFKTITG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
             PFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVESEWGQG
Sbjct  61   IPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVESEWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            A LDVL SK+A DT+HTIKAICI HNETATGVTN+LA
Sbjct  121  AKLDVLESKIASDTSHTIKAICIAHNETATGVTNDLA  157



>ref|XP_009338530.1| PREDICTED: serine--glyoxylate aminotransferase-like [Pyrus x 
bretschneideri]
Length=401

 Score =   301 bits (772),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 141/157 (90%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGRNHLFVPGPVNIP+ V+R+M RNNEDYRSPA+PA+TKTLLEDVKKIFKTT+G
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEAVLRSMNRNNEDYRSPAIPAMTKTLLEDVKKIFKTTTG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPF+IPTTGTGAWESALTNTLSPGDR VSFLIGQFSLLWIDQQQRL FNVDVVESEWGQG
Sbjct  61   TPFMIPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQQQRLKFNVDVVESEWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            ANLD+L SK+AEDTAHTIKAICIVHNETATGVTNNLA
Sbjct  121  ANLDILESKIAEDTAHTIKAICIVHNETATGVTNNLA  157



>gb|ABK96624.1| unknown [Populus trichocarpa x Populus deltoides]
Length=401

 Score =   301 bits (772),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 143/157 (91%), Positives = 148/157 (94%), Gaps = 0/157 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY   PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPAVPA+TKTLLEDVKKIFKTTSG
Sbjct  1    MDYFYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAVPAMTKTLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
             PFLIPTTGTGAWESALTNTLSPGDR VSFLIGQFSLLWIDQQQRL FNVDVVES+WGQG
Sbjct  61   IPFLIPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQQQRLGFNVDVVESDWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            AN D+LASKLAEDTAHTIKA+CIVHNETATGVTNNLA
Sbjct  121  ANFDILASKLAEDTAHTIKAVCIVHNETATGVTNNLA  157



>ref|XP_006369573.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|ERP66142.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
Length=381

 Score =   301 bits (770),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 141/157 (90%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY   PGRNHLFVPGPVNIP+ V+RAM RNNEDYRSPAVPA+TKTLLEDVKKIFKTTSG
Sbjct  1    MDYFYGPGRNHLFVPGPVNIPESVLRAMNRNNEDYRSPAVPAMTKTLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPF+IPTTGTGAWESALTNTLSPGDR VSF+IGQFSLLWIDQQ+RL FNVDVVES+WGQG
Sbjct  61   TPFIIPTTGTGAWESALTNTLSPGDRTVSFMIGQFSLLWIDQQKRLGFNVDVVESDWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            ANLD+LASKLAEDTAHTIKA+CIVHNETATGVTNNLA
Sbjct  121  ANLDILASKLAEDTAHTIKAVCIVHNETATGVTNNLA  157



>gb|AGL09526.1| alanine-glyoxylate aminotransferase, partial [Peperomia prostrata]
Length=289

 Score =   297 bits (761),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 141/152 (93%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  353
            PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSGTPF+IP
Sbjct  1    PGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSGTPFIIP  60

Query  354  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  533
            TTGTGAWESALTNTLSPGDRI+SFLIGQFSLLWIDQQQRL FNVDVVES+WGQGANLD+L
Sbjct  61   TTGTGAWESALTNTLSPGDRIISFLIGQFSLLWIDQQQRLGFNVDVVESDWGQGANLDIL  120

Query  534  ASKLAEDTAHTIKAICIVHNETATGVTNNLAT  629
            ASKLA DTAH+IKAICIVHNETATGVTNNLAT
Sbjct  121  ASKLASDTAHSIKAICIVHNETATGVTNNLAT  152



>gb|AGT38285.1| serine--glyoxylate aminotransferase [Gossypium hirsutum]
 gb|KJB83532.1| hypothetical protein B456_013G252200 [Gossypium raimondii]
Length=401

 Score =   301 bits (770),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 143/158 (91%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY   PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPA+PA+TKTLLEDVKKIFKTT+G
Sbjct  1    MDYFYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPAMTKTLLEDVKKIFKTTTG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPF+IPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVESEWGQG
Sbjct  61   TPFMIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVESEWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLAT  629
            ANLDVLA KLA D  HTIKAICIVHNETATGVTNNLAT
Sbjct  121  ANLDVLAEKLAADRTHTIKAICIVHNETATGVTNNLAT  158



>ref|XP_007015204.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 ref|XP_007015205.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 ref|XP_007015206.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 gb|EOY32823.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 gb|EOY32824.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 gb|EOY32825.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
Length=401

 Score =   301 bits (770),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 142/158 (90%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPA+PA+TKTLLEDVK IFKTT+G
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPAMTKTLLEDVKMIFKTTTG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPF+IPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG
Sbjct  61   TPFMIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLAT  629
            ANL++LA KLA D  HTIKAICIVHNETATGVTNNLAT
Sbjct  121  ANLEILAEKLASDYTHTIKAICIVHNETATGVTNNLAT  158



>dbj|BAJ33858.1| unnamed protein product [Thellungiella halophila]
Length=438

 Score =   301 bits (772),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 140/158 (89%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  153  KMDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTS  332
            KMDY+N PGR+HLFVPGPVNIP+QVIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTS
Sbjct  37   KMDYMNGPGRHHLFVPGPVNIPEQVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTS  96

Query  333  GTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQ  512
            GTPF+ PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQ+RLNFNVDVVESEWGQ
Sbjct  97   GTPFMFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESEWGQ  156

Query  513  GANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            GANL VLASKL++D  H+IKAICIVHNETATGVTN+++
Sbjct  157  GANLQVLASKLSQDQNHSIKAICIVHNETATGVTNDIS  194



>gb|AGL09527.1| alanine-glyoxylate aminotransferase, partial [Piper nigrum]
Length=275

 Score =   296 bits (758),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 142/152 (93%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  353
            PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP
Sbjct  1    PGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  60

Query  354  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  533
            TTGTGAWESALTNTLSPGDRI+SFLIGQFSLLWIDQQQRL FNVDVVES+WGQGANLD+L
Sbjct  61   TTGTGAWESALTNTLSPGDRIISFLIGQFSLLWIDQQQRLGFNVDVVESDWGQGANLDIL  120

Query  534  ASKLAEDTAHTIKAICIVHNETATGVTNNLAT  629
            ASKLA DT HTIKAICIVHNETATGVTNNL T
Sbjct  121  ASKLASDTTHTIKAICIVHNETATGVTNNLLT  152



>gb|KDP35982.1| hypothetical protein JCGZ_08377 [Jatropha curcas]
Length=401

 Score =   300 bits (768),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 142/158 (90%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY+  PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPAVPALTKTLLEDVKKIFKTT+G
Sbjct  1    MDYMYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTTG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFL PTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL FNVDVVES+WGQG
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRLGFNVDVVESDWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLAT  629
            ANLD+LA KLA DTAHTIKA+CIVHNETATGVTNNLAT
Sbjct  121  ANLDILAEKLAADTAHTIKAVCIVHNETATGVTNNLAT  158



>ref|XP_009410322.1| PREDICTED: serine--glyoxylate aminotransferase-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009410323.1| PREDICTED: serine--glyoxylate aminotransferase-like [Musa acuminata 
subsp. malaccensis]
Length=401

 Score =   300 bits (767),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 142/158 (90%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MD+  APGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1    MDFFYAPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFLIPTTGTGAWESALTNTLSPGD+IVSFLIGQFSLLWIDQQQRLNFNVDV+ESEWG+G
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDKIVSFLIGQFSLLWIDQQQRLNFNVDVIESEWGRG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLAT  629
            A+LD LASKLA D +H+IKA+CIVHNETATGVTNNLAT
Sbjct  121  ADLDALASKLAADWSHSIKAVCIVHNETATGVTNNLAT  158



>emb|CDY37208.1| BnaA09g08290D [Brassica napus]
Length=401

 Score =   300 bits (767),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 140/157 (89%), Positives = 151/157 (96%), Gaps = 0/157 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY+N PGR+HLFVPGPVNIP+QVIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYMNGPGRHHLFVPGPVNIPEQVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPF+ PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQ+RLNFNVDVVESEWGQG
Sbjct  61   TPFMFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESEWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            ANL VLASKL++D  HTIKAICIVHNETATGVTN+++
Sbjct  121  ANLQVLASKLSQDQNHTIKAICIVHNETATGVTNDIS  157



>gb|ABQ81925.1| aminotransferase 2 [Cucumis melo]
Length=401

 Score =   300 bits (767),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 141/157 (90%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGRNHLFVPGPVNIP+QV+RAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFL PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNF VDV+ESEWG+G
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFKVDVIESEWGEG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            A LDVLA+KLA DT HTIKA+CIVHNETATGVTN+L+
Sbjct  121  AKLDVLAAKLAADTDHTIKAVCIVHNETATGVTNDLS  157



>ref|XP_010094254.1| Serine--glyoxylate aminotransferase [Morus notabilis]
 gb|EXB55505.1| Serine--glyoxylate aminotransferase [Morus notabilis]
Length=358

 Score =   298 bits (763),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 141/157 (90%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYVN PGR+HLFVPGPVNIP+ VIRAM RNNEDYRSPA+PA+TK LLEDVK IFKTTSG
Sbjct  1    MDYVNGPGRHHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPAMTKVLLEDVKMIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVES+WGQG
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVESDWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            ANL+VL +KLAED AH+IKAICIVHNETATGVTNNLA
Sbjct  121  ANLEVLEAKLAEDRAHSIKAICIVHNETATGVTNNLA  157



>gb|KHG29969.1| Serine--glyoxylate aminotransferase -like protein [Gossypium 
arboreum]
Length=401

 Score =   299 bits (766),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 140/158 (89%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PG+NHLFVPGPVNIP+ V+RAM RNNEDYRSPA+PA+TKTLLEDVKKIFKTT+G
Sbjct  1    MDYVYGPGKNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAIPAMTKTLLEDVKKIFKTTTG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFLIPTTGTGAWESALTNTLSPGDR V+FLIGQFSLLWIDQQQRLNFNVDVVESEWGQG
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRTVTFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLAT  629
            ANLD+LA KLA D +HTIKAICIVHNETATG+TNNLAT
Sbjct  121  ANLDILAEKLAADHSHTIKAICIVHNETATGITNNLAT  158



>ref|XP_008449670.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
melo]
 gb|AAQ56195.1| aminotransferase 2 [Cucumis melo]
Length=401

 Score =   299 bits (766),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 141/157 (90%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGRNHLFVPGPVNIP+QV+RAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFL PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNF VDV+ESEWG+G
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFKVDVIESEWGEG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            A LDVLA+KLA DT HTIKA+CIVHNETATGVTN+L+
Sbjct  121  AKLDVLAAKLAADTDHTIKAVCIVHNETATGVTNDLS  157



>gb|AAL62332.1|AF461048_1 aminotransferase 2 [Cucumis melo]
Length=401

 Score =   299 bits (766),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 141/157 (90%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGRNHLFVPGPVNIP+QV+RAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFL PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNF VDV+ESEWG+G
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFKVDVIESEWGEG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            A LDVLA+KLA DT HTIKA+CIVHNETATGVTN+L+
Sbjct  121  AKLDVLAAKLAADTDHTIKAVCIVHNETATGVTNDLS  157



>ref|NP_001284445.1| serine--glyoxylate aminotransferase-like [Cucumis melo]
 gb|ABQ81923.1| aminotransferase 2 [Cucumis melo]
Length=401

 Score =   299 bits (765),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 141/157 (90%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGRNHLFVPGPVNIP+QV+RAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFL PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNF VDV+ESEWG+G
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFKVDVIESEWGEG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            A LDVLA+KLA DT HTIKA+CIVHNETATGVTN+L+
Sbjct  121  AKLDVLAAKLAADTDHTIKAVCIVHNETATGVTNDLS  157



>emb|CDX81443.1| BnaC09g08540D [Brassica napus]
Length=401

 Score =   299 bits (765),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/157 (89%), Positives = 151/157 (96%), Gaps = 0/157 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY+N PGR+HLFVPGPVNIP+QV+RAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYMNGPGRHHLFVPGPVNIPEQVVRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPF+ PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQ+RLNFNVDVVESEWGQG
Sbjct  61   TPFMFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESEWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            ANL VLASKL++D  HTIKAICIVHNETATGVTN+++
Sbjct  121  ANLQVLASKLSQDQNHTIKAICIVHNETATGVTNDIS  157



>ref|XP_006409690.1| hypothetical protein EUTSA_v10022711mg [Eutrema salsugineum]
 gb|ESQ51143.1| hypothetical protein EUTSA_v10022711mg [Eutrema salsugineum]
Length=401

 Score =   298 bits (764),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/157 (89%), Positives = 151/157 (96%), Gaps = 0/157 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY+N PGR+HLFVPGPVNIP+QVIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYMNGPGRHHLFVPGPVNIPEQVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPF+ PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQ+RLNFNVDVVESEWGQG
Sbjct  61   TPFMFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESEWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            ANL VLASKL++D  H+IKAICIVHNETATGVTN+++
Sbjct  121  ANLQVLASKLSQDQNHSIKAICIVHNETATGVTNDIS  157



>ref|XP_009112244.1| PREDICTED: serine--glyoxylate aminotransferase [Brassica rapa]
Length=401

 Score =   298 bits (764),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 139/157 (89%), Positives = 151/157 (96%), Gaps = 0/157 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY+N PGR+HLFVPGPVNIP+QVIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYMNGPGRHHLFVPGPVNIPEQVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPF+ PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQ+RLNFNVDVVESEWGQG
Sbjct  61   TPFMFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESEWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            ANL VLA+KL++D  HTIKAICIVHNETATGVTN+++
Sbjct  121  ANLQVLAAKLSQDQNHTIKAICIVHNETATGVTNDIS  157



>gb|KJB54389.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
 gb|KJB54390.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
 gb|KJB54392.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
 gb|KJB54394.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
Length=401

 Score =   298 bits (763),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 140/158 (89%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PG+NHLFVPGPVNIP+ V+RAM RNNEDYRSPA+PA+TK LLEDVKKIFKT++G
Sbjct  1    MDYVYGPGKNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAIPAMTKNLLEDVKKIFKTSTG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFLIPTTGTGAWESALTNTLSPGDR VSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLAT  629
            ANLD+LA KLA D +HTIKAICIVHNETATGVTNNLAT
Sbjct  121  ANLDILAEKLAADHSHTIKAICIVHNETATGVTNNLAT  158



>gb|ABQ81922.1| aminotransferase 2 [Cucumis sativus]
Length=401

 Score =   298 bits (763),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 140/157 (89%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGRNHLFVPGPVNIP+QV+RAM RNNEDYRSPAVPALTKTLLEDVKKIFKT+SG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTSSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFL PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNF VDV+ESEWG+G
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFKVDVIESEWGEG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            A LDVLA+KLA DT HTIKA+CIVHNETATGVTN+L+
Sbjct  121  AKLDVLAAKLAADTDHTIKAVCIVHNETATGVTNDLS  157



>gb|AGL09524.1| alanine-glyoxylate aminotransferase, partial [Calycanthus occidentalis]
Length=289

 Score =   294 bits (753),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 141/151 (93%), Positives = 146/151 (97%), Gaps = 0/151 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  353
            PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPAVPALTK LLEDVKKIFKTT+ TPF+IP
Sbjct  1    PGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAVPALTKILLEDVKKIFKTTTATPFVIP  60

Query  354  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  533
            TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDV+ES+WGQGANLDVL
Sbjct  61   TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVIESDWGQGANLDVL  120

Query  534  ASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            ASKLA DTAHTIKAICIVHNETATGVTNNLA
Sbjct  121  ASKLAADTAHTIKAICIVHNETATGVTNNLA  151



>ref|XP_004140203.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
sativus]
 ref|XP_004156042.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
sativus]
 gb|KGN48108.1| Aminotransferase 2 [Cucumis sativus]
Length=401

 Score =   298 bits (762),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 140/157 (89%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGRNHLFVPGPVNIP+QV+RAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFL PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNF VDV+ES+WG+G
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFKVDVIESDWGEG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            A LDVLA+KLA DT HTIKA+CIVHNETATGVTN+L+
Sbjct  121  AKLDVLAAKLAADTDHTIKAVCIVHNETATGVTNDLS  157



>emb|CDX89604.1| BnaC03g45180D [Brassica napus]
Length=401

 Score =   297 bits (761),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 151/157 (96%), Gaps = 0/157 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY+N PGR+HLFVPGPVNIP+QVIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYMNGPGRHHLFVPGPVNIPEQVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPF+ PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQ+RLNFNVDVVES+WGQG
Sbjct  61   TPFMFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESDWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            ANL VLASKL++D  H+IKAICIVHNETATGVTN+++
Sbjct  121  ANLQVLASKLSQDQNHSIKAICIVHNETATGVTNDIS  157



>ref|XP_009136209.1| PREDICTED: serine--glyoxylate aminotransferase-like [Brassica 
rapa]
 ref|XP_009136210.1| PREDICTED: serine--glyoxylate aminotransferase-like [Brassica 
rapa]
 emb|CDX93112.1| BnaA03g38340D [Brassica napus]
Length=401

 Score =   297 bits (761),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 151/157 (96%), Gaps = 0/157 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY+N PGR+HLFVPGPVNIP+QVIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYMNGPGRHHLFVPGPVNIPEQVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPF+ PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQ+RLNFNVDVVES+WGQG
Sbjct  61   TPFMFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESDWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            ANL VLASKL++D  H+IKAICIVHNETATGVTN+++
Sbjct  121  ANLQVLASKLSQDQNHSIKAICIVHNETATGVTNDIS  157



>gb|KHG14448.1| Serine--glyoxylate aminotransferase -like protein [Gossypium 
arboreum]
Length=401

 Score =   297 bits (761),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 142/158 (90%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MD   APG+NHLFVPGPVNIP+ VIRAM RNNEDYRSPA+PA+TKTLLEDVKKIFKTT+G
Sbjct  1    MDNFYAPGKNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPAMTKTLLEDVKKIFKTTTG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPF+IPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVESEWGQG
Sbjct  61   TPFMIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVESEWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLAT  629
            ANLDVLA KLA D  HTIKAICIVHNETATGVTNNLAT
Sbjct  121  ANLDVLAEKLAADRTHTIKAICIVHNETATGVTNNLAT  158



>gb|AGL09530.1| alanine-glyoxylate aminotransferase, partial [Xymalos monospora]
Length=289

 Score =   293 bits (750),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 141/151 (93%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  353
            PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPA+PALTK LLEDVKKIFKT +GTPFLIP
Sbjct  1    PGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKILLEDVKKIFKTATGTPFLIP  60

Query  354  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  533
            TTGTGAWES LTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL
Sbjct  61   TTGTGAWESTLTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  120

Query  534  ASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            ASKLA D AHTIKAICIVHNETATGVTNNLA
Sbjct  121  ASKLAADRAHTIKAICIVHNETATGVTNNLA  151



>ref|XP_010909203.1| PREDICTED: serine--glyoxylate aminotransferase [Elaeis guineensis]
 ref|XP_010909204.1| PREDICTED: serine--glyoxylate aminotransferase [Elaeis guineensis]
Length=402

 Score =   297 bits (760),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 143/158 (91%), Positives = 150/158 (95%), Gaps = 1/158 (1%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVES-EWGQ  512
            TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL F+VDV+ES EWGQ
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFDVDVIESGEWGQ  120

Query  513  GANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            GANLD+LA+KLA D A+TIKAICIVHNETATGVTNNLA
Sbjct  121  GANLDILATKLAADRAYTIKAICIVHNETATGVTNNLA  158



>gb|ABQ81924.1| aminotransferase 2 [Cucumis sativus]
Length=401

 Score =   296 bits (759),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 140/157 (89%), Positives = 148/157 (94%), Gaps = 0/157 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGRNHLFVPGPVNIP+QV+RAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPF  PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNF VDV+ESEWG+G
Sbjct  61   TPFSFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFKVDVIESEWGEG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            A LDVLA+KLA DT HTIKA+CIVHNETATGVTN+L+
Sbjct  121  AKLDVLAAKLAADTDHTIKAVCIVHNETATGVTNDLS  157



>ref|XP_002531124.1| serine-pyruvate aminotransferase, putative [Ricinus communis]
 gb|EEF31258.1| serine-pyruvate aminotransferase, putative [Ricinus communis]
Length=401

 Score =   296 bits (757),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 139/157 (89%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPAVPALTKTLLEDVKKIFKTT+G
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTTG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFL PTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL F+VDVV+S+WGQG
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRLGFDVDVVKSQWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            ANLD+LASKLA D+AHTIKA+CIVHNETATGVTN+LA
Sbjct  121  ANLDILASKLAADSAHTIKAVCIVHNETATGVTNDLA  157



>gb|AAL47679.1| aminotransferase 1 [Cucumis melo]
Length=401

 Score =   296 bits (757),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 141/157 (90%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV APG+NHLFVPGPVNIP+ V+RAM RNNEDYRSPAVPALTKTLLEDVKKIFK+T+G
Sbjct  1    MDYVYAPGKNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKSTTG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            T FLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVES+WGQG
Sbjct  61   TTFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESDWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            ANLDVL SKLA D  HTIKAICIVHNETATGVTN+L+
Sbjct  121  ANLDVLESKLATDGGHTIKAICIVHNETATGVTNDLS  157



>ref|XP_006297832.1| hypothetical protein CARUB_v10013869mg [Capsella rubella]
 gb|EOA30730.1| hypothetical protein CARUB_v10013869mg [Capsella rubella]
Length=401

 Score =   295 bits (756),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY+  PGR+HLFVPGPVNIP+ VIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYMYGPGRHHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFL PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQ+RLNFNVDVVES+WGQG
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESDWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            ANL VLASKL+ED +H+IKAICIVHNETATGVTN+++
Sbjct  121  ANLQVLASKLSEDASHSIKAICIVHNETATGVTNDIS  157



>gb|AAQ56192.1| aminotransferase 1 [Cucumis melo]
Length=401

 Score =   295 bits (756),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 140/157 (89%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV APG+NHLFVPGPVNIP+ V+RAM RNNEDYRSPAVPALTKTLLEDVKKIFK+T+G
Sbjct  1    MDYVYAPGKNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKSTTG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            T FLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDV+ES+WGQG
Sbjct  61   TTFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVIESDWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            ANLDVL SKLA D  HTIKAICIVHNETATGVTN+L+
Sbjct  121  ANLDVLESKLATDGGHTIKAICIVHNETATGVTNDLS  157



>ref|XP_009415566.1| PREDICTED: serine--glyoxylate aminotransferase [Musa acuminata 
subsp. malaccensis]
Length=401

 Score =   295 bits (755),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 139/157 (89%), Positives = 148/157 (94%), Gaps = 0/157 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MD+V  PG+NHLFVPGPVNIP+ VIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDFVYGPGKNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNF VDVVESEWG+G
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFRVDVVESEWGRG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            A+LD LASKL  D +HTIKA+CIVHNETATGVTN+LA
Sbjct  121  ADLDALASKLEADRSHTIKAVCIVHNETATGVTNDLA  157



>ref|XP_002885871.1| hypothetical protein ARALYDRAFT_480305 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62130.1| hypothetical protein ARALYDRAFT_480305 [Arabidopsis lyrata subsp. 
lyrata]
Length=401

 Score =   295 bits (754),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 139/157 (89%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY+  PGR+HLFVPGPVNIP+ VIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYMYGPGRHHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFL PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQ+RLNFNVDVVESEWGQG
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESEWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            ANL VLASKL++D  HTIKAICIVHNETATGVTN+++
Sbjct  121  ANLQVLASKLSQDENHTIKAICIVHNETATGVTNDIS  157



>ref|NP_001284450.1| serine--glyoxylate aminotransferase [Cucumis melo]
 gb|AAQ56194.1| aminotransferase 1 [Cucumis melo]
Length=401

 Score =   294 bits (753),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 140/157 (89%), Positives = 148/157 (94%), Gaps = 0/157 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV APG+NHLFVPGPVNIP+ V+RAM RNNEDYRSPAVPAL KTLLEDVKKIFK+T+G
Sbjct  1    MDYVYAPGKNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAVPALAKTLLEDVKKIFKSTTG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            T FLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVES+WGQG
Sbjct  61   TTFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESDWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            ANLDVL SKLA D  HTIKAICIVHNETATGVTN+L+
Sbjct  121  ANLDVLESKLATDGGHTIKAICIVHNETATGVTNDLS  157



>gb|AAQ56193.1| aminotransferase 2 [Cucumis melo]
Length=401

 Score =   294 bits (753),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 139/157 (89%), Positives = 148/157 (94%), Gaps = 0/157 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGRNHLFVPGPVNIP+QV+RAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            T FL PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWID+QQRLNF VDV+ESEWG+G
Sbjct  61   TLFLFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDRQQRLNFKVDVIESEWGEG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            A LDVLA+KLA DT HTIKA+CIVHNETATGVTN+L+
Sbjct  121  AKLDVLAAKLAADTDHTIKAVCIVHNETATGVTNDLS  157



>ref|XP_010488837.1| PREDICTED: serine--glyoxylate aminotransferase-like [Camelina 
sativa]
Length=401

 Score =   294 bits (752),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY+  PGR+HLFVPGPVNIP+ VIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYMYGPGRHHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFL PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQ+RLNFNVDVVESEWGQG
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESEWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            ANL VLASKL++D  H+IKAICIVHNETATGVTN+++
Sbjct  121  ANLQVLASKLSQDENHSIKAICIVHNETATGVTNDIS  157



>ref|XP_010518509.1| PREDICTED: serine--glyoxylate aminotransferase isoform X1 [Camelina 
sativa]
 ref|XP_010518516.1| PREDICTED: serine--glyoxylate aminotransferase isoform X1 [Camelina 
sativa]
 ref|XP_010518525.1| PREDICTED: serine--glyoxylate aminotransferase isoform X2 [Camelina 
sativa]
Length=401

 Score =   294 bits (752),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY+  PGR+HLFVPGPVNIP+ VIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYMYGPGRHHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFL PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQ+RLNFNVDVVESEWGQG
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESEWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            ANL VLASKL++D  H+IKAICIVHNETATGVTN+++
Sbjct  121  ANLQVLASKLSQDENHSIKAICIVHNETATGVTNDIS  157



>ref|XP_004139054.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
sativus]
 ref|XP_004166102.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
sativus]
 gb|KGN66521.1| Aminotransferase 1 [Cucumis sativus]
Length=401

 Score =   293 bits (750),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 140/157 (89%), Positives = 148/157 (94%), Gaps = 0/157 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV APG+NHLFVPGPVNIP+ V+RAM RNNEDYRSPAVPALTKTLLEDVKKIFK+T+G
Sbjct  1    MDYVYAPGKNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKSTAG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            T FLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVES+WGQG
Sbjct  61   TTFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESDWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            ANLDVL SKLA D   TIKAICIVHNETATGVTN+L+
Sbjct  121  ANLDVLESKLAADGGQTIKAICIVHNETATGVTNDLS  157



>ref|NP_178969.1| alanine--glyoxylate aminotransferase [Arabidopsis thaliana]
 ref|NP_849951.1| alanine--glyoxylate aminotransferase [Arabidopsis thaliana]
 sp|Q56YA5.2|SGAT_ARATH RecName: Full=Serine--glyoxylate aminotransferase; AltName: Full=Alanine--glyoxylate 
aminotransferase; Short=AGT; AltName: 
Full=Asparagine aminotransferase; AltName: Full=Serine--pyruvate 
aminotransferase [Arabidopsis thaliana]
 gb|AAC26854.1| alanine:glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AAD28669.1| alanine-glyoxylate aminotransferase [Arabidopsis thaliana]
 dbj|BAB20811.1| serine glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AAM20136.1| putative alanine-glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AAM45058.1| putative alanine-glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AEC06227.1| alanine--glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AEC06228.1| alanine--glyoxylate aminotransferase [Arabidopsis thaliana]
Length=401

 Score =   293 bits (750),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY+  PGR+HLFVPGPVNIP+ VIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYMYGPGRHHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFL PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQ+RLNFNVDVVES+WGQG
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESDWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            ANL VLASKL++D  HTIKAICIVHNETATGVTN+++
Sbjct  121  ANLQVLASKLSQDENHTIKAICIVHNETATGVTNDIS  157



>ref|XP_010557501.1| PREDICTED: serine--glyoxylate aminotransferase [Tarenaya hassleriana]
 ref|XP_010557502.1| PREDICTED: serine--glyoxylate aminotransferase [Tarenaya hassleriana]
Length=401

 Score =   293 bits (750),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPF+IPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVESEWG+G
Sbjct  61   TPFIIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVESEWGRG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            A+L VL+SKL++D  HTIKAICIVHNETATGVTN+++
Sbjct  121  ADLQVLSSKLSQDPQHTIKAICIVHNETATGVTNDIS  157



>gb|AAB95218.1| putative serine-glyoxylate aminotransferase [Fritillaria agrestis]
Length=401

 Score =   293 bits (749),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 146/157 (93%), Gaps = 0/157 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGRNHLFVPGPVNIP+ VIRAM RNNEDYR+PA+PALTKTLLEDVKK+FKTT+G
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRAPAIPALTKTLLEDVKKLFKTTTG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPF+IPTTGTGAWESALTNTLSPGD IVSFLIGQFSLLWIDQQQRL F VDV+ESEWGQG
Sbjct  61   TPFIIPTTGTGAWESALTNTLSPGDTIVSFLIGQFSLLWIDQQQRLKFKVDVIESEWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            ANLD LASKLA D  HTIKA+CIVHNETATGVTNNLA
Sbjct  121  ANLDELASKLAADRTHTIKAVCIVHNETATGVTNNLA  157



>ref|XP_010467178.1| PREDICTED: serine--glyoxylate aminotransferase-like [Camelina 
sativa]
Length=454

 Score =   294 bits (752),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY+  PGR+HLFVPGPVNIP+ VIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYMYGPGRHHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFL PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQ+RLNFNVDVVESEWGQG
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESEWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            ANL VLASKL++D  H+IKAICIVHNETATGVTN+++
Sbjct  121  ANLQVLASKLSQDENHSIKAICIVHNETATGVTNDIS  157



>ref|XP_010673724.1| PREDICTED: serine--glyoxylate aminotransferase [Beta vulgaris 
subsp. vulgaris]
Length=401

 Score =   292 bits (747),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY+  PGR+HLFVPGPVNIP+ VIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTT+G
Sbjct  1    MDYMYGPGRHHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTTG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQ+RL FNVDV+ESEWG+G
Sbjct  61   TPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQKRLGFNVDVIESEWGRG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLAT  629
            A+L+ ++SK+A DTAHT+KAICIVHNETATGVTNNLAT
Sbjct  121  ADLEAMSSKIAADTAHTVKAICIVHNETATGVTNNLAT  158



>gb|AGL09523.1| alanine-glyoxylate aminotransferase, partial [Asarum caudatum]
Length=289

 Score =   287 bits (735),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 136/151 (90%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  353
            PGRNHLFVPGPVNIP+ V+RAM RNNEDYRSPAVPA+TKTLLEDVKKIFKTTSGTPFLIP
Sbjct  1    PGRNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAVPAMTKTLLEDVKKIFKTTSGTPFLIP  60

Query  354  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  533
            TTGTGAWESALTNTLSPGD+ VSFLIGQFSLLWIDQQQRL FNV+V+ESEWGQGANLD+L
Sbjct  61   TTGTGAWESALTNTLSPGDQTVSFLIGQFSLLWIDQQQRLKFNVNVIESEWGQGANLDIL  120

Query  534  ASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            ASKLA D+ H IKAICIVHNETATGVTNNLA
Sbjct  121  ASKLAADSEHKIKAICIVHNETATGVTNNLA  151



>gb|ABR26028.1| serine-glyoxylate aminotransferase [Oryza sativa Indica Group]
Length=198

 Score =   283 bits (725),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 134/156 (86%), Positives = 145/156 (93%), Gaps = 0/156 (0%)
 Frame = +3

Query  159  DYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGT  338
            DYV  PGRNHLFVPGPVNIPDQVIRAM+R NEDYRSPAVPALTKTLLEDVK+IFKTT+GT
Sbjct  3    DYVYGPGRNHLFVPGPVNIPDQVIRAMSRQNEDYRSPAVPALTKTLLEDVKQIFKTTTGT  62

Query  339  PFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGA  518
            PFL PTTGTGAWESALTNTLSPGD+IVSFLIGQFSLLWIDQQQRLNFNVDVVES+WG GA
Sbjct  63   PFLFPTTGTGAWESALTNTLSPGDKIVSFLIGQFSLLWIDQQQRLNFNVDVVESDWGYGA  122

Query  519  NLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            +L  L  KL +D +H+IKAICIVHNETATGVTN+L+
Sbjct  123  DLAALDYKLRQDPSHSIKAICIVHNETATGVTNDLS  158



>dbj|BAJ90006.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ90413.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95504.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95684.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=401

 Score =   288 bits (737),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 135/156 (87%), Positives = 145/156 (93%), Gaps = 0/156 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY+N PGRNHLFVPGPVNIPDQVIRAM+R NEDYRSPA+PALTKTLLEDVKKIFKTT+G
Sbjct  1    MDYMNGPGRNHLFVPGPVNIPDQVIRAMSRQNEDYRSPAIPALTKTLLEDVKKIFKTTTG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFL PTTGTGAWESALTNTLSPGDRIVSF +GQFSLLWIDQQQRL F+VDVVES+WG G
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRIVSFSLGQFSLLWIDQQQRLGFSVDVVESDWGYG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNL  623
            A+L VL SKL  D+ HTIKAICIVHNETATGVTN+L
Sbjct  121  ADLGVLESKLRSDSQHTIKAICIVHNETATGVTNDL  156



>ref|XP_003574732.2| PREDICTED: serine--glyoxylate aminotransferase [Brachypodium 
distachyon]
Length=461

 Score =   290 bits (741),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = +3

Query  144  EGEKMDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFK  323
            E  KMDYV  PGRNHLFVPGPVNIPD VIRAM+R NEDYRSPAVPALTKTLLEDVKKIFK
Sbjct  57   ENSKMDYVYGPGRNHLFVPGPVNIPDPVIRAMSRQNEDYRSPAVPALTKTLLEDVKKIFK  116

Query  324  TTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESE  503
            TT+GTPFL PTTGTGAWESALTNTLSPGDRIVSF +GQFSLLWIDQQQRLNF VDVVES+
Sbjct  117  TTTGTPFLFPTTGTGAWESALTNTLSPGDRIVSFSLGQFSLLWIDQQQRLNFQVDVVESD  176

Query  504  WGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNL  623
            WG GA+L  L +KL++D AHTIKA+CIVHNETATGVTN+L
Sbjct  177  WGHGADLGALETKLSQDAAHTIKAVCIVHNETATGVTNDL  216



>gb|EMS66805.1| Serine--glyoxylate aminotransferase [Triticum urartu]
Length=401

 Score =   286 bits (732),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 134/156 (86%), Positives = 144/156 (92%), Gaps = 0/156 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY+N PGRNHLFVPGPVNIPDQVIRAM+R NEDYRSPA+PALTKTLLEDVKKIFKTT+G
Sbjct  1    MDYMNGPGRNHLFVPGPVNIPDQVIRAMSRQNEDYRSPAIPALTKTLLEDVKKIFKTTTG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFL PTTGTGAWESALTNTLSPGDRIVSF +GQFSLLWIDQQQRL F+VDVVES+WG G
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRIVSFSLGQFSLLWIDQQQRLGFSVDVVESDWGYG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNL  623
            A+L  L SKL  D+ HTIKAICIVHNETATGVTN+L
Sbjct  121  ADLGALESKLRTDSQHTIKAICIVHNETATGVTNDL  156



>ref|XP_004973838.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X2 
[Setaria italica]
 ref|XP_004973839.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X3 
[Setaria italica]
Length=402

 Score =   286 bits (732),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 137/157 (87%), Positives = 145/157 (92%), Gaps = 0/157 (0%)
 Frame = +3

Query  159  DYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGT  338
            DYV  PGR HLFVPGPVNIPD VIRAM R NEDYRSPAVP LTK LLEDVKKIFKTT+GT
Sbjct  3    DYVYGPGRTHLFVPGPVNIPDPVIRAMNRQNEDYRSPAVPVLTKILLEDVKKIFKTTTGT  62

Query  339  PFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGA  518
            PF+IPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVES+WG+GA
Sbjct  63   PFIIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLGFNVDVVESDWGRGA  122

Query  519  NLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLAT  629
            +LDVL +KL +DTAHTIKAI IVHNETATGVTN+LAT
Sbjct  123  DLDVLEAKLRQDTAHTIKAIAIVHNETATGVTNDLAT  159



>ref|XP_002279236.1| PREDICTED: serine--glyoxylate aminotransferase [Vitis vinifera]
 ref|XP_010651495.1| PREDICTED: serine--glyoxylate aminotransferase [Vitis vinifera]
Length=401

 Score =   286 bits (732),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 135/157 (86%), Positives = 144/157 (92%), Gaps = 0/157 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MD   APG NHLFVPGPVNIPD VIRAM RNNEDYR+P +PALTK LLEDVKKIFKTT+G
Sbjct  1    MDRYFAPGTNHLFVPGPVNIPDHVIRAMNRNNEDYRAPPIPALTKDLLEDVKKIFKTTTG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFLIPTTGTGAWESALTNTLSPGDR VSFLIGQFSLLWIDQQ+RL FNVDV+ESEWGQG
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQQKRLRFNVDVIESEWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            ANL++LA K+A D AHTIKA+CIVHNETATGVTNNLA
Sbjct  121  ANLEILAEKIAADRAHTIKAVCIVHNETATGVTNNLA  157



>emb|CAN84001.1| hypothetical protein VITISV_007680 [Vitis vinifera]
Length=401

 Score =   286 bits (731),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 135/157 (86%), Positives = 144/157 (92%), Gaps = 0/157 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MD   APG NHLFVPGPVNIPD VIRAM RNNEDYR+P +PALTK LLEDVKKIFKTT+G
Sbjct  1    MDRYFAPGTNHLFVPGPVNIPDHVIRAMNRNNEDYRAPPIPALTKDLLEDVKKIFKTTTG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFLIPTTGTGAWESALTNTLSPGDR VSFLIGQFSLLWIDQQ+RL FNVDV+ESEWGQG
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQQKRLRFNVDVIESEWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            ANL++LA K+A D AHTIKA+CIVHNETATGVTNNLA
Sbjct  121  ANLEILAEKIAADRAHTIKAVCIVHNETATGVTNNLA  157



>ref|XP_004973837.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X1 
[Setaria italica]
Length=437

 Score =   286 bits (732),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 137/157 (87%), Positives = 145/157 (92%), Gaps = 0/157 (0%)
 Frame = +3

Query  159  DYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGT  338
            DYV  PGR HLFVPGPVNIPD VIRAM R NEDYRSPAVP LTK LLEDVKKIFKTT+GT
Sbjct  38   DYVYGPGRTHLFVPGPVNIPDPVIRAMNRQNEDYRSPAVPVLTKILLEDVKKIFKTTTGT  97

Query  339  PFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGA  518
            PF+IPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVES+WG+GA
Sbjct  98   PFIIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLGFNVDVVESDWGRGA  157

Query  519  NLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLAT  629
            +LDVL +KL +DTAHTIKAI IVHNETATGVTN+LAT
Sbjct  158  DLDVLEAKLRQDTAHTIKAIAIVHNETATGVTNDLAT  194



>ref|NP_001062170.1| Os08g0502700 [Oryza sativa Japonica Group]
 dbj|BAD08917.1| putative aminotransferase [Oryza sativa Japonica Group]
 dbj|BAD09269.1| putative aminotransferase [Oryza sativa Japonica Group]
 dbj|BAF24084.1| Os08g0502700 [Oryza sativa Japonica Group]
 gb|EAZ07527.1| hypothetical protein OsI_29783 [Oryza sativa Indica Group]
 gb|EAZ43252.1| hypothetical protein OsJ_27850 [Oryza sativa Japonica Group]
 dbj|BAG89198.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89373.1| unnamed protein product [Oryza sativa Japonica Group]
Length=402

 Score =   284 bits (727),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 134/156 (86%), Positives = 145/156 (93%), Gaps = 0/156 (0%)
 Frame = +3

Query  159  DYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGT  338
            DYV  PGRNHLFVPGPVNIPDQVIRAM+R NEDYRSPAVPALTKTLLEDVK+IFKTT+GT
Sbjct  3    DYVYGPGRNHLFVPGPVNIPDQVIRAMSRQNEDYRSPAVPALTKTLLEDVKQIFKTTTGT  62

Query  339  PFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGA  518
            PFL PTTGTGAWESALTNTLSPGD+IVSFLIGQFSLLWIDQQQRLNFNVDVVES+WG GA
Sbjct  63   PFLFPTTGTGAWESALTNTLSPGDKIVSFLIGQFSLLWIDQQQRLNFNVDVVESDWGYGA  122

Query  519  NLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            +L  L  KL +D +H+IKAICIVHNETATGVTN+L+
Sbjct  123  DLAALDYKLRQDPSHSIKAICIVHNETATGVTNDLS  158



>ref|XP_006659561.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X1 
[Oryza brachyantha]
 ref|XP_006659562.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X2 
[Oryza brachyantha]
 ref|XP_006659563.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X3 
[Oryza brachyantha]
Length=402

 Score =   284 bits (726),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 135/156 (87%), Positives = 142/156 (91%), Gaps = 0/156 (0%)
 Frame = +3

Query  159  DYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGT  338
            DY   PGRNHLFVPGPVNIPDQVIRAM R NEDYRSPAVPALTKTLLEDVK+IFKTT+GT
Sbjct  3    DYAYGPGRNHLFVPGPVNIPDQVIRAMNRQNEDYRSPAVPALTKTLLEDVKQIFKTTTGT  62

Query  339  PFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGA  518
            PFL PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNF VDVVES+WGQGA
Sbjct  63   PFLFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFKVDVVESDWGQGA  122

Query  519  NLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            +L  L  KL  D +HTIKAICIVHNETATGVTN+L+
Sbjct  123  DLAALDYKLRGDPSHTIKAICIVHNETATGVTNDLS  158



>ref|XP_002444789.1| hypothetical protein SORBIDRAFT_07g028080 [Sorghum bicolor]
 gb|EES14284.1| hypothetical protein SORBIDRAFT_07g028080 [Sorghum bicolor]
Length=402

 Score =   281 bits (719),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 133/156 (85%), Positives = 142/156 (91%), Gaps = 0/156 (0%)
 Frame = +3

Query  159  DYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGT  338
            DYV  PGRNHLFVPGPVNIPD VIRAM R NEDYRSPA+PALTK LLEDVK+IFKTT+GT
Sbjct  3    DYVYGPGRNHLFVPGPVNIPDPVIRAMNRQNEDYRSPAIPALTKVLLEDVKRIFKTTTGT  62

Query  339  PFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGA  518
            PFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL F+VDVVES+WG GA
Sbjct  63   PFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLGFDVDVVESDWGHGA  122

Query  519  NLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            +LD L  KL +DT HTIKA+ IVHNETATGVTN+LA
Sbjct  123  DLDALERKLRDDTLHTIKAVAIVHNETATGVTNDLA  158



>gb|AGL09528.1| alanine-glyoxylate aminotransferase, partial [Saururus cernuus]
Length=279

 Score =   275 bits (702),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 133/141 (94%), Positives = 137/141 (97%), Gaps = 0/141 (0%)
 Frame = +3

Query  207  VNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESAL  386
            VNIP+ VIRAM RNNEDYRSPAVPA+TKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESAL
Sbjct  1    VNIPEPVIRAMNRNNEDYRSPAVPAMTKTLLEDVKKIFKTTSGTPFMIPTTGTGAWESAL  60

Query  387  TNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHT  566
            TNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVESEWGQGANLD+LASKLA DTAHT
Sbjct  61   TNTLSPGDRIVSFLIGQFSLLWIDQQQRLGFNVDVVESEWGQGANLDILASKLAADTAHT  120

Query  567  IKAICIVHNETATGVTNNLAT  629
            IKAICIVHNETATGVTNNLAT
Sbjct  121  IKAICIVHNETATGVTNNLAT  141



>ref|XP_004491262.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cicer arietinum]
Length=401

 Score =   276 bits (705),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 128/156 (82%), Positives = 144/156 (92%), Gaps = 0/156 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDYV  PGR+HLFVPGP NIP+QVIRAM RNNE++R+PA+PALTK LL+DVKKIFKTTSG
Sbjct  1    MDYVYGPGRSHLFVPGPSNIPEQVIRAMNRNNENHRTPAIPALTKALLDDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
             PFLIP+TGTGAWESALTNTLSPGD+IVSFL+GQFSLLWI+QQ++LNF VDVVESEWGQ 
Sbjct  61   IPFLIPSTGTGAWESALTNTLSPGDQIVSFLMGQFSLLWIEQQKKLNFKVDVVESEWGQD  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNL  623
            A+LD L SKLA D +HTIKAICIVHNETATGVTN+L
Sbjct  121  ADLDALESKLASDKSHTIKAICIVHNETATGVTNDL  156



>ref|XP_003617296.1| Alanine glyoxylate aminotransferase [Medicago truncatula]
 gb|AET00255.1| serine-glyoxylate aminotransferase-like protein [Medicago truncatula]
Length=401

 Score =   273 bits (697),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 128/156 (82%), Positives = 139/156 (89%), Gaps = 0/156 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MD+   PGRNHLFVPGP NIP+ VIRAM RNNE++R+PA+  LTKTLL+DVKKIFKTTSG
Sbjct  1    MDFAYGPGRNHLFVPGPTNIPEHVIRAMNRNNENHRTPAITTLTKTLLDDVKKIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
             PFLIPTTGTGAWESALTNTLSPGDR VSFLIGQFSLLWI+QQ+RLNF VDVVESEWGQG
Sbjct  61   IPFLIPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIEQQKRLNFKVDVVESEWGQG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNL  623
            A+LD L SKLA D  HTIKAICIVHNET TGVTN+L
Sbjct  121  ADLDALESKLASDKTHTIKAICIVHNETTTGVTNDL  156



>gb|ABF70331.1| aminotransferase 1 [Cucumis sativus]
Length=386

 Score =   271 bits (693),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 131/150 (87%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  356
            GR +  VPGPVNIP+ V+RAM RNNEDYRSPAVPALTKTLLEDVKKIFK+T+GT FLIPT
Sbjct  1    GRGNSIVPGPVNIPEPVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKSTAGTTFLIPT  60

Query  357  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  536
            TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVES+WGQGANLDVL 
Sbjct  61   TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESDWGQGANLDVLE  120

Query  537  SKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            SKLA D   TIKAICIVHNETATGVTN+L+
Sbjct  121  SKLAADGGQTIKAICIVHNETATGVTNDLS  150



>tpg|DAA47863.1| TPA: hypothetical protein ZEAMMB73_595389 [Zea mays]
Length=368

 Score =   268 bits (685),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 129/157 (82%), Positives = 138/157 (88%), Gaps = 1/157 (1%)
 Frame = +3

Query  159  DYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGT  338
            DYV  PGR HLFVPGPVNIPD VIRAM R NEDYRSPAVPALTK LLEDVKKIFKTT+GT
Sbjct  3    DYVYGPGRTHLFVPGPVNIPDPVIRAMNRQNEDYRSPAVPALTKVLLEDVKKIFKTTTGT  62

Query  339  PFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGA  518
            PF+IPTTGTGAWESALTNTLSPGDR+VSFLIGQFSLLWIDQQ+RL F+VD VESEWGQGA
Sbjct  63   PFMIPTTGTGAWESALTNTLSPGDRVVSFLIGQFSLLWIDQQRRLGFDVDAVESEWGQGA  122

Query  519  NLDVLASKLAEDT-AHTIKAICIVHNETATGVTNNLA  626
            +L  L  +L ED   H IKA+ IVHNETATGVTN+LA
Sbjct  123  DLAALERRLREDAPRHAIKAVAIVHNETATGVTNDLA  159



>ref|NP_001148339.1| LOC100281949 [Zea mays]
 ref|XP_008675752.1| PREDICTED: LOC100281949 isoform X1 [Zea mays]
 ref|XP_008675758.1| PREDICTED: LOC100281949 isoform X1 [Zea mays]
 gb|ACG30854.1| serine--glyoxylate aminotransferase [Zea mays]
 gb|ACN28633.1| unknown [Zea mays]
 tpg|DAA47859.1| TPA: Serine--glyoxylate aminotransferase isoform 1 [Zea mays]
 tpg|DAA47860.1| TPA: Serine--glyoxylate aminotransferase isoform 2 [Zea mays]
 tpg|DAA47861.1| TPA: Serine--glyoxylate aminotransferase isoform 3 [Zea mays]
 tpg|DAA47862.1| TPA: Serine--glyoxylate aminotransferase isoform 4 [Zea mays]
Length=403

 Score =   268 bits (686),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 129/157 (82%), Positives = 138/157 (88%), Gaps = 1/157 (1%)
 Frame = +3

Query  159  DYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGT  338
            DYV  PGR HLFVPGPVNIPD VIRAM R NEDYRSPAVPALTK LLEDVKKIFKTT+GT
Sbjct  3    DYVYGPGRTHLFVPGPVNIPDPVIRAMNRQNEDYRSPAVPALTKVLLEDVKKIFKTTTGT  62

Query  339  PFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGA  518
            PF+IPTTGTGAWESALTNTLSPGDR+VSFLIGQFSLLWIDQQ+RL F+VD VESEWGQGA
Sbjct  63   PFMIPTTGTGAWESALTNTLSPGDRVVSFLIGQFSLLWIDQQRRLGFDVDAVESEWGQGA  122

Query  519  NLDVLASKLAEDT-AHTIKAICIVHNETATGVTNNLA  626
            +L  L  +L ED   H IKA+ IVHNETATGVTN+LA
Sbjct  123  DLAALERRLREDAPRHAIKAVAIVHNETATGVTNDLA  159



>gb|AGL09525.1| alanine-glyoxylate aminotransferase, partial [Manekia incurva]
Length=267

 Score =   253 bits (645),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/129 (95%), Positives = 125/129 (97%), Gaps = 0/129 (0%)
 Frame = +3

Query  243  RNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVS  422
            RNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSP DRIVS
Sbjct  2    RNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPCDRIVS  61

Query  423  FLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETA  602
            FLIGQFSLLWIDQQQRL FNVDVVES+WGQGANLD+LASKLA DT HTIKAICIVHNETA
Sbjct  62   FLIGQFSLLWIDQQQRLGFNVDVVESDWGQGANLDILASKLASDTTHTIKAICIVHNETA  121

Query  603  TGVTNNLAT  629
            TGVTNNLAT
Sbjct  122  TGVTNNLAT  130



>gb|AGL09531.1| alanine-glyoxylate aminotransferase, partial [Zippelia begoniifolia]
Length=259

 Score =   249 bits (635),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 120/126 (95%), Positives = 124/126 (98%), Gaps = 0/126 (0%)
 Frame = +3

Query  252  EDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLI  431
            EDYRSPAVPALTKTLL+DVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLI
Sbjct  1    EDYRSPAVPALTKTLLQDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLI  60

Query  432  GQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGV  611
            GQFSLLWIDQQQRL FNVDVVES+WGQGANLD+LASKLA DT+HTIKAICIVHNETATGV
Sbjct  61   GQFSLLWIDQQQRLGFNVDVVESDWGQGANLDILASKLASDTSHTIKAICIVHNETATGV  120

Query  612  TNNLAT  629
            TNNLAT
Sbjct  121  TNNLAT  126



>gb|AGL09529.1| alanine-glyoxylate aminotransferase, partial [Thottea sp. JN-2013]
Length=252

 Score =   248 bits (633),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 119/128 (93%), Positives = 126/128 (98%), Gaps = 0/128 (0%)
 Frame = +3

Query  243  RNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVS  422
            RNNEDYRSPAVP LTKTLLEDVKKIFKTT+GTPFLIPTTGTGAWESALTNTLSPGDRIVS
Sbjct  1    RNNEDYRSPAVPLLTKTLLEDVKKIFKTTAGTPFLIPTTGTGAWESALTNTLSPGDRIVS  60

Query  423  FLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETA  602
            FLIGQFSLLWIDQQQRLNFNVDVVES+WG+GA+L+VLASKLA DT+HTIKAIC+VHNETA
Sbjct  61   FLIGQFSLLWIDQQQRLNFNVDVVESDWGRGADLEVLASKLAADTSHTIKAICLVHNETA  120

Query  603  TGVTNNLA  626
            TGVTNNLA
Sbjct  121  TGVTNNLA  128



>gb|ABR16109.1| unknown [Picea sitchensis]
Length=359

 Score =   248 bits (632),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 131/157 (83%), Gaps = 0/157 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MD    PGRN LFVPGPVNIP+ V++AM RNNEDYR+P VPALTK LL DV KIFK+T+G
Sbjct  1    MDPFYGPGRNQLFVPGPVNIPEPVLQAMNRNNEDYRAPPVPALTKKLLADVPKIFKSTTG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFL PTTGTGAWESALTNTLSP DRI+SF +GQFSLLWIDQ +RLNF+VDVV  EWG G
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPRDRIISFEMGQFSLLWIDQMKRLNFDVDVVHCEWGTG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
             +L++L +KL  D  H +KAIC VHNETATGVTNNLA
Sbjct  121  VDLEILRTKLEADKEHKVKAICCVHNETATGVTNNLA  157



>gb|ACN39798.1| unknown [Picea sitchensis]
Length=401

 Score =   248 bits (634),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 131/157 (83%), Gaps = 0/157 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MD    PGRN LFVPGPVNIP+ V++AM RNNEDYR+P VPALTK LL DV KIFK+T+G
Sbjct  1    MDPFYGPGRNQLFVPGPVNIPEPVLQAMNRNNEDYRAPPVPALTKKLLADVPKIFKSTTG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFL PTTGTGAWESALTNTLSP DRI+SF +GQFSLLWIDQ +RLNF+VDVV  EWG G
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPRDRIISFEMGQFSLLWIDQMKRLNFDVDVVHCEWGTG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
             +L++L +KL  D  H +KAIC VHNETATGVTNNLA
Sbjct  121  VDLEILRTKLEADKEHKVKAICCVHNETATGVTNNLA  157



>ref|XP_008666464.1| PREDICTED: serine--glyoxylate aminotransferase-like [Zea mays]
Length=229

 Score =   242 bits (618),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 128/147 (87%), Gaps = 1/147 (1%)
 Frame = +3

Query  189  LFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTG  368
            +FVPGPVNIP  V RAM R NEDYRSPAVPALTK LLEDVKKIFKTT+GTPF+IPTTGTG
Sbjct  1    MFVPGPVNIPGPVNRAMNRQNEDYRSPAVPALTKVLLEDVKKIFKTTTGTPFMIPTTGTG  60

Query  369  AWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLA  548
             WESALTNTLSPGDR+VSFLIGQFSLLWIDQQ+RL F+VD VESEWGQGA+L  L  +L 
Sbjct  61   VWESALTNTLSPGDRVVSFLIGQFSLLWIDQQRRLGFDVDAVESEWGQGADLAALERRLR  120

Query  549  EDT-AHTIKAICIVHNETATGVTNNLA  626
            +D   H IKA+ IVHNETATGVTN+LA
Sbjct  121  DDAPRHAIKAVAIVHNETATGVTNDLA  147



>gb|ABK24112.1| unknown [Picea sitchensis]
Length=401

 Score =   248 bits (632),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 130/157 (83%), Gaps = 0/157 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MD    PGRN LFVPGPVNIP+ V+ AM RNNEDYR+P VPALTK LL DV KIFK+T+G
Sbjct  1    MDPFYGPGRNQLFVPGPVNIPEPVLHAMNRNNEDYRAPPVPALTKKLLADVPKIFKSTTG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPFL PTTGTGAWESALTNTLSP DRI+SF +GQFSLLWIDQ +RLNF+VDVV  EWG G
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPRDRIISFEMGQFSLLWIDQMKRLNFDVDVVHCEWGTG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
             +L++L +KL  D  H +KAIC VHNETATGVTNNLA
Sbjct  121  VDLEILRTKLEADKEHKVKAICCVHNETATGVTNNLA  157



>tpg|DAA47874.1| TPA: hypothetical protein ZEAMMB73_131074 [Zea mays]
Length=290

 Score =   242 bits (618),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 128/147 (87%), Gaps = 1/147 (1%)
 Frame = +3

Query  189  LFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTG  368
            +FVPGPVNIP  V RAM R NEDYRSPAVPALTK LLEDVKKIFKTT+GTPF+IPTTGTG
Sbjct  1    MFVPGPVNIPGPVNRAMNRQNEDYRSPAVPALTKVLLEDVKKIFKTTTGTPFMIPTTGTG  60

Query  369  AWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLA  548
             WESALTNTLSPGDR+VSFLIGQFSLLWIDQQ+RL F+VD VESEWGQGA+L  L  +L 
Sbjct  61   VWESALTNTLSPGDRVVSFLIGQFSLLWIDQQRRLGFDVDAVESEWGQGADLAALERRLR  120

Query  549  EDTA-HTIKAICIVHNETATGVTNNLA  626
            +D   H IKA+ IVHNETATGVTN+LA
Sbjct  121  DDAPRHAIKAVAIVHNETATGVTNDLA  147



>ref|XP_001783551.1| predicted protein [Physcomitrella patens]
 gb|EDQ51640.1| predicted protein [Physcomitrella patens]
Length=402

 Score =   243 bits (619),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 104/157 (66%), Positives = 134/157 (85%), Gaps = 0/157 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            M+Y  APGRNHLFVPGP N+P+ ++RAM R+NED+RSPA P L+K++++DVK+IF+T + 
Sbjct  1    MEYYPAPGRNHLFVPGPTNVPEPILRAMNRSNEDHRSPAFPKLSKSVIDDVKEIFRTKTA  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            T F+ PTTGTGAWESALTNTLSPGD+I+SF +GQFSLLWIDQ QR NF+VDVV+ EWG G
Sbjct  61   TSFIFPTTGTGAWESALTNTLSPGDKIISFRLGQFSLLWIDQMQRYNFDVDVVDCEWGAG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
             +LDVL  KL  D +H++KA+C+VHNET+TGVTN++ 
Sbjct  121  IDLDVLKQKLVSDRSHSVKAVCVVHNETSTGVTNDIG  157



>emb|CBI24214.3| unnamed protein product [Vitis vinifera]
Length=374

 Score =   241 bits (614),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/130 (87%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +3

Query  237  MTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRI  416
            M RNNEDYR+P +PALTK LLEDVKKIFKTT+GTPFLIPTTGTGAWESALTNTLSPGDR 
Sbjct  1    MNRNNEDYRAPPIPALTKDLLEDVKKIFKTTTGTPFLIPTTGTGAWESALTNTLSPGDRT  60

Query  417  VSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNE  596
            VSFLIGQFSLLWIDQQ+RL FNVDV+ESEWGQGANL++LA K+A D AHTIKA+CIVHNE
Sbjct  61   VSFLIGQFSLLWIDQQKRLRFNVDVIESEWGQGANLEILAEKIAADRAHTIKAVCIVHNE  120

Query  597  TATGVTNNLA  626
            TATGVTNNLA
Sbjct  121  TATGVTNNLA  130



>ref|XP_001755667.1| predicted protein [Physcomitrella patens]
 gb|EDQ79340.1| predicted protein [Physcomitrella patens]
Length=402

 Score =   241 bits (615),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 104/157 (66%), Positives = 134/157 (85%), Gaps = 0/157 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            M+Y  APGRNHLFVPGP N+P+ ++RAM R+NED+RSPA P L+K++++DVK+IF+TT+ 
Sbjct  1    MEYYPAPGRNHLFVPGPTNVPEPILRAMNRSNEDHRSPAFPKLSKSVIDDVKQIFRTTTA  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            T F+ PTTGTGAWESALTNTLSPGD+I+SF +GQFSLLWIDQ QR NF+VDVV+ EWG G
Sbjct  61   TSFIFPTTGTGAWESALTNTLSPGDKIISFRLGQFSLLWIDQMQRYNFDVDVVDCEWGTG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
             +LD L  KL  D +H++KA+C+VHNET+TGVTN++ 
Sbjct  121  VDLDNLKQKLQSDWSHSVKAVCVVHNETSTGVTNDIG  157



>gb|AEX09293.1| alanine glyoxylate aminotransferase [Peperomia rupiseda]
Length=358

 Score =   237 bits (605),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 113/123 (92%), Positives = 120/123 (98%), Gaps = 0/123 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDRI+SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRIISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WGQGANL++LASKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGQGANLEILASKLASDAAHSIKAICIVHNETATGVTNN  120

Query  621  LAT  629
            LAT
Sbjct  121  LAT  123



>gb|AEX09262.1| alanine glyoxylate aminotransferase [Peperomia aff. ovatopeltata 
JN-2011]
Length=342

 Score =   236 bits (603),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 113/123 (92%), Positives = 119/123 (97%), Gaps = 0/123 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WGQGANL++LASKLA D AHTIKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGQGANLEILASKLASDAAHTIKAICIVHNETATGVTNN  120

Query  621  LAT  629
            LAT
Sbjct  121  LAT  123



>ref|XP_002983655.1| hypothetical protein SELMODRAFT_228964 [Selaginella moellendorffii]
 gb|EFJ15151.1| hypothetical protein SELMODRAFT_228964 [Selaginella moellendorffii]
Length=401

 Score =   238 bits (607),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 108/156 (69%), Positives = 132/156 (85%), Gaps = 0/156 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            M+Y  APGRNHLFVPGP N+P++VI+A +R NED+RSPA   L+K++L+ VK +FKT + 
Sbjct  1    MEYFPAPGRNHLFVPGPTNVPEKVIQAFSRGNEDHRSPAFATLSKSVLDGVKDLFKTKTA  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            T F+ PTTGTGAWESALTNTLSPGD+IVSF +GQFSLLWIDQ QRL FNVDVV+ EWG G
Sbjct  61   TSFIFPTTGTGAWESALTNTLSPGDKIVSFRLGQFSLLWIDQMQRLKFNVDVVDCEWGAG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNL  623
            A+L++L +KLA D  H IKAICIVHNET+TGVTN++
Sbjct  121  ADLNILNAKLAMDYNHEIKAICIVHNETSTGVTNSI  156



>gb|AEX09255.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score =   237 bits (604),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 114/123 (93%), Positives = 119/123 (97%), Gaps = 0/123 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPAVPALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAVPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WGQGANL++LASKLA D AHTIKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGQGANLEILASKLASDAAHTIKAICIVHNETATGVTNN  120

Query  621  LAT  629
            LAT
Sbjct  121  LAT  123



>ref|XP_002990557.1| hypothetical protein SELMODRAFT_448066 [Selaginella moellendorffii]
 gb|EFJ08434.1| hypothetical protein SELMODRAFT_448066 [Selaginella moellendorffii]
Length=401

 Score =   238 bits (607),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 108/156 (69%), Positives = 132/156 (85%), Gaps = 0/156 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            M+Y  APGRNHLFVPGP N+P++VI+A +R NED+RSPA   L+K++L+ VK +FKT + 
Sbjct  1    MEYFPAPGRNHLFVPGPTNVPEKVIQAFSRGNEDHRSPAFATLSKSVLDGVKDLFKTKTA  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            T F+ PTTGTGAWESALTNTLSPGD+IVSF +GQFSLLWIDQ QRL FNVDVV+ EWG G
Sbjct  61   TSFIFPTTGTGAWESALTNTLSPGDKIVSFRLGQFSLLWIDQMQRLKFNVDVVDCEWGAG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNL  623
            A+L++L +KLA D  H IKAICIVHNET+TGVTN++
Sbjct  121  ADLNILNAKLAMDYNHEIKAICIVHNETSTGVTNSI  156



>gb|AEX09248.1| alanine glyoxylate aminotransferase [Peperomia questionis]
Length=360

 Score =   236 bits (603),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 113/123 (92%), Positives = 119/123 (97%), Gaps = 0/123 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WGQGANL++LASKLA D AHTIKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGQGANLEILASKLASDAAHTIKAICIVHNETATGVTNN  120

Query  621  LAT  629
            LAT
Sbjct  121  LAT  123



>gb|AEX09252.1| alanine glyoxylate aminotransferase [Peperomia exclamationis]
Length=342

 Score =   236 bits (601),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 113/123 (92%), Positives = 119/123 (97%), Gaps = 0/123 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPAVPALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAVPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WGQGANL++LASKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGQGANLEILASKLASDAAHSIKAICIVHNETATGVTNN  120

Query  621  LAT  629
            LAT
Sbjct  121  LAT  123



>gb|AEX09287.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=331

 Score =   235 bits (599),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/123 (91%), Positives = 119/123 (97%), Gaps = 0/123 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA DTAH+IKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDTAHSIKAICIVHNETATGVTNN  120

Query  621  LAT  629
            LAT
Sbjct  121  LAT  123



>gb|AEX09282.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=332

 Score =   235 bits (599),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/123 (91%), Positives = 119/123 (97%), Gaps = 0/123 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA DTAH+IKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDTAHSIKAICIVHNETATGVTNN  120

Query  621  LAT  629
            LAT
Sbjct  121  LAT  123



>gb|AEX09251.1| alanine glyoxylate aminotransferase [Peperomia schizandra]
Length=331

 Score =   235 bits (599),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/123 (91%), Positives = 119/123 (97%), Gaps = 0/123 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WGQGANL++LASKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGQGANLEILASKLASDAAHSIKAICIVHNETATGVTNN  120

Query  621  LAT  629
            LAT
Sbjct  121  LAT  123



>gb|AEX09288.1| alanine glyoxylate aminotransferase [Peperomia parvisagittata]
Length=335

 Score =   235 bits (599),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/123 (91%), Positives = 119/123 (97%), Gaps = 0/123 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA DTAH+IKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDTAHSIKAICIVHNETATGVTNN  120

Query  621  LAT  629
            LAT
Sbjct  121  LAT  123



>gb|AEX09308.1| alanine glyoxylate aminotransferase [Peperomia polycephala]
Length=356

 Score =   235 bits (600),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/123 (91%), Positives = 119/123 (97%), Gaps = 0/123 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WGQGANLD+L+SKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGQGANLDILSSKLASDAAHSIKAICIVHNETATGVTNN  120

Query  621  LAT  629
            LAT
Sbjct  121  LAT  123



>gb|AEX09305.1| alanine glyoxylate aminotransferase [Peperomia pseudoverruculosa]
Length=362

 Score =   235 bits (600),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/123 (91%), Positives = 119/123 (97%), Gaps = 0/123 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WGQGANL++LASKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGQGANLEILASKLASDAAHSIKAICIVHNETATGVTNN  120

Query  621  LAT  629
            LAT
Sbjct  121  LAT  123



>gb|AEX09250.1| alanine glyoxylate aminotransferase [Peperomia schizandra]
Length=362

 Score =   235 bits (600),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/123 (91%), Positives = 119/123 (97%), Gaps = 0/123 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WGQGANL++LASKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGQGANLEILASKLASDAAHSIKAICIVHNETATGVTNN  120

Query  621  LAT  629
            LAT
Sbjct  121  LAT  123



>gb|AEX09246.1| alanine glyoxylate aminotransferase [Peperomia elatior]
Length=335

 Score =   234 bits (597),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/123 (91%), Positives = 118/123 (96%), Gaps = 0/123 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AHTIKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHTIKAICIVHNETATGVTNN  120

Query  621  LAT  629
            LAT
Sbjct  121  LAT  123



>gb|AEX09249.1| alanine glyoxylate aminotransferase [Peperomia aff. gracillima 
JN-2011]
Length=358

 Score =   235 bits (599),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 112/123 (91%), Positives = 118/123 (96%), Gaps = 0/123 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AHTIKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHTIKAICIVHNETATGVTNN  120

Query  621  LAT  629
            LAT
Sbjct  121  LAT  123



>gb|AEX09273.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=362

 Score =   235 bits (599),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 112/123 (91%), Positives = 119/123 (97%), Gaps = 0/123 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA DTAH+IKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDTAHSIKAICIVHNETATGVTNN  120

Query  621  LAT  629
            LAT
Sbjct  121  LAT  123



>gb|AEX09245.1| alanine glyoxylate aminotransferase [Peperomia putlaensis]
Length=349

 Score =   234 bits (597),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 112/123 (91%), Positives = 118/123 (96%), Gaps = 0/123 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AHTIKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHTIKAICIVHNETATGVTNN  120

Query  621  LAT  629
            LAT
Sbjct  121  LAT  123



>gb|AEX09310.1| alanine glyoxylate aminotransferase [Peperomia wernerrauhii]
Length=331

 Score =   233 bits (595),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 111/123 (90%), Positives = 118/123 (96%), Gaps = 0/123 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNETATGVTNN  120

Query  621  LAT  629
            LAT
Sbjct  121  LAT  123



>gb|AEX09266.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=350

 Score =   234 bits (596),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 111/123 (90%), Positives = 119/123 (97%), Gaps = 0/123 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WGQGANL++L+SKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGQGANLEILSSKLASDAAHSIKAICIVHNETATGVTNN  120

Query  621  LAT  629
            LAT
Sbjct  121  LAT  123



>gb|AEX09263.1| alanine glyoxylate aminotransferase [Peperomia putlaensis]
Length=358

 Score =   234 bits (597),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 112/123 (91%), Positives = 118/123 (96%), Gaps = 0/123 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPAVPALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAVPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNETATGVTNN  120

Query  621  LAT  629
            LAT
Sbjct  121  LAT  123



>gb|AEX09268.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=359

 Score =   234 bits (596),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 111/123 (90%), Positives = 119/123 (97%), Gaps = 0/123 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WGQGANL++L+SKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGQGANLEILSSKLASDAAHSIKAICIVHNETATGVTNN  120

Query  621  LAT  629
            LAT
Sbjct  121  LAT  123



>gb|AEX09244.1| alanine glyoxylate aminotransferase [Peperomia basiradicans]
Length=332

 Score =   233 bits (594),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 111/123 (90%), Positives = 118/123 (96%), Gaps = 0/123 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNETATGVTNN  120

Query  621  LAT  629
            LAT
Sbjct  121  LAT  123



>gb|AEX09274.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=358

 Score =   234 bits (596),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 111/123 (90%), Positives = 119/123 (97%), Gaps = 0/123 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WGQGANL++L+SKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGQGANLEILSSKLASDAAHSIKAICIVHNETATGVTNN  120

Query  621  LAT  629
            LAT
Sbjct  121  LAT  123



>gb|AEX09302.1| alanine glyoxylate aminotransferase [Peperomia sp. JN-2011]
Length=343

 Score =   233 bits (595),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 111/123 (90%), Positives = 119/123 (97%), Gaps = 0/123 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WGQGANL++L+SKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGQGANLEILSSKLASDAAHSIKAICIVHNETATGVTNN  120

Query  621  LAT  629
            LAT
Sbjct  121  LAT  123



>gb|AEX09283.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=349

 Score =   233 bits (595),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 111/123 (90%), Positives = 119/123 (97%), Gaps = 0/123 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WGQGANL++L+SKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGQGANLEILSSKLASDAAHSIKAICIVHNETATGVTNN  120

Query  621  LAT  629
            LAT
Sbjct  121  LAT  123



>gb|AEX09301.1| alanine glyoxylate aminotransferase [Peperomia sp. JN-2011]
Length=358

 Score =   234 bits (596),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 111/123 (90%), Positives = 119/123 (97%), Gaps = 0/123 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WGQGANL++L+SKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGQGANLEILSSKLASDAAHSIKAICIVHNETATGVTNN  120

Query  621  LAT  629
            LAT
Sbjct  121  LAT  123



>gb|AEX09286.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
Length=358

 Score =   234 bits (596),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 111/123 (90%), Positives = 118/123 (96%), Gaps = 0/123 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNETATGVTNN  120

Query  621  LAT  629
            LAT
Sbjct  121  LAT  123



>gb|AEX09300.1| alanine glyoxylate aminotransferase [Peperomia parvifolia]
Length=362

 Score =   234 bits (596),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 112/123 (91%), Positives = 118/123 (96%), Gaps = 0/123 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPAVPALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAVPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNETATGVTNN  120

Query  621  LAT  629
            LAT
Sbjct  121  LAT  123



>gb|AEX09295.1| alanine glyoxylate aminotransferase [Peperomia pugnicaudex]
Length=356

 Score =   233 bits (595),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 111/123 (90%), Positives = 118/123 (96%), Gaps = 0/123 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNETATGVTNN  120

Query  621  LAT  629
            LAT
Sbjct  121  LAT  123



>gb|AEX09306.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=362

 Score =   234 bits (596),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 111/123 (90%), Positives = 119/123 (97%), Gaps = 0/123 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WGQGANL++L+SKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGQGANLEILSSKLASDAAHSIKAICIVHNETATGVTNN  120

Query  621  LAT  629
            LAT
Sbjct  121  LAT  123



>gb|AEX09277.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
Length=351

 Score =   233 bits (595),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 111/123 (90%), Positives = 118/123 (96%), Gaps = 0/123 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNETATGVTNN  120

Query  621  LAT  629
            LAT
Sbjct  121  LAT  123



>gb|AEX09253.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score =   233 bits (595),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/123 (90%), Positives = 118/123 (96%), Gaps = 0/123 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNETATGVTNN  120

Query  621  LAT  629
            LAT
Sbjct  121  LAT  123



>gb|AEX09257.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
 gb|AEX09278.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
 gb|AEX09279.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
Length=362

 Score =   233 bits (595),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/123 (90%), Positives = 118/123 (96%), Gaps = 0/123 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNETATGVTNN  120

Query  621  LAT  629
            LAT
Sbjct  121  LAT  123



>gb|AEX09275.1| alanine glyoxylate aminotransferase [Peperomia parvisagittata]
Length=362

 Score =   233 bits (595),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/123 (90%), Positives = 118/123 (96%), Gaps = 0/123 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNETATGVTNN  120

Query  621  LAT  629
            LAT
Sbjct  121  LAT  123



>gb|AEX09270.1| alanine glyoxylate aminotransferase [Peperomia verruculosa]
 gb|AEX09296.1| alanine glyoxylate aminotransferase [Peperomia verruculosa]
 gb|AEX09297.1| alanine glyoxylate aminotransferase [Peperomia verruculosa]
Length=362

 Score =   233 bits (595),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/123 (90%), Positives = 118/123 (96%), Gaps = 0/123 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNETATGVTNN  120

Query  621  LAT  629
            LAT
Sbjct  121  LAT  123



>gb|AEX09311.1| alanine glyoxylate aminotransferase [Peperomia andina]
Length=362

 Score =   233 bits (595),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/123 (90%), Positives = 118/123 (96%), Gaps = 0/123 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNETATGVTNN  120

Query  621  LAT  629
            LAT
Sbjct  121  LAT  123



>gb|AEX09298.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=362

 Score =   233 bits (594),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/123 (90%), Positives = 118/123 (96%), Gaps = 0/123 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNETATGVTNN  120

Query  621  LAT  629
            LAT
Sbjct  121  LAT  123



>gb|AEX09260.1| alanine glyoxylate aminotransferase [Peperomia aff. ovatopeltata 
JN-2011]
Length=326

 Score =   232 bits (591),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/123 (90%), Positives = 117/123 (95%), Gaps = 0/123 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AH IKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDXAHXIKAICIVHNETATGVTNN  120

Query  621  LAT  629
            LAT
Sbjct  121  LAT  123



>gb|AEX09309.1| alanine glyoxylate aminotransferase [Peperomia wernerrauhii]
Length=335

 Score =   232 bits (591),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/123 (89%), Positives = 118/123 (96%), Gaps = 0/123 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WG GANL++L+SKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILSSKLASDAAHSIKAICIVHNETATGVTNN  120

Query  621  LAT  629
            LAT
Sbjct  121  LAT  123



>gb|AEX09256.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score =   232 bits (592),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 112/123 (91%), Positives = 117/123 (95%), Gaps = 0/123 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPAVPALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAVPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AHTIKAICIVH ETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDVAHTIKAICIVHXETATGVTNN  120

Query  621  LAT  629
            LAT
Sbjct  121  LAT  123



>gb|AEX09304.1| alanine glyoxylate aminotransferase [Peperomia chutanka]
Length=358

 Score =   232 bits (592),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 110/123 (89%), Positives = 118/123 (96%), Gaps = 0/123 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQ+RL FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQERLGFNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNETATGVTNN  120

Query  621  LAT  629
            LAT
Sbjct  121  LAT  123



>gb|AEX09258.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score =   232 bits (592),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 111/123 (90%), Positives = 117/123 (95%), Gaps = 0/123 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPAVPAL KTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAVPALAKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNETATGVTNN  120

Query  621  LAT  629
            LAT
Sbjct  121  LAT  123



>gb|AEX09292.1| alanine glyoxylate aminotransferase [Peperomia klopfensteinii]
Length=330

 Score =   231 bits (589),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 110/123 (89%), Positives = 117/123 (95%), Gaps = 0/123 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTT GTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTXGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNETATGVTNN  120

Query  621  LAT  629
            LAT
Sbjct  121  LAT  123



>gb|AEX09299.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=362

 Score =   231 bits (590),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 110/123 (89%), Positives = 117/123 (95%), Gaps = 0/123 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTTSG PF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGAPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNETATGVTNN  120

Query  621  LAT  629
            LAT
Sbjct  121  LAT  123



>gb|AEX09254.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score =   231 bits (589),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 111/123 (90%), Positives = 118/123 (96%), Gaps = 0/123 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPAVPALTKTLLEDVKKIFKTTSGT F+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAVPALTKTLLEDVKKIFKTTSGTSFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WGQGANL++LASKLA + AH+IKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGQGANLEILASKLASNAAHSIKAICIVHNETATGVTNN  120

Query  621  LAT  629
            LAT
Sbjct  121  LAT  123



>gb|AEX09242.1| alanine glyoxylate aminotransferase [Peperomia aff. pinoi JN-2011]
Length=335

 Score =   230 bits (587),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 111/123 (90%), Positives = 117/123 (95%), Gaps = 0/123 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQ RL FNVDVVES+WG GANL+++ASKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQTRLGFNVDVVESDWGLGANLEIMASKLASDAAHSIKAICIVHNETATGVTNN  120

Query  621  LAT  629
            LAT
Sbjct  121  LAT  123



>ref|XP_001763095.1| predicted protein [Physcomitrella patens]
 gb|EDQ71972.1| predicted protein [Physcomitrella patens]
Length=402

 Score =   231 bits (588),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 100/157 (64%), Positives = 130/157 (83%), Gaps = 0/157 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            M+   APGRNHLFVPGP NIPD+V++AM RNNED+RSP  PAL K++LEDVK +F+T +G
Sbjct  1    MELFPAPGRNHLFVPGPTNIPDRVLQAMNRNNEDHRSPTFPALAKSVLEDVKLLFRTQTG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPF+ P++GTGAWESALTNT+SPGDRI+   +GQF +LWI+   RL+FNVDV+E EWG+G
Sbjct  61   TPFIFPSSGTGAWESALTNTMSPGDRIIVPRMGQFCVLWINLMTRLHFNVDVIECEWGEG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
             +L++L  KL  D  H +KA+C+VHNET+TGVTN+L+
Sbjct  121  IDLEILKQKLQSDHTHAVKAVCVVHNETSTGVTNDLS  157



>gb|AEX09294.1| alanine glyoxylate aminotransferase [Peperomia sp. JN-2011]
Length=345

 Score =   229 bits (583),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 109/123 (89%), Positives = 117/123 (95%), Gaps = 0/123 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D A +IKA+CIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAXSIKAVCIVHNETATGVTNN  120

Query  621  LAT  629
            LAT
Sbjct  121  LAT  123



>gb|AEX09267.1| alanine glyoxylate aminotransferase [Peperomia radiatinervosa]
Length=362

 Score =   228 bits (582),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 108/123 (88%), Positives = 117/123 (95%), Gaps = 0/123 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL  +VDVVES+WG GANL++L+SKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61   SLLWIDQQQRLGLDVDVVESDWGHGANLEILSSKLASDAAHSIKAICIVHNETATGVTNN  120

Query  621  LAT  629
            LAT
Sbjct  121  LAT  123



>gb|AEX09276.1| alanine glyoxylate aminotransferase [Peperomia parvisagittata]
Length=362

 Score =   228 bits (580),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/123 (88%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = +3

Query  261  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  440
            RSPA+PALTKTLLEDVKKIFKTT G PF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTPGIPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  441  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  620
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNETATGV NN
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNETATGVANN  120

Query  621  LAT  629
            LAT
Sbjct  121  LAT  123



>gb|ADO24297.1| aminotransferase [Valeriana jatamansi]
Length=116

 Score =   215 bits (548),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 102/116 (88%), Positives = 108/116 (93%), Gaps = 0/116 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MD   A GRNHLFVPGPVNIP+ V+RAM RNNEDYRSPA+PA+TKTLLEDVK+IFKTTSG
Sbjct  1    MDNFYAAGRNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAIPAMTKTLLEDVKQIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESE  503
            TPFL PTTGTGAWESALTNTLSPGDR+VSFLIGQFSLLWIDQQQRL FNVDVVESE
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRVVSFLIGQFSLLWIDQQQRLGFNVDVVESE  116



>gb|EYU35937.1| hypothetical protein MIMGU_mgv1a026291mg, partial [Erythranthe 
guttata]
Length=359

 Score =   220 bits (561),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 107/116 (92%), Positives = 111/116 (96%), Gaps = 0/116 (0%)
 Frame = +3

Query  282  LTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQ  461
            LTK LLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDR VSFLIGQFSLLWIDQ
Sbjct  1    LTKNLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQ  60

Query  462  QQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLAT  629
            QQRL FNVDVVES+WG GA+LD LASK+AEDTAHTIKA+CIVHNETATGVTNNLAT
Sbjct  61   QQRLKFNVDVVESDWGAGADLDALASKIAEDTAHTIKAVCIVHNETATGVTNNLAT  116



>gb|ADG26437.1| putative aminotransferase [Valeriana jatamansi]
Length=116

 Score =   209 bits (533),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MD   A GRNH+FVPG VNIP+ V+RAM RNNEDYRSPA+PA+TKTLLEDVK+IFKTTSG
Sbjct  1    MDNFYAAGRNHMFVPGLVNIPEPVLRAMNRNNEDYRSPAIPAMTKTLLEDVKQIFKTTSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESE  503
            TPFL PTTGTGAWESALTNTLSPGDR+VSFLIGQFSLLWIDQQQRL FNVDVVES+
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRVVSFLIGQFSLLWIDQQQRLGFNVDVVESK  116



>gb|EMT09291.1| Serine--glyoxylate aminotransferase [Aegilops tauschii]
Length=290

 Score =   213 bits (543),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 98/109 (90%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY+N PGRNHLFVPGPVNIPDQVIRAM+R NEDYRSPA+PALTKTLLEDVKKIFKTT+G
Sbjct  1    MDYMNGPGRNHLFVPGPVNIPDQVIRAMSRQNEDYRSPAIPALTKTLLEDVKKIFKTTTG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFN  482
            TPFL PTTGTGAWESALTNTLSPGDRIVSF +GQFSLLWIDQQQRL F+
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRIVSFSLGQFSLLWIDQQQRLGFS  109



>gb|AEX09303.1| alanine glyoxylate aminotransferase [Peperomia ayacuchoana]
Length=351

 Score =   215 bits (547),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 102/112 (91%), Positives = 108/112 (96%), Gaps = 0/112 (0%)
 Frame = +3

Query  294  LLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL  473
            LLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL
Sbjct  1    LLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRL  60

Query  474  NFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLAT  629
             FNVDVVES+WGQGANL++LASKLA D AH+IKAICIVHNETATGVTNNLAT
Sbjct  61   GFNVDVVESDWGQGANLEILASKLASDAAHSIKAICIVHNETATGVTNNLAT  112



>ref|XP_002970880.1| hypothetical protein SELMODRAFT_147375 [Selaginella moellendorffii]
 gb|EFJ28206.1| hypothetical protein SELMODRAFT_147375 [Selaginella moellendorffii]
Length=401

 Score =   216 bits (550),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 96/158 (61%), Positives = 119/158 (75%), Gaps = 0/158 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY  APGRNHLFVPGP NIP +V++A+ R NED+RSPA P  ++ LL DV +IF T SG
Sbjct  1    MDYFMAPGRNHLFVPGPSNIPQKVMQALNRGNEDHRSPAFPVFSRQLLADVTRIFSTQSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPF+IPTTGTG WE A  NTLS GDR+++F+ GQFS LW  Q Q+L+F+VD V+ +WG G
Sbjct  61   TPFIIPTTGTGGWECAAVNTLSTGDRVLTFVFGQFSHLWSQQLQKLHFDVDAVQCQWGGG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLAT  629
             +L VL SKL  D  H IKA+C+VHNET+TG+  NL  
Sbjct  121  VDLGVLDSKLRADEEHRIKAVCVVHNETSTGININLGV  158



>ref|XP_002969615.1| hypothetical protein SELMODRAFT_267279 [Selaginella moellendorffii]
 gb|EFJ29703.1| hypothetical protein SELMODRAFT_267279 [Selaginella moellendorffii]
Length=401

 Score =   216 bits (550),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 96/158 (61%), Positives = 119/158 (75%), Gaps = 0/158 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MDY  APGRNHLFVPGP NIP +V++A+ R NED+RSPA P  ++ LL DV +IF T SG
Sbjct  1    MDYFMAPGRNHLFVPGPSNIPQKVMQALNRGNEDHRSPAFPVFSRQLLADVTRIFSTQSG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            TPF+IPTTGTG WE A  NTLS GDR+++F+ GQFS LW  Q Q+L+F+VD V+ +WG G
Sbjct  61   TPFIIPTTGTGGWECAAVNTLSTGDRVLTFVFGQFSHLWSQQLQKLHFDVDAVQCQWGGG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLAT  629
             +L VL SKL  D  H IKA+C+VHNET+TG+  NL  
Sbjct  121  VDLGVLDSKLRADEEHRIKAVCVVHNETSTGININLGV  158



>gb|AEX09259.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=351

 Score =   214 bits (546),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/112 (91%), Positives = 107/112 (96%), Gaps = 0/112 (0%)
 Frame = +3

Query  294  LLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL  473
            LLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL
Sbjct  1    LLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRL  60

Query  474  NFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLAT  629
             FNVDVVES+WG GANL++LASKLA D AHTIKAICIVHNETATGVTNNLAT
Sbjct  61   GFNVDVVESDWGHGANLEILASKLASDVAHTIKAICIVHNETATGVTNNLAT  112



>gb|AEX09307.1| alanine glyoxylate aminotransferase [Peperomia verruculosa]
Length=351

 Score =   213 bits (541),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 101/112 (90%), Positives = 107/112 (96%), Gaps = 0/112 (0%)
 Frame = +3

Query  294  LLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL  473
            LLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL
Sbjct  1    LLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRL  60

Query  474  NFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLAT  629
             FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNETATGVTNNLAT
Sbjct  61   GFNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNETATGVTNNLAT  112



>gb|AEX09291.1| alanine glyoxylate aminotransferase [Peperomia jalcaensis]
Length=323

 Score =   211 bits (538),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/111 (90%), Positives = 106/111 (95%), Gaps = 0/111 (0%)
 Frame = +3

Query  297  LEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLN  476
            LEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL 
Sbjct  1    LEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRLG  60

Query  477  FNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLAT  629
            FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNETATGVTNNLAT
Sbjct  61   FNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNETATGVTNNLAT  111



>gb|AEX09284.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=338

 Score =   211 bits (538),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/111 (90%), Positives = 107/111 (96%), Gaps = 0/111 (0%)
 Frame = +3

Query  297  LEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLN  476
            LEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL 
Sbjct  1    LEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRLG  60

Query  477  FNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLAT  629
            FNVDVVES+WGQGANL++L+SKLA D AH+IKAICIVHNETATGVTNNLAT
Sbjct  61   FNVDVVESDWGQGANLEILSSKLASDAAHSIKAICIVHNETATGVTNNLAT  111



>gb|AEX09272.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
Length=338

 Score =   211 bits (537),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 100/111 (90%), Positives = 106/111 (95%), Gaps = 0/111 (0%)
 Frame = +3

Query  297  LEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLN  476
            LEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL 
Sbjct  1    LEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRLG  60

Query  477  FNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLAT  629
            FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNETATGVTNNLAT
Sbjct  61   FNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNETATGVTNNLAT  111



>gb|AEX09265.1| alanine glyoxylate aminotransferase [Peperomia radiatinervosa]
Length=353

 Score =   211 bits (537),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 101/114 (89%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = +3

Query  288  KTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQ  467
            KTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGD  +SFLIGQFSLLWIDQQQ
Sbjct  1    KTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDXTISFLIGQFSLLWIDQQQ  60

Query  468  RLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLAT  629
            RL F VDVVES+WG GANL++LASKLA D AH+IKAICIVHNETATGVTNNLAT
Sbjct  61   RLGFXVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNETATGVTNNLAT  114



>gb|AEX09264.1| alanine glyoxylate aminotransferase [Peperomia radiatinervosa]
Length=334

 Score =   209 bits (531),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/112 (88%), Positives = 105/112 (94%), Gaps = 0/112 (0%)
 Frame = +3

Query  294  LLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL  473
            LLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL
Sbjct  1    LLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRL  60

Query  474  NFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLAT  629
             FNVDVVES+WG GANL++LAS LA D  H+IKAICIVHNETATGVTNNLAT
Sbjct  61   GFNVDVVESDWGHGANLEILASXLASDAGHSIKAICIVHNETATGVTNNLAT  112



>gb|AEX09285.1| alanine glyoxylate aminotransferase [Peperomia radiatinervosa]
Length=350

 Score =   206 bits (525),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/111 (88%), Positives = 104/111 (94%), Gaps = 0/111 (0%)
 Frame = +3

Query  297  LEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLN  476
            LEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL 
Sbjct  1    LEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRLG  60

Query  477  FNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLAT  629
            F VDVVES+WG GANL++LASKLA D  H+IKAICIVHNETATGVTNNLAT
Sbjct  61   FIVDVVESDWGHGANLEILASKLASDAGHSIKAICIVHNETATGVTNNLAT  111



>gb|AEX09271.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=332

 Score =   202 bits (514),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 95/106 (90%), Positives = 102/106 (96%), Gaps = 0/106 (0%)
 Frame = +3

Query  312  KIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDV  491
            KIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL FNVDV
Sbjct  1    KIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRLGFNVDV  60

Query  492  VESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLAT  629
            VES+WGQGANL++L+SKLA D AH+IKAICIVHNETATGVTNNLAT
Sbjct  61   VESDWGQGANLEILSSKLASDAAHSIKAICIVHNETATGVTNNLAT  106



>gb|AEX09261.1| alanine glyoxylate aminotransferase [Peperomia aff. ovatopeltata 
JN-2011]
Length=327

 Score =   198 bits (503),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/103 (91%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +3

Query  321  KTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVES  500
            KTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL FNVDVVES
Sbjct  1    KTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRLGFNVDVVES  60

Query  501  EWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLAT  629
            +WGQGANL++LASKLA D AHTIKAICIVHNETATGVTNNLAT
Sbjct  61   DWGQGANLEILASKLASDAAHTIKAICIVHNETATGVTNNLAT  103



>gb|AEX09247.1| alanine glyoxylate aminotransferase [Peperomia cavispicata]
Length=342

 Score =   198 bits (504),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/103 (91%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +3

Query  321  KTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVES  500
            KTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL FNVDVVES
Sbjct  1    KTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRLGFNVDVVES  60

Query  501  EWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLAT  629
            +WGQGANL++LASKLA D AHTIKAICIVHNETATGVTNNLAT
Sbjct  61   DWGQGANLEILASKLASDAAHTIKAICIVHNETATGVTNNLAT  103



>gb|AEX09281.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
Length=330

 Score =   195 bits (495),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/103 (89%), Positives = 98/103 (95%), Gaps = 0/103 (0%)
 Frame = +3

Query  321  KTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVES  500
            KTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL FNVDVVES
Sbjct  1    KTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRLGFNVDVVES  60

Query  501  EWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLAT  629
            +WG GANL++LASKLA D AH+IKAICIVHNETATGVTNNLAT
Sbjct  61   DWGHGANLEILASKLASDAAHSIKAICIVHNETATGVTNNLAT  103



>ref|XP_005709273.1| serine--glyoxylate transaminase [Galdieria sulphuraria]
 gb|EME32753.1| serine--glyoxylate transaminase [Galdieria sulphuraria]
Length=400

 Score =   196 bits (497),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 116/150 (77%), Gaps = 0/150 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  356
            G+N L VPGP N+PD+V+RAM RN+ED+RSP  PAL KT+LE++K +F TT G  F+ P 
Sbjct  5    GKNFLMVPGPTNVPDRVLRAMHRNSEDHRSPDFPALAKTVLENIKWVFGTTKGRSFIFPA  64

Query  357  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  536
            +GTGAWE+ALTNTL+ GD+++S   GQFS LWID  QRL   V +++ +WG+G  +D+L+
Sbjct  65   SGTGAWEAALTNTLNKGDKVISVRFGQFSHLWIDMMQRLGLEVTILDVDWGEGIPIDILS  124

Query  537  SKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            S +A+DT H  +A+C+VHNET TGVT ++A
Sbjct  125  SYIAQDTRHEYQAVCVVHNETTTGVTTDIA  154



>gb|AEX09269.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=328

 Score =   194 bits (492),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/102 (89%), Positives = 98/102 (96%), Gaps = 0/102 (0%)
 Frame = +3

Query  324  TTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESE  503
            TTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL FNVDVVES+
Sbjct  1    TTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRLGFNVDVVESD  60

Query  504  WGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLAT  629
            WGQGANL++L+SKLA D AH+IKAICIVHNETATGVTNNLAT
Sbjct  61   WGQGANLEILSSKLASDAAHSIKAICIVHNETATGVTNNLAT  102



>gb|AEX09243.1| alanine glyoxylate aminotransferase [Peperomia sp. JN-2011]
Length=301

 Score =   192 bits (489),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/100 (91%), Positives = 96/100 (96%), Gaps = 0/100 (0%)
 Frame = +3

Query  330  SGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWG  509
            SGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL FNVDVVES+WG
Sbjct  1    SGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRLGFNVDVVESDWG  60

Query  510  QGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLAT  629
            QGANL++LASKLA D AHTIKAICIVHNETATGVTNNLAT
Sbjct  61   QGANLEILASKLASDAAHTIKAICIVHNETATGVTNNLAT  100



>gb|AEX09290.1| alanine glyoxylate aminotransferase [Peperomia dolabella]
Length=311

 Score =   193 bits (490),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/102 (89%), Positives = 97/102 (95%), Gaps = 0/102 (0%)
 Frame = +3

Query  324  TTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESE  503
            TTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL FNVDVVES+
Sbjct  1    TTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRLGFNVDVVESD  60

Query  504  WGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLAT  629
            WG GANL++LASKLA D AH+IKAICIVHNETATGVTNNLAT
Sbjct  61   WGHGANLEILASKLASDAAHSIKAICIVHNETATGVTNNLAT  102



>gb|AEX09280.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=330

 Score =   192 bits (487),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 90/102 (88%), Positives = 97/102 (95%), Gaps = 0/102 (0%)
 Frame = +3

Query  324  TTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESE  503
            T SGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL FNVDVVES+
Sbjct  1    TXSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRLGFNVDVVESD  60

Query  504  WGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLAT  629
            WGQGANL++L+SKLA D AH+IKAICIVHNETATGVTNNLAT
Sbjct  61   WGQGANLEILSSKLASDAAHSIKAICIVHNETATGVTNNLAT  102



>ref|WP_017485211.1| serine--glyoxylate aminotransferase [Methylobacterium sp. MB200]
Length=402

 Score =   192 bits (489),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/158 (58%), Positives = 110/158 (70%), Gaps = 0/158 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            M     PGRNHLFVPGP NIPD+V+RAM   +ED+RS   P+LTK L ED KK+F +T G
Sbjct  1    MAATRRPGRNHLFVPGPTNIPDRVMRAMMVQSEDHRSVDFPSLTKPLFEDTKKVFGSTEG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            T FL P +GTG WESALTNTL+ GD++++   GQFS LWID  QRL  +V V E EWG G
Sbjct  61   TIFLFPASGTGIWESALTNTLARGDKVLTARYGQFSHLWIDMAQRLGLDVIVQEEEWGTG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLAT  629
            A  D +   L  D  H IKA+ +VHNETATGVT+N+  
Sbjct  121  AKADKIEEALRADKDHQIKAVMVVHNETATGVTSNIGA  158



>gb|AEX09289.1| alanine glyoxylate aminotransferase [Peperomia gigantea]
Length=312

 Score =   190 bits (482),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/99 (90%), Positives = 95/99 (96%), Gaps = 0/99 (0%)
 Frame = +3

Query  333  GTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQ  512
            GTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL FNVDVVES+WGQ
Sbjct  1    GTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRLGFNVDVVESDWGQ  60

Query  513  GANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLAT  629
            GANL++LASKLA D AH+IKAICIVHNETATGVTNNLAT
Sbjct  61   GANLEILASKLASDAAHSIKAICIVHNETATGVTNNLAT  99



>gb|ACN36238.1| unknown [Zea mays]
Length=328

 Score =   190 bits (483),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 94/120 (78%), Positives = 100/120 (83%), Gaps = 7/120 (6%)
 Frame = +3

Query  159  DYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGT  338
            DYV  PGR HLFVPGPVNIPD VIRAM R NEDYRSPAVPALTK LLEDVKKIFKTT+GT
Sbjct  3    DYVYGPGRTHLFVPGPVNIPDPVIRAMNRQNEDYRSPAVPALTKVLLEDVKKIFKTTTGT  62

Query  339  PFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQR---LNFNVDVVESEWG  509
            PF+IPTTGTGAWESALTNTLSPGDR+VSFLIGQFSLL +D       L+F +D    EWG
Sbjct  63   PFMIPTTGTGAWESALTNTLSPGDRVVSFLIGQFSLLLVDGVSSICALDFRMD----EWG  118



>ref|WP_015950680.1| serine--glyoxylate aminotransferase [Methylobacterium extorquens]
 gb|ACK82978.1| aminotransferase class V [Methylobacterium extorquens CM4]
Length=402

 Score =   190 bits (483),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/158 (57%), Positives = 110/158 (70%), Gaps = 0/158 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            M     PGRNHLFVPGP NIPD+V+RAM   +ED+RS   P+LTK L ED KK+F +T G
Sbjct  1    MAATRRPGRNHLFVPGPTNIPDRVMRAMMVQSEDHRSVDFPSLTKPLFEDTKKVFGSTEG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            T FL P +GTG WESAL+NTL+ GD++V+   GQFS LWID  QRL  +V V E EWG G
Sbjct  61   TIFLFPASGTGIWESALSNTLARGDKVVAARFGQFSHLWIDMAQRLGLDVVVQEEEWGTG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLAT  629
            A  + +   L  D  H IKA+ +VHNETATGVT+N+  
Sbjct  121  AKPEKIEEALRADKNHEIKAVMVVHNETATGVTSNIGA  158



>ref|WP_026610206.1| serine--glyoxylate aminotransferase [Methylocaldum szegediense]
Length=394

 Score =   190 bits (482),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/151 (58%), Positives = 109/151 (72%), Gaps = 0/151 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  353
            PGR HL+VPGP NIPD ++ AM    ED+R P  P L + LLED+KKIF+T SG  F+ P
Sbjct  2    PGRTHLYVPGPTNIPDSILSAMHVPMEDHRRPDFPELIQPLLEDLKKIFQTKSGQCFIFP  61

Query  354  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  533
             TGT  WE ALTNTLSPGD+++++  GQFS LWID  +RL F+V+  E  WG+G  LD L
Sbjct  62   ATGTAGWEIALTNTLSPGDKVLAYRFGQFSHLWIDMARRLGFDVEYEEVPWGEGVPLDRL  121

Query  534  ASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
             ++L  DT H IKA+ I HNETATGVT++LA
Sbjct  122  EARLKADTKHEIKALLICHNETATGVTSDLA  152



>ref|XP_005648727.1| serine glyoxylate aminotransferase [Coccomyxa subellipsoidea 
C-169]
 gb|EIE24183.1| serine glyoxylate aminotransferase [Coccomyxa subellipsoidea 
C-169]
Length=434

 Score =   191 bits (484),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/151 (60%), Positives = 109/151 (72%), Gaps = 0/151 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  353
            PGRNHL VPGPVNI +QV+RAM R ++++R P  P   + +LED K IFKTT GTPF+ P
Sbjct  41   PGRNHLAVPGPVNIHEQVMRAMDRPSQNHRDPWFPPFFQQILEDTKYIFKTTEGTPFIFP  100

Query  354  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  533
             TGTG WE ALTNTLSPGD++V+F  GQFS LWID  QRL  +V VVE EWG GA+   L
Sbjct  101  GTGTGGWEVALTNTLSPGDKVVTFRYGQFSHLWIDMMQRLGLDVQVVEVEWGGGADEAKL  160

Query  534  ASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
               L  DT   IKA+ +VHNET TGVT+++ 
Sbjct  161  EQILKADTDKKIKAVAVVHNETTTGVTSDIG  191



>ref|WP_010960683.1| serine--glyoxylate aminotransferase [Methylococcus capsulatus]
 gb|AAU92322.1| serine--glyoxylate aminotransferase [Methylococcus capsulatus 
str. Bath]
Length=395

 Score =   189 bits (481),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 108/150 (72%), Gaps = 0/150 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  353
            PGRNHL+VPGP NIPD V+ AM    ED+R P  PAL   LLE++KK+F+T +G  F+ P
Sbjct  2    PGRNHLYVPGPTNIPDAVLSAMHVPMEDHRRPDFPALVTPLLENLKKVFRTEAGQCFIFP  61

Query  354  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  533
             TGT  WE AL+NTLSPGD+++S+  GQFS LWID  +RL   V+  E  WGQG  LD L
Sbjct  62   ATGTAGWEIALSNTLSPGDKVLSYRFGQFSHLWIDLARRLGLEVEYEEVPWGQGVPLDRL  121

Query  534  ASKLAEDTAHTIKAICIVHNETATGVTNNL  623
             ++L  DTAH IKA+ I HNETATGVTN+L
Sbjct  122  EARLKADTAHEIKAVLICHNETATGVTNDL  151



>ref|WP_020188076.1| hypothetical protein [Methylopila sp. 73B]
Length=402

 Score =   189 bits (481),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 111/152 (73%), Gaps = 0/152 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  353
            PG+N LFVPGP N+P++V+RAM  + ED+RSP  P LTK L E +KK+FKT  G  F+ P
Sbjct  5    PGKNFLFVPGPTNVPERVLRAMVVSQEDHRSPIFPELTKPLYEGLKKVFKTKDGQVFIFP  64

Query  354  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  533
            ++GTG WE+ALTNTL+PGD++++   GQFS LW D  QRL  +V + E EWG GA+ + +
Sbjct  65   SSGTGGWEAALTNTLAPGDKVLTARFGQFSHLWTDMAQRLGLDVQIQEEEWGTGAHEEKI  124

Query  534  ASKLAEDTAHTIKAICIVHNETATGVTNNLAT  629
               L  DTAH IKA+ +VHNETATGVT+N+  
Sbjct  125  EEALVADTAHEIKAVMVVHNETATGVTSNIGA  156



>ref|WP_012453656.1| serine--glyoxylate aminotransferase [Methylobacterium populi]
 gb|ACB79910.1| aminotransferase class V [Methylobacterium populi BJ001]
Length=402

 Score =   189 bits (481),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/158 (57%), Positives = 110/158 (70%), Gaps = 0/158 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            M     PGRNHLFVPGP NIPD+V+RAM   +ED+RS   P+LTK L ED KK+F +T G
Sbjct  1    MAATRRPGRNHLFVPGPTNIPDRVMRAMMVQSEDHRSVDFPSLTKPLFEDTKKVFGSTEG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            T FL P +GTG WESALTNTL+ GD++++   GQFS LWID  QRL  +V V E EWG G
Sbjct  61   TIFLFPASGTGIWESALTNTLARGDKVLTSRYGQFSHLWIDMAQRLGLDVIVQEEEWGTG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLAT  629
            A  + +   L  D  H IKA+ +VHNETATGVT+N+  
Sbjct  121  AKPEKIEEALRADKNHEIKAVMVVHNETATGVTSNIGA  158



>ref|WP_012253362.1| serine--glyoxylate aminotransferase [Methylobacterium extorquens]
 gb|ABY30194.1| Serine--glyoxylate transaminase [Methylobacterium extorquens 
PA1]
Length=402

 Score =   189 bits (480),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 110/158 (70%), Gaps = 0/158 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            M     PGRNHLFVPGP NIPD+V+RAM   +ED+RS   P+LTK L ED KK+F +T G
Sbjct  1    MAATRRPGRNHLFVPGPTNIPDRVMRAMMVQSEDHRSVDFPSLTKPLFEDTKKVFGSTEG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            T FL P +GTG WESAL+NTL+ GD++++   GQFS LWID  QRL  +V V E EWG G
Sbjct  61   TIFLFPASGTGIWESALSNTLARGDKVLAARFGQFSHLWIDMAQRLGLDVVVQEEEWGTG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLAT  629
            A  + +   L  D  H IKA+ +VHNETATGVT+N+  
Sbjct  121  AKPEKIEEALRADKNHEIKAVMVVHNETATGVTSNIGA  158



>ref|WP_003597639.1| serine--glyoxylate aminotransferase [Methylobacterium extorquens]
 sp|P55819.2|SGAA_METEA RecName: Full=Serine--glyoxylate aminotransferase; Short=SGAT 
[Methylobacterium extorquens AM1]
 gb|ACS39570.1| serine-glyoxylate aminotransferase (SGAT) [Methylobacterium extorquens 
AM1]
 emb|CAX24121.1| serine-glyoxylate aminotransferase (SGAT) [Methylobacterium extorquens 
DM4]
 gb|EHP94104.1| Serine--glyoxylate transaminase [Methylobacterium extorquens 
DSM 13060]
Length=402

 Score =   189 bits (480),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 110/158 (70%), Gaps = 0/158 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            M     PGRNHLFVPGP NIPD+V+RAM   +ED+RS   P+LTK L ED KK+F +T G
Sbjct  1    MAATRRPGRNHLFVPGPTNIPDRVMRAMMVQSEDHRSVDFPSLTKPLFEDTKKVFGSTEG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            T FL P +GTG WESAL+NTL+ GD++++   GQFS LWID  QRL  +V V E EWG G
Sbjct  61   TIFLFPASGTGIWESALSNTLARGDKVLAARFGQFSHLWIDMAQRLGLDVVVQEEEWGTG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLAT  629
            A  + +   L  D  H IKA+ +VHNETATGVT+N+  
Sbjct  121  AKPEKIEEALRADKNHEIKAVMVVHNETATGVTSNIGA  158



>ref|WP_041930245.1| serine--glyoxylate aminotransferase, partial [Methylibium petroleiphilum]
Length=395

 Score =   188 bits (478),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 111/150 (74%), Gaps = 0/150 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  356
            GRN LFVPGP N+P++V RAM  + ED+RS   P LTK++LED+K +FKTT+GTP + P 
Sbjct  3    GRNFLFVPGPTNVPERVQRAMVVSMEDHRSSKFPDLTKSVLEDLKAVFKTTTGTPIIFPA  62

Query  357  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  536
            TGTG WE+ALTNTLSPGD +++   GQFS LWID   RL F V+ VE EWG+G  ++  A
Sbjct  63   TGTGGWEAALTNTLSPGDLVLASRFGQFSHLWIDMITRLGFQVETVECEWGEGVPVEKYA  122

Query  537  SKLAEDTAHTIKAICIVHNETATGVTNNLA  626
              LA+D  H IKA+   HNETATGVT+++A
Sbjct  123  EILAKDKGHKIKAVIATHNETATGVTSDIA  152



>ref|WP_026362994.1| serine--glyoxylate aminotransferase [Methylopila sp. M107]
Length=402

 Score =   188 bits (478),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 82/152 (54%), Positives = 111/152 (73%), Gaps = 0/152 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  353
            PG+N LFVPGP N+P++V+RAM  + ED+RSP  P LTK L E +KK++KTT G  F+ P
Sbjct  5    PGKNFLFVPGPTNVPERVLRAMVVSQEDHRSPIFPELTKPLYEGLKKVYKTTEGQVFIFP  64

Query  354  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  533
            ++GTG WE+AL NTL+PGD++++   GQFS LW D  QRL  +V ++E EWG GA+ + +
Sbjct  65   SSGTGGWEAALANTLAPGDKVLNSRFGQFSHLWTDMAQRLGLDVQILEEEWGTGAHEEKI  124

Query  534  ASKLAEDTAHTIKAICIVHNETATGVTNNLAT  629
               L  D AH IKA+ +VHNETATGVT+N+  
Sbjct  125  EEALVADKAHEIKAVMVVHNETATGVTSNIGA  156



>gb|ABM96214.1| serine-glyoxylate aminotransferase [Methylibium petroleiphilum 
PM1]
Length=415

 Score =   188 bits (478),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 111/150 (74%), Gaps = 0/150 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  356
            GRN LFVPGP N+P++V RAM  + ED+RS   P LTK++LED+K +FKTT+GTP + P 
Sbjct  3    GRNFLFVPGPTNVPERVQRAMVVSMEDHRSSKFPDLTKSVLEDLKAVFKTTTGTPIIFPA  62

Query  357  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  536
            TGTG WE+ALTNTLSPGD +++   GQFS LWID   RL F V+ VE EWG+G  ++  A
Sbjct  63   TGTGGWEAALTNTLSPGDLVLASRFGQFSHLWIDMITRLGFQVETVECEWGEGVPVEKYA  122

Query  537  SKLAEDTAHTIKAICIVHNETATGVTNNLA  626
              LA+D  H IKA+   HNETATGVT+++A
Sbjct  123  EILAKDKGHKIKAVIATHNETATGVTSDIA  152



>dbj|BAQ46928.1| serine--glyoxylate aminotransferase [Methylobacterium aquaticum]
Length=396

 Score =   187 bits (474),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 109/152 (72%), Gaps = 0/152 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  353
            PGRN LFVPGP NIPD+V RAM   +ED+RS A P LT  L E+ KKIFK+  G  FL P
Sbjct  7    PGRNFLFVPGPTNIPDRVQRAMIVPSEDHRSSAFPELTLPLFEETKKIFKSREGQIFLFP  66

Query  354  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  533
             TGTGAWE+ALTNTLSPGDR+++   GQFS LWID  +R+  +V+V E EWG+GA+ D +
Sbjct  67   ATGTGAWEAALTNTLSPGDRVLAPRYGQFSTLWIDLARRVGLDVEVQEEEWGKGADPDRI  126

Query  534  ASKLAEDTAHTIKAICIVHNETATGVTNNLAT  629
               L  D  H IKA+ +VHNET TGVT+++  
Sbjct  127  EEALRADREHRIKAVLVVHNETTTGVTSDIGA  158



>ref|WP_014149643.1| serine--glyoxylate aminotransferase [Methylomicrobium alcaliphilum]
 ref|YP_004918468.1| serine-glyoxylate aminotransferase [Methylomicrobium alcaliphilum 
20Z]
 emb|CCE24883.1| Serine-glyoxylate aminotransferase [Methylomicrobium alcaliphilum 
20Z]
Length=387

 Score =   186 bits (472),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 108/150 (72%), Gaps = 0/150 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  356
            GRNHL+VPGP NIPD+V+ AM   +ED+RSP  P L K LLED+KK+FKT +G  F+ P 
Sbjct  3    GRNHLYVPGPTNIPDEVLSAMHVPSEDHRSPIFPELFKPLLEDLKKVFKTETGHSFIFPA  62

Query  357  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  536
            TGT  WE ALTNTLSPGD+++ +  GQFS LW    +RL+F V V+E  WG+G  LD L 
Sbjct  63   TGTAGWEIALTNTLSPGDKVLIYRFGQFSHLWAAMAKRLDFEVIVIERPWGEGIPLDDLE  122

Query  537  SKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            ++L ED  H IKAI   HNETATGVT+++ 
Sbjct  123  ARLKEDGKHEIKAILATHNETATGVTSDIG  152



>ref|WP_018238561.1| serine--glyoxylate aminotransferase [Ensifer sp. BR816]
Length=396

 Score =   186 bits (473),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 108/152 (71%), Gaps = 0/152 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  353
            PG NHLF+PGP NIP+QV +AM    ED RSP  P LT  L  DVKK+FK   G  F+ P
Sbjct  2    PGYNHLFIPGPTNIPEQVRQAMNLPMEDMRSPRYPELTLPLFADVKKVFKNQDGRVFIYP  61

Query  354  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  533
            ++GTGAWE+A+TN LSPGDR++    GQFS LW+D  +RL F VD ++ EWG G  +++ 
Sbjct  62   SSGTGAWEAAMTNVLSPGDRLLMSRFGQFSHLWVDMAERLGFEVDCLDREWGTGVPVELY  121

Query  534  ASKLAEDTAHTIKAICIVHNETATGVTNNLAT  629
            A +LA D AH IKA+ + HNETATGVT+++A 
Sbjct  122  AERLAADKAHEIKAVFVTHNETATGVTSDVAA  153



>ref|WP_014762956.1| serine--glyoxylate aminotransferase [Sinorhizobium fredii]
 gb|AFL50786.1| serine--glyoxylate aminotransferase SgaA [Sinorhizobium fredii 
USDA 257]
Length=396

 Score =   186 bits (472),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 84/151 (56%), Positives = 108/151 (72%), Gaps = 0/151 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  356
            G NHLF+PGP NIP+QV +AM    ED RSP  P LT  L  DVKK+FK  SG  F+ P+
Sbjct  3    GYNHLFIPGPTNIPEQVRQAMNLPMEDMRSPRYPELTLPLFADVKKVFKNHSGRVFIYPS  62

Query  357  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  536
            +GTGAWE+A+TN LSPGDR++    GQFS LW+D  +RL F VD ++ EWG G  +++ A
Sbjct  63   SGTGAWEAAMTNVLSPGDRVLMSRFGQFSHLWVDMAERLRFEVDCIDREWGTGVPVELYA  122

Query  537  SKLAEDTAHTIKAICIVHNETATGVTNNLAT  629
             +LA D AH IKA+ + HNETATGVT+++A 
Sbjct  123  ERLAADKAHKIKAVFVTHNETATGVTSDVAA  153



>ref|WP_036230592.1| MULTISPECIES: serine--glyoxylate aminotransferase [Methylibium]
 gb|EWS54025.1| Soluble hydrogenase 42 kDa subunit [Methylibium sp. T29]
 gb|EWS61014.1| Soluble hydrogenase 42 kDa subunit [Methylibium sp. T29-B]
Length=415

 Score =   186 bits (473),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 111/150 (74%), Gaps = 0/150 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  356
            GRN LFVPGP N+P++V RAM  + ED+RS   P LTK++LED+K +FKTT+GTP + P 
Sbjct  3    GRNFLFVPGPTNVPERVQRAMVVSMEDHRSSKFPDLTKSVLEDLKAVFKTTNGTPIIFPA  62

Query  357  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  536
            TGTG WE+ALTNTLSPGD +++   GQFS LWID   RL F V+ VE EWG+G  ++  A
Sbjct  63   TGTGGWEAALTNTLSPGDLVLASRFGQFSHLWIDMITRLGFQVETVECEWGEGVPVEKYA  122

Query  537  SKLAEDTAHTIKAICIVHNETATGVTNNLA  626
              L++D  H IKA+   HNETATGVT+++A
Sbjct  123  EILSKDKGHRIKAVIATHNETATGVTSDIA  152



>ref|WP_017840623.1| serine--glyoxylate aminotransferase [Methylomicrobium buryatense]
Length=387

 Score =   186 bits (471),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 107/150 (71%), Gaps = 0/150 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  356
            GRNHL+VPGP NIPD+V+ AM   +ED+RSP  P L K LLED+KK+FKT +G  F+ P 
Sbjct  3    GRNHLYVPGPTNIPDEVLSAMHVPSEDHRSPIFPELFKPLLEDLKKVFKTETGHSFIFPA  62

Query  357  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  536
            TGT  WE ALTNTLSPGD+++ +  GQFS LW    +RL F V V+E  WG+G  LD L 
Sbjct  63   TGTAGWEIALTNTLSPGDKVLIYRFGQFSHLWAAMAKRLGFEVIVIERPWGEGIPLDDLE  122

Query  537  SKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            ++L ED  H IKAI   HNETATGVT+++ 
Sbjct  123  ARLKEDGQHEIKAILATHNETATGVTSDIG  152



>ref|WP_027156802.1| serine--glyoxylate aminotransferase [Methylobacter luteus]
Length=388

 Score =   185 bits (470),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 81/150 (54%), Positives = 109/150 (73%), Gaps = 0/150 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  356
            GRNHL++PGP N+P +V+ AM  N ED+RSP  P L K LL+D+KK+FKT +G  F+ P 
Sbjct  3    GRNHLYIPGPTNVPSEVLNAMHVNMEDHRSPIFPKLLKPLLQDLKKVFKTETGQAFIFPA  62

Query  357  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  536
            TGT  WE ALTNTL+PGD+++ +  GQFS LW +  +RL FNV++ +  WG+G  LD L 
Sbjct  63   TGTAGWEIALTNTLNPGDKVLIYRFGQFSHLWAEMAKRLGFNVEIHQETWGKGIPLDKLE  122

Query  537  SKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            ++L EDT H IKA+   HNETATGVT+++ 
Sbjct  123  ARLKEDTKHEIKAVLATHNETATGVTSDIG  152



>ref|WP_037416404.1| serine--glyoxylate aminotransferase [Sinorhizobium sp. CCBAU 
05631]
Length=396

 Score =   184 bits (467),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 108/150 (72%), Gaps = 0/150 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  356
            G NHLF+PGP NIP+QV +AM    ED RSP  P LT  L  D+K++FK  SG  F+ P+
Sbjct  3    GYNHLFIPGPTNIPEQVRQAMNLPMEDMRSPRYPELTLPLFADIKRVFKNQSGRVFIYPS  62

Query  357  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  536
            +GTGAWE+A+TN L PGDR++    GQFS LW+D  +RL F VD ++ EWG G  +++ A
Sbjct  63   SGTGAWEAAMTNVLYPGDRVLMSRFGQFSHLWVDMAERLGFEVDCLDREWGTGVPVELYA  122

Query  537  SKLAEDTAHTIKAICIVHNETATGVTNNLA  626
             +LA D AHTIKA+ + HNETATGVT+++A
Sbjct  123  DRLAADKAHTIKAVFVTHNETATGVTSDVA  152



>ref|WP_003535479.1| serine--glyoxylate aminotransferase [Sinorhizobium meliloti]
 gb|EHK74228.1| serine--glyoxylate aminotransferase [Sinorhizobium meliloti CCNWSX0020]
Length=396

 Score =   183 bits (465),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 83/151 (55%), Positives = 107/151 (71%), Gaps = 0/151 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  356
            G NHLF+PGP NIP+QV +AM    ED RSP  P LT  L  DVKKIFK  +G  F+ P+
Sbjct  3    GYNHLFIPGPTNIPEQVRQAMNLPMEDMRSPRYPELTLPLFSDVKKIFKNQNGRVFIYPS  62

Query  357  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  536
            +GTGAWE+A+TN LSPGDR++    GQFS LW+D   RL F VD ++ EWG G  +++ A
Sbjct  63   SGTGAWEAAMTNVLSPGDRVLMSRFGQFSHLWVDMAARLGFEVDCIDREWGTGVPVELYA  122

Query  537  SKLAEDTAHTIKAICIVHNETATGVTNNLAT  629
             +L+ D AH IKA+ + HNETATGVT+++A 
Sbjct  123  ERLSADKAHKIKAVFVTHNETATGVTSDVAA  153



>ref|WP_034858116.1| serine--glyoxylate aminotransferase [Ensifer sojae]
Length=396

 Score =   183 bits (465),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 109/150 (73%), Gaps = 0/150 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  356
            G NHLF+PGP NIP+QV +AM    ED RSP  P LT  L  DVKK+FK  +G  F+ P+
Sbjct  3    GYNHLFIPGPTNIPEQVRQAMNLPMEDMRSPRYPELTLPLFADVKKVFKNENGRVFIYPS  62

Query  357  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  536
            +GTGAWE+A+TN LSPGDR++    GQFS LW+D  +RL F VD ++ EWG G  +++ A
Sbjct  63   SGTGAWEAAMTNVLSPGDRVLMSRFGQFSHLWVDMAERLGFEVDCLDMEWGTGVPVELYA  122

Query  537  SKLAEDTAHTIKAICIVHNETATGVTNNLA  626
             +L+ D AH+IKA+ + HNETATGVT+++A
Sbjct  123  ERLSADKAHSIKAVFVTHNETATGVTSDVA  152



>ref|WP_007559580.1| serine--glyoxylate aminotransferase [Methylobacterium sp. GXF4]
 gb|EIZ86366.1| class V aminotransferase [Methylobacterium sp. GXF4]
Length=402

 Score =   183 bits (465),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 85/158 (54%), Positives = 110/158 (70%), Gaps = 0/158 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            M     PGRNHLF+PGP NIPD+V+RAM   +ED+RSP  P L K LL+D K +F +T+G
Sbjct  1    MAATRRPGRNHLFIPGPTNIPDRVLRAMHVPSEDHRSPGFPELVKPLLQDAKIVFGSTAG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            T  L P++GTG WESAL+NTL  GD++++   GQFS LW+D  QRL  +V V E EWG G
Sbjct  61   TVILFPSSGTGIWESALSNTLCRGDKVLTSRYGQFSHLWVDMAQRLGLDVIVQEEEWGTG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLAT  629
            A+   +   L  D  H IKA+ +VHNETATGVT+++A 
Sbjct  121  ADPQKIEEALRADKDHAIKAVMVVHNETATGVTSDIAA  158



>ref|WP_027147316.1| MULTISPECIES: serine--glyoxylate aminotransferase [Methylobacter]
Length=388

 Score =   182 bits (463),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 79/150 (53%), Positives = 109/150 (73%), Gaps = 0/150 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  356
            GRNHL++PGP N+P +V+ AM  N ED+RSP  P L K LL+D+KK+FKT +G  F+ P 
Sbjct  3    GRNHLYIPGPTNVPSEVLNAMHVNMEDHRSPIFPKLLKPLLQDLKKVFKTETGQAFVFPA  62

Query  357  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  536
            TGT  WE ALTNTL+PGD+++ +  GQFS LW +  +RL F+V++ +  WG+G  LD L 
Sbjct  63   TGTAGWEIALTNTLNPGDKVLIYRFGQFSHLWAEMAKRLGFDVEIHQEAWGKGIPLDKLE  122

Query  537  SKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            ++L ED+ H IKA+   HNETATGVT+++ 
Sbjct  123  ARLKEDSQHEIKAVLATHNETATGVTSDIG  152



>ref|WP_026597137.1| serine--glyoxylate aminotransferase [Methylobacterium sp. 77]
Length=402

 Score =   182 bits (463),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 108/158 (68%), Gaps = 0/158 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            M     PGRNHLFVPGP NIPD+V RAM   +ED+RS   PALTK L E+ K +F +T G
Sbjct  1    MAATRRPGRNHLFVPGPTNIPDRVQRAMIVPSEDHRSVDFPALTKPLFEETKAVFGSTEG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            T FL P +GTG WE+ALTNTL  GD++++   GQFS LWID  QRL  NV V E EWG G
Sbjct  61   TIFLFPASGTGIWEAALTNTLHRGDKVLTSRFGQFSHLWIDMAQRLGLNVIVQEEEWGTG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLAT  629
            A+ + +   L  DT H IKA+  VHNETATGVT+++  
Sbjct  121  ASPERIEEALRADTNHEIKAVMTVHNETATGVTSDIGA  158



>ref|WP_014329402.1| serine--glyoxylate aminotransferase [Sinorhizobium fredii]
 emb|CCE96968.1| serine-glyoxylate aminotransferase-related [Sinorhizobium fredii 
HH103]
Length=396

 Score =   182 bits (463),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 82/151 (54%), Positives = 108/151 (72%), Gaps = 0/151 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  356
            G NHLF+PGP NIP+QV +AM    ED RSP  P LT  L  DVKK+FK  +G  F+ P+
Sbjct  3    GYNHLFIPGPTNIPEQVRQAMNLPMEDMRSPRFPELTLPLFADVKKVFKNRNGRVFIYPS  62

Query  357  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  536
            +GTGAWE+A+TN LSPGD+++    GQFS LW+D  +RL F VD ++ EWG G  +++ A
Sbjct  63   SGTGAWEAAMTNVLSPGDKVLMSRFGQFSHLWVDMAERLGFEVDCLDREWGTGVPVELYA  122

Query  537  SKLAEDTAHTIKAICIVHNETATGVTNNLAT  629
             +LA D AH IKA+ + HNETATGVT+++A 
Sbjct  123  ERLAADKAHKIKAVFVTHNETATGVTSDVAA  153



>ref|WP_036253086.1| serine--glyoxylate aminotransferase [Methylobacter sp. BBA5.1]
Length=388

 Score =   182 bits (462),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 79/150 (53%), Positives = 109/150 (73%), Gaps = 0/150 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  356
            GRNHL++PGP N+P +V+ AM  N ED+RSP  P L K LL+D+KK+FKT +G  F+ P 
Sbjct  3    GRNHLYIPGPTNVPSEVLNAMHVNMEDHRSPIFPKLLKPLLQDLKKVFKTETGQAFVFPA  62

Query  357  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  536
            TGT  WE ALTNTL+PGD+++ +  GQFS LW +  +RL F+V++ +  WG+G  LD L 
Sbjct  63   TGTAGWEIALTNTLNPGDKVLIYRFGQFSHLWAEMAKRLGFDVEIHQETWGKGIPLDKLE  122

Query  537  SKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            ++L ED+ H IKA+   HNETATGVT+++ 
Sbjct  123  ARLKEDSQHEIKAVLATHNETATGVTSDIG  152



>ref|WP_026622911.1| serine--glyoxylate aminotransferase [Ensifer sp. WSM1721]
Length=396

 Score =   182 bits (462),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 82/149 (55%), Positives = 107/149 (72%), Gaps = 0/149 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  356
            G NHLF+PGP NIP+QV +AM    ED RSP  P LT  L  DVKK+FK  +G  F+ P+
Sbjct  3    GYNHLFIPGPTNIPEQVRQAMNLPMEDMRSPQYPELTLPLFADVKKVFKNRNGRVFIYPS  62

Query  357  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  536
            +GTGAWE+A+TN LSPGDR++    GQFS LW+D  +RL F VD ++ EWG G  +++ A
Sbjct  63   SGTGAWEAAMTNVLSPGDRVLMSRFGQFSHLWVDMAERLGFEVDCLDMEWGTGVPVELYA  122

Query  537  SKLAEDTAHTIKAICIVHNETATGVTNNL  623
             +LA D AH IKA+ + HNETATGVT+++
Sbjct  123  ERLAADKAHRIKAVFVTHNETATGVTSDV  151



>ref|WP_018410273.1| serine--glyoxylate aminotransferase [Methyloversatilis sp. NVD]
Length=396

 Score =   182 bits (462),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 103/150 (69%), Gaps = 0/150 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  356
            GRNHLFVPGP N+PD+V+RAM    ED+RSP  P LTK++L D+KK+FKTT GT    P 
Sbjct  6    GRNHLFVPGPTNVPDRVLRAMVVAQEDHRSPKFPELTKSVLADLKKVFKTTEGTILTFPA  65

Query  357  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  536
            +GTG WE+ALTNTLSPGD+++    GQFS LW D  QRL F V +++ EWG G   D   
Sbjct  66   SGTGMWEAALTNTLSPGDKVLCSRFGQFSHLWADMAQRLGFEVQILDVEWGTGVPYDQYE  125

Query  537  SKLAEDTAHTIKAICIVHNETATGVTNNLA  626
              L  D  H IKA+    NETATGVT+++ 
Sbjct  126  EVLRADKEHKIKAVLACQNETATGVTSDIG  155



>ref|WP_031434945.1| serine--glyoxylate aminotransferase [Methylomarinum vadi]
Length=388

 Score =   182 bits (461),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 107/150 (71%), Gaps = 0/150 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  356
            GRNHLF+PGP N P +V+ AM    ED+RSP  P L K +LED+KK+F+T +G  F+ P 
Sbjct  3    GRNHLFIPGPTNTPHEVLSAMHVPMEDHRSPDFPKLLKPVLEDLKKVFRTETGQAFIFPA  62

Query  357  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  536
            TGT  WE ALTNTLSPGD+++ +  GQFS LW+D  +RL  +V+  E EWG+G  LD L 
Sbjct  63   TGTAGWEIALTNTLSPGDKVLIYRFGQFSHLWMDMAKRLGLDVEFHEVEWGKGIPLDALE  122

Query  537  SKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            ++L ED  H IKA+   HNETATGVT+++A
Sbjct  123  TRLKEDGNHEIKAVLATHNETATGVTSDIA  152



>ref|WP_027999163.1| serine--glyoxylate aminotransferase [Sinorhizobium arboris]
Length=396

 Score =   182 bits (461),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 107/150 (71%), Gaps = 0/150 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  356
            G NHLF+PGP NIP+QV +AM    ED RSP  P LT  L  DVKK+FK  +G  F+ P+
Sbjct  3    GYNHLFIPGPTNIPEQVRQAMNLPMEDMRSPRFPELTLPLFADVKKVFKNRNGRVFIYPS  62

Query  357  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  536
            +GTGAWE+A+TN LSPGD+++    GQFS LW+D  +RL F VD ++ EWG G  +D+ A
Sbjct  63   SGTGAWEAAMTNVLSPGDKVLMSRFGQFSHLWVDMAERLGFEVDCLDMEWGTGVPVDLYA  122

Query  537  SKLAEDTAHTIKAICIVHNETATGVTNNLA  626
             +LA D  H IKA+ + HNETATGVT+++A
Sbjct  123  ERLAADETHQIKAVFVTHNETATGVTSDVA  152



>ref|WP_028755163.1| serine--glyoxylate aminotransferase [Rhizobium leucaenae]
Length=396

 Score =   182 bits (461),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/151 (54%), Positives = 107/151 (71%), Gaps = 0/151 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  356
            G NHLF+PGP NIP+QV +AM    ED RSP  P LT  L  DVKK+FK  +G  F+ P+
Sbjct  3    GYNHLFIPGPTNIPEQVRQAMNLPMEDMRSPRYPELTLPLFADVKKVFKNHNGRVFIYPS  62

Query  357  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  536
            +GTGAWE+A+TN LSPGDR++    GQFS LW+D  +RL F VD ++ EWG G  +++ A
Sbjct  63   SGTGAWEAAMTNVLSPGDRVLMSRFGQFSHLWVDMAERLGFEVDCLDMEWGTGVPVELYA  122

Query  537  SKLAEDTAHTIKAICIVHNETATGVTNNLAT  629
             +L  D AH IKA+ + HNETATGVT+++A 
Sbjct  123  ERLVADKAHKIKAVFVTHNETATGVTSDVAA  153



>ref|WP_022947294.1| serine--glyoxylate aminotransferase [Methylohalobius crimeensis]
Length=395

 Score =   182 bits (461),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/151 (56%), Positives = 104/151 (69%), Gaps = 0/151 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  356
            GRNHL+VPGP N PD V+ AM    ED+R+P    L K LLED+KK+F+T  G  FL P 
Sbjct  3    GRNHLYVPGPTNAPDSVLSAMHVPMEDHRAPDFSELVKPLLEDLKKVFRTEKGQVFLFPA  62

Query  357  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  536
            TGT  WE A+TNTLSPGD+++S+  GQFS LWI   QR+  +V+  E  WG+G  L+ L 
Sbjct  63   TGTAGWEVAMTNTLSPGDKVLSYRFGQFSHLWIQSAQRMGLDVEYHEVPWGEGVPLEHLE  122

Query  537  SKLAEDTAHTIKAICIVHNETATGVTNNLAT  629
             +L EDT H IK + I HNETATGVTN+LA 
Sbjct  123  QRLQEDTNHEIKGLLICHNETATGVTNDLAA  153



>ref|XP_003617694.1| Alanine glyoxylate aminotransferase [Medicago truncatula]
 gb|AET00653.1| serine-glyoxylate aminotransferase-like protein [Medicago truncatula]
Length=350

 Score =   181 bits (458),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 98/156 (63%), Positives = 106/156 (68%), Gaps = 31/156 (20%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            MD+   P RNHLFVPG  NIP+ VI   T             LTKTLL+DVKKIFKT  G
Sbjct  1    MDFAYGPERNHLFVPGSTNIPEHVIPITT-------------LTKTLLDDVKKIFKTVYG  47

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
              FLIPTTG    ESALTNT+SPG R +SFLIGQFSLLWI+QQ+RLNF VDVVESEWGQG
Sbjct  48   ISFLIPTTGI---ESALTNTMSPGYRTISFLIGQFSLLWIEQQKRLNFKVDVVESEWGQG  104

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNL  623
            ANL+               AICIVHNET TGVTNNL
Sbjct  105  ANLE---------------AICIVHNETTTGVTNNL  125



>ref|WP_040961132.1| serine--glyoxylate aminotransferase [Sinorhizobium fredii]
Length=396

 Score =   182 bits (461),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/151 (54%), Positives = 107/151 (71%), Gaps = 0/151 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  356
            G NHLF+PGP NIP+QV +AM    ED RSP  P LT  L  DVKK+FK  +G  F+ P+
Sbjct  3    GYNHLFIPGPTNIPEQVRQAMNLPMEDMRSPRYPELTLPLFADVKKVFKNRNGRVFIYPS  62

Query  357  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  536
            +GTGAWE+A+TN LSPGD+++    GQFS LW+D  +RL F VD ++ EWG G  + + A
Sbjct  63   SGTGAWEAAMTNVLSPGDKVLMSRFGQFSHLWVDMAERLGFEVDCLDREWGTGVPVKLYA  122

Query  537  SKLAEDTAHTIKAICIVHNETATGVTNNLAT  629
             +LA D AH IKA+ + HNETATGVT+++A 
Sbjct  123  ERLAADKAHKIKAVFVTHNETATGVTSDVAA  153



>ref|WP_005371842.1| MULTISPECIES: serine--glyoxylate aminotransferase [Methylomicrobium]
 gb|EIC29744.1| serine-pyruvate aminotransferase/archaeal aspartate aminotransferase 
[Methylomicrobium album BG8]
Length=388

 Score =   181 bits (460),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 79/150 (53%), Positives = 108/150 (72%), Gaps = 0/150 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  356
            GRNHL++PGP N+P +V+ AM    ED+RSP  PA+ K LLED+KK+F+T  G  F+ P 
Sbjct  3    GRNHLYIPGPTNVPHEVLSAMHAPMEDHRSPKFPAIFKPLLEDMKKVFRTEKGQCFIFPA  62

Query  357  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  536
            TGT  WE ALTNTL+PGD+++ +  GQFS LW +  +RL F+V++ +  WG+G  LD L 
Sbjct  63   TGTAGWEIALTNTLNPGDKVIIYRFGQFSHLWAEMAKRLGFDVEIHQETWGKGIPLDKLE  122

Query  537  SKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            ++L ED  H IKA+   HNETATGVT+++A
Sbjct  123  ARLKEDKNHEIKAVLATHNETATGVTSDIA  152



>ref|WP_027172630.1| serine--glyoxylate aminotransferase [Methylobacterium sp. 10]
Length=402

 Score =   181 bits (460),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 90/158 (57%), Positives = 105/158 (66%), Gaps = 0/158 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            M     PGRNHLFVPGP NIPD+V RAM   +ED+RS   P LTK L E+ K +F +T G
Sbjct  1    MAATRRPGRNHLFVPGPTNIPDRVQRAMIVPSEDHRSVDFPTLTKPLFEETKAVFGSTEG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            T FL P +GTG WESALTNTL  GD +++   GQFS LWID  QRL  NV V E EWG G
Sbjct  61   TIFLFPASGTGIWESALTNTLHRGDTVLTSRFGQFSHLWIDMAQRLGLNVIVQEEEWGTG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLAT  629
            AN   +   L  DT H IKA+  VHNETATGVT+++  
Sbjct  121  ANPQRIEEALRADTNHEIKAVMTVHNETATGVTSDIGA  158



>ref|WP_026175686.1| serine--glyoxylate aminotransferase [Methylobacterium sp. 88A]
Length=402

 Score =   181 bits (460),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 90/158 (57%), Positives = 105/158 (66%), Gaps = 0/158 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            M     PGRNHLFVPGP NIPD+V RAM   +ED+RS   P LTK L E+ K +F +T G
Sbjct  1    MAATRRPGRNHLFVPGPTNIPDRVQRAMIVPSEDHRSVDFPTLTKPLFEETKAVFGSTEG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            T FL P +GTG WESALTNTL  GD +++   GQFS LWID  QRL  NV V E EWG G
Sbjct  61   TIFLFPASGTGIWESALTNTLHRGDTVLTSRFGQFSHLWIDMAQRLGLNVIVQEEEWGTG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLAT  629
            AN   +   L  DT H IKA+  VHNETATGVT+++  
Sbjct  121  ANPQRIEEALRADTNHEIKAVMTVHNETATGVTSDIGA  158



>ref|WP_026616975.1| serine--glyoxylate aminotransferase [Ensifer sp. TW10]
Length=396

 Score =   181 bits (460),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 81/151 (54%), Positives = 108/151 (72%), Gaps = 0/151 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  356
            G NHLF+PGP NIP+QV +AM    ED RSP  P LT  L  DV+K+FK  +G  F+ P+
Sbjct  3    GYNHLFIPGPTNIPEQVRQAMNLPMEDMRSPRFPELTLPLFADVRKVFKNQNGRVFIYPS  62

Query  357  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  536
            +GTGAWE+A+TN LSPGDR++    GQFS LW+D  +RL F VD ++ EWG G  +++ A
Sbjct  63   SGTGAWEAAMTNVLSPGDRVLMSRFGQFSHLWVDMAERLGFEVDCLDMEWGTGVPVELYA  122

Query  537  SKLAEDTAHTIKAICIVHNETATGVTNNLAT  629
             +LA D AH I+A+ + HNETATGVT+++A 
Sbjct  123  ERLAADKAHEIQAVFVTHNETATGVTSDVAA  153



>ref|WP_018329867.1| serine--glyoxylate aminotransferase [Rhizobium giardinii]
Length=396

 Score =   181 bits (459),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 80/152 (53%), Positives = 108/152 (71%), Gaps = 0/152 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  353
            PG NHLF+PGP NIP+QV +AM    ED RSP  P LT  L  D++++FK  +G  F+ P
Sbjct  2    PGYNHLFIPGPTNIPEQVRQAMNLPMEDMRSPRFPELTLPLFADLRRVFKNQNGRVFIYP  61

Query  354  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  533
            ++GTGAWE+A+TN LSPGD ++    GQFS LW+D  +RL F VD ++ EWG G  +++ 
Sbjct  62   SSGTGAWEAAMTNVLSPGDHVLMSRFGQFSHLWVDMAERLGFKVDCIDMEWGTGVPVELY  121

Query  534  ASKLAEDTAHTIKAICIVHNETATGVTNNLAT  629
            A +L  D AHTIKA+ + HNETATGVT+++A 
Sbjct  122  AERLTGDKAHTIKAVFVTHNETATGVTSDVAA  153



>ref|WP_037384071.1| serine--glyoxylate aminotransferase [Ensifer americanum]
 gb|KEC78847.1| serine-glyoxylate aminotransferase [Sinorhizobium americanum 
CCGM7]
Length=395

 Score =   181 bits (458),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 80/151 (53%), Positives = 108/151 (72%), Gaps = 0/151 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  356
            G NHLF+PGP NIP++V +AM    ED RSP  P LT  L  D+K++FK  +G  F+ P+
Sbjct  3    GYNHLFIPGPTNIPERVRQAMNLPMEDMRSPRYPELTLPLFADIKQVFKNKTGRVFIYPS  62

Query  357  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  536
            +GTGAWE+A+TN LSPGDR++    GQFS LW+D  +RL F VD ++ EWG G  +++ A
Sbjct  63   SGTGAWEAAMTNVLSPGDRVLMSRFGQFSHLWVDMAERLGFEVDCLDREWGTGVPVELYA  122

Query  537  SKLAEDTAHTIKAICIVHNETATGVTNNLAT  629
             +LA D AH IKA+ + HNETATGVT+++A 
Sbjct  123  ERLAADEAHEIKAVFVTHNETATGVTSDVAA  153



>ref|WP_006890572.1| serine--glyoxylate aminotransferase [Methylobacter tundripaludum]
 gb|EGW22602.1| Serine--glyoxylate transaminase [Methylobacter tundripaludum 
SV96]
Length=388

 Score =   181 bits (458),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 78/150 (52%), Positives = 109/150 (73%), Gaps = 0/150 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  356
            GRNHL++PGP N+P++++ AM  N ED+RSP  P L   LL+D+KKIFKT +G  F+ P 
Sbjct  3    GRNHLYIPGPTNVPNEILNAMHVNMEDHRSPVFPKLLTPLLQDLKKIFKTETGQAFIFPA  62

Query  357  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  536
            TGT  WE ALTNTL+PGD+++ +  GQFS LW +  +RL F+V++ +  WG+G  LD + 
Sbjct  63   TGTAGWEVALTNTLNPGDKVLIYRFGQFSHLWAEMAKRLGFDVEIHQEVWGKGIPLDRME  122

Query  537  SKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            ++L EDT H IKA+   HNETATGVT+++ 
Sbjct  123  ARLKEDTNHEIKAVLATHNETATGVTSDIG  152



>ref|WP_037131645.1| serine--glyoxylate aminotransferase [Rhizobium sp. CF097]
Length=396

 Score =   181 bits (458),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 82/151 (54%), Positives = 108/151 (72%), Gaps = 0/151 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  353
            PG +HLF+PGP NIP+QV +AM    ED RS   P LT  L  DVKK+FK  +G  F+ P
Sbjct  2    PGYSHLFIPGPTNIPEQVRQAMNLPMEDMRSSRYPELTLPLFADVKKVFKNQNGRVFIYP  61

Query  354  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  533
            ++GTGAWE+A+TN LSPGDR++    GQFS LW+D  +RL F VD ++ EWG G  +++ 
Sbjct  62   SSGTGAWEAAMTNVLSPGDRVLMSRFGQFSHLWVDMAERLGFVVDCLDREWGTGVPVELY  121

Query  534  ASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            A +LA D AH IKA+ + HNETATGVT+++A
Sbjct  122  AERLAADKAHEIKAVFVTHNETATGVTSDVA  152



>ref|WP_031437003.1| serine--glyoxylate aminotransferase [Methylobacter tundripaludum]
Length=388

 Score =   180 bits (457),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 78/150 (52%), Positives = 109/150 (73%), Gaps = 0/150 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  356
            GRNHL++PGP N+P++++ AM  N ED+RSP  P L   LL+D+KKIFKT +G  F+ P 
Sbjct  3    GRNHLYIPGPTNVPNEILNAMHVNMEDHRSPVFPKLLTPLLQDLKKIFKTETGQAFIFPA  62

Query  357  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  536
            TGT  WE ALTNTL+PGD+++ +  GQFS LW +  +RL F+V++ +  WG+G  LD + 
Sbjct  63   TGTAGWEVALTNTLNPGDKVLIYRFGQFSHLWAEMAKRLGFDVEIHQEVWGKGIPLDRME  122

Query  537  SKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            ++L EDT H IKA+   HNETATGVT+++ 
Sbjct  123  ARLKEDTNHEIKAVLATHNETATGVTSDIG  152



>ref|WP_012709136.1| serine--glyoxylate aminotransferase [Sinorhizobium fredii]
 ref|YP_002827132.1| serine--glyoxylate aminotransferase [Sinorhizobium fredii NGR234]
 gb|ACP26379.1| serine--glyoxylate aminotransferase [Sinorhizobium fredii NGR234]
Length=395

 Score =   181 bits (458),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 81/151 (54%), Positives = 106/151 (70%), Gaps = 0/151 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  356
            G NHLF+PGP NIP+Q+ +AM    ED RSP  P LT  L  DVKK+FK  +G  F+ P+
Sbjct  3    GYNHLFIPGPTNIPEQIRQAMNLPMEDMRSPRYPELTLPLFADVKKVFKNRNGRVFIYPS  62

Query  357  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  536
            +GTGAWE+A+TN LSPGDR++    GQFS LW+D  +RL   VD ++ EWG G  +D+  
Sbjct  63   SGTGAWEAAMTNVLSPGDRVLMSRFGQFSHLWVDMAERLGLEVDCLDREWGTGVPVDLYT  122

Query  537  SKLAEDTAHTIKAICIVHNETATGVTNNLAT  629
             +LA D AH IKA+ + HNETATGVT+++A 
Sbjct  123  ERLAADKAHRIKAVFVTHNETATGVTSDVAA  153



>ref|WP_028223486.1| serine--glyoxylate aminotransferase [Burkholderia oxyphila]
Length=421

 Score =   181 bits (459),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 83/152 (55%), Positives = 107/152 (70%), Gaps = 0/152 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  353
            PGRN L VPGP NIPD V+RAM  + ED+RS   P L   +L D+K+++KTTSG PF+ P
Sbjct  10   PGRNILAVPGPTNIPDAVLRAMVVSMEDHRSTRFPELANGVLSDLKRLYKTTSGQPFIFP  69

Query  354  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  533
            ++GTGAWE+ALTNTLSPGDR++    GQFS LW D  QRL F V++VE +WG+G  ++ +
Sbjct  70   SSGTGAWEAALTNTLSPGDRVLVARFGQFSHLWADMAQRLGFEVEIVEVDWGEGVPVERI  129

Query  534  ASKLAEDTAHTIKAICIVHNETATGVTNNLAT  629
               L  D  H IK I   HNETATGVT+++  
Sbjct  130  EEVLKADKKHQIKGILACHNETATGVTSDIGA  161



>ref|WP_015933415.1| serine--glyoxylate aminotransferase [Methylobacterium nodulans]
 gb|ACL61852.1| aminotransferase class V [Methylobacterium nodulans ORS 2060]
Length=417

 Score =   181 bits (459),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 109/152 (72%), Gaps = 0/152 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  353
            PGRN LFVPGP N+P++V RAM    ED+RS + P LT  L E++KK+FK+  G  F+ P
Sbjct  7    PGRNFLFVPGPTNVPERVQRAMIVPMEDHRSSSFPDLTLPLFENMKKVFKSKDGQVFIFP  66

Query  354  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  533
            ++GTGAWE+ALTNTLSPGDR+++   GQFS LWID  QR+  +V + + EWG GAN D +
Sbjct  67   SSGTGAWEAALTNTLSPGDRVLASRFGQFSTLWIDLAQRVGLDVVIQDEEWGTGANPDRI  126

Query  534  ASKLAEDTAHTIKAICIVHNETATGVTNNLAT  629
               L  D  H IKA+ IVHNETATGVT+++  
Sbjct  127  EEALRADRDHRIKAVLIVHNETATGVTSDIGA  158



>ref|WP_026608295.1| serine--glyoxylate aminotransferase [Methylocapsa acidiphila]
Length=412

 Score =   181 bits (458),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 82/152 (54%), Positives = 109/152 (72%), Gaps = 0/152 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  353
            PGR+ LFVPGP N+PD+V RAM    ED+RS   P LT  L ED+KK+FK+  G  F+ P
Sbjct  2    PGRHFLFVPGPTNVPDRVQRAMLVAMEDHRSSKFPELTLPLFEDLKKVFKSVDGQVFIFP  61

Query  354  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  533
            ++GTGAWE++L+NTLSPGD++++   GQFS LWID  QRL  +V V+E EWG G   + +
Sbjct  62   SSGTGAWEASLSNTLSPGDKVLASRFGQFSHLWIDLAQRLGLDVQVLEEEWGTGVKPEKI  121

Query  534  ASKLAEDTAHTIKAICIVHNETATGVTNNLAT  629
             + L ED +H IKA+  VHNETATGVT+++  
Sbjct  122  EAILREDKSHQIKAVLAVHNETATGVTSDIGA  153



>ref|WP_012320605.1| MULTISPECIES: serine--glyoxylate aminotransferase [Methylobacterium]
 gb|ACB25646.1| aminotransferase class V [Methylobacterium radiotolerans JCM 
2831]
 gb|KIU30995.1| serine--glyoxylate aminotransferase [Methylobacterium radiotolerans]
 dbj|GAN47418.1| class V aminotransferase [Methylobacterium sp. ME121]
Length=402

 Score =   181 bits (458),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 83/158 (53%), Positives = 110/158 (70%), Gaps = 0/158 (0%)
 Frame = +3

Query  156  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  335
            M     PGRNHLF+PGP NIP++V+RAM   +ED+RSP+ P L K LL+D K +F +T+G
Sbjct  1    MAATRRPGRNHLFIPGPTNIPERVLRAMHVPSEDHRSPSFPELVKPLLQDSKMVFGSTNG  60

Query  336  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  515
            T  L P++GTG WESAL+NTL  GD++++   GQFS LW+D  QRL  +V V E EWG G
Sbjct  61   TVILFPSSGTGIWESALSNTLCRGDKVLTARYGQFSHLWVDMAQRLGLDVIVQEEEWGAG  120

Query  516  ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLAT  629
            A+   +   L  D  H IKA+ +VHNETATGVT+++  
Sbjct  121  ADPQKIEEALRADKDHAIKAVMVVHNETATGVTSDIGA  158



>ref|WP_040580464.1| serine--glyoxylate aminotransferase [Methyloferula stellata]
Length=404

 Score =   180 bits (457),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 81/151 (54%), Positives = 110/151 (73%), Gaps = 0/151 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  353
            PGR+ LFVPGP N+PD+++RAM    ED+R+P  P LTK +LED+KKIFKTT+G  F+ P
Sbjct  10   PGRHFLFVPGPTNVPDRILRAMHVPMEDHRNPTFPDLTKPILEDLKKIFKTTTGQCFVYP  69

Query  354  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  533
            +TGTG WE+ALTNTLSPGD+++    GQFS LW D  QR+  +V V++ EWG G + + +
Sbjct  70   STGTGGWEAALTNTLSPGDKVIVSRYGQFSALWTDLAQRIGLDVQVIDEEWGTGTHPEHI  129

Query  534  ASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
             + L  D  H IK + +V NETATGVT+++ 
Sbjct  130  HAILEADKEHKIKGVLVVQNETATGVTSDVG  160



>ref|WP_035937801.1| serine--glyoxylate aminotransferase [Burkholderia glathei]
 gb|KDR42451.1| serine--glyoxylate aminotransferase [Burkholderia glathei]
 emb|CDY78627.1| Serine--glyoxylate aminotransferase [Burkholderia glathei]
Length=419

 Score =   180 bits (457),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/151 (54%), Positives = 106/151 (70%), Gaps = 0/151 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  353
            PGRN L VPGP NIPDQV+R+M  + ED+RS   P L   +L D+K ++KTT+G PF+ P
Sbjct  10   PGRNFLAVPGPTNIPDQVLRSMVVSMEDHRSSKFPELANGVLSDLKALYKTTTGQPFIFP  69

Query  354  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  533
            ++GTGAWE+ALTNTLSPGD++V    GQFS LW D   RL F V +V+ EWG+G  ++ +
Sbjct  70   SSGTGAWEAALTNTLSPGDKVVVARFGQFSHLWADMAHRLGFEVQIVDVEWGEGVPVERI  129

Query  534  ASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
               L  D  HTIK I   HNETATGVT+++ 
Sbjct  130  EEILRADKQHTIKGILACHNETATGVTSDIG  160



>ref|WP_026223456.1| serine--glyoxylate aminotransferase [Methylosarcina fibrata]
Length=390

 Score =   179 bits (455),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 79/150 (53%), Positives = 107/150 (71%), Gaps = 0/150 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  356
            GRNHL++PGP N+P +V+ AM    ED+RSP  P L K LLED+KK+F+T  G  F+ P 
Sbjct  3    GRNHLYIPGPTNVPHEVLSAMHAPMEDHRSPKFPTLFKPLLEDLKKVFRTEDGQCFIFPA  62

Query  357  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  536
            TGT  WE ALTNTL+PGD+++ +  GQFS LW +  +RL F+V++ +  WG+G  LD L 
Sbjct  63   TGTAGWEVALTNTLNPGDKVLIYRFGQFSHLWAEMAKRLGFDVEIHQETWGRGIPLDKLE  122

Query  537  SKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            ++L ED  H IKA+   HNETATGVT+++A
Sbjct  123  ARLKEDKNHEIKAVLATHNETATGVTSDIA  152



>ref|WP_012590731.1| serine--glyoxylate aminotransferase [Methylocella silvestris]
 gb|ACK50661.1| aminotransferase class V [Methylocella silvestris BL2]
Length=396

 Score =   179 bits (455),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 105/152 (69%), Gaps = 0/152 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  353
            PGR+ LFVPGP N+P++V RAM    ED+RSP  P LT  L +D+KKI+KT  G  FL P
Sbjct  2    PGRHFLFVPGPTNVPERVARAMVVPMEDHRSPKFPELTLPLFQDLKKIYKTKDGQVFLFP  61

Query  354  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  533
            ++GTGAWESA  NTLSPGD+++    GQFS LWID  QR+ F+V ++E EWG G   + +
Sbjct  62   SSGTGAWESAFNNTLSPGDKVLMSRFGQFSHLWIDMAQRMGFDVQILEEEWGTGVKPEKI  121

Query  534  ASKLAEDTAHTIKAICIVHNETATGVTNNLAT  629
               L  D +H IKA+   HNETATGV +++A 
Sbjct  122  EEILRADKSHQIKAVTATHNETATGVASDIAA  153



>ref|XP_001702107.1| serine glyoxylate aminotransferase [Chlamydomonas reinhardtii]
 gb|EDO97196.1| serine glyoxylate aminotransferase [Chlamydomonas reinhardtii]
Length=437

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/151 (54%), Positives = 105/151 (70%), Gaps = 0/151 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  353
            PGRNHLFVPGPVNI ++V+RAM    +++R P      K  LED K ++ T + TPF+ P
Sbjct  39   PGRNHLFVPGPVNIHERVLRAMHVPGQNHRDPWFAEFYKECLEDTKHMYGTKAATPFIFP  98

Query  354  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  533
             TGTG WE+AL NTLSPGD+++ F  G FS LWID  QRL  +V VV+  WG+GA+   L
Sbjct  99   GTGTGGWEAALCNTLSPGDKVICFRYGLFSHLWIDMMQRLGLDVTVVDRPWGEGADEGAL  158

Query  534  ASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
               L +DT   IKA+C+VHNET TGVT+++A
Sbjct  159  EELLRKDTGKKIKAVCVVHNETTTGVTSDIA  189



>ref|WP_027168976.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. WSM3224]
Length=396

 Score =   179 bits (454),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 106/150 (71%), Gaps = 0/150 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  356
            G  HLF+PGP NIP+QV +AM    ED R+ + P LT  L ED+KK+FK  +G  F+ P+
Sbjct  3    GFTHLFIPGPTNIPEQVRQAMNLPMEDMRAASFPDLTLPLFEDIKKVFKNETGRVFIYPS  62

Query  357  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  536
            +GTGAWE+A+TN LSPGDR++    GQFS LW+D  +RL F VDVV+ EWG G  L++ A
Sbjct  63   SGTGAWEAAMTNVLSPGDRVLMSRFGQFSHLWVDMAERLGFEVDVVDCEWGTGVPLEIYA  122

Query  537  SKLAEDTAHTIKAICIVHNETATGVTNNLA  626
             +L  D AH IKAI    NETATGVT+++A
Sbjct  123  ERLKADKAHRIKAIFCTQNETATGVTSDVA  152



>ref|XP_001702106.1| serine glyoxylate aminotransferase [Chlamydomonas reinhardtii]
 gb|EDO97195.1| serine glyoxylate aminotransferase [Chlamydomonas reinhardtii]
Length=448

 Score =   180 bits (456),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/151 (54%), Positives = 105/151 (70%), Gaps = 0/151 (0%)
 Frame = +3

Query  174  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  353
            PGRNHLFVPGPVNI ++V+RAM    +++R P      K  LED K ++ T + TPF+ P
Sbjct  50   PGRNHLFVPGPVNIHERVLRAMHVPGQNHRDPWFAEFYKECLEDTKHMYGTKAATPFIFP  109

Query  354  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  533
             TGTG WE+AL NTLSPGD+++ F  G FS LWID  QRL  +V VV+  WG+GA+   L
Sbjct  110  GTGTGGWEAALCNTLSPGDKVICFRYGLFSHLWIDMMQRLGLDVTVVDRPWGEGADEGAL  169

Query  534  ASKLAEDTAHTIKAICIVHNETATGVTNNLA  626
               L +DT   IKA+C+VHNET TGVT+++A
Sbjct  170  EELLRKDTGKKIKAVCVVHNETTTGVTSDIA  200



>ref|WP_024298006.1| serine--glyoxylate aminotransferase [Methylosarcina lacus]
Length=388

 Score =   179 bits (453),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 79/150 (53%), Positives = 107/150 (71%), Gaps = 0/150 (0%)
 Frame = +3

Query  177  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  356
            GRNHL++PGP N+P +V+ AM    ED+RSP  P L K LLED+KKIF+T +G  F+ P 
Sbjct  3    GRNHLYIPGPTNVPHEVLSAMHAPMEDHRSPKFPTLFKPLLEDMKKIFRTENGQCFIFPA  62

Query  357  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  536
            TGT  WE ALTNTL+PGD+++ +  GQFS LW +  +RL F+V++ +  WG+G  LD L 
Sbjct  63   TGTAGWEIALTNTLNPGDKVLIYRFGQFSHLWAEMAKRLGFDVEIHQETWGKGIPLDKLE  122

Query  537  SKLAEDTAHTIKAICIVHNETATGVTNNLA  626
            ++L ED  H IKA+   HNETATGVT+++ 
Sbjct  123  ARLKEDKNHEIKAVLATHNETATGVTSDIG  152



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 893169593250