BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF050P09

Length=704
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006341693.1|  PREDICTED: protein ECERIFERUM 3-like               379   2e-124   Solanum tuberosum [potatoes]
ref|XP_009609207.1|  PREDICTED: protein ECERIFERUM 3-like isoform X1    370   6e-121   Nicotiana tomentosiformis
ref|XP_009609208.1|  PREDICTED: protein ECERIFERUM 3-like isoform X2    369   8e-121   Nicotiana tomentosiformis
ref|XP_010318689.1|  PREDICTED: protein ECERIFERUM 3 isoform X3         368   9e-121   
ref|XP_004235875.1|  PREDICTED: protein ECERIFERUM 3 isoform X1         369   1e-120   Solanum lycopersicum
ref|XP_010318688.1|  PREDICTED: protein ECERIFERUM 3 isoform X2         369   1e-120   Solanum lycopersicum
ref|XP_009788358.1|  PREDICTED: protein ECERIFERUM 3-like               365   4e-119   Nicotiana sylvestris
ref|XP_011073243.1|  PREDICTED: protein ECERIFERUM 3-like isoform X3    342   3e-111   Sesamum indicum [beniseed]
ref|XP_011082697.1|  PREDICTED: protein ECERIFERUM 3-like               342   3e-110   Sesamum indicum [beniseed]
ref|XP_011073242.1|  PREDICTED: protein ECERIFERUM 3-like isoform X2    341   9e-110   Sesamum indicum [beniseed]
ref|XP_011073241.1|  PREDICTED: protein ECERIFERUM 3-like isoform X1    341   1e-109   Sesamum indicum [beniseed]
emb|CDO98263.1|  unnamed protein product                                316   1e-99    Coffea canephora [robusta coffee]
gb|EYU21788.1|  hypothetical protein MIMGU_mgv1a025856mg                313   3e-99    Erythranthe guttata [common monkey flower]
ref|XP_007013964.1|  Fatty acid hydroxylase superfamily                 311   3e-98    
ref|XP_002270033.2|  PREDICTED: protein ECERIFERUM 3-like               304   1e-95    Vitis vinifera
emb|CBI25242.3|  unnamed protein product                                304   1e-95    Vitis vinifera
ref|XP_002270075.1|  PREDICTED: protein ECERIFERUM 3-like               304   1e-95    Vitis vinifera
emb|CBI25244.3|  unnamed protein product                                304   1e-95    Vitis vinifera
ref|XP_002270946.1|  PREDICTED: protein ECERIFERUM 3                    303   2e-95    Vitis vinifera
gb|EYU24562.1|  hypothetical protein MIMGU_mgv1a002930mg                299   1e-93    Erythranthe guttata [common monkey flower]
gb|KJB83319.1|  hypothetical protein B456_013G242200                    292   1e-93    Gossypium raimondii
ref|XP_003549515.1|  PREDICTED: protein ECERIFERUM 3-like               298   3e-93    Glycine max [soybeans]
gb|KHN17538.1|  Protein WAX2                                            298   3e-93    Glycine soja [wild soybean]
gb|KJB83320.1|  hypothetical protein B456_013G242200                    294   3e-93    Gossypium raimondii
ref|XP_004309858.1|  PREDICTED: protein ECERIFERUM 3                    298   4e-93    Fragaria vesca subsp. vesca
gb|KJB83321.1|  hypothetical protein B456_013G242200                    294   4e-93    Gossypium raimondii
ref|XP_007221983.1|  hypothetical protein PRUPE_ppa002836mg             296   1e-92    Prunus persica
ref|XP_007154834.1|  hypothetical protein PHAVU_003G1516000g            289   2e-92    Phaseolus vulgaris [French bean]
ref|XP_008223563.1|  PREDICTED: protein ECERIFERUM 3 isoform X2         294   2e-92    
ref|XP_007154833.1|  hypothetical protein PHAVU_003G1516000g            289   2e-92    Phaseolus vulgaris [French bean]
gb|KJB83322.1|  hypothetical protein B456_013G242200                    294   2e-92    Gossypium raimondii
gb|KJB83324.1|  hypothetical protein B456_013G242200                    294   4e-92    Gossypium raimondii
ref|XP_010929211.1|  PREDICTED: protein ECERIFERUM 3-like isoform X2    292   1e-91    
ref|XP_010103144.1|  Protein WAX2                                       293   1e-91    
ref|XP_008223562.1|  PREDICTED: protein ECERIFERUM 3 isoform X1         294   1e-91    Prunus mume [ume]
gb|KJB83318.1|  hypothetical protein B456_013G242200                    293   1e-91    Gossypium raimondii
ref|XP_003542310.1|  PREDICTED: protein ECERIFERUM 3-like               293   2e-91    Glycine max [soybeans]
ref|XP_010929210.1|  PREDICTED: protein ECERIFERUM 3-like isoform X1    292   5e-91    Elaeis guineensis
ref|XP_004507787.1|  PREDICTED: protein ECERIFERUM 3-like               290   4e-90    Cicer arietinum [garbanzo]
gb|KHG30512.1|  Protein WAX2 -like protein                              288   1e-89    Gossypium arboreum [tree cotton]
ref|XP_008794400.1|  PREDICTED: protein ECERIFERUM 3-like               288   2e-89    Phoenix dactylifera
ref|XP_008804903.1|  PREDICTED: protein ECERIFERUM 3-like isoform X2    286   2e-89    
gb|KEH32582.1|  fatty acid hydroxylase superfamily protein              288   3e-89    Medicago truncatula
ref|XP_008804902.1|  PREDICTED: protein ECERIFERUM 3-like isoform X1    286   1e-88    Phoenix dactylifera
gb|EPS72440.1|  hypothetical protein M569_02318                         279   1e-88    Genlisea aurea
ref|XP_010545442.1|  PREDICTED: protein ECERIFERUM 3 isoform X2         283   1e-88    
gb|KJB83323.1|  hypothetical protein B456_013G242200                    286   1e-88    Gossypium raimondii
gb|EYU37115.1|  hypothetical protein MIMGU_mgv1a021583mg                285   2e-88    Erythranthe guttata [common monkey flower]
ref|XP_009417462.1|  PREDICTED: protein ECERIFERUM 3-like               285   3e-88    Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO62362.1|  hypothetical protein CISIN_1g006768mg                   280   7e-88    Citrus sinensis [apfelsine]
ref|XP_011070158.1|  PREDICTED: protein ECERIFERUM 3-like               284   7e-88    Sesamum indicum [beniseed]
gb|KJB23545.1|  hypothetical protein B456_004G104100                    281   8e-88    Gossypium raimondii
emb|CDY11848.1|  BnaC03g12740D                                          283   1e-87    Brassica napus [oilseed rape]
ref|XP_010047031.1|  PREDICTED: protein ECERIFERUM 3                    283   2e-87    Eucalyptus grandis [rose gum]
ref|XP_010545441.1|  PREDICTED: protein ECERIFERUM 3 isoform X1         281   6e-87    Tarenaya hassleriana [spider flower]
ref|XP_010914063.1|  PREDICTED: protein ECERIFERUM 3 isoform X2         281   6e-87    Elaeis guineensis
ref|XP_010914062.1|  PREDICTED: protein ECERIFERUM 3 isoform X1         281   1e-86    Elaeis guineensis
ref|XP_009622102.1|  PREDICTED: protein ECERIFERUM 3-like               270   1e-86    Nicotiana tomentosiformis
ref|XP_006350059.1|  PREDICTED: protein ECERIFERUM 3-like               280   1e-86    Solanum tuberosum [potatoes]
gb|KJB23541.1|  hypothetical protein B456_004G104100                    280   2e-86    Gossypium raimondii
ref|XP_006279594.1|  hypothetical protein CARUB_v10026077mg             280   2e-86    Capsella rubella
gb|KJB23544.1|  hypothetical protein B456_004G104100                    280   2e-86    Gossypium raimondii
gb|KDO62360.1|  hypothetical protein CISIN_1g006768mg                   280   3e-86    Citrus sinensis [apfelsine]
ref|XP_002308430.2|  hypothetical protein POPTR_0006s19140g             278   1e-85    
ref|XP_011012180.1|  PREDICTED: protein ECERIFERUM 3-like               275   1e-85    Populus euphratica
ref|XP_006453492.1|  hypothetical protein CICLE_v10007738mg             277   4e-85    Citrus clementina [clementine]
ref|XP_011079338.1|  PREDICTED: protein ECERIFERUM 3-like               276   7e-85    Sesamum indicum [beniseed]
emb|CDP02895.1|  unnamed protein product                                276   1e-84    Coffea canephora [robusta coffee]
ref|XP_010452800.1|  PREDICTED: protein ECERIFERUM 3-like               275   1e-84    Camelina sativa [gold-of-pleasure]
gb|KHG27245.1|  Protein WAX2                                            275   1e-84    Gossypium arboreum [tree cotton]
ref|XP_010483318.1|  PREDICTED: protein ECERIFERUM 3                    275   2e-84    Camelina sativa [gold-of-pleasure]
ref|XP_011018104.1|  PREDICTED: protein ECERIFERUM 3                    275   3e-84    Populus euphratica
ref|XP_009132107.1|  PREDICTED: protein ECERIFERUM 3-like               274   3e-84    Brassica rapa
gb|KHG27244.1|  Protein WAX2                                            275   4e-84    Gossypium arboreum [tree cotton]
ref|XP_010904609.1|  PREDICTED: protein ECERIFERUM 3-like               273   5e-84    Elaeis guineensis
emb|CDY50795.1|  BnaCnng19590D                                          273   1e-83    Brassica napus [oilseed rape]
emb|CDY51280.1|  BnaA10g11680D                                          273   1e-83    Brassica napus [oilseed rape]
ref|XP_010536953.1|  PREDICTED: LOW QUALITY PROTEIN: protein ECER...    272   2e-83    
ref|XP_010443488.1|  PREDICTED: protein ECERIFERUM 3-like               273   2e-83    Camelina sativa [gold-of-pleasure]
ref|XP_002325096.1|  hypothetical protein POPTR_0018s10830g             273   2e-83    
ref|XP_002864528.1|  hypothetical protein ARALYDRAFT_495876             272   2e-83    
emb|CDX88639.1|  BnaA03g10100D                                          272   3e-83    
emb|CDY02769.1|  BnaC02g11200D                                          271   5e-83    
ref|XP_009120299.1|  PREDICTED: protein ECERIFERUM 3-like isoform X1    271   9e-83    Brassica rapa
ref|XP_009766364.1|  PREDICTED: protein ECERIFERUM 3-like               270   1e-82    Nicotiana sylvestris
ref|XP_009120300.1|  PREDICTED: protein ECERIFERUM 3-like isoform X2    270   1e-82    Brassica rapa
ref|NP_200588.2|  protein ECERIFERUM 3                                  270   2e-82    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004242647.1|  PREDICTED: protein ECERIFERUM 3                    269   4e-82    Solanum lycopersicum
ref|XP_002528208.1|  sterol desaturase, putative                        268   4e-82    
ref|XP_006401167.1|  hypothetical protein EUTSA_v10012960mg             269   5e-82    Eutrema salsugineum [saltwater cress]
emb|CDY11847.1|  BnaC03g12730D                                          268   1e-81    Brassica napus [oilseed rape]
ref|XP_009798188.1|  PREDICTED: protein ECERIFERUM 3-like               268   1e-81    Nicotiana sylvestris
ref|XP_009132284.1|  PREDICTED: protein ECERIFERUM 3-like               266   1e-81    
ref|XP_009587593.1|  PREDICTED: protein ECERIFERUM 3-like               267   2e-81    Nicotiana tomentosiformis
gb|EYU34298.1|  hypothetical protein MIMGU_mgv1a0095731mg               258   5e-81    Erythranthe guttata [common monkey flower]
ref|XP_010687696.1|  PREDICTED: protein ECERIFERUM 3                    265   7e-81    Beta vulgaris subsp. vulgaris [field beet]
gb|KJB23543.1|  hypothetical protein B456_004G104100                    265   1e-80    Gossypium raimondii
ref|XP_004173838.1|  PREDICTED: protein ECERIFERUM 3-like               258   1e-80    
emb|CDX88642.1|  BnaA03g10070D                                          265   2e-80    
emb|CDX88640.1|  BnaA03g10090D                                          263   4e-80    
gb|KHG04940.1|  Protein WAX2                                            261   8e-80    Gossypium arboreum [tree cotton]
gb|KJB27033.1|  hypothetical protein B456_004G273200                    262   1e-79    Gossypium raimondii
gb|KJB27032.1|  hypothetical protein B456_004G273200                    262   2e-79    Gossypium raimondii
gb|KHG04939.1|  Protein WAX2                                            261   2e-79    Gossypium arboreum [tree cotton]
ref|XP_003578148.1|  PREDICTED: protein ECERIFERUM 3-like               260   7e-79    Brachypodium distachyon [annual false brome]
ref|XP_009387454.1|  PREDICTED: protein ECERIFERUM 3-like isoform X4    260   8e-79    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010278025.1|  PREDICTED: protein ECERIFERUM 3                    259   1e-78    Nelumbo nucifera [Indian lotus]
ref|XP_009387452.1|  PREDICTED: protein ECERIFERUM 3-like isoform X2    260   1e-78    
ref|XP_009387453.1|  PREDICTED: protein ECERIFERUM 3-like isoform X3    260   2e-78    
ref|XP_004149879.1|  PREDICTED: protein ECERIFERUM 3-like               259   2e-78    Cucumis sativus [cucumbers]
ref|XP_008443806.1|  PREDICTED: protein ECERIFERUM 3                    259   2e-78    Cucumis melo [Oriental melon]
ref|XP_009387450.1|  PREDICTED: protein ECERIFERUM 3-like isoform X1    260   2e-78    
gb|AEQ39063.1|  putative sterol desaturase                              249   3e-78    Wolffia arrhiza
ref|XP_009400348.1|  PREDICTED: protein ECERIFERUM 3-like               257   1e-77    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009126813.1|  PREDICTED: protein ECERIFERUM 3                    256   2e-77    Brassica rapa
emb|CDY32747.1|  BnaA02g08090D                                          254   1e-76    Brassica napus [oilseed rape]
ref|XP_006343719.1|  PREDICTED: protein ECERIFERUM 3-like               254   3e-76    Solanum tuberosum [potatoes]
gb|AAA33934.1|  lipid transfer protein                                  251   4e-76    Senecio odorus
ref|XP_009390985.1|  PREDICTED: protein ECERIFERUM 3-like               249   6e-75    Musa acuminata subsp. malaccensis [pisang utan]
gb|KDP38762.1|  hypothetical protein JCGZ_04115                         249   1e-74    Jatropha curcas
ref|XP_004956872.1|  PREDICTED: protein ECERIFERUM 3-like               246   2e-73    Setaria italica
ref|NP_001063227.1|  Os09g0426800                                       245   3e-73    
gb|EAZ44800.1|  hypothetical protein OsJ_29433                          245   3e-73    Oryza sativa Japonica Group [Japonica rice]
gb|KDO62363.1|  hypothetical protein CISIN_1g006768mg                   243   1e-72    Citrus sinensis [apfelsine]
ref|XP_006845484.1|  hypothetical protein AMTR_s00019p00142280          241   3e-72    
dbj|BAK02959.1|  predicted protein                                      242   6e-72    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003570600.1|  PREDICTED: protein ECERIFERUM 3-like               242   8e-72    Brachypodium distachyon [annual false brome]
dbj|BAB08850.1|  lipid transfer protein; glossy1 homolog                234   2e-69    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004973574.1|  PREDICTED: protein ECERIFERUM 3-like               233   9e-69    Setaria italica
gb|ACN25333.1|  unknown                                                 233   2e-68    Zea mays [maize]
gb|ADE75704.1|  unknown                                                 232   4e-68    Picea sitchensis
ref|XP_004951702.1|  PREDICTED: protein ECERIFERUM 3-like isoform X3    232   4e-68    Setaria italica
gb|EPS65188.1|  hypothetical protein M569_09590                         221   5e-68    Genlisea aurea
ref|XP_002451653.1|  hypothetical protein SORBIDRAFT_04g005330          232   5e-68    Sorghum bicolor [broomcorn]
gb|AGT16346.1|  glossy1 protein                                         231   6e-68    Saccharum hybrid cultivar R570
ref|XP_008643558.1|  PREDICTED: uncharacterized protein LOC100280...    233   1e-67    
gb|EEE56435.1|  hypothetical protein OsJ_05611                          229   1e-67    Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ85039.1|  predicted protein                                      231   1e-67    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ87617.1|  predicted protein                                      230   1e-67    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001046080.1|  Os02g0178800                                       229   7e-67    
gb|EEC72610.1|  hypothetical protein OsI_06088                          229   7e-67    Oryza sativa Indica Group [Indian rice]
gb|AFW87578.1|  hypothetical protein ZEAMMB73_499314                    224   9e-67    
gb|EMT05456.1|  Protein WAX2                                            227   9e-67    
ref|XP_008658046.1|  PREDICTED: uncharacterized protein LOC100192...    225   2e-65    
ref|NP_001266321.1|  gl1 protein                                        224   4e-65    
ref|XP_004965700.1|  PREDICTED: protein ECERIFERUM 3-like               223   8e-65    Setaria italica
gb|EMT23422.1|  Protein WAX2                                            224   8e-65    
dbj|BAJ85064.1|  predicted protein                                      223   2e-64    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002437383.1|  hypothetical protein SORBIDRAFT_10g025920          218   5e-63    Sorghum bicolor [broomcorn]
ref|NP_001058237.1|  Os06g0653000                                       216   3e-62    
ref|XP_003563334.1|  PREDICTED: protein ECERIFERUM 3-like               215   9e-62    Brachypodium distachyon [annual false brome]
gb|AAR90847.1|  glossy1 protein                                         214   1e-61    Zea mays [maize]
gb|EAZ01917.1|  hypothetical protein OsI_23945                          214   2e-61    Oryza sativa Indica Group [Indian rice]
tpg|DAA61563.1|  TPA: glossy1                                           214   3e-61    
ref|NP_001105247.1|  glossy1                                            214   3e-61    Zea mays [maize]
ref|XP_006646964.1|  PREDICTED: protein ECERIFERUM 3-like               214   3e-61    
gb|ACN25689.1|  unknown                                                 211   3e-60    Zea mays [maize]
ref|XP_002975687.1|  hypothetical protein SELMODRAFT_103982             207   6e-59    Selaginella moellendorffii
ref|XP_002960347.1|  hypothetical protein SELMODRAFT_437448             204   1e-57    Selaginella moellendorffii
ref|XP_002967368.1|  hypothetical protein SELMODRAFT_408343             203   3e-57    Selaginella moellendorffii
gb|KJB83325.1|  hypothetical protein B456_013G242200                    200   5e-57    Gossypium raimondii
ref|XP_001782380.1|  predicted protein                                  200   4e-56    
ref|XP_006657201.1|  PREDICTED: protein ECERIFERUM 3-like               195   2e-54    
ref|XP_002961424.1|  hypothetical protein SELMODRAFT_164680             192   4e-53    Selaginella moellendorffii
ref|XP_002990278.1|  hypothetical protein SELMODRAFT_185167             191   7e-53    Selaginella moellendorffii
gb|EMS67420.1|  Protein WAX2                                            191   1e-52    Triticum urartu
tpg|DAA61565.1|  TPA: glossy1                                           178   8e-51    
ref|XP_001783415.1|  predicted protein                                  185   1e-50    
gb|AAB87597.1|  gl1                                                     179   1e-50    Zea mays [maize]
ref|XP_001420263.1|  predicted protein                                  182   1e-49    Ostreococcus lucimarinus CCE9901
ref|XP_001781794.1|  predicted protein                                  181   4e-49    
emb|CEF99557.1|  Uncharacterised domain Wax2, C-terminal                179   1e-48    Ostreococcus tauri
ref|XP_003081883.1|  faceless pollen-1 (ISS)                            179   2e-48    
ref|XP_002509294.1|  predicted protein                                  177   5e-48    Micromonas commoda
gb|EMS58990.1|  Protein WAX2                                            176   1e-47    Triticum urartu
ref|XP_002989550.1|  hypothetical protein SELMODRAFT_129942             174   1e-46    
gb|EMS51792.1|  Protein WAX2                                            171   1e-46    Triticum urartu
dbj|BAJ85405.1|  predicted protein                                      170   2e-46    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010920377.1|  PREDICTED: protein ECERIFERUM 1-like               171   3e-46    
ref|XP_002964260.1|  hypothetical protein SELMODRAFT_230422             169   6e-45    
gb|EMT33049.1|  Protein WAX2                                            168   1e-44    
dbj|BAK04216.1|  predicted protein                                      167   2e-44    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003575378.1|  PREDICTED: protein ECERIFERUM 1-like               167   2e-44    Brachypodium distachyon [annual false brome]
ref|XP_006647531.1|  PREDICTED: protein ECERIFERUM 1-like               167   4e-44    Oryza brachyantha
ref|XP_001756318.1|  predicted protein                                  166   4e-44    
ref|XP_010936012.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    166   7e-44    Elaeis guineensis
ref|XP_004976194.1|  PREDICTED: protein ECERIFERUM 1-like               166   7e-44    Setaria italica
gb|EMT06855.1|  Protein WAX2                                            165   1e-43    
gb|EEC73617.1|  hypothetical protein OsI_08114                          165   1e-43    Oryza sativa Indica Group [Indian rice]
ref|NP_001047459.1|  Os02g0621300                                       165   2e-43    
gb|EEE57393.1|  hypothetical protein OsJ_07566                          165   2e-43    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010920316.1|  PREDICTED: protein ECERIFERUM 1-like               165   2e-43    Elaeis guineensis
gb|ACA14353.1|  TCER1                                                   165   2e-43    Triticum aestivum [Canadian hard winter wheat]
ref|XP_002448160.1|  hypothetical protein SORBIDRAFT_06g022320          164   2e-43    Sorghum bicolor [broomcorn]
ref|XP_003580122.1|  PREDICTED: protein ECERIFERUM 1-like               164   2e-43    Brachypodium distachyon [annual false brome]
dbj|BAK01778.1|  predicted protein                                      162   2e-43    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006857470.1|  hypothetical protein AMTR_s00067p00188650          164   3e-43    Amborella trichopoda
gb|EMS48098.1|  Protein WAX2                                            162   2e-42    Triticum urartu
gb|EMS48099.1|  Protein WAX2                                            162   2e-42    Triticum urartu
ref|XP_009410811.1|  PREDICTED: protein ECERIFERUM 1-like               162   2e-42    
ref|XP_003574039.1|  PREDICTED: protein ECERIFERUM 1-like               161   3e-42    
ref|XP_010255640.1|  PREDICTED: protein ECERIFERUM 1-like               161   3e-42    Nelumbo nucifera [Indian lotus]
ref|XP_010052747.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    159   2e-41    Eucalyptus grandis [rose gum]
ref|XP_010052746.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    159   2e-41    Eucalyptus grandis [rose gum]
ref|XP_009384064.1|  PREDICTED: protein ECERIFERUM 1-like               159   2e-41    Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP09363.1|  unnamed protein product                                159   3e-41    Coffea canephora [robusta coffee]
gb|EMT07276.1|  Protein WAX2                                            158   5e-41    
ref|XP_008796440.1|  PREDICTED: uncharacterized protein LOC103711898    161   6e-41    
ref|XP_006661851.1|  PREDICTED: protein ECERIFERUM 1-like               157   1e-40    
ref|XP_003625024.1|  Protein WAX2                                       157   1e-40    
ref|XP_004954341.1|  PREDICTED: protein ECERIFERUM 1-like               157   1e-40    Setaria italica
ref|XP_010054532.1|  PREDICTED: protein ECERIFERUM 1-like               156   1e-40    Eucalyptus grandis [rose gum]
ref|XP_007509665.1|  predicted protein                                  156   3e-40    Bathycoccus prasinos
ref|XP_002454767.1|  hypothetical protein SORBIDRAFT_04g036940          155   5e-40    
gb|EMS58051.1|  Protein WAX2                                            154   8e-40    Triticum urartu
gb|EAY87991.1|  hypothetical protein OsI_09413                          154   8e-40    Oryza sativa Indica Group [Indian rice]
ref|NP_001048490.1|  Os02g0814200                                       154   9e-40    
emb|CAE03390.2|  OSJNBa0004N05.14                                       154   1e-39    Oryza sativa Japonica Group [Japonica rice]
dbj|BAK00236.1|  predicted protein                                      154   1e-39    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002973631.1|  hypothetical protein SELMODRAFT_99824              147   1e-39    
ref|XP_010691968.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    154   1e-39    Beta vulgaris subsp. vulgaris [field beet]
gb|EMT04955.1|  Protein WAX2                                            153   1e-39    
gb|ABD28319.2|  Sterol desaturase                                       153   2e-39    Medicago truncatula
ref|XP_002464501.1|  hypothetical protein SORBIDRAFT_01g019590          153   2e-39    Sorghum bicolor [broomcorn]
gb|ACN31737.1|  unknown                                                 153   2e-39    Zea mays [maize]
gb|ACR38546.1|  unknown                                                 153   2e-39    Zea mays [maize]
ref|XP_002454185.1|  hypothetical protein SORBIDRAFT_04g026320          153   2e-39    Sorghum bicolor [broomcorn]
ref|XP_004982905.1|  PREDICTED: protein ECERIFERUM 1-like               153   3e-39    Setaria italica
ref|XP_004953128.1|  PREDICTED: protein ECERIFERUM 1-like               153   3e-39    Setaria italica
ref|XP_002262647.1|  PREDICTED: protein ECERIFERUM 1                    152   3e-39    
gb|AFW68611.1|  hypothetical protein ZEAMMB73_227989                    150   3e-39    
gb|KDP34470.1|  hypothetical protein JCGZ_12753                         147   3e-39    Jatropha curcas
ref|XP_003625020.1|  Protein WAX2                                       152   3e-39    
ref|XP_010936011.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    152   6e-39    Elaeis guineensis
gb|EYU40309.1|  hypothetical protein MIMGU_mgv1a003047mg                152   7e-39    Erythranthe guttata [common monkey flower]
emb|CAN60676.1|  hypothetical protein VITISV_029045                     151   7e-39    Vitis vinifera
ref|XP_002262785.1|  PREDICTED: protein ECERIFERUM 1                    151   1e-38    Vitis vinifera
gb|EMS58604.1|  Protein WAX2                                            151   1e-38    Triticum urartu
ref|XP_009337262.1|  PREDICTED: protein ECERIFERUM 1-like               151   1e-38    Pyrus x bretschneideri [bai li]
gb|AES88391.2|  fatty acid hydroxylase superfamily protein              151   1e-38    Medicago truncatula
ref|XP_010054531.1|  PREDICTED: protein ECERIFERUM 1-like               151   1e-38    Eucalyptus grandis [rose gum]
gb|EEC67150.1|  hypothetical protein OsI_33995                          151   1e-38    Oryza sativa Indica Group [Indian rice]
gb|ACG35856.1|  CER1                                                    151   1e-38    Zea mays [maize]
ref|NP_001146661.1|  uncharacterized protein LOC100280261               150   2e-38    Zea mays [maize]
ref|XP_003625022.1|  Protein WAX2                                       150   2e-38    Medicago truncatula
gb|AAD29719.1|AF143746_1  CER1                                          150   2e-38    Oryza sativa Indica Group [Indian rice]
ref|XP_002265685.2|  PREDICTED: protein ECERIFERUM 1-like               150   2e-38    Vitis vinifera
ref|XP_008676840.1|  PREDICTED: uncharacterized protein LOC100273...    150   3e-38    Zea mays [maize]
ref|XP_008676841.1|  PREDICTED: uncharacterized protein LOC100273...    150   3e-38    Zea mays [maize]
ref|XP_008375723.1|  PREDICTED: protein ECERIFERUM 1-like               150   3e-38    
gb|KHG15491.1|  Protein WAX2 -like protein                              150   3e-38    Gossypium arboreum [tree cotton]
ref|XP_008361247.1|  PREDICTED: protein ECERIFERUM 1-like               150   3e-38    
gb|ACG47659.1|  CER1                                                    150   3e-38    Zea mays [maize]
ref|XP_008364777.1|  PREDICTED: protein ECERIFERUM 1-like               150   3e-38    
ref|XP_002263787.2|  PREDICTED: protein ECERIFERUM 1-like               149   4e-38    Vitis vinifera
emb|CBI16761.3|  unnamed protein product                                149   4e-38    Vitis vinifera
gb|EMS68717.1|  Protein WAX2                                            149   5e-38    Triticum urartu
ref|XP_010041339.1|  PREDICTED: protein ECERIFERUM 1-like               146   5e-38    
ref|XP_003574037.1|  PREDICTED: protein ECERIFERUM 1-like               149   6e-38    Brachypodium distachyon [annual false brome]
ref|XP_008232283.1|  PREDICTED: protein ECERIFERUM 1-like               149   6e-38    Prunus mume [ume]
gb|KDP28917.1|  hypothetical protein JCGZ_14688                         149   6e-38    Jatropha curcas
gb|KJB67450.1|  hypothetical protein B456_010G191300                    149   7e-38    Gossypium raimondii
gb|KJB67445.1|  hypothetical protein B456_010G191100                    149   7e-38    Gossypium raimondii
ref|XP_007041184.1|  Fatty acid hydroxylase superfamily                 152   8e-38    
ref|XP_007015842.1|  CER1 protein isoform 1                             149   8e-38    
ref|XP_006354620.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    149   9e-38    Solanum tuberosum [potatoes]
ref|XP_009797701.1|  PREDICTED: protein ECERIFERUM 1-like               149   9e-38    Nicotiana sylvestris
gb|ABF51011.1|  putative aldehyde decarbonylase enzyme CER1;1           149   9e-38    Hordeum vulgare [barley]
ref|XP_006354619.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    149   1e-37    
ref|XP_010054526.1|  PREDICTED: protein ECERIFERUM 1-like               148   1e-37    
ref|XP_010276564.1|  PREDICTED: protein ECERIFERUM 1-like               148   1e-37    Nelumbo nucifera [Indian lotus]
gb|KCW44429.1|  hypothetical protein EUGRSUZ_L02074                     146   1e-37    Eucalyptus grandis [rose gum]
gb|KHN40121.1|  Protein WAX2                                            148   1e-37    Glycine soja [wild soybean]
ref|XP_003061467.1|  predicted protein                                  148   1e-37    Micromonas pusilla CCMP1545
ref|XP_010255639.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    148   1e-37    
gb|ABG47420.1|  putative CER1                                           148   1e-37    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ85488.1|  predicted protein                                      148   2e-37    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003570374.1|  PREDICTED: protein ECERIFERUM 1-like               148   2e-37    Brachypodium distachyon [annual false brome]
emb|CAN81825.1|  hypothetical protein VITISV_014168                     151   2e-37    Vitis vinifera
ref|XP_007041188.1|  Fatty acid hydroxylase superfamily isoform 4       147   2e-37    
ref|XP_002265189.2|  PREDICTED: protein ECERIFERUM 1                    147   2e-37    
gb|KJB09060.1|  hypothetical protein B456_001G122000                    148   2e-37    
ref|XP_004493412.1|  PREDICTED: protein ECERIFERUM 1-like               147   2e-37    
ref|XP_007041189.1|  Fatty acid hydroxylase superfamily isoform 5       147   2e-37    
ref|XP_010255638.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    148   3e-37    
ref|XP_003633900.1|  PREDICTED: protein ECERIFERUM 1-like               147   3e-37    
ref|XP_003606194.1|  Protein WAX2                                       147   3e-37    
ref|XP_009339872.1|  PREDICTED: protein ECERIFERUM 1-like               145   3e-37    
ref|XP_007041187.1|  Fatty acid hydroxylase superfamily isoform 3       147   3e-37    
gb|KJB76288.1|  hypothetical protein B456_012G081500                    146   3e-37    
ref|XP_009376851.1|  PREDICTED: protein ECERIFERUM 1-like               147   3e-37    
gb|KHG12604.1|  Protein WAX2 -like protein                              147   4e-37    
ref|XP_007041185.1|  Fatty acid hydroxylase superfamily isoform 1       147   4e-37    
gb|EMT15793.1|  Protein WAX2                                            146   4e-37    
ref|XP_007041186.1|  Fatty acid hydroxylase superfamily isoform 2       147   4e-37    
gb|EYU40308.1|  hypothetical protein MIMGU_mgv1a002952mg                146   6e-37    
ref|XP_009586962.1|  PREDICTED: protein ECERIFERUM 1-like               146   6e-37    
gb|KJB67449.1|  hypothetical protein B456_010G191200                    146   6e-37    
ref|XP_009337264.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    146   7e-37    
ref|XP_009337263.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    146   8e-37    
gb|KJB76287.1|  hypothetical protein B456_012G081500                    146   8e-37    
ref|XP_009787251.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    146   8e-37    
ref|XP_009787252.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    145   8e-37    
gb|KJB76286.1|  hypothetical protein B456_012G081500                    146   8e-37    
ref|XP_010520222.1|  PREDICTED: protein ECERIFERUM 1-like               145   1e-36    
ref|XP_009612939.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    145   2e-36    
ref|XP_008338420.1|  PREDICTED: protein ECERIFERUM 1-like               144   3e-36    
gb|AAB87722.1|  glossy1 homolog                                         144   3e-36    
ref|XP_008232262.1|  PREDICTED: protein ECERIFERUM 1-like               144   3e-36    
gb|EYU42308.1|  hypothetical protein MIMGU_mgv1a002931mg                144   3e-36    
ref|XP_007218863.1|  hypothetical protein PRUPE_ppa002893mg             144   4e-36    
ref|XP_009625188.1|  PREDICTED: protein ECERIFERUM 1-like               144   4e-36    
gb|KHG03871.1|  Protein WAX2 -like protein                              144   4e-36    
gb|ACJ85705.1|  unknown                                                 142   5e-36    
gb|KJB76254.1|  hypothetical protein B456_012G081600                    143   5e-36    
ref|XP_006480707.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    143   5e-36    
ref|XP_009600723.1|  PREDICTED: protein ECERIFERUM 1-like               144   6e-36    
ref|XP_002526512.1|  sterol desaturase, putative                        144   6e-36    
emb|CBI16760.3|  unnamed protein product                                147   6e-36    
ref|XP_004307280.1|  PREDICTED: protein ECERIFERUM 1-like               143   7e-36    
gb|KJB76252.1|  hypothetical protein B456_012G081600                    143   7e-36    
ref|XP_006428971.1|  hypothetical protein CICLE_v10011291mg             143   7e-36    
ref|XP_008356893.1|  PREDICTED: protein ECERIFERUM 1-like               141   8e-36    
ref|XP_006361513.1|  PREDICTED: protein ECERIFERUM 1-like               143   8e-36    
gb|EPS65064.1|  hypothetical protein M569_09713                         143   9e-36    
ref|XP_008344085.1|  PREDICTED: protein ECERIFERUM 1-like               143   9e-36    
ref|XP_006357723.1|  PREDICTED: protein ECERIFERUM 1-like               143   9e-36    
gb|KJB76251.1|  hypothetical protein B456_012G081600                    142   1e-35    
emb|CDP09364.1|  unnamed protein product                                143   1e-35    
ref|XP_004234847.1|  PREDICTED: protein ECERIFERUM 1-like               143   1e-35    
ref|XP_002526511.1|  sterol desaturase, putative                        142   1e-35    
gb|KJB76257.1|  hypothetical protein B456_012G081600                    143   1e-35    
gb|KJB76256.1|  hypothetical protein B456_012G081600                    142   1e-35    
ref|XP_007134355.1|  hypothetical protein PHAVU_010G040600g             142   1e-35    
ref|XP_004510150.1|  PREDICTED: protein ECERIFERUM 1-like               142   1e-35    
ref|XP_009777506.1|  PREDICTED: protein ECERIFERUM 1-like               141   2e-35    
ref|XP_004170720.1|  PREDICTED: protein ECERIFERUM 1-like               141   2e-35    
ref|XP_010052726.1|  PREDICTED: protein ECERIFERUM 1-like               142   3e-35    
ref|XP_010247895.1|  PREDICTED: protein ECERIFERUM 1-like               141   3e-35    
ref|XP_009586975.1|  PREDICTED: protein ECERIFERUM 1-like               141   4e-35    
ref|XP_010255641.1|  PREDICTED: protein ECERIFERUM 1-like               141   4e-35    
ref|XP_007008729.1|  Fatty acid hydroxylase superfamily isoform 1       141   4e-35    
ref|XP_007015845.1|  CER1 protein                                       141   5e-35    
gb|KEH17984.1|  fatty acid hydroxylase superfamily protein              141   5e-35    
gb|AAC24373.1|  CER1-like protein                                       141   5e-35    
ref|XP_007008730.1|  Fatty acid hydroxylase superfamily isoform 2       140   5e-35    
ref|XP_008438253.1|  PREDICTED: protein ECERIFERUM 1-like               141   5e-35    
ref|NP_171721.3|  protein CER1-like 1                                   141   6e-35    
gb|KDO85386.1|  hypothetical protein CISIN_1g006590mg                   140   6e-35    
gb|KFK42593.1|  hypothetical protein AALP_AA1G015500                    140   6e-35    
gb|KDO85384.1|  hypothetical protein CISIN_1g006590mg                   140   7e-35    
ref|NP_973742.1|  protein CER1-like 1                                   140   7e-35    
ref|XP_004133955.1|  PREDICTED: protein ECERIFERUM 1-like               140   7e-35    
ref|XP_010276559.1|  PREDICTED: protein ECERIFERUM 1-like               140   9e-35    
ref|XP_006445498.1|  hypothetical protein CICLE_v10019265mg             139   9e-35    
ref|XP_006857475.1|  hypothetical protein AMTR_s00067p00190600          140   1e-34    
ref|XP_004307281.1|  PREDICTED: protein ECERIFERUM 1-like               140   1e-34    
ref|XP_007220536.1|  hypothetical protein PRUPE_ppa002824mg             140   1e-34    
gb|EYU40310.1|  hypothetical protein MIMGU_mgv1a003047mg                140   1e-34    
ref|NP_001064826.1|  Os10g0471100                                       140   1e-34    
ref|XP_006464363.1|  PREDICTED: protein ECERIFERUM 1-like isoform X3    139   1e-34    
ref|XP_006354678.1|  PREDICTED: protein ECERIFERUM 1-like               140   1e-34    
ref|XP_010691966.1|  PREDICTED: protein ECERIFERUM 1-like               139   1e-34    
ref|XP_008438263.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    139   2e-34    
gb|KDO85383.1|  hypothetical protein CISIN_1g006590mg                   139   2e-34    
gb|KDO85387.1|  hypothetical protein CISIN_1g006590mg                   140   2e-34    
ref|XP_008438262.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    139   2e-34    
gb|KDO85382.1|  hypothetical protein CISIN_1g006590mg                   139   2e-34    
ref|XP_009376850.1|  PREDICTED: protein ECERIFERUM 1-like               139   2e-34    
ref|XP_006464362.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    139   2e-34    
ref|XP_008232261.1|  PREDICTED: protein ECERIFERUM 1-like               139   2e-34    
ref|XP_006464361.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    139   2e-34    
ref|XP_006445500.1|  hypothetical protein CICLE_v10019279mg             139   2e-34    
ref|XP_008245904.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    139   3e-34    
ref|XP_006445499.1|  hypothetical protein CICLE_v10019265mg             139   3e-34    
gb|KHN40120.1|  Protein WAX2                                            139   3e-34    
ref|XP_010479268.1|  PREDICTED: protein CER1-like 1                     139   3e-34    
ref|XP_009760059.1|  PREDICTED: protein ECERIFERUM 1-like isoform X3    139   3e-34    
gb|EPS71900.1|  hypothetical protein M569_02856                         139   3e-34    
emb|CAA65200.1|  CER1-like                                              139   3e-34    
ref|XP_009760058.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    139   3e-34    
ref|XP_008245903.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    139   4e-34    
ref|XP_007220541.1|  hypothetical protein PRUPE_ppa002903mg             139   4e-34    
ref|XP_009760057.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    139   4e-34    
gb|KGN56664.1|  hypothetical protein Csa_3G127750                       139   4e-34    
ref|XP_010324966.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    138   4e-34    
ref|XP_007218858.1|  hypothetical protein PRUPE_ppa002770mg             139   4e-34    
ref|XP_004229695.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    138   4e-34    
ref|XP_006354616.1|  PREDICTED: protein ECERIFERUM 1-like               138   4e-34    
ref|XP_003521032.2|  PREDICTED: protein ECERIFERUM 1-like               139   5e-34    
ref|XP_003529007.1|  PREDICTED: protein ECERIFERUM 1-like               138   5e-34    
ref|XP_008232308.1|  PREDICTED: protein ECERIFERUM 1-like               138   5e-34    
ref|XP_006306997.1|  hypothetical protein CARUB_v10008574mg             138   5e-34    
gb|AFW64028.1|  hypothetical protein ZEAMMB73_844277                    138   6e-34    
ref|XP_011466122.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    138   6e-34    
ref|XP_011466125.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    137   6e-34    
ref|XP_004168237.1|  PREDICTED: protein ECERIFERUM 1-like               137   7e-34    
ref|XP_010517047.1|  PREDICTED: protein CER1-like 2 isoform X2          137   7e-34    
ref|XP_004145021.1|  PREDICTED: protein ECERIFERUM 1-like               137   8e-34    
ref|XP_010517046.1|  PREDICTED: protein CER1-like 2 isoform X1          137   8e-34    
ref|XP_004134362.1|  PREDICTED: protein ECERIFERUM 1-like               137   9e-34    
ref|XP_010097746.1|  Protein WAX2                                       137   1e-33    
ref|XP_006418509.1|  hypothetical protein EUTSA_v10009534mg             137   1e-33    
ref|XP_009614034.1|  PREDICTED: protein ECERIFERUM 1-like               137   1e-33    
ref|XP_006354618.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    137   1e-33    
gb|EYU42307.1|  hypothetical protein MIMGU_mgv1a003396mg                137   1e-33    
ref|XP_007134354.1|  hypothetical protein PHAVU_010G040500g             137   1e-33    
gb|KGN56666.1|  hypothetical protein Csa_3G127770                       137   1e-33    
ref|XP_006652506.1|  PREDICTED: protein ECERIFERUM 1-like               136   1e-33    
ref|XP_006365794.1|  PREDICTED: protein ECERIFERUM 1-like               137   1e-33    
gb|KHN30013.1|  Protein WAX2                                            137   1e-33    
ref|XP_010496697.1|  PREDICTED: protein CER1-like 1                     137   2e-33    
ref|XP_006354617.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    137   2e-33    
ref|XP_010539481.1|  PREDICTED: protein CER1-like 2                     137   2e-33    
ref|XP_006418508.1|  hypothetical protein EUTSA_v10007056mg             136   2e-33    
ref|XP_010052731.1|  PREDICTED: protein ECERIFERUM 1-like               136   2e-33    
gb|AAC24374.1|  CER1 protein                                            136   2e-33    
dbj|BAA11024.1|  possible aldehyde decarbonylase                        135   2e-33    
emb|CDX79754.1|  BnaC03g20900D                                          136   3e-33    
ref|XP_009141690.1|  PREDICTED: protein CER1-like 2 isoform X3          135   3e-33    
ref|XP_004308720.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    136   3e-33    
ref|NP_001184890.1|  protein ECERIFERUM 1                               136   3e-33    
ref|XP_009141683.1|  PREDICTED: protein CER1-like 2                     136   3e-33    
ref|XP_011469549.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    136   3e-33    
ref|NP_171723.2|  protein ECERIFERUM 1                                  136   3e-33    
ref|XP_010505369.1|  PREDICTED: protein CER1-like 2                     136   3e-33    
ref|XP_008460068.1|  PREDICTED: protein ECERIFERUM 1-like               135   4e-33    
emb|CDY55893.1|  BnaA04g29140D                                          135   4e-33    
ref|XP_009141689.1|  PREDICTED: protein CER1-like 2 isoform X2          135   4e-33    
ref|XP_009141688.1|  PREDICTED: protein CER1-like 2 isoform X1          135   4e-33    
gb|KFK36660.1|  hypothetical protein AALP_AA4G153400                    135   4e-33    
ref|XP_003626834.1|  gl1-like protein                                   135   5e-33    
gb|EPS60467.1|  hypothetical protein M569_14337                         135   5e-33    
gb|AHD24918.1|  CER1                                                    135   5e-33    
ref|XP_004510149.1|  PREDICTED: protein ECERIFERUM 1-like isoform X3    134   5e-33    
emb|CDY55894.1|  BnaA04g29150D                                          135   6e-33    
ref|XP_008438252.1|  PREDICTED: protein ECERIFERUM 1-like               135   8e-33    
ref|XP_009118866.1|  PREDICTED: protein ECERIFERUM 1                    135   8e-33    
emb|CAN62442.1|  hypothetical protein VITISV_009194                     134   8e-33    
emb|CAA65199.1|  CER1-like                                              134   1e-32    
ref|NP_001118464.1|  protein CER1-like 2                                134   1e-32    
ref|XP_010509285.1|  PREDICTED: protein CER1-like 2                     134   1e-32    
ref|XP_011085147.1|  PREDICTED: protein ECERIFERUM 1-like               134   1e-32    
ref|XP_009779400.1|  PREDICTED: protein ECERIFERUM 1-like               136   1e-32    
ref|XP_006295717.1|  hypothetical protein CARUB_v10024836mg             134   1e-32    
ref|XP_006583526.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    133   1e-32    
gb|EMT04858.1|  Protein WAX2                                            134   1e-32    
gb|AAB87721.1|  maize gl1 homolog                                       134   1e-32    
ref|XP_009793428.1|  PREDICTED: protein ECERIFERUM 1-like               134   2e-32    
ref|XP_009133199.1|  PREDICTED: protein CER1-like 2                     134   2e-32    
ref|NP_181306.3|  protein CER1-like 2                                   134   2e-32    
ref|XP_010511349.1|  PREDICTED: protein CER1-like 1                     134   2e-32    
ref|XP_002892018.1|  hypothetical protein ARALYDRAFT_887207             132   2e-32    
emb|CDY38059.1|  BnaCnng09200D                                          135   2e-32    
gb|KFK42594.1|  hypothetical protein AALP_AA1G015600                    134   2e-32    
gb|ABC87808.1|  TCER1                                                   130   2e-32    
ref|XP_010480305.1|  PREDICTED: protein CER1-like 1 isoform X1          133   3e-32    
ref|XP_004510147.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    133   3e-32    
ref|XP_010480306.1|  PREDICTED: protein CER1-like 1 isoform X2          133   3e-32    
ref|XP_011093466.1|  PREDICTED: protein ECERIFERUM 1-like               133   3e-32    
ref|XP_010414811.1|  PREDICTED: protein CER1-like 1 isoform X2          133   3e-32    
ref|XP_003530144.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    133   3e-32    
ref|XP_007041196.1|  CER1 protein                                       133   4e-32    
ref|XP_010414810.1|  PREDICTED: protein CER1-like 1 isoform X1          133   4e-32    
ref|XP_004229696.2|  PREDICTED: protein ECERIFERUM 1-like               134   8e-32    
ref|XP_009614891.1|  PREDICTED: LOW QUALITY PROTEIN: protein ECER...    129   9e-32    
ref|XP_007041192.1|  CER1 protein                                       131   1e-31    
gb|KCW76761.1|  hypothetical protein EUGRSUZ_D01120                     131   1e-31    
ref|XP_003606182.1|  Protein WAX2                                       131   1e-31    
gb|AES88379.2|  fatty acid hydroxylase superfamily protein              131   1e-31    
ref|XP_011093465.1|  PREDICTED: protein ECERIFERUM 1-like               131   2e-31    
gb|AIE57503.1|  CER1                                                    131   2e-31    
emb|CBI16764.3|  unnamed protein product                                126   2e-31    
gb|EMS47164.1|  Protein WAX2                                            132   2e-31    
ref|XP_004252845.1|  PREDICTED: protein ECERIFERUM 1                    130   3e-31    
emb|CDX93353.1|  BnaC04g45430D                                          130   3e-31    
ref|XP_006410962.1|  hypothetical protein EUTSA_v10016375mg             130   4e-31    
gb|EMT22938.1|  hypothetical protein F775_42817                         126   4e-31    
ref|XP_010493027.1|  PREDICTED: protein CER1-like 1                     130   5e-31    
ref|XP_006375521.1|  hypothetical protein POPTR_0014s15050g             129   6e-31    
ref|XP_006375524.1|  hypothetical protein POPTR_0014s15080g             129   8e-31    
emb|CBI16759.3|  unnamed protein product                                125   8e-31    
ref|XP_010496713.1|  PREDICTED: protein ECERIFERUM 1 isoform X1         129   1e-30    
ref|XP_011005107.1|  PREDICTED: protein ECERIFERUM 1-like               129   1e-30    
ref|XP_010661477.1|  PREDICTED: protein ECERIFERUM 1-like               127   1e-30    
ref|XP_006306971.1|  hypothetical protein CARUB_v10008547mg             129   1e-30    
ref|XP_011012757.1|  PREDICTED: protein ECERIFERUM 1-like               128   2e-30    
ref|XP_006306552.1|  hypothetical protein CARUB_v10012639mg             128   2e-30    
emb|CDX91381.1|  BnaC04g07690D                                          128   3e-30    
emb|CDX74937.1|  BnaA05g06830D                                          127   3e-30    
ref|XP_009143457.1|  PREDICTED: protein CER1-like 2                     127   4e-30    
emb|CDX93352.1|  BnaC04g45440D                                          127   4e-30    
ref|XP_010496480.1|  PREDICTED: protein ECERIFERUM 1-like               127   5e-30    
ref|XP_010496714.1|  PREDICTED: protein ECERIFERUM 1 isoform X2         127   5e-30    
ref|XP_004253318.1|  PREDICTED: protein CER1-like 2                     127   5e-30    
ref|XP_002881545.1|  hypothetical protein ARALYDRAFT_321478             127   6e-30    
gb|KJB67446.1|  hypothetical protein B456_010G191100                    125   1e-29    
ref|XP_006375527.1|  hypothetical protein POPTR_0014s15110g             126   1e-29    
gb|AAC23640.1|  CER1-like protein                                       126   1e-29    
ref|XP_010097743.1|  Protein WAX2                                       126   2e-29    



>ref|XP_006341693.1| PREDICTED: protein ECERIFERUM 3-like [Solanum tuberosum]
Length=646

 Score =   379 bits (972),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 171/233 (73%), Positives = 206/233 (88%), Gaps = 0/233 (0%)
 Frame = +1

Query  4    WKESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDN  183
            WKES E+IWCLHIL+L  LRGLVHQLWS+YSNML+ NR +RVSQQGID+EQID EW WDN
Sbjct  55   WKESMENIWCLHILILCALRGLVHQLWSTYSNMLYLNRTRRVSQQGIDYEQIDHEWDWDN  114

Query  184  FLILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPL  363
            FLILQAI+ SF Y++FPSLAN+P W+ +G++ CL+LH+G SEPL+Y MHRLLHSS L+PL
Sbjct  115  FLILQAIVGSFVYLNFPSLANIPLWDVRGLISCLILHIGISEPLFYWMHRLLHSSHLFPL  174

Query  364  YHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLR  543
            YHW HH+SK+ HPFTAG A FLEHLLLCV+VGIPTLGTAF+G+GSI V+YSYILAFDFLR
Sbjct  175  YHWHHHESKITHPFTAGHATFLEHLLLCVVVGIPTLGTAFIGYGSISVMYSYILAFDFLR  234

Query  544  CLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            CLG+SNVEI+P  L++ +P+L+Y+IY PTY+ LHH + +TNFCLFMPLYDMLG
Sbjct  235  CLGHSNVEIIPHSLYQRVPLLRYVIYCPTYHSLHHQEMKTNFCLFMPLYDMLG  287



>ref|XP_009609207.1| PREDICTED: protein ECERIFERUM 3-like isoform X1 [Nicotiana tomentosiformis]
Length=640

 Score =   370 bits (949),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 169/234 (72%), Positives = 203/234 (87%), Gaps = 1/234 (0%)
 Frame = +1

Query  4    WKESWE-DIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWD  180
            WKE+ E DIWCLHIL+L  LRGLVHQLWS+YSNML+  R +RVSQ+GI FEQID EWHWD
Sbjct  48   WKENMEEDIWCLHILILCALRGLVHQLWSTYSNMLYLVRTRRVSQEGIGFEQIDNEWHWD  107

Query  181  NFLILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYP  360
            NFLILQAI+ SFAY++FPSLANLP W+ +G + CL+LH+G SEPLYY +HR+LHS  L+P
Sbjct  108  NFLILQAIVGSFAYLNFPSLANLPVWDVRGFISCLILHIGISEPLYYWIHRILHSPHLFP  167

Query  361  LYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFL  540
            LYHW HH+SK+ HPFTAG+A FLEHLLLCV+VGIPTLGTAF+G+GSI V+YSYILAFDFL
Sbjct  168  LYHWHHHESKITHPFTAGNATFLEHLLLCVVVGIPTLGTAFIGYGSISVMYSYILAFDFL  227

Query  541  RCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            RCLG+SNVEI P   ++ +P+L+Y+IY PTY+ LHH D +TNFCLFMPLYD+LG
Sbjct  228  RCLGHSNVEIFPHSFYQHVPLLRYIIYCPTYHSLHHQDMKTNFCLFMPLYDLLG  281



>ref|XP_009609208.1| PREDICTED: protein ECERIFERUM 3-like isoform X2 [Nicotiana tomentosiformis]
Length=638

 Score =   369 bits (948),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 169/234 (72%), Positives = 203/234 (87%), Gaps = 1/234 (0%)
 Frame = +1

Query  4    WKESWE-DIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWD  180
            WKE+ E DIWCLHIL+L  LRGLVHQLWS+YSNML+  R +RVSQ+GI FEQID EWHWD
Sbjct  48   WKENMEEDIWCLHILILCALRGLVHQLWSTYSNMLYLVRTRRVSQEGIGFEQIDNEWHWD  107

Query  181  NFLILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYP  360
            NFLILQAI+ SFAY++FPSLANLP W+ +G + CL+LH+G SEPLYY +HR+LHS  L+P
Sbjct  108  NFLILQAIVGSFAYLNFPSLANLPVWDVRGFISCLILHIGISEPLYYWIHRILHSPHLFP  167

Query  361  LYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFL  540
            LYHW HH+SK+ HPFTAG+A FLEHLLLCV+VGIPTLGTAF+G+GSI V+YSYILAFDFL
Sbjct  168  LYHWHHHESKITHPFTAGNATFLEHLLLCVVVGIPTLGTAFIGYGSISVMYSYILAFDFL  227

Query  541  RCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            RCLG+SNVEI P   ++ +P+L+Y+IY PTY+ LHH D +TNFCLFMPLYD+LG
Sbjct  228  RCLGHSNVEIFPHSFYQHVPLLRYIIYCPTYHSLHHQDMKTNFCLFMPLYDLLG  281



>ref|XP_010318689.1| PREDICTED: protein ECERIFERUM 3 isoform X3 [Solanum lycopersicum]
Length=607

 Score =   368 bits (945),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 165/233 (71%), Positives = 203/233 (87%), Gaps = 0/233 (0%)
 Frame = +1

Query  4    WKESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDN  183
            WKES EDIWCLHILVL  LRGLVHQLWS++SNML+ N  +RVS +GID++QID EW WDN
Sbjct  52   WKESMEDIWCLHILVLCSLRGLVHQLWSTFSNMLYLNSTRRVSYEGIDYDQIDNEWDWDN  111

Query  184  FLILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPL  363
            FLILQA++ SF Y++FPSLANLP W+ +G++ CL+LH+G SEPL+Y MHRLLHSS L+PL
Sbjct  112  FLILQAVVGSFVYLNFPSLANLPVWDVRGLISCLILHIGISEPLFYWMHRLLHSSYLFPL  171

Query  364  YHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLR  543
            YHW HH+SK+ HPFTAG   FLEHLLLCV++GIPTLGTAF+G+GSI V+YSYILAFDFLR
Sbjct  172  YHWHHHESKITHPFTAGHGTFLEHLLLCVVIGIPTLGTAFIGYGSISVMYSYILAFDFLR  231

Query  544  CLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            C+G+SNVEI+P  L++ +P+L+Y+IY PTY+ LHH + +TNFCLFMPLYDMLG
Sbjct  232  CMGHSNVEIIPHSLYQRVPLLRYVIYCPTYHSLHHQEMKTNFCLFMPLYDMLG  284



>ref|XP_004235875.1| PREDICTED: protein ECERIFERUM 3 isoform X1 [Solanum lycopersicum]
Length=643

 Score =   369 bits (948),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 165/233 (71%), Positives = 203/233 (87%), Gaps = 0/233 (0%)
 Frame = +1

Query  4    WKESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDN  183
            WKES EDIWCLHILVL  LRGLVHQLWS++SNML+ N  +RVS +GID++QID EW WDN
Sbjct  52   WKESMEDIWCLHILVLCSLRGLVHQLWSTFSNMLYLNSTRRVSYEGIDYDQIDNEWDWDN  111

Query  184  FLILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPL  363
            FLILQA++ SF Y++FPSLANLP W+ +G++ CL+LH+G SEPL+Y MHRLLHSS L+PL
Sbjct  112  FLILQAVVGSFVYLNFPSLANLPVWDVRGLISCLILHIGISEPLFYWMHRLLHSSYLFPL  171

Query  364  YHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLR  543
            YHW HH+SK+ HPFTAG   FLEHLLLCV++GIPTLGTAF+G+GSI V+YSYILAFDFLR
Sbjct  172  YHWHHHESKITHPFTAGHGTFLEHLLLCVVIGIPTLGTAFIGYGSISVMYSYILAFDFLR  231

Query  544  CLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            C+G+SNVEI+P  L++ +P+L+Y+IY PTY+ LHH + +TNFCLFMPLYDMLG
Sbjct  232  CMGHSNVEIIPHSLYQRVPLLRYVIYCPTYHSLHHQEMKTNFCLFMPLYDMLG  284



>ref|XP_010318688.1| PREDICTED: protein ECERIFERUM 3 isoform X2 [Solanum lycopersicum]
Length=641

 Score =   369 bits (948),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 165/233 (71%), Positives = 203/233 (87%), Gaps = 0/233 (0%)
 Frame = +1

Query  4    WKESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDN  183
            WKES EDIWCLHILVL  LRGLVHQLWS++SNML+ N  +RVS +GID++QID EW WDN
Sbjct  52   WKESMEDIWCLHILVLCSLRGLVHQLWSTFSNMLYLNSTRRVSYEGIDYDQIDNEWDWDN  111

Query  184  FLILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPL  363
            FLILQA++ SF Y++FPSLANLP W+ +G++ CL+LH+G SEPL+Y MHRLLHSS L+PL
Sbjct  112  FLILQAVVGSFVYLNFPSLANLPVWDVRGLISCLILHIGISEPLFYWMHRLLHSSYLFPL  171

Query  364  YHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLR  543
            YHW HH+SK+ HPFTAG   FLEHLLLCV++GIPTLGTAF+G+GSI V+YSYILAFDFLR
Sbjct  172  YHWHHHESKITHPFTAGHGTFLEHLLLCVVIGIPTLGTAFIGYGSISVMYSYILAFDFLR  231

Query  544  CLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            C+G+SNVEI+P  L++ +P+L+Y+IY PTY+ LHH + +TNFCLFMPLYDMLG
Sbjct  232  CMGHSNVEIIPHSLYQRVPLLRYVIYCPTYHSLHHQEMKTNFCLFMPLYDMLG  284



>ref|XP_009788358.1| PREDICTED: protein ECERIFERUM 3-like [Nicotiana sylvestris]
Length=638

 Score =   365 bits (937),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 170/234 (73%), Positives = 199/234 (85%), Gaps = 1/234 (0%)
 Frame = +1

Query  4    WKESWED-IWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWD  180
            WKE+ ED IWCLHIL+L  LRGLVHQLW +YSNML   R +RVSQ+GI FEQID EWHWD
Sbjct  48   WKENIEDDIWCLHILILCALRGLVHQLWCTYSNMLCLVRTRRVSQEGIGFEQIDNEWHWD  107

Query  181  NFLILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYP  360
            NFLILQAI+ SF Y++FPSLANLP W+ +G + CL+LH+G SEPLYY MHRLLHS  L+P
Sbjct  108  NFLILQAIVGSFVYLNFPSLANLPLWDVRGFISCLILHIGISEPLYYWMHRLLHSPHLFP  167

Query  361  LYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFL  540
            LYHW HH+SK+ HPFTAG A FLEHLLLCVIVGIPTLGTAF+G+GSI V+YSYILAFDFL
Sbjct  168  LYHWQHHESKITHPFTAGHATFLEHLLLCVIVGIPTLGTAFIGYGSISVMYSYILAFDFL  227

Query  541  RCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            RCLG+SNVEI P   ++ +P+L+Y+IY PTY+ LHH D +TNFCLFMPLYD+LG
Sbjct  228  RCLGHSNVEIFPHSFYQHVPLLRYIIYCPTYHSLHHQDMKTNFCLFMPLYDLLG  281



>ref|XP_011073243.1| PREDICTED: protein ECERIFERUM 3-like isoform X3 [Sesamum indicum]
Length=547

 Score =   342 bits (877),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 158/227 (70%), Positives = 189/227 (83%), Gaps = 0/227 (0%)
 Frame = +1

Query  19   EDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQ  198
            +D WCLHIL+L GLR LVHQLWS+YSNMLF NRA R+++QG++F QID EWHWDNFLIL+
Sbjct  61   DDTWCLHILILFGLRALVHQLWSTYSNMLFLNRAHRINEQGVEFSQIDAEWHWDNFLILE  120

Query  199  AILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLH  378
            AILA    +SFP LANLP W+ +GV+ CL+LH+G SEPLYY MHRLLH   L+  YHWLH
Sbjct  121  AILAYLLCLSFPLLANLPIWDLRGVLICLILHIGISEPLYYWMHRLLHFPSLFRKYHWLH  180

Query  379  HDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYS  558
            H SKV  PFTAG A+FLE LLLCV++GIPTLGTAF+GHGS+ +IY Y+L FDFL CLG+S
Sbjct  181  HSSKVISPFTAGHASFLERLLLCVVIGIPTLGTAFIGHGSVGLIYCYLLVFDFLLCLGHS  240

Query  559  NVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDML  699
            NVE++P  LF+ IP+LKYLIY+PTY+ LHHMD  TNFCLFMP+YD L
Sbjct  241  NVEVLPGSLFQAIPLLKYLIYTPTYHSLHHMDMGTNFCLFMPVYDKL  287



>ref|XP_011082697.1| PREDICTED: protein ECERIFERUM 3-like [Sesamum indicum]
Length=635

 Score =   342 bits (877),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 158/230 (69%), Positives = 188/230 (82%), Gaps = 0/230 (0%)
 Frame = +1

Query  10   ESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFL  189
            E   D WCLHIL+L+GLR LVHQLWSS+S MLF NR +R++QQG++F+QID EWHWDNFL
Sbjct  52   EVKNDDWCLHILMLSGLRALVHQLWSSFSCMLFVNRTRRINQQGVEFDQIDAEWHWDNFL  111

Query  190  ILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYH  369
            ILQ   ASF Y+SFP+LANLP W+ +GV+ CL+LHMG SEPLYY +HRLLHSS L+  YH
Sbjct  112  ILQTFAASFLYLSFPALANLPIWDIRGVICCLMLHMGISEPLYYWLHRLLHSSSLFEQYH  171

Query  370  WLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCL  549
            WLHH SKV HP+TA  A FLEH+LLC +VGIPTLGT F+G+GSII++Y Y L FDFL+CL
Sbjct  172  WLHHSSKVLHPYTAEHATFLEHILLCAVVGIPTLGTVFIGYGSIILMYGYFLVFDFLQCL  231

Query  550  GYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDML  699
            G+ NVE+ P  LF+TIP+LKYLI  PTY+ LHH D  TNFCLFMPLYD L
Sbjct  232  GHCNVEVFPDRLFETIPLLKYLIRPPTYHSLHHSDMGTNFCLFMPLYDKL  281



>ref|XP_011073242.1| PREDICTED: protein ECERIFERUM 3-like isoform X2 [Sesamum indicum]
Length=641

 Score =   341 bits (875),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 158/227 (70%), Positives = 189/227 (83%), Gaps = 0/227 (0%)
 Frame = +1

Query  19   EDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQ  198
            +D WCLHIL+L GLR LVHQLWS+YSNMLF NRA R+++QG++F QID EWHWDNFLIL+
Sbjct  61   DDTWCLHILILFGLRALVHQLWSTYSNMLFLNRAHRINEQGVEFSQIDAEWHWDNFLILE  120

Query  199  AILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLH  378
            AILA    +SFP LANLP W+ +GV+ CL+LH+G SEPLYY MHRLLH   L+  YHWLH
Sbjct  121  AILAYLLCLSFPLLANLPIWDLRGVLICLILHIGISEPLYYWMHRLLHFPSLFRKYHWLH  180

Query  379  HDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYS  558
            H SKV  PFTAG A+FLE LLLCV++GIPTLGTAF+GHGS+ +IY Y+L FDFL CLG+S
Sbjct  181  HSSKVISPFTAGHASFLERLLLCVVIGIPTLGTAFIGHGSVGLIYCYLLVFDFLLCLGHS  240

Query  559  NVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDML  699
            NVE++P  LF+ IP+LKYLIY+PTY+ LHHMD  TNFCLFMP+YD L
Sbjct  241  NVEVLPGSLFQAIPLLKYLIYTPTYHSLHHMDMGTNFCLFMPVYDKL  287



>ref|XP_011073241.1| PREDICTED: protein ECERIFERUM 3-like isoform X1 [Sesamum indicum]
Length=643

 Score =   341 bits (874),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 158/227 (70%), Positives = 189/227 (83%), Gaps = 0/227 (0%)
 Frame = +1

Query  19   EDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQ  198
            +D WCLHIL+L GLR LVHQLWS+YSNMLF NRA R+++QG++F QID EWHWDNFLIL+
Sbjct  61   DDTWCLHILILFGLRALVHQLWSTYSNMLFLNRAHRINEQGVEFSQIDAEWHWDNFLILE  120

Query  199  AILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLH  378
            AILA    +SFP LANLP W+ +GV+ CL+LH+G SEPLYY MHRLLH   L+  YHWLH
Sbjct  121  AILAYLLCLSFPLLANLPIWDLRGVLICLILHIGISEPLYYWMHRLLHFPSLFRKYHWLH  180

Query  379  HDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYS  558
            H SKV  PFTAG A+FLE LLLCV++GIPTLGTAF+GHGS+ +IY Y+L FDFL CLG+S
Sbjct  181  HSSKVISPFTAGHASFLERLLLCVVIGIPTLGTAFIGHGSVGLIYCYLLVFDFLLCLGHS  240

Query  559  NVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDML  699
            NVE++P  LF+ IP+LKYLIY+PTY+ LHHMD  TNFCLFMP+YD L
Sbjct  241  NVEVLPGSLFQAIPLLKYLIYTPTYHSLHHMDMGTNFCLFMPVYDKL  287



>emb|CDO98263.1| unnamed protein product [Coffea canephora]
Length=675

 Score =   316 bits (809),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 149/225 (66%), Positives = 189/225 (84%), Gaps = 0/225 (0%)
 Frame = +1

Query  28   WCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAIL  207
            WCLHIL+L  LRGL++QLWSSY  M F NR +R+S++GIDF+QID EW+WDNFLIL AI+
Sbjct  90   WCLHILLLFLLRGLLYQLWSSYDYMFFLNRTRRISEEGIDFKQIDAEWNWDNFLILHAIV  149

Query  208  ASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLHHDS  387
            A  AY SFPSL NLP W+ +G+  CL LH+G SEP+YY +HRLLHS +L+  YHWLHH S
Sbjct  150  AVLAYWSFPSLTNLPLWDGRGIFCCLALHIGVSEPVYYWLHRLLHSPNLFTDYHWLHHSS  209

Query  388  KVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYSNVE  567
            KV HPFTAG A FLEHL+LC+++G+P LGT F+G+GSI ++YSY+L FD LRCLG+SNVE
Sbjct  210  KVSHPFTAGHATFLEHLVLCIVIGVPILGTVFIGYGSISILYSYVLLFDMLRCLGHSNVE  269

Query  568  IMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            ++P HLF+ IP+L+YL+Y+PTY+ +HHMD RTNFCLFMP+YD+LG
Sbjct  270  VIPHHLFENIPLLRYLVYTPTYHNIHHMDMRTNFCLFMPVYDILG  314



>gb|EYU21788.1| hypothetical protein MIMGU_mgv1a025856mg [Erythranthe guttata]
Length=633

 Score =   313 bits (803),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 141/227 (62%), Positives = 182/227 (80%), Gaps = 0/227 (0%)
 Frame = +1

Query  19   EDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQ  198
            ++IWCLHIL+L   R LVHQLWSSY+NMLF NRA+R+ Q+G++F QID EWHWDNFLILQ
Sbjct  53   DNIWCLHILILFYHRALVHQLWSSYTNMLFLNRARRIDQRGVEFNQIDAEWHWDNFLILQ  112

Query  199  AILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLH  378
              +AS +YMSF  LANLP W+ +G++ C++LH+G SEP YY +HRLLH+  L+  YH+LH
Sbjct  113  ITVASLSYMSFSLLANLPLWDLRGIICCIILHIGISEPFYYWIHRLLHTPVLFQHYHFLH  172

Query  379  HDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYS  558
            H SKV +PFT    +FLEH+LLCV++GIPTLGTA +G+GSI ++Y Y+  FDFLRCL +S
Sbjct  173  HSSKVVNPFTGAHLSFLEHILLCVVIGIPTLGTALIGYGSIGLMYGYLFVFDFLRCLQHS  232

Query  559  NVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDML  699
            NVE++P  LF+ IP+LKYL+ +PTY+ LHH +  TNFCLFMP YD L
Sbjct  233  NVEVVPCQLFQAIPLLKYLVCTPTYHSLHHAETGTNFCLFMPFYDKL  279



>ref|XP_007013964.1| Fatty acid hydroxylase superfamily [Theobroma cacao]
 gb|EOY31583.1| Fatty acid hydroxylase superfamily [Theobroma cacao]
Length=632

 Score =   311 bits (797),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 138/234 (59%), Positives = 183/234 (78%), Gaps = 0/234 (0%)
 Frame = +1

Query  1    VWKESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWD  180
            +++++ +D+WCLHIL++  LRGL+HQLWSSY +MLF  R +R+ QQG+DF+QID+EW WD
Sbjct  33   IYEDTLKDLWCLHILLICALRGLIHQLWSSYGSMLFLTRNRRIKQQGVDFKQIDREWDWD  92

Query  181  NFLILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYP  360
            NF+ILQA+LAS A + FPSL  LP W  KG +   +LH+  SEP+YY  HR+ H S L+ 
Sbjct  93   NFIILQALLASMACLIFPSLDGLPLWNSKGFIALFLLHVTISEPVYYWAHRVFHESYLFT  152

Query  361  LYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFL  540
             YH LHH S VPHPFTAG A FLEHL+LCV++GIP  G+  +G+GS  +IYSY+LAFDFL
Sbjct  153  HYHSLHHSSPVPHPFTAGHATFLEHLVLCVVIGIPMTGSVLMGYGSTSMIYSYVLAFDFL  212

Query  541  RCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            RCLG+SNVE++P  +F  +P L+YLI++PTY+ LHH +  TNFCLFMPL+D +G
Sbjct  213  RCLGHSNVEVVPHEIFNKLPFLRYLIHTPTYHSLHHTEMGTNFCLFMPLFDAMG  266



>ref|XP_002270033.2| PREDICTED: protein ECERIFERUM 3-like [Vitis vinifera]
Length=620

 Score =   304 bits (778),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 144/233 (62%), Positives = 174/233 (75%), Gaps = 0/233 (0%)
 Frame = +1

Query  1    VWKESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWD  180
            +W+E+    WCLHIL+L  LRGLVHQLWSSY NMLF  R   + +QGIDF+QID EWHWD
Sbjct  34   IWEETRNPSWCLHILLLCALRGLVHQLWSSYCNMLFITRNHWILRQGIDFKQIDPEWHWD  93

Query  181  NFLILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYP  360
            NF+ILQA +A  A +SFP L NLP W  KG++ C+VLHMG SEPLYY  HRLLH+   + 
Sbjct  94   NFIILQAFMAGMALLSFPFLTNLPLWNTKGIICCMVLHMGISEPLYYWFHRLLHTQYFFS  153

Query  361  LYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFL  540
             YH LHH S V  PFT G A F EHL++ VI+GIPT+GT   G+GSI +IY YIL FDFL
Sbjct  154  HYHSLHHASIVTQPFTVGLATFSEHLMMGVIIGIPTVGTWLFGYGSISLIYGYILVFDFL  213

Query  541  RCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDML  699
            RC+G+SNVEI+P  LF+  P LKY +Y+PTY+ LHH +  TNFCLFMPLYD +
Sbjct  214  RCMGHSNVEIIPHALFQIFPFLKYFLYTPTYHCLHHTEMNTNFCLFMPLYDSI  266



>emb|CBI25242.3| unnamed protein product [Vitis vinifera]
Length=622

 Score =   304 bits (778),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 144/233 (62%), Positives = 174/233 (75%), Gaps = 0/233 (0%)
 Frame = +1

Query  1    VWKESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWD  180
            +W+E+    WCLHIL+L  LRGLVHQLWSSY NMLF  R   + +QGIDF+QID EWHWD
Sbjct  34   IWEETRNPSWCLHILLLCALRGLVHQLWSSYCNMLFITRNHWILRQGIDFKQIDPEWHWD  93

Query  181  NFLILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYP  360
            NF+ILQA +A  A +SFP L NLP W  KG++ C+VLHMG SEPLYY  HRLLH+   + 
Sbjct  94   NFIILQAFMAGMALLSFPFLTNLPLWNTKGIICCMVLHMGISEPLYYWFHRLLHTQYFFS  153

Query  361  LYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFL  540
             YH LHH S V  PFT G A F EHL++ VI+GIPT+GT   G+GSI +IY YIL FDFL
Sbjct  154  HYHSLHHASIVTQPFTVGLATFSEHLMMGVIIGIPTVGTWLFGYGSISLIYGYILVFDFL  213

Query  541  RCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDML  699
            RC+G+SNVEI+P  LF+  P LKY +Y+PTY+ LHH +  TNFCLFMPLYD +
Sbjct  214  RCMGHSNVEIIPHALFQIFPFLKYFLYTPTYHCLHHTEMNTNFCLFMPLYDSI  266



>ref|XP_002270075.1| PREDICTED: protein ECERIFERUM 3-like [Vitis vinifera]
Length=620

 Score =   304 bits (778),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 142/231 (61%), Positives = 175/231 (76%), Gaps = 0/231 (0%)
 Frame = +1

Query  1    VWKESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWD  180
            +W+++    WCLHIL+L  LRGLVHQLW SY NMLF  R + + +QGI+F+QID+EWHWD
Sbjct  34   IWEKTQNPSWCLHILLLCALRGLVHQLWYSYCNMLFITRNRWILRQGINFKQIDREWHWD  93

Query  181  NFLILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYP  360
            NF+ILQA +A    +SFP L NLP W  KG++ C+VLHMG SEPLYY  HRLLH+   + 
Sbjct  94   NFIILQAFVAGMVLLSFPFLTNLPLWNTKGIICCMVLHMGISEPLYYWFHRLLHTQYFFS  153

Query  361  LYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFL  540
             YH LHH S V  PFTAG A FLEHL++ VI+GIPT+GT   G+GSI +IY YIL FDFL
Sbjct  154  HYHSLHHASIVTQPFTAGLATFLEHLMMGVIIGIPTVGTWLFGYGSISLIYGYILVFDFL  213

Query  541  RCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYD  693
            RC+G+SNVEI+P  LF+  P LKY +Y+PTY+ LHH +  TNFCLFMPLYD
Sbjct  214  RCMGHSNVEIIPHALFQIFPFLKYFLYTPTYHCLHHTEMNTNFCLFMPLYD  264



>emb|CBI25244.3| unnamed protein product [Vitis vinifera]
Length=622

 Score =   304 bits (778),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 142/233 (61%), Positives = 176/233 (76%), Gaps = 0/233 (0%)
 Frame = +1

Query  1    VWKESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWD  180
            +W+++    WCLHIL+L  LRGLVHQLW SY NMLF  R + + +QGI+F+QID+EWHWD
Sbjct  34   IWEKTQNPSWCLHILLLCALRGLVHQLWYSYCNMLFITRNRWILRQGINFKQIDREWHWD  93

Query  181  NFLILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYP  360
            NF+ILQA +A    +SFP L NLP W  KG++ C+VLHMG SEPLYY  HRLLH+   + 
Sbjct  94   NFIILQAFVAGMVLLSFPFLTNLPLWNTKGIICCMVLHMGISEPLYYWFHRLLHTQYFFS  153

Query  361  LYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFL  540
             YH LHH S V  PFTAG A FLEHL++ VI+GIPT+GT   G+GSI +IY YIL FDFL
Sbjct  154  HYHSLHHASIVTQPFTAGLATFLEHLMMGVIIGIPTVGTWLFGYGSISLIYGYILVFDFL  213

Query  541  RCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDML  699
            RC+G+SNVEI+P  LF+  P LKY +Y+PTY+ LHH +  TNFCLFMPLYD +
Sbjct  214  RCMGHSNVEIIPHALFQIFPFLKYFLYTPTYHCLHHTEMNTNFCLFMPLYDSI  266



>ref|XP_002270946.1| PREDICTED: protein ECERIFERUM 3 [Vitis vinifera]
 emb|CBI36611.3| unnamed protein product [Vitis vinifera]
Length=632

 Score =   303 bits (777),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 137/232 (59%), Positives = 177/232 (76%), Gaps = 0/232 (0%)
 Frame = +1

Query  7    KESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNF  186
            +++  D WCLHIL+L  LRGL+HQ W SYSNMLF  R +R+ +QG+DF+QID+EW WDNF
Sbjct  37   EDAQTDTWCLHILILCALRGLIHQSWCSYSNMLFLTRNRRIQKQGVDFKQIDREWDWDNF  96

Query  187  LILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLY  366
            ++LQA++AS A+  FP L++LP W  +GV+  L+LH+G SEPLYY +HR  H + L+  Y
Sbjct  97   ILLQALIASVAFYIFPFLSDLPVWNTRGVIAALILHIGVSEPLYYWVHRCFHGNYLFTRY  156

Query  367  HWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRC  546
            H LHH S V   FTAGSA FLEHL+L  +VGIP LG++ +G GSI +IY Y+L FDFLRC
Sbjct  157  HSLHHASTVTQSFTAGSATFLEHLILSAVVGIPVLGSSLMGFGSISMIYGYVLIFDFLRC  216

Query  547  LGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            LG+SNVE++P  +F   P LKYLIY+PTY+ LHH +  TNFCLFMPL+D LG
Sbjct  217  LGHSNVEVVPHAMFHAFPFLKYLIYTPTYHSLHHTEMGTNFCLFMPLFDALG  268



>gb|EYU24562.1| hypothetical protein MIMGU_mgv1a002930mg [Erythranthe guttata]
Length=624

 Score =   299 bits (765),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 139/231 (60%), Positives = 180/231 (78%), Gaps = 1/231 (0%)
 Frame = +1

Query  10   ESWEDIWC-LHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNF  186
            E   D W  LHIL+L  LR L+HQL+S+YS++LF NRA+++++ G++F+QID EWHWDNF
Sbjct  40   EIKNDSWFFLHILILFALRALIHQLFSTYSSLLFLNRARKINENGVEFDQIDAEWHWDNF  99

Query  187  LILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLY  366
            LILQA +AS  YMSFPSL N P W+  G+  C+VLH+G SEPLYY +HRLLHS  L+  Y
Sbjct  100  LILQAAVASLLYMSFPSLNNFPKWDKNGIFICIVLHIGISEPLYYWIHRLLHSPSLFHKY  159

Query  367  HWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRC  546
            H+LHH SKV HPFTA  A FLEH+LLC++VGIP +G+A +G+GS+ ++YSY+L FDFL+C
Sbjct  160  HYLHHTSKVLHPFTAEYATFLEHILLCLVVGIPIVGSALIGYGSMSMVYSYLLVFDFLQC  219

Query  547  LGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDML  699
            LG+ N+E+ P  LF   P+LKYLI +PTY+ LHH +  TNFCLFMP YD L
Sbjct  220  LGHCNIEVFPFRLFDAFPLLKYLIRTPTYHSLHHTNMGTNFCLFMPFYDHL  270



>gb|KJB83319.1| hypothetical protein B456_013G242200 [Gossypium raimondii]
Length=413

 Score =   292 bits (748),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 131/228 (57%), Positives = 169/228 (74%), Gaps = 0/228 (0%)
 Frame = +1

Query  19   EDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQ  198
            +D+WC+HIL++  LRGL+HQLWSSY+NM F  R + + QQG+DF+QID EW WDNF+ILQ
Sbjct  40   KDLWCIHILLICTLRGLIHQLWSSYNNMFFLTRNRWIKQQGVDFKQIDDEWDWDNFIILQ  99

Query  199  AILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLH  378
            A+LAS A + FPSL  LP W  KG +  L+LH+  SEPLYY  HR  H   L+  YH LH
Sbjct  100  AMLASMASLIFPSLNTLPLWNLKGFIASLLLHVTISEPLYYWAHRFFHKPYLFNHYHSLH  159

Query  379  HDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYS  558
            H S VPHPFTAG A  LEHL+LC ++GIP  G+  +G+GS  +IY ++L FDF RCLG+S
Sbjct  160  HSSPVPHPFTAGHATPLEHLVLCTVIGIPITGSILMGYGSTAMIYGHVLVFDFFRCLGHS  219

Query  559  NVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            N E++P  +F  +P+L+Y IY+PTY+ LHH +  TNFCLFMPL+D LG
Sbjct  220  NAEVVPHEVFNKLPLLRYFIYTPTYHSLHHTEMETNFCLFMPLFDALG  267



>ref|XP_003549515.1| PREDICTED: protein ECERIFERUM 3-like [Glycine max]
Length=632

 Score =   298 bits (763),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 138/225 (61%), Positives = 174/225 (77%), Gaps = 0/225 (0%)
 Frame = +1

Query  28   WCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAIL  207
            WCLH+L+L+GLRGL+H LW SYS+M F  R +R+ Q+G+DF+QIDKEW WDNFLILQA++
Sbjct  45   WCLHLLILSGLRGLIHVLWGSYSHMFFLTRNRRIVQKGVDFKQIDKEWDWDNFLILQALV  104

Query  208  ASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLHHDS  387
            AS A   FP L +LP W  KG++  LVLH+G SEPLYY +HR  H   L+  YH LHH S
Sbjct  105  ASMACYMFPFLQHLPLWNVKGLIVALVLHVGVSEPLYYWVHRKFHGDYLFTHYHSLHHSS  164

Query  388  KVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYSNVE  567
             VP  FTAG+A  LEHL++ VI+GIP LG + +G+GS  +IY Y+L FDFLRCLG+SNVE
Sbjct  165  PVPESFTAGNATLLEHLIMTVIIGIPILGASLMGYGSASMIYGYVLIFDFLRCLGHSNVE  224

Query  568  IMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            I+P  LF+ +P L+Y+IY+PTY+ LHH DK TNFCLFMPL+D LG
Sbjct  225  IVPHQLFEKLPFLRYVIYTPTYHHLHHSDKDTNFCLFMPLFDSLG  269



>gb|KHN17538.1| Protein WAX2 [Glycine soja]
Length=632

 Score =   298 bits (763),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 138/225 (61%), Positives = 174/225 (77%), Gaps = 0/225 (0%)
 Frame = +1

Query  28   WCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAIL  207
            WCLH+L+L+GLRGL+H LW SYS+M F  R +R+ Q+G+DF+QIDKEW WDNFLILQA++
Sbjct  45   WCLHLLILSGLRGLIHVLWGSYSHMFFLTRNRRIVQKGVDFKQIDKEWDWDNFLILQALV  104

Query  208  ASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLHHDS  387
            AS A   FP L +LP W  KG++  LVLH+G SEPLYY +HR  H   L+  YH LHH S
Sbjct  105  ASMACYMFPFLQHLPLWNVKGLIVALVLHVGVSEPLYYWVHRKFHGDYLFTHYHSLHHSS  164

Query  388  KVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYSNVE  567
             VP  FTAG+A  LEHL++ VI+GIP LG + +G+GS  +IY Y+L FDFLRCLG+SNVE
Sbjct  165  PVPESFTAGNATLLEHLIMTVIIGIPILGASLMGYGSASMIYGYVLIFDFLRCLGHSNVE  224

Query  568  IMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            I+P  LF+ +P L+Y+IY+PTY+ LHH DK TNFCLFMPL+D LG
Sbjct  225  IVPHQLFEKLPFLRYVIYTPTYHHLHHSDKDTNFCLFMPLFDSLG  269



>gb|KJB83320.1| hypothetical protein B456_013G242200 [Gossypium raimondii]
Length=490

 Score =   294 bits (752),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 131/228 (57%), Positives = 169/228 (74%), Gaps = 0/228 (0%)
 Frame = +1

Query  19   EDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQ  198
            +D+WC+HIL++  LRGL+HQLWSSY+NM F  R + + QQG+DF+QID EW WDNF+ILQ
Sbjct  40   KDLWCIHILLICTLRGLIHQLWSSYNNMFFLTRNRWIKQQGVDFKQIDDEWDWDNFIILQ  99

Query  199  AILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLH  378
            A+LAS A + FPSL  LP W  KG +  L+LH+  SEPLYY  HR  H   L+  YH LH
Sbjct  100  AMLASMASLIFPSLNTLPLWNLKGFIASLLLHVTISEPLYYWAHRFFHKPYLFNHYHSLH  159

Query  379  HDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYS  558
            H S VPHPFTAG A  LEHL+LC ++GIP  G+  +G+GS  +IY ++L FDF RCLG+S
Sbjct  160  HSSPVPHPFTAGHATPLEHLVLCTVIGIPITGSILMGYGSTAMIYGHVLVFDFFRCLGHS  219

Query  559  NVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            N E++P  +F  +P+L+Y IY+PTY+ LHH +  TNFCLFMPL+D LG
Sbjct  220  NAEVVPHEVFNKLPLLRYFIYTPTYHSLHHTEMETNFCLFMPLFDALG  267



>ref|XP_004309858.1| PREDICTED: protein ECERIFERUM 3 [Fragaria vesca subsp. vesca]
Length=630

 Score =   298 bits (762),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 137/234 (59%), Positives = 176/234 (75%), Gaps = 5/234 (2%)
 Frame = +1

Query  16   WEDI-----WCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWD  180
            +ED+     WCLH+L++  LRGL++QLW+SYSNMLF  R +R+ +QG+DF+QID EWHWD
Sbjct  34   YEDVLPMQSWCLHVLIICALRGLIYQLWNSYSNMLFLTRNRRIIKQGVDFKQIDAEWHWD  93

Query  181  NFLILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYP  360
            NF+ILQ ++AS A    P L +LP W  KG++ C+VLH+G SEPLYY +HR  H++D Y 
Sbjct  94   NFIILQGLIASMACYLVPYLQDLPVWNPKGLITCMVLHVGVSEPLYYWVHRRFHANDFYQ  153

Query  361  LYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFL  540
             YH LHH S VP P TAG+A FLE L+L VI+GIP LG+  +G GSI +IY Y   FDFL
Sbjct  154  NYHSLHHSSPVPQPLTAGNATFLEDLILTVIIGIPILGSTLMGFGSIGIIYGYFSVFDFL  213

Query  541  RCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            R LGYSNVE++   LF+ IP LKYL+Y+PTY+ LHH +K +NFCLFMPL+D LG
Sbjct  214  RGLGYSNVEVISHKLFEKIPFLKYLLYTPTYHSLHHTEKGSNFCLFMPLFDALG  267



>gb|KJB83321.1| hypothetical protein B456_013G242200 [Gossypium raimondii]
Length=514

 Score =   294 bits (753),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 131/228 (57%), Positives = 169/228 (74%), Gaps = 0/228 (0%)
 Frame = +1

Query  19   EDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQ  198
            +D+WC+HIL++  LRGL+HQLWSSY+NM F  R + + QQG+DF+QID EW WDNF+ILQ
Sbjct  40   KDLWCIHILLICTLRGLIHQLWSSYNNMFFLTRNRWIKQQGVDFKQIDDEWDWDNFIILQ  99

Query  199  AILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLH  378
            A+LAS A + FPSL  LP W  KG +  L+LH+  SEPLYY  HR  H   L+  YH LH
Sbjct  100  AMLASMASLIFPSLNTLPLWNLKGFIASLLLHVTISEPLYYWAHRFFHKPYLFNHYHSLH  159

Query  379  HDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYS  558
            H S VPHPFTAG A  LEHL+LC ++GIP  G+  +G+GS  +IY ++L FDF RCLG+S
Sbjct  160  HSSPVPHPFTAGHATPLEHLVLCTVIGIPITGSILMGYGSTAMIYGHVLVFDFFRCLGHS  219

Query  559  NVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            N E++P  +F  +P+L+Y IY+PTY+ LHH +  TNFCLFMPL+D LG
Sbjct  220  NAEVVPHEVFNKLPLLRYFIYTPTYHSLHHTEMETNFCLFMPLFDALG  267



>ref|XP_007221983.1| hypothetical protein PRUPE_ppa002836mg [Prunus persica]
 gb|EMJ23182.1| hypothetical protein PRUPE_ppa002836mg [Prunus persica]
Length=629

 Score =   296 bits (759),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 139/227 (61%), Positives = 167/227 (74%), Gaps = 0/227 (0%)
 Frame = +1

Query  22   DIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQA  201
            + WCLHIL+L  LRG VHQLWSSY+NMLF  R +R+ QQG+DF+QIDKEW WDNF+ILQ 
Sbjct  43   NSWCLHILILCALRGTVHQLWSSYTNMLFLTRTRRILQQGVDFKQIDKEWDWDNFIILQG  102

Query  202  ILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLHH  381
            ++AS A    P L NLP W   G +  LVLH+G SEPLYY MHR  H +  +  YH LHH
Sbjct  103  LIASTACYLLPFLQNLPLWNTIGFISTLVLHVGVSEPLYYWMHRRFHGNYFFENYHSLHH  162

Query  382  DSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYSN  561
             S +P PFTAGSA  LEHL+L  IVGIP LGT  +G GSI  IY Y+L FDFLRCLG+SN
Sbjct  163  SSPIPQPFTAGSATLLEHLVLGAIVGIPVLGTTLMGCGSIFAIYGYVLVFDFLRCLGHSN  222

Query  562  VEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            VE++   LF+  P L+YL+Y+PTY+ LHH +  TNFCLFMPL+D LG
Sbjct  223  VEVISHKLFEKAPFLRYLLYTPTYHSLHHTEMDTNFCLFMPLFDALG  269



>ref|XP_007154834.1| hypothetical protein PHAVU_003G1516000g, partial [Phaseolus vulgaris]
 gb|ESW26828.1| hypothetical protein PHAVU_003G1516000g, partial [Phaseolus vulgaris]
Length=409

 Score =   289 bits (740),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 135/225 (60%), Positives = 170/225 (76%), Gaps = 0/225 (0%)
 Frame = +1

Query  28   WCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAIL  207
            WCLH+L+L+GLRGL+H LW SYS+MLF  R +R+ QQG+DF+QIDKEW WDNFLILQA++
Sbjct  45   WCLHLLILSGLRGLIHVLWGSYSHMLFLTRNRRILQQGVDFKQIDKEWDWDNFLILQALV  104

Query  208  ASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLHHDS  387
             S A   FP L +LP W  KG+   L+LH+G SEPLYY +H+  H   L+  YH LHH S
Sbjct  105  TSMACYMFPFLQHLPLWNVKGLFVTLILHVGVSEPLYYWVHKRFHGDYLFTHYHSLHHSS  164

Query  388  KVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYSNVE  567
             VP  FTAG A  LEHL+L V++GIP LG + +G+GS  +IY+Y+L FDFLRCLG+ NVE
Sbjct  165  PVPESFTAGHATLLEHLILTVVIGIPILGASVMGYGSASLIYAYVLIFDFLRCLGHGNVE  224

Query  568  IMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            I+P  LF+    L+Y+IY+PTY+ LHH DK TNFCLFMPL+D LG
Sbjct  225  IVPHQLFEKFQFLRYVIYTPTYHSLHHSDKDTNFCLFMPLFDALG  269



>ref|XP_008223563.1| PREDICTED: protein ECERIFERUM 3 isoform X2 [Prunus mume]
Length=575

 Score =   294 bits (753),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 137/227 (60%), Positives = 168/227 (74%), Gaps = 0/227 (0%)
 Frame = +1

Query  22   DIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQA  201
            + WCLHIL+L  LRG+VHQLWSSY+NMLF  R +R+ QQG+DF+QIDKEW WDNF+ILQ 
Sbjct  43   NSWCLHILILCALRGIVHQLWSSYTNMLFLTRTRRILQQGVDFKQIDKEWDWDNFIILQG  102

Query  202  ILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLHH  381
            ++AS A      L NLP W   G +  LVLH+G SEPLYY MHR  H +  +  YH LHH
Sbjct  103  LIASTACYLLQFLQNLPLWNTIGFISTLVLHVGVSEPLYYWMHRRFHGNYFFENYHSLHH  162

Query  382  DSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYSN  561
             S +P PFTAG+A  LEHL+L  IVGIP LGT  +G GSI VIY Y+L FDFLRCLG SN
Sbjct  163  SSPIPQPFTAGNATLLEHLVLGAIVGIPVLGTTLMGCGSIFVIYGYVLVFDFLRCLGLSN  222

Query  562  VEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            VE++   LF+  P+L+YL+Y+PTY+ LHH +  TNFCLFMPL+D +G
Sbjct  223  VEVISHKLFEKAPLLRYLLYTPTYHSLHHTEMDTNFCLFMPLFDAVG  269



>ref|XP_007154833.1| hypothetical protein PHAVU_003G1516000g [Phaseolus vulgaris]
 gb|ESW26827.1| hypothetical protein PHAVU_003G1516000g [Phaseolus vulgaris]
Length=410

 Score =   289 bits (740),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 135/225 (60%), Positives = 170/225 (76%), Gaps = 0/225 (0%)
 Frame = +1

Query  28   WCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAIL  207
            WCLH+L+L+GLRGL+H LW SYS+MLF  R +R+ QQG+DF+QIDKEW WDNFLILQA++
Sbjct  45   WCLHLLILSGLRGLIHVLWGSYSHMLFLTRNRRILQQGVDFKQIDKEWDWDNFLILQALV  104

Query  208  ASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLHHDS  387
             S A   FP L +LP W  KG+   L+LH+G SEPLYY +H+  H   L+  YH LHH S
Sbjct  105  TSMACYMFPFLQHLPLWNVKGLFVTLILHVGVSEPLYYWVHKRFHGDYLFTHYHSLHHSS  164

Query  388  KVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYSNVE  567
             VP  FTAG A  LEHL+L V++GIP LG + +G+GS  +IY+Y+L FDFLRCLG+ NVE
Sbjct  165  PVPESFTAGHATLLEHLILTVVIGIPILGASVMGYGSASLIYAYVLIFDFLRCLGHGNVE  224

Query  568  IMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            I+P  LF+    L+Y+IY+PTY+ LHH DK TNFCLFMPL+D LG
Sbjct  225  IVPHQLFEKFQFLRYVIYTPTYHSLHHSDKDTNFCLFMPLFDALG  269



>gb|KJB83322.1| hypothetical protein B456_013G242200 [Gossypium raimondii]
Length=569

 Score =   294 bits (752),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 131/228 (57%), Positives = 169/228 (74%), Gaps = 0/228 (0%)
 Frame = +1

Query  19   EDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQ  198
            +D+WC+HIL++  LRGL+HQLWSSY+NM F  R + + QQG+DF+QID EW WDNF+ILQ
Sbjct  40   KDLWCIHILLICTLRGLIHQLWSSYNNMFFLTRNRWIKQQGVDFKQIDDEWDWDNFIILQ  99

Query  199  AILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLH  378
            A+LAS A + FPSL  LP W  KG +  L+LH+  SEPLYY  HR  H   L+  YH LH
Sbjct  100  AMLASMASLIFPSLNTLPLWNLKGFIASLLLHVTISEPLYYWAHRFFHKPYLFNHYHSLH  159

Query  379  HDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYS  558
            H S VPHPFTAG A  LEHL+LC ++GIP  G+  +G+GS  +IY ++L FDF RCLG+S
Sbjct  160  HSSPVPHPFTAGHATPLEHLVLCTVIGIPITGSILMGYGSTAMIYGHVLVFDFFRCLGHS  219

Query  559  NVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            N E++P  +F  +P+L+Y IY+PTY+ LHH +  TNFCLFMPL+D LG
Sbjct  220  NAEVVPHEVFNKLPLLRYFIYTPTYHSLHHTEMETNFCLFMPLFDALG  267



>gb|KJB83324.1| hypothetical protein B456_013G242200 [Gossypium raimondii]
Length=595

 Score =   294 bits (752),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 131/228 (57%), Positives = 169/228 (74%), Gaps = 0/228 (0%)
 Frame = +1

Query  19   EDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQ  198
            +D+WC+HIL++  LRGL+HQLWSSY+NM F  R + + QQG+DF+QID EW WDNF+ILQ
Sbjct  8    KDLWCIHILLICTLRGLIHQLWSSYNNMFFLTRNRWIKQQGVDFKQIDDEWDWDNFIILQ  67

Query  199  AILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLH  378
            A+LAS A + FPSL  LP W  KG +  L+LH+  SEPLYY  HR  H   L+  YH LH
Sbjct  68   AMLASMASLIFPSLNTLPLWNLKGFIASLLLHVTISEPLYYWAHRFFHKPYLFNHYHSLH  127

Query  379  HDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYS  558
            H S VPHPFTAG A  LEHL+LC ++GIP  G+  +G+GS  +IY ++L FDF RCLG+S
Sbjct  128  HSSPVPHPFTAGHATPLEHLVLCTVIGIPITGSILMGYGSTAMIYGHVLVFDFFRCLGHS  187

Query  559  NVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            N E++P  +F  +P+L+Y IY+PTY+ LHH +  TNFCLFMPL+D LG
Sbjct  188  NAEVVPHEVFNKLPLLRYFIYTPTYHSLHHTEMETNFCLFMPLFDALG  235



>ref|XP_010929211.1| PREDICTED: protein ECERIFERUM 3-like isoform X2 [Elaeis guineensis]
Length=561

 Score =   292 bits (747),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 135/234 (58%), Positives = 170/234 (73%), Gaps = 0/234 (0%)
 Frame = +1

Query  1    VWKESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWD  180
             W++   D WCLH+LVL  LRGLVHQLW S+ NMLF  R +RV   G+DF QIDKEW WD
Sbjct  33   AWEQGKPDRWCLHVLVLCALRGLVHQLWCSFGNMLFLTRRRRVLGDGVDFRQIDKEWDWD  92

Query  181  NFLILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYP  360
            NFLILQ+ + +    SFPS+  LP W+ KGV   L+LH+  SEPL+Y +HR  H   L+ 
Sbjct  93   NFLILQSFIGALVCYSFPSIRKLPLWDPKGVFIALLLHVWVSEPLFYWVHRAFHRGYLFT  152

Query  361  LYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFL  540
             YH LHH + VP  FTAG A  LEHL LCV++G P LG   LG GS  ++Y Y+L FDFL
Sbjct  153  RYHSLHHSTPVPQSFTAGFATPLEHLFLCVVMGAPLLGACSLGTGSAGLVYGYVLLFDFL  212

Query  541  RCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            RC+G+SNVE++P  LF+ +PVL+YLIY+PTY+ LHHM+K +NFCLFMPL+D+LG
Sbjct  213  RCMGHSNVEVLPHGLFQALPVLRYLIYTPTYHSLHHMEKNSNFCLFMPLFDLLG  266



>ref|XP_010103144.1| Protein WAX2 [Morus notabilis]
 gb|EXB94909.1| Protein WAX2 [Morus notabilis]
Length=623

 Score =   293 bits (751),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 136/233 (58%), Positives = 177/233 (76%), Gaps = 1/233 (0%)
 Frame = +1

Query  7    KESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNF  186
            +++ ++ WCLHI +L   R  ++QLW+SY+NMLF  R +RV QQG+DF+QIDKEW+WDNF
Sbjct  36   EKTQKESWCLHICLLYLFRCFLYQLWTSYTNMLFLTRNRRVIQQGVDFKQIDKEWNWDNF  95

Query  187  LILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSD-LYPL  363
            LILQA+ A      FPSL NLP W  KG++  ++LH+G SEPLYY +HR  H +D L+  
Sbjct  96   LILQALFAFTGCYIFPSLQNLPLWNLKGLIAVVILHVGVSEPLYYWVHRFFHRNDHLFIN  155

Query  364  YHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLR  543
            YH LHH S VP PFTAG+A FLEHL L +I+GIP +G + LG+GSI +IY Y+  FDFLR
Sbjct  156  YHSLHHSSPVPQPFTAGNATFLEHLFLSLIIGIPIIGASLLGYGSIGLIYGYVSIFDFLR  215

Query  544  CLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            CLG+SNVE++P  LF+ IP L+YL+Y+PTYY LHH +  TNFCLFMPL+D +G
Sbjct  216  CLGHSNVEVVPHKLFEAIPFLRYLLYTPTYYSLHHTELETNFCLFMPLFDAVG  268



>ref|XP_008223562.1| PREDICTED: protein ECERIFERUM 3 isoform X1 [Prunus mume]
Length=638

 Score =   294 bits (752),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 137/227 (60%), Positives = 168/227 (74%), Gaps = 0/227 (0%)
 Frame = +1

Query  22   DIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQA  201
            + WCLHIL+L  LRG+VHQLWSSY+NMLF  R +R+ QQG+DF+QIDKEW WDNF+ILQ 
Sbjct  43   NSWCLHILILCALRGIVHQLWSSYTNMLFLTRTRRILQQGVDFKQIDKEWDWDNFIILQG  102

Query  202  ILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLHH  381
            ++AS A      L NLP W   G +  LVLH+G SEPLYY MHR  H +  +  YH LHH
Sbjct  103  LIASTACYLLQFLQNLPLWNTIGFISTLVLHVGVSEPLYYWMHRRFHGNYFFENYHSLHH  162

Query  382  DSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYSN  561
             S +P PFTAG+A  LEHL+L  IVGIP LGT  +G GSI VIY Y+L FDFLRCLG SN
Sbjct  163  SSPIPQPFTAGNATLLEHLVLGAIVGIPVLGTTLMGCGSIFVIYGYVLVFDFLRCLGLSN  222

Query  562  VEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            VE++   LF+  P+L+YL+Y+PTY+ LHH +  TNFCLFMPL+D +G
Sbjct  223  VEVISHKLFEKAPLLRYLLYTPTYHSLHHTEMDTNFCLFMPLFDAVG  269



>gb|KJB83318.1| hypothetical protein B456_013G242200 [Gossypium raimondii]
Length=627

 Score =   293 bits (751),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 131/228 (57%), Positives = 169/228 (74%), Gaps = 0/228 (0%)
 Frame = +1

Query  19   EDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQ  198
            +D+WC+HIL++  LRGL+HQLWSSY+NM F  R + + QQG+DF+QID EW WDNF+ILQ
Sbjct  40   KDLWCIHILLICTLRGLIHQLWSSYNNMFFLTRNRWIKQQGVDFKQIDDEWDWDNFIILQ  99

Query  199  AILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLH  378
            A+LAS A + FPSL  LP W  KG +  L+LH+  SEPLYY  HR  H   L+  YH LH
Sbjct  100  AMLASMASLIFPSLNTLPLWNLKGFIASLLLHVTISEPLYYWAHRFFHKPYLFNHYHSLH  159

Query  379  HDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYS  558
            H S VPHPFTAG A  LEHL+LC ++GIP  G+  +G+GS  +IY ++L FDF RCLG+S
Sbjct  160  HSSPVPHPFTAGHATPLEHLVLCTVIGIPITGSILMGYGSTAMIYGHVLVFDFFRCLGHS  219

Query  559  NVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            N E++P  +F  +P+L+Y IY+PTY+ LHH +  TNFCLFMPL+D LG
Sbjct  220  NAEVVPHEVFNKLPLLRYFIYTPTYHSLHHTEMETNFCLFMPLFDALG  267



>ref|XP_003542310.1| PREDICTED: protein ECERIFERUM 3-like [Glycine max]
 gb|KHN34764.1| Protein WAX2 [Glycine soja]
Length=629

 Score =   293 bits (750),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 134/225 (60%), Positives = 172/225 (76%), Gaps = 0/225 (0%)
 Frame = +1

Query  28   WCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAIL  207
            WCLH+L+L+GLRGL+H LW SYS+M F  R +R+ Q+G+DF+QIDKEW WDNFLILQA++
Sbjct  45   WCLHLLILSGLRGLIHVLWGSYSHMFFLTRNRRIVQKGVDFKQIDKEWDWDNFLILQALV  104

Query  208  ASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLHHDS  387
            AS A   FP L +LP W  KG++  L+LH+G SEPLYY +HR  H   L+  YH LHH S
Sbjct  105  ASMACYMFPFLQHLPLWNVKGLIVALILHVGVSEPLYYWVHRKFHGDYLFTHYHSLHHSS  164

Query  388  KVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYSNVE  567
             VP  FTAG+A  LEHL++ VI+G P LG + +G+GS  +IY Y+L FDFLRCLG+ NVE
Sbjct  165  PVPESFTAGNATLLEHLIMTVIIGTPILGASLMGYGSASLIYGYVLIFDFLRCLGHCNVE  224

Query  568  IMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            ++P  LF+ +P L+Y+IY+PTY+ LHH DK TNFCLFMPL+D LG
Sbjct  225  VVPHQLFEKLPFLRYVIYTPTYHHLHHSDKDTNFCLFMPLFDALG  269



>ref|XP_010929210.1| PREDICTED: protein ECERIFERUM 3-like isoform X1 [Elaeis guineensis]
Length=619

 Score =   292 bits (747),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 135/234 (58%), Positives = 170/234 (73%), Gaps = 0/234 (0%)
 Frame = +1

Query  1    VWKESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWD  180
             W++   D WCLH+LVL  LRGLVHQLW S+ NMLF  R +RV   G+DF QIDKEW WD
Sbjct  33   AWEQGKPDRWCLHVLVLCALRGLVHQLWCSFGNMLFLTRRRRVLGDGVDFRQIDKEWDWD  92

Query  181  NFLILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYP  360
            NFLILQ+ + +    SFPS+  LP W+ KGV   L+LH+  SEPL+Y +HR  H   L+ 
Sbjct  93   NFLILQSFIGALVCYSFPSIRKLPLWDPKGVFIALLLHVWVSEPLFYWVHRAFHRGYLFT  152

Query  361  LYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFL  540
             YH LHH + VP  FTAG A  LEHL LCV++G P LG   LG GS  ++Y Y+L FDFL
Sbjct  153  RYHSLHHSTPVPQSFTAGFATPLEHLFLCVVMGAPLLGACSLGTGSAGLVYGYVLLFDFL  212

Query  541  RCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            RC+G+SNVE++P  LF+ +PVL+YLIY+PTY+ LHHM+K +NFCLFMPL+D+LG
Sbjct  213  RCMGHSNVEVLPHGLFQALPVLRYLIYTPTYHSLHHMEKNSNFCLFMPLFDLLG  266



>ref|XP_004507787.1| PREDICTED: protein ECERIFERUM 3-like [Cicer arietinum]
Length=633

 Score =   290 bits (741),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 132/225 (59%), Positives = 171/225 (76%), Gaps = 0/225 (0%)
 Frame = +1

Query  28   WCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAIL  207
            WCLH+L+L GLRGLVH LW SYSN+LF  R +R+ QQG+DF+QIDKEW WDNF+ILQA++
Sbjct  46   WCLHLLILCGLRGLVHVLWCSYSNLLFLTRNRRILQQGVDFKQIDKEWDWDNFMILQALV  105

Query  208  ASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLHHDS  387
             S  +  FP L +LP W  KG++  LVLH+G SEPLYY +H+  H   L+  YH LHH S
Sbjct  106  GSICFYVFPFLQHLPLWNAKGLIAALVLHVGVSEPLYYWVHKKFHEDYLFTHYHSLHHSS  165

Query  388  KVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYSNVE  567
             VP P TA +A  LEH++L V++GIP +G + +G+GS  ++YSY+L FDFLRCLG+ NVE
Sbjct  166  PVPTPLTAENATLLEHVILTVVIGIPIIGASMMGYGSGSLVYSYVLIFDFLRCLGHCNVE  225

Query  568  IMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            I+P  LF+  P L+Y+IY+PTY+ LHH +K TNFCLFMPL+D LG
Sbjct  226  IVPHKLFEAFPFLRYVIYTPTYHNLHHTEKDTNFCLFMPLFDALG  270



>gb|KHG30512.1| Protein WAX2 -like protein [Gossypium arboreum]
Length=627

 Score =   288 bits (738),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 130/228 (57%), Positives = 168/228 (74%), Gaps = 0/228 (0%)
 Frame = +1

Query  19   EDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQ  198
            +D+WC+HIL++  LRG +HQLWSSY+NM F  R + + QQG+DF+QID EW WDNF+ILQ
Sbjct  40   KDLWCIHILLICTLRGFIHQLWSSYNNMFFLTRNRWIKQQGVDFKQIDDEWDWDNFIILQ  99

Query  199  AILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLH  378
            A+LAS A + FPSL  LP W  KG +  L+LH+  SEPLYY  HRL H   L+  YH LH
Sbjct  100  AMLASMACLIFPSLNTLPLWNLKGFIASLLLHVTISEPLYYWAHRLFHKPYLFIHYHSLH  159

Query  379  HDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYS  558
            H S VPHPFTAG A  LEHL+LC ++GIP  G+  +G+GS  +IY ++L FDF RCLG+S
Sbjct  160  HSSPVPHPFTAGHATPLEHLVLCTVIGIPITGSILMGYGSTAMIYGHVLVFDFFRCLGHS  219

Query  559  NVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            N E++P  +F  + +L+Y IY+PTY+ LHH +  TNFCLFMPL+D LG
Sbjct  220  NAEVVPHEVFNKLHLLRYFIYTPTYHSLHHTEMETNFCLFMPLFDALG  267



>ref|XP_008794400.1| PREDICTED: protein ECERIFERUM 3-like [Phoenix dactylifera]
Length=619

 Score =   288 bits (737),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 131/234 (56%), Positives = 169/234 (72%), Gaps = 0/234 (0%)
 Frame = +1

Query  1    VWKESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWD  180
             W++   D WCLH+L+L  LRG VHQLW S+ NMLF  R +RV   G+DF+QIDKEW WD
Sbjct  33   AWEQGQPDRWCLHVLILCVLRGQVHQLWCSFGNMLFLTRRRRVLGDGVDFKQIDKEWDWD  92

Query  181  NFLILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYP  360
            NFLILQ+ + + A  SF S+ NLP W+ +G +  L+LH+G SEPL+Y +HR  H   L+ 
Sbjct  93   NFLILQSFIGALACHSFSSIRNLPRWDPRGALVALLLHVGVSEPLFYWVHRAFHRGYLFA  152

Query  361  LYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFL  540
             YH LHH   VP  FTAG A  LEHL LCV++G P LG  FLG GS  ++Y Y+L FDFL
Sbjct  153  RYHSLHHSIPVPQSFTAGFATPLEHLFLCVVMGAPLLGACFLGTGSAGLVYGYVLLFDFL  212

Query  541  RCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            RC+G+SNVE++P  LF+ +P L+YLIY+PTY+ LHH +K +NFCLFMP +D+LG
Sbjct  213  RCMGHSNVEVLPHGLFQALPFLRYLIYTPTYHSLHHTEKNSNFCLFMPFFDVLG  266



>ref|XP_008804903.1| PREDICTED: protein ECERIFERUM 3-like isoform X2 [Phoenix dactylifera]
Length=565

 Score =   286 bits (732),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 129/234 (55%), Positives = 167/234 (71%), Gaps = 0/234 (0%)
 Frame = +1

Query  1    VWKESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWD  180
             W++   D WCLHIL+L  LRG +HQLWSS+ NMLF  R +RV   G+DF+QIDKEW WD
Sbjct  33   AWEQGKADQWCLHILILCSLRGFIHQLWSSFHNMLFLTRRRRVLSDGVDFKQIDKEWDWD  92

Query  181  NFLILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYP  360
            NFLILQ+ + +  Y SF  + NLP W+ +G V  L+LH+G SEPL+Y +HR  H+  L+ 
Sbjct  93   NFLILQSFIGALVYYSFLPIRNLPLWDPRGAVVALLLHVGVSEPLFYWVHRAFHTGYLFS  152

Query  361  LYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFL  540
             YH  HH   VP  FTAG A  LEHL LC ++G+P LG   LG GS  ++Y Y+L FDFL
Sbjct  153  HYHSFHHSIPVPQSFTAGFATPLEHLFLCAVMGVPILGACLLGTGSAGLVYGYVLLFDFL  212

Query  541  RCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            RC+G+ NVE++P  LF  +P+L+YLIY+PTY+ LHH +K +NFCLFMPL+D LG
Sbjct  213  RCMGHCNVEVLPHGLFDALPLLRYLIYTPTYHSLHHREKNSNFCLFMPLFDALG  266



>gb|KEH32582.1| fatty acid hydroxylase superfamily protein [Medicago truncatula]
Length=633

 Score =   288 bits (736),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 130/225 (58%), Positives = 168/225 (75%), Gaps = 0/225 (0%)
 Frame = +1

Query  28   WCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAIL  207
            WC+H+LVL GLR L+H  WSSYSNMLF  R +R+ QQG+DF+QIDKEW WDNFLILQ ++
Sbjct  45   WCIHLLVLCGLRTLLHVFWSSYSNMLFLTRNRRILQQGVDFKQIDKEWDWDNFLILQTLV  104

Query  208  ASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLHHDS  387
            A+     FP L +LP W  KG++  ++LH+G SEPLYY +H+  H   L+  YH LHH S
Sbjct  105  ATLVSYIFPFLQHLPLWNVKGIIVAMILHVGVSEPLYYWVHKKFHGDYLFKNYHSLHHSS  164

Query  388  KVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYSNVE  567
             VP P TAG+A FLEHL+L  ++GIP  G + +G+GS  ++Y Y+L FDFLRCLG+ NVE
Sbjct  165  PVPTPLTAGNATFLEHLILMAVIGIPIFGASMMGYGSGSLVYGYVLIFDFLRCLGHCNVE  224

Query  568  IMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            I+P  LFK  P L+Y+I++PTY+ LHH +K TNFCLFMPL+D LG
Sbjct  225  IIPHKLFKAFPFLRYVIHTPTYHNLHHTEKDTNFCLFMPLFDALG  269



>ref|XP_008804902.1| PREDICTED: protein ECERIFERUM 3-like isoform X1 [Phoenix dactylifera]
Length=619

 Score =   286 bits (731),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 129/234 (55%), Positives = 167/234 (71%), Gaps = 0/234 (0%)
 Frame = +1

Query  1    VWKESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWD  180
             W++   D WCLHIL+L  LRG +HQLWSS+ NMLF  R +RV   G+DF+QIDKEW WD
Sbjct  33   AWEQGKADQWCLHILILCSLRGFIHQLWSSFHNMLFLTRRRRVLSDGVDFKQIDKEWDWD  92

Query  181  NFLILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYP  360
            NFLILQ+ + +  Y SF  + NLP W+ +G V  L+LH+G SEPL+Y +HR  H+  L+ 
Sbjct  93   NFLILQSFIGALVYYSFLPIRNLPLWDPRGAVVALLLHVGVSEPLFYWVHRAFHTGYLFS  152

Query  361  LYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFL  540
             YH  HH   VP  FTAG A  LEHL LC ++G+P LG   LG GS  ++Y Y+L FDFL
Sbjct  153  HYHSFHHSIPVPQSFTAGFATPLEHLFLCAVMGVPILGACLLGTGSAGLVYGYVLLFDFL  212

Query  541  RCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            RC+G+ NVE++P  LF  +P+L+YLIY+PTY+ LHH +K +NFCLFMPL+D LG
Sbjct  213  RCMGHCNVEVLPHGLFDALPLLRYLIYTPTYHSLHHREKNSNFCLFMPLFDALG  266



>gb|EPS72440.1| hypothetical protein M569_02318, partial [Genlisea aurea]
Length=394

 Score =   279 bits (713),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 124/225 (55%), Positives = 168/225 (75%), Gaps = 0/225 (0%)
 Frame = +1

Query  19   EDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQ  198
            +  WC  +LV+  LR LVHQ WSSYS MLF NR +R+ +QGI++ QID+EWHWD+FLILQ
Sbjct  24   QQSWCFLVLVVLALRALVHQFWSSYSCMLFLNRTRRIDEQGIEYSQIDEEWHWDDFLILQ  83

Query  199  AILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLH  378
              +ASF YMS P L +LP W+++G++ C+ LH+  SEPLYY +HRLLH+  L+  YHW H
Sbjct  84   TGIASFLYMSSPPLMDLPFWDWRGIICCVALHVIVSEPLYYWIHRLLHADVLFRRYHWYH  143

Query  379  HDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYS  558
            H SKV HPFT      +EH+++CV+VGIP +GT  +G GS+   + Y+L FDFL+CL +S
Sbjct  144  HSSKVLHPFTGSHLTLMEHVVICVVVGIPIVGTHLIGFGSMSSTFGYLLCFDFLQCLKHS  203

Query  559  NVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYD  693
            NVE+ PS LF  +PVLKYL+ +P+Y+ LHH +  +NFCLF+P+YD
Sbjct  204  NVEVFPSRLFDAVPVLKYLVCTPSYHSLHHKEMGSNFCLFLPVYD  248



>ref|XP_010545442.1| PREDICTED: protein ECERIFERUM 3 isoform X2 [Tarenaya hassleriana]
Length=523

 Score =   283 bits (723),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 132/233 (57%), Positives = 170/233 (73%), Gaps = 1/233 (0%)
 Frame = +1

Query  7    KESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNF  186
            +E+     CLHILV++ LRGLVH L+SS+SNMLF  R +R+ QQG+DF QID EWHWDNF
Sbjct  36   EENPRATLCLHILVISALRGLVHVLFSSFSNMLFLTRTRRIDQQGVDFNQIDHEWHWDNF  95

Query  187  LILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHS-SDLYPL  363
            ++LQAI+AS A    P L +LP W  +G +  +VLH+  SEPLYY++HR  H  S L+  
Sbjct  96   ILLQAIIASVACYMTPFLNSLPLWNPRGFIALIVLHVTISEPLYYIVHRCFHGYSPLFTH  155

Query  364  YHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLR  543
            YH  HH S VPHP TAG+A FLEH++LC+I+G P LG+  LG GS   IY Y++ FDFLR
Sbjct  156  YHSFHHSSPVPHPMTAGNATFLEHIVLCIIIGAPLLGSCLLGVGSTSSIYGYVVMFDFLR  215

Query  544  CLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            C+G+ N EI+  ++FKT P L+YL+Y+PTY+ LH  D  TNFCLFMPL+D LG
Sbjct  216  CMGHCNAEIISHNVFKTFPFLRYLLYTPTYHNLHRRDMGTNFCLFMPLFDALG  268



>gb|KJB83323.1| hypothetical protein B456_013G242200 [Gossypium raimondii]
Length=624

 Score =   286 bits (731),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 130/228 (57%), Positives = 167/228 (73%), Gaps = 3/228 (1%)
 Frame = +1

Query  19   EDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQ  198
            +D+WC+HIL++  LRGL+HQLWSSY+NM F  R + + QQG+DF+QID EW WDNF+ILQ
Sbjct  40   KDLWCIHILLICTLRGLIHQLWSSYNNMFFLTRNRWIKQQGVDFKQIDDEWDWDNFIILQ  99

Query  199  AILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLH  378
            A+LAS A + FPSL  LP W  KG +  L+LH+  SEPLYY  HR  H   L+  YH LH
Sbjct  100  AMLASMASLIFPSLNTLPLWNLKGFIASLLLHVTISEPLYYWAHRFFHKPYLFNHYHSLH  159

Query  379  HDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYS  558
            H S VPHPFTAG A  LEHL+LC ++GIP  G+  +G+GS  +IY ++L FDF RCLG+S
Sbjct  160  HSSPVPHPFTAGHATPLEHLVLCTVIGIPITGSILMGYGSTAMIYGHVLVFDFFRCLGHS  219

Query  559  NVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            N E++P  +F  +P+L+Y IY+PT   LHH +  TNFCLFMPL+D LG
Sbjct  220  NAEVVPHEVFNKLPLLRYFIYTPT---LHHTEMETNFCLFMPLFDALG  264



>gb|EYU37115.1| hypothetical protein MIMGU_mgv1a021583mg [Erythranthe guttata]
Length=609

 Score =   285 bits (729),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 128/232 (55%), Positives = 169/232 (73%), Gaps = 0/232 (0%)
 Frame = +1

Query  7    KESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNF  186
            +ES ++ WCLHI ++  LR  V+QLW+SYSNMLF NR + + ++G+DF+QIDKEWHWDNF
Sbjct  36   QESMKESWCLHIFIICMLRLFVYQLWTSYSNMLFLNRNRIIVKKGVDFKQIDKEWHWDNF  95

Query  187  LILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLY  366
            ++LQAI+A+     F +L   P W   G    L LH+  SEPL+Y +H+  H   L+  Y
Sbjct  96   ILLQAIVAALVLNVFRTLEKEPLWNKNGFAAALALHVAISEPLFYSIHKCFHGKYLFENY  155

Query  367  HWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRC  546
            H+LHH S VP P+TAG   FLEHLLL V+VG+P +GT  +G GSI +IY Y+L FDFLRC
Sbjct  156  HFLHHSSPVPQPYTAGHGTFLEHLLLTVVVGVPIVGTFIIGRGSISLIYGYVLVFDFLRC  215

Query  547  LGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            LG+SNVEI+P  +F  IP LKY++Y+PTY+ LHH +  TN+CLFMPL+D LG
Sbjct  216  LGHSNVEIIPHQVFDAIPFLKYILYTPTYHNLHHAETNTNYCLFMPLFDALG  267



>ref|XP_009417462.1| PREDICTED: protein ECERIFERUM 3-like [Musa acuminata subsp. malaccensis]
Length=620

 Score =   285 bits (728),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 131/232 (56%), Positives = 181/232 (78%), Gaps = 0/232 (0%)
 Frame = +1

Query  7    KESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNF  186
            +ES E  WCLH+++L  LRGL++QLW S+ NMLF  R +R+ + G+DF+QID+EWHWDNF
Sbjct  36   EESKEGRWCLHLMILFALRGLMYQLWYSFGNMLFLVRRRRIFKDGVDFKQIDQEWHWDNF  95

Query  187  LILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLY  366
            LILQ ++ + A + FPSL +LP W+  G++  L+LH+ FSEP++Y +HR+LH   L+  Y
Sbjct  96   LILQCMIGALACLIFPSLQSLPRWDLMGLLTALLLHVVFSEPVFYCLHRVLHRPHLFQNY  155

Query  367  HWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRC  546
            H LHH S+VP  FTAG A  LEHL+LCV++G+P LG   +G GS  +IY Y+L FDFLRC
Sbjct  156  HSLHHSSQVPQSFTAGFATPLEHLILCVVMGVPLLGACLVGRGSAGLIYGYVLLFDFLRC  215

Query  547  LGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            +G+SNVEI P  LF+++P+L+YLIY+PTY+ LH M+K++NFCLFMPL+D+LG
Sbjct  216  MGHSNVEIFPHGLFQSLPLLRYLIYTPTYHSLHRMEKKSNFCLFMPLFDLLG  267



>gb|KDO62362.1| hypothetical protein CISIN_1g006768mg [Citrus sinensis]
Length=487

 Score =   280 bits (716),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 130/235 (55%), Positives = 176/235 (75%), Gaps = 1/235 (0%)
 Frame = +1

Query  1    VWKESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWD  180
            V+++   + WCLHIL+++ LRGL+H LW+S+SNMLF NRA++++Q+G+DF+QID EW+WD
Sbjct  33   VYEDKRIEYWCLHILIISVLRGLIHILWNSFSNMLFLNRARQINQRGVDFKQIDNEWNWD  92

Query  181  NFLILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSD-LY  357
            NF++LQA +AS  Y  FP   +LP W  KG +   +LH+  SEPLYY++HR  H +  L+
Sbjct  93   NFILLQAAIASMGYYIFPCSESLPRWNTKGFIALQILHVAVSEPLYYVLHRHFHRNKYLF  152

Query  358  PLYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDF  537
              YH LHH S VP   TAG A  LEH++L  IV IP LG++ +G+GSI +IY YIL FDF
Sbjct  153  IHYHSLHHSSPVPQIPTAGHATLLEHIVLSAIVAIPILGSSIIGYGSISLIYGYILMFDF  212

Query  538  LRCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            LRCLG+ NVEI+P   F+T P L+YL+Y+PTY+ LHH +K +NFCLFMPL+D LG
Sbjct  213  LRCLGHCNVEIIPHRWFETFPFLRYLLYTPTYHSLHHTEKDSNFCLFMPLFDALG  267



>ref|XP_011070158.1| PREDICTED: protein ECERIFERUM 3-like [Sesamum indicum]
Length=626

 Score =   284 bits (726),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 127/232 (55%), Positives = 169/232 (73%), Gaps = 0/232 (0%)
 Frame = +1

Query  7    KESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNF  186
            +ES +D W LHI ++  LR L++Q W+SYSNMLFF R +++ ++G+DF QIDKEW WDNF
Sbjct  35   EESMKDAWSLHIFIVCMLRLLMYQAWTSYSNMLFFTRNRQIVKKGVDFRQIDKEWDWDNF  94

Query  187  LILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLY  366
            ++LQAI+A  A   FP+ A L  W   G+   + LH+  SEPL+Y +H+  H   L+  Y
Sbjct  95   ILLQAIVAGLALYIFPTSATLAVWNQTGITTAIALHVAISEPLFYTIHKSFHGDYLFTNY  154

Query  367  HWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRC  546
            H LHH S VP P+TAG A FLEHL L V++G+P +G+  +GHGSII+IY Y+L FD LRC
Sbjct  155  HSLHHSSPVPQPYTAGHATFLEHLFLTVVIGVPIIGSFAVGHGSIILIYGYVLVFDLLRC  214

Query  547  LGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            LG+SNVEI+P  LF  +P LKY+IY+PTY+ LHH +  TN+CLFMPL+D LG
Sbjct  215  LGHSNVEIVPHQLFDLVPFLKYIIYTPTYHSLHHAEMETNYCLFMPLFDALG  266



>gb|KJB23545.1| hypothetical protein B456_004G104100 [Gossypium raimondii]
Length=525

 Score =   281 bits (719),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 133/234 (57%), Positives = 175/234 (75%), Gaps = 0/234 (0%)
 Frame = +1

Query  1    VWKESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWD  180
            ++++S +D+WCLHILV+  LRGL+HQLW+SYS  LF  R +R+ Q+G+DF+QID+EW WD
Sbjct  33   IYEDSIKDLWCLHILVICALRGLIHQLWNSYSTTLFLTRNRRIKQEGVDFKQIDREWDWD  92

Query  181  NFLILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYP  360
            NFLIL A+LA  A + FPSL +LP W  KG +  L LH+  SEPLYY  HR  H   L+ 
Sbjct  93   NFLILHALLAYMACLIFPSLDDLPLWNPKGFITLLFLHVTVSEPLYYWAHRYFHEGYLFT  152

Query  361  LYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFL  540
             YH LHH S V HP+TAG A FLEHL+LCV++GIP  G+  +G+GS  ++Y Y+ AFDFL
Sbjct  153  HYHSLHHSSSVTHPYTAGHATFLEHLILCVVIGIPMAGSITMGYGSTSMVYGYVSAFDFL  212

Query  541  RCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            RCLG+SNVE++P  +F  +P LKY +Y+PTY+ LHH +  TNFCLFMPL+D +G
Sbjct  213  RCLGHSNVEVVPHEVFNKLPFLKYFLYTPTYHSLHHTEMGTNFCLFMPLFDAMG  266



>emb|CDY11848.1| BnaC03g12740D [Brassica napus]
Length=631

 Score =   283 bits (725),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 132/237 (56%), Positives = 178/237 (75%), Gaps = 5/237 (2%)
 Frame = +1

Query  7    KESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNF  186
            ++ W   WCL+IL++ GL+GLVH LWS+Y+NMLF  R  R++ +G+DF+QID EW+WDN+
Sbjct  35   EDYWRAFWCLNILIICGLKGLVHVLWSTYNNMLFLTRTLRINPKGVDFKQIDHEWNWDNY  94

Query  187  LILQAILASF-AYMSFPSL---ANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSD-  351
            ++LQAILAS   YMS PS+   + +P W  KG++  LVLH+ FSEPLYY +HR +H ++ 
Sbjct  95   ILLQAILASMICYMSTPSMMIISTIPLWNTKGLIVLLVLHVTFSEPLYYFLHRSVHRNNY  154

Query  352  LYPLYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAF  531
            L+  YH  HH S VP+P TA +A  LE LLLCV+ G+P +G+  LG GSI +IY Y + F
Sbjct  155  LFTNYHSFHHSSPVPNPMTANNATLLESLLLCVVAGVPLIGSFLLGVGSISLIYGYAITF  214

Query  532  DFLRCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            DFLRCLG+ NVEI    LF+T+P+L+YLIY+PTY+ LHH D  TNFCLFMP++D+LG
Sbjct  215  DFLRCLGHCNVEIFSHKLFETLPILRYLIYTPTYHSLHHQDMETNFCLFMPIFDVLG  271



>ref|XP_010047031.1| PREDICTED: protein ECERIFERUM 3 [Eucalyptus grandis]
 gb|KCW78780.1| hypothetical protein EUGRSUZ_C00214 [Eucalyptus grandis]
Length=624

 Score =   283 bits (723),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 128/232 (55%), Positives = 175/232 (75%), Gaps = 0/232 (0%)
 Frame = +1

Query  7    KESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNF  186
            +++ +  WCLH+L++ GLR   H L+ ++ NMLF N ++R+ +QG+DF+QID+EW WDNF
Sbjct  35   EDTAKSSWCLHLLIIWGLRSFTHVLFGAFGNMLFLNLSRRIIKQGVDFKQIDREWDWDNF  94

Query  187  LILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLY  366
            LILQA +AS AY  FP LA+LP W  +G++  L+LH+G SEPLYY +HR  H   L+  Y
Sbjct  95   LILQAFVASMAYYIFPILADLPLWNARGLITVLMLHIGASEPLYYWVHRHFHGKYLFTNY  154

Query  367  HWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRC  546
            H LHH+S VP  FTAG A FLEHL+L VI GIP LG+ +LGHGS+ ++Y Y++ FD LRC
Sbjct  155  HSLHHESAVPQSFTAGHATFLEHLILTVIAGIPILGSVWLGHGSLSLVYGYLVMFDVLRC  214

Query  547  LGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            LG+ NVE +P+ +F+ +P L+YLIY+PTY+ LHH +  TNFCLFMPL+D +G
Sbjct  215  LGHCNVEFIPNRIFEILPFLRYLIYTPTYHSLHHTEMDTNFCLFMPLFDAVG  266



>ref|XP_010545441.1| PREDICTED: protein ECERIFERUM 3 isoform X1 [Tarenaya hassleriana]
Length=629

 Score =   281 bits (720),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 132/233 (57%), Positives = 170/233 (73%), Gaps = 1/233 (0%)
 Frame = +1

Query  7    KESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNF  186
            +E+     CLHILV++ LRGLVH L+SS+SNMLF  R +R+ QQG+DF QID EWHWDNF
Sbjct  36   EENPRATLCLHILVISALRGLVHVLFSSFSNMLFLTRTRRIDQQGVDFNQIDHEWHWDNF  95

Query  187  LILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHS-SDLYPL  363
            ++LQAI+AS A    P L +LP W  +G +  +VLH+  SEPLYY++HR  H  S L+  
Sbjct  96   ILLQAIIASVACYMTPFLNSLPLWNPRGFIALIVLHVTISEPLYYIVHRCFHGYSPLFTH  155

Query  364  YHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLR  543
            YH  HH S VPHP TAG+A FLEH++LC+I+G P LG+  LG GS   IY Y++ FDFLR
Sbjct  156  YHSFHHSSPVPHPMTAGNATFLEHIVLCIIIGAPLLGSCLLGVGSTSSIYGYVVMFDFLR  215

Query  544  CLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            C+G+ N EI+  ++FKT P L+YL+Y+PTY+ LH  D  TNFCLFMPL+D LG
Sbjct  216  CMGHCNAEIISHNVFKTFPFLRYLLYTPTYHNLHRRDMGTNFCLFMPLFDALG  268



>ref|XP_010914063.1| PREDICTED: protein ECERIFERUM 3 isoform X2 [Elaeis guineensis]
Length=596

 Score =   281 bits (718),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 126/234 (54%), Positives = 167/234 (71%), Gaps = 0/234 (0%)
 Frame = +1

Query  1    VWKESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWD  180
             W++   D WCLHIL+L  LRG +HQLWSS+ NMLF  R +RV   G+DF+QID+EW WD
Sbjct  33   AWEQGKADQWCLHILILCALRGSIHQLWSSFHNMLFLTRRRRVLSDGVDFKQIDEEWDWD  92

Query  181  NFLILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYP  360
            NFLILQ+ + +  Y SF  +  LP W+ KG +  L+LH+G SEPL+Y +HR  H+  L+ 
Sbjct  93   NFLILQSFIGALVYYSFLPIRKLPLWDPKGAIVALLLHVGISEPLFYWVHRAFHTGYLFT  152

Query  361  LYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFL  540
             YH  HH   VP  FTAG    LEHL LCV++G+P LG   LG GS  ++Y Y+L FDFL
Sbjct  153  RYHSFHHSIPVPQSFTAGYGTPLEHLFLCVVMGVPILGACLLGTGSAGLVYGYVLLFDFL  212

Query  541  RCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            RC+G+SNVE++P  LF+ +P L++LIY+PTY+ LHH +K +NFCLFMPL+D+ G
Sbjct  213  RCMGHSNVEVLPHGLFEALPFLRHLIYTPTYHSLHHTEKNSNFCLFMPLFDVWG  266



>ref|XP_010914062.1| PREDICTED: protein ECERIFERUM 3 isoform X1 [Elaeis guineensis]
Length=619

 Score =   281 bits (718),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 126/234 (54%), Positives = 167/234 (71%), Gaps = 0/234 (0%)
 Frame = +1

Query  1    VWKESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWD  180
             W++   D WCLHIL+L  LRG +HQLWSS+ NMLF  R +RV   G+DF+QID+EW WD
Sbjct  33   AWEQGKADQWCLHILILCALRGSIHQLWSSFHNMLFLTRRRRVLSDGVDFKQIDEEWDWD  92

Query  181  NFLILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYP  360
            NFLILQ+ + +  Y SF  +  LP W+ KG +  L+LH+G SEPL+Y +HR  H+  L+ 
Sbjct  93   NFLILQSFIGALVYYSFLPIRKLPLWDPKGAIVALLLHVGISEPLFYWVHRAFHTGYLFT  152

Query  361  LYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFL  540
             YH  HH   VP  FTAG    LEHL LCV++G+P LG   LG GS  ++Y Y+L FDFL
Sbjct  153  RYHSFHHSIPVPQSFTAGYGTPLEHLFLCVVMGVPILGACLLGTGSAGLVYGYVLLFDFL  212

Query  541  RCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            RC+G+SNVE++P  LF+ +P L++LIY+PTY+ LHH +K +NFCLFMPL+D+ G
Sbjct  213  RCMGHSNVEVLPHGLFEALPFLRHLIYTPTYHSLHHTEKNSNFCLFMPLFDVWG  266



>ref|XP_009622102.1| PREDICTED: protein ECERIFERUM 3-like [Nicotiana tomentosiformis]
Length=291

 Score =   270 bits (691),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 126/225 (56%), Positives = 169/225 (75%), Gaps = 0/225 (0%)
 Frame = +1

Query  28   WCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAIL  207
            WCLH+L+L  LRG+++QLWSS+SNMLF  R +R+ + G+DF QIDKEW WDNF++L A++
Sbjct  42   WCLHVLILCSLRGIIYQLWSSFSNMLFLTRNRRIIKGGVDFRQIDKEWDWDNFVLLHALM  101

Query  208  ASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLHHDS  387
            A+ AY  FP+L NLP W+  G+V   +LH+  SEPLYY +H+  H S L+  YH LHH S
Sbjct  102  ATLAYYMFPNLVNLPIWDLSGLVVITILHIVISEPLYYFLHKCFHGSYLFSHYHSLHHSS  161

Query  388  KVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYSNVE  567
             +P PFTAG A FLE +LL  ++GIP LG+  +G+GS+ +IY Y+L FDFLRCLG+ N E
Sbjct  162  AIPQPFTAGHATFLEQILLGGVIGIPILGSCLMGYGSVAIIYGYVLIFDFLRCLGHCNFE  221

Query  568  IMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            I+P  LF   P +KYL+Y+PTY+ LHH +  TN+CLFMPL+D+LG
Sbjct  222  ILPHQLFLAFPFMKYLLYTPTYHNLHHTEIETNYCLFMPLFDVLG  266



>ref|XP_006350059.1| PREDICTED: protein ECERIFERUM 3-like [Solanum tuberosum]
Length=629

 Score =   280 bits (717),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 130/232 (56%), Positives = 173/232 (75%), Gaps = 0/232 (0%)
 Frame = +1

Query  7    KESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNF  186
            ++S    WCLH+L+L  LRGL++QLWSS+SNMLF  R +R+ +QG+ F+QID+EW WDNF
Sbjct  35   EDSIMATWCLHVLILCSLRGLIYQLWSSFSNMLFLTRNRRIIKQGVGFKQIDEEWDWDNF  94

Query  187  LILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLY  366
            ++LQAI+AS AY +FP+  N+P W   G +  ++LH+  SEPLYY  H+L H S L+  Y
Sbjct  95   ILLQAIMASLAYYTFPNTINIPIWNLNGFIMIIILHIVISEPLYYYFHKLFHGSYLFRNY  154

Query  367  HWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRC  546
            H LHH S VP PFTAG A FLE ++L  ++GIP LG   +G+GSI +IYSY+L FDFLRC
Sbjct  155  HSLHHSSAVPQPFTAGHATFLEQIILGGVIGIPILGCYVMGYGSIAMIYSYVLVFDFLRC  214

Query  547  LGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            LG+ N EI+P  LF   P +KYLIY+PTY+ LHH +  TN+CLFMPL+D++G
Sbjct  215  LGHCNFEIIPHQLFLAFPFMKYLIYTPTYHSLHHTEMGTNYCLFMPLFDVIG  266



>gb|KJB23541.1| hypothetical protein B456_004G104100 [Gossypium raimondii]
Length=624

 Score =   280 bits (716),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 133/234 (57%), Positives = 175/234 (75%), Gaps = 0/234 (0%)
 Frame = +1

Query  1    VWKESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWD  180
            ++++S +D+WCLHILV+  LRGL+HQLW+SYS  LF  R +R+ Q+G+DF+QID+EW WD
Sbjct  33   IYEDSIKDLWCLHILVICALRGLIHQLWNSYSTTLFLTRNRRIKQEGVDFKQIDREWDWD  92

Query  181  NFLILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYP  360
            NFLIL A+LA  A + FPSL +LP W  KG +  L LH+  SEPLYY  HR  H   L+ 
Sbjct  93   NFLILHALLAYMACLIFPSLDDLPLWNPKGFITLLFLHVTVSEPLYYWAHRYFHEGYLFT  152

Query  361  LYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFL  540
             YH LHH S V HP+TAG A FLEHL+LCV++GIP  G+  +G+GS  ++Y Y+ AFDFL
Sbjct  153  HYHSLHHSSSVTHPYTAGHATFLEHLILCVVIGIPMAGSITMGYGSTSMVYGYVSAFDFL  212

Query  541  RCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            RCLG+SNVE++P  +F  +P LKY +Y+PTY+ LHH +  TNFCLFMPL+D +G
Sbjct  213  RCLGHSNVEVVPHEVFNKLPFLKYFLYTPTYHSLHHTEMGTNFCLFMPLFDAMG  266



>ref|XP_006279594.1| hypothetical protein CARUB_v10026077mg [Capsella rubella]
 gb|EOA12492.1| hypothetical protein CARUB_v10026077mg [Capsella rubella]
Length=629

 Score =   280 bits (716),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 131/234 (56%), Positives = 175/234 (75%), Gaps = 6/234 (3%)
 Frame = +1

Query  19   EDI----WCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNF  186
            EDI    WCLHIL++ GL+ LVH+LWS ++NMLF  R  R++ +GIDF+QID EWHWDN+
Sbjct  36   EDISKVLWCLHILIICGLKALVHELWSVFNNMLFVTRTLRINPKGIDFKQIDHEWHWDNY  95

Query  187  LILQAILASF-AYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSD-LYP  360
            +ILQA++AS   YMS P + +LP W  KG++  +VLH+ FSEPLYY +H+  H ++  + 
Sbjct  96   IILQAMIASLICYMSPPLMNSLPLWNTKGLIALIVLHVTFSEPLYYFLHKSFHRNNYFFT  155

Query  361  LYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFL  540
             YH  HH S VPHP TAG+A  LE+L+LCV+ G+P +G+   G GS+ VIY Y + FDF+
Sbjct  156  HYHSFHHSSPVPHPMTAGNATLLENLILCVVAGVPLIGSCLFGVGSLSVIYGYAVMFDFM  215

Query  541  RCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            RCLG+ NVEI    LF+T+P L+YLIY+PTY+GLHH +  TNFCLFMPL+D+LG
Sbjct  216  RCLGHCNVEIFSHKLFETLPFLRYLIYTPTYHGLHHQEMGTNFCLFMPLFDVLG  269



>gb|KJB23544.1| hypothetical protein B456_004G104100 [Gossypium raimondii]
Length=625

 Score =   280 bits (716),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 133/234 (57%), Positives = 175/234 (75%), Gaps = 0/234 (0%)
 Frame = +1

Query  1    VWKESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWD  180
            ++++S +D+WCLHILV+  LRGL+HQLW+SYS  LF  R +R+ Q+G+DF+QID+EW WD
Sbjct  33   IYEDSIKDLWCLHILVICALRGLIHQLWNSYSTTLFLTRNRRIKQEGVDFKQIDREWDWD  92

Query  181  NFLILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYP  360
            NFLIL A+LA  A + FPSL +LP W  KG +  L LH+  SEPLYY  HR  H   L+ 
Sbjct  93   NFLILHALLAYMACLIFPSLDDLPLWNPKGFITLLFLHVTVSEPLYYWAHRYFHEGYLFT  152

Query  361  LYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFL  540
             YH LHH S V HP+TAG A FLEHL+LCV++GIP  G+  +G+GS  ++Y Y+ AFDFL
Sbjct  153  HYHSLHHSSSVTHPYTAGHATFLEHLILCVVIGIPMAGSITMGYGSTSMVYGYVSAFDFL  212

Query  541  RCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            RCLG+SNVE++P  +F  +P LKY +Y+PTY+ LHH +  TNFCLFMPL+D +G
Sbjct  213  RCLGHSNVEVVPHEVFNKLPFLKYFLYTPTYHSLHHTEMGTNFCLFMPLFDAMG  266



>gb|KDO62360.1| hypothetical protein CISIN_1g006768mg [Citrus sinensis]
 gb|KDO62361.1| hypothetical protein CISIN_1g006768mg [Citrus sinensis]
Length=632

 Score =   280 bits (715),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 130/235 (55%), Positives = 176/235 (75%), Gaps = 1/235 (0%)
 Frame = +1

Query  1    VWKESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWD  180
            V+++   + WCLHIL+++ LRGL+H LW+S+SNMLF NRA++++Q+G+DF+QID EW+WD
Sbjct  33   VYEDKRIEYWCLHILIISVLRGLIHILWNSFSNMLFLNRARQINQRGVDFKQIDNEWNWD  92

Query  181  NFLILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSD-LY  357
            NF++LQA +AS  Y  FP   +LP W  KG +   +LH+  SEPLYY++HR  H +  L+
Sbjct  93   NFILLQAAIASMGYYIFPCSESLPRWNTKGFIALQILHVAVSEPLYYVLHRHFHRNKYLF  152

Query  358  PLYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDF  537
              YH LHH S VP   TAG A  LEH++L  IV IP LG++ +G+GSI +IY YIL FDF
Sbjct  153  IHYHSLHHSSPVPQIPTAGHATLLEHIVLSAIVAIPILGSSIIGYGSISLIYGYILMFDF  212

Query  538  LRCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            LRCLG+ NVEI+P   F+T P L+YL+Y+PTY+ LHH +K +NFCLFMPL+D LG
Sbjct  213  LRCLGHCNVEIIPHRWFETFPFLRYLLYTPTYHSLHHTEKDSNFCLFMPLFDALG  267



>ref|XP_002308430.2| hypothetical protein POPTR_0006s19140g [Populus trichocarpa]
 gb|EEE91953.2| hypothetical protein POPTR_0006s19140g [Populus trichocarpa]
Length=633

 Score =   278 bits (712),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/230 (56%), Positives = 168/230 (73%), Gaps = 1/230 (0%)
 Frame = +1

Query  13   SWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLI  192
            S++D WCLHIL++   R  +HQLWSSY  MLF  R +R++Q G DF+QIDKEW WDNF++
Sbjct  37   SFKDDWCLHILIICVARSSLHQLWSSYVTMLFLTRNRRINQHGYDFKQIDKEWDWDNFIL  96

Query  193  LQAILASFA-YMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYH  369
            LQA++AS A Y+  P + N+P W  KG +  L LH+G SEPLYY +HR  H S L+  YH
Sbjct  97   LQALIASMACYIDPPFIENVPLWNAKGFITILSLHVGISEPLYYWVHRCFHESYLFNQYH  156

Query  370  WLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCL  549
             +HH S V HPFT  +A FLEHL L  ++G+P +G+  LG+GS I+IY Y+L FDFLRCL
Sbjct  157  SIHHSSPVLHPFTGATATFLEHLALTTVIGLPIIGSCMLGNGSRIMIYGYLLMFDFLRCL  216

Query  550  GYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDML  699
            G+ NVE++P  LF T+P L+YL+Y+PTY+ LHH D  TNFCLFMP +D +
Sbjct  217  GHCNVEVVPHQLFDTLPSLRYLLYTPTYHSLHHTDMGTNFCLFMPFFDAI  266



>ref|XP_011012180.1| PREDICTED: protein ECERIFERUM 3-like [Populus euphratica]
Length=527

 Score =   275 bits (704),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 127/232 (55%), Positives = 170/232 (73%), Gaps = 1/232 (0%)
 Frame = +1

Query  7    KESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNF  186
            + S++D WCLHIL++   R  +HQLWSSY NMLF    +R++Q G DF+QIDKEW WDNF
Sbjct  35   EGSFKDDWCLHILIICVARSSLHQLWSSYVNMLFLTCNRRINQHGYDFKQIDKEWDWDNF  94

Query  187  LILQAILASFA-YMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPL  363
            ++LQA++AS A Y+  P + N+P W  +G +  L LH+G SEPLYY +HR  H S L+  
Sbjct  95   ILLQALIASMACYIDQPFIENVPLWNAEGFIIILSLHVGVSEPLYYWVHRCFHKSYLFNQ  154

Query  364  YHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLR  543
            YH +HH + V HPFT  +A FLEHL L  +VG+P +G+  LG+GS I+IY Y+L FDFLR
Sbjct  155  YHSIHHSAPVLHPFTGATATFLEHLALTTVVGLPIIGSCMLGNGSRIMIYGYLLVFDFLR  214

Query  544  CLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDML  699
            CLG+ NVE++P  LF T+P L+YL+Y+PTY+ LHH D+ TNFCLFMP +D +
Sbjct  215  CLGHCNVEVVPHQLFDTLPSLRYLLYTPTYHSLHHTDRGTNFCLFMPFFDAI  266



>ref|XP_006453492.1| hypothetical protein CICLE_v10007738mg [Citrus clementina]
 ref|XP_006474093.1| PREDICTED: protein ECERIFERUM 3-like [Citrus sinensis]
 gb|ESR66732.1| hypothetical protein CICLE_v10007738mg [Citrus clementina]
Length=632

 Score =   277 bits (708),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 129/235 (55%), Positives = 174/235 (74%), Gaps = 1/235 (0%)
 Frame = +1

Query  1    VWKESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWD  180
            V+++   + WCLHIL ++ LRGL+H LW+S+SNMLF NR ++++Q+G+DF+QID EW+WD
Sbjct  33   VYEDKRIEYWCLHILFISVLRGLIHILWNSFSNMLFLNRTRQINQRGVDFKQIDNEWNWD  92

Query  181  NFLILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSD-LY  357
            NF++LQA +AS  Y  FP   +LP W  KG +   +LH+  SEPLYY++HR  H +  L+
Sbjct  93   NFILLQAAIASMGYYIFPCSESLPRWNTKGFIALQILHVAVSEPLYYVLHRHFHRNKYLF  152

Query  358  PLYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDF  537
              YH LHH S VP   TAG A  LEH++L  IV IP LG++ +G+GSI +IY YIL FDF
Sbjct  153  IHYHSLHHSSPVPQIPTAGHATLLEHIVLSAIVAIPILGSSIIGYGSISLIYGYILMFDF  212

Query  538  LRCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            LRCLG+ NVEI+P   F+T P L+YL+Y+PTY+ LHH +K +NFCLFMPL+D LG
Sbjct  213  LRCLGHCNVEIIPHRWFETFPFLRYLLYTPTYHSLHHTEKDSNFCLFMPLFDALG  267



>ref|XP_011079338.1| PREDICTED: protein ECERIFERUM 3-like [Sesamum indicum]
Length=625

 Score =   276 bits (706),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 124/232 (53%), Positives = 168/232 (72%), Gaps = 0/232 (0%)
 Frame = +1

Query  7    KESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNF  186
            +E  ++ WCLHI VL  LR  ++Q W+SYSNMLF  R + + ++G+DF+QIDKEWHWDNF
Sbjct  35   EEITKERWCLHIFVLCMLRLAMYQAWTSYSNMLFLTRNRIIVKKGVDFKQIDKEWHWDNF  94

Query  187  LILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLY  366
            ++LQ I+A      FP+   LP W  KG+   ++LH+  SEPL+Y  H+  H S L+  Y
Sbjct  95   ILLQGIVAFSVLYMFPTFETLPLWNKKGITAAILLHVAISEPLFYSTHKCFHGSYLFTYY  154

Query  367  HWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRC  546
            H LHH S VP  FTAG A FLEHLLL V++G+P +G+  +GHGS+++IY Y+L FD LRC
Sbjct  155  HSLHHSSAVPQAFTAGHATFLEHLLLTVVIGVPIMGSFLIGHGSLMLIYGYVLIFDLLRC  214

Query  547  LGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            LG+SNVEI+P  +F  IP L+Y++Y+PTY+ LHH +  TN+CLFMPL+D LG
Sbjct  215  LGHSNVEIVPYQIFDAIPFLRYILYTPTYHSLHHAEMGTNYCLFMPLFDALG  266



>emb|CDP02895.1| unnamed protein product [Coffea canephora]
Length=631

 Score =   276 bits (705),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 124/228 (54%), Positives = 165/228 (72%), Gaps = 0/228 (0%)
 Frame = +1

Query  19   EDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQ  198
            + +WCLHIL+L  LR  ++  W+SYSNMLF  R +R+ ++G+DF+QIDKEW WDNF++LQ
Sbjct  40   QALWCLHILILCVLRCFMYHSWTSYSNMLFLTRNRRIIKEGVDFKQIDKEWDWDNFILLQ  99

Query  199  AILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLH  378
            A LA+  +  FP LA+LP W  +G +  ++LH+  SEPLYYL H+  H   L+  YH LH
Sbjct  100  AALATLIFYKFPFLADLPLWNTRGFIAIVLLHIAISEPLYYLTHKYFHGKYLFTNYHSLH  159

Query  379  HDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYS  558
            H S VP PFTAG    LEHL+L V++G+P +G  FLG GSI +IY Y+L FD LRCLG+ 
Sbjct  160  HSSPVPQPFTAGHLTLLEHLVLAVVIGVPIVGACFLGLGSISMIYGYVLIFDLLRCLGHC  219

Query  559  NVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            N EI+P  +F+  P L+YL+YSPTY+ LH  +  TNFCLFMP+YD+LG
Sbjct  220  NTEILPHQIFEKFPFLRYLLYSPTYHSLHRTEMGTNFCLFMPIYDLLG  267



>ref|XP_010452800.1| PREDICTED: protein ECERIFERUM 3-like [Camelina sativa]
Length=632

 Score =   275 bits (704),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 128/233 (55%), Positives = 173/233 (74%), Gaps = 5/233 (2%)
 Frame = +1

Query  19   EDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQ  198
            + +WCLHIL++ G + LVHQLWS ++NMLF  R  R++ +GIDF+QID EWHWDN++ILQ
Sbjct  40   KALWCLHILIICGFKALVHQLWSVFNNMLFVTRTLRINPKGIDFKQIDHEWHWDNYIILQ  99

Query  199  AILASF-AYMSFP---SLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSD-LYPL  363
            AI+AS   YMS P    + +LP W  KG++  +VLH+ FSEPLYY +HR +H ++  +  
Sbjct  100  AIIASLICYMSPPLMMMMNSLPLWNTKGLIALIVLHVTFSEPLYYFLHRSIHRNNYFFTH  159

Query  364  YHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLR  543
            YH  HH S VPHP TAG+A  LE+L+LCV+ G+P +G+   G GS+ V+Y Y + FDF+R
Sbjct  160  YHSFHHSSPVPHPMTAGNATLLENLILCVVAGVPLIGSCLFGFGSLSVMYGYAVMFDFMR  219

Query  544  CLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            CLG+ NVEI    LF+T+P L+YLIY+PTY+ LHH +  TNFCLFMPL+D+LG
Sbjct  220  CLGHCNVEIFSHKLFETLPFLRYLIYTPTYHSLHHQEMGTNFCLFMPLFDVLG  272



>gb|KHG27245.1| Protein WAX2 [Gossypium arboreum]
Length=624

 Score =   275 bits (704),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 131/234 (56%), Positives = 173/234 (74%), Gaps = 0/234 (0%)
 Frame = +1

Query  1    VWKESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWD  180
            ++++S +D+WCLHILV+  LRGL+HQLWSSYS  LF  R +R+  +G+DF+QID+EW WD
Sbjct  33   IYEDSIKDLWCLHILVICALRGLIHQLWSSYSTTLFLTRNRRIKPEGVDFKQIDREWDWD  92

Query  181  NFLILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYP  360
            NFLIL A+LA  A + FPSL +LP W  KG +  L LH+  SEPLYY  HR  H   L+ 
Sbjct  93   NFLILHALLAYMACLIFPSLDDLPLWNPKGFITLLFLHVTVSEPLYYWAHRYFHEGYLFT  152

Query  361  LYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFL  540
             YH LHH S V HP+TAG A FLEHL+LC+++GIP   +  +G+GS  ++Y Y+ AFDFL
Sbjct  153  HYHSLHHSSSVTHPYTAGHATFLEHLILCIVIGIPMAASIMMGYGSTSMVYGYVSAFDFL  212

Query  541  RCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            RCLG+SNVE++P  +F  +P LKY +Y+PTY+ LHH +  TNFCLFMPL+D +G
Sbjct  213  RCLGHSNVEVVPHEVFIKLPFLKYFLYTPTYHSLHHTEMGTNFCLFMPLFDAMG  266



>ref|XP_010483318.1| PREDICTED: protein ECERIFERUM 3 [Camelina sativa]
 gb|AIE57504.1| CER3 [Camelina sativa]
Length=632

 Score =   275 bits (703),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 128/233 (55%), Positives = 174/233 (75%), Gaps = 5/233 (2%)
 Frame = +1

Query  19   EDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQ  198
            + +WCLHIL++ GL+ LVH+LWS ++NMLF  R  R++ +GIDF+QID EWHWDN++ILQ
Sbjct  40   KALWCLHILIICGLKALVHELWSVFNNMLFVTRTLRINPKGIDFKQIDHEWHWDNYIILQ  99

Query  199  AILASF-AYMSFP---SLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSD-LYPL  363
            AI+AS   YMS P    + +LP W  KG++  +VLH+ FSEPLYY +H+ +H ++  +  
Sbjct  100  AIIASLICYMSPPLMRMMNSLPLWNTKGLIALIVLHVTFSEPLYYFLHKSIHRNNYFFTH  159

Query  364  YHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLR  543
            YH  HH S VPHP TAG+A  LE+L+LCV+ G+P +G+   G GS+ VIY Y + FDF+R
Sbjct  160  YHSFHHSSPVPHPMTAGNATLLENLVLCVVAGVPLIGSCLFGVGSLSVIYGYAVMFDFMR  219

Query  544  CLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            CLG+ NVEI    LF+T+P L+YLIY+PTY+ LHH +  TNFCLFMPL+D+LG
Sbjct  220  CLGHCNVEIFSHKLFETLPFLRYLIYTPTYHSLHHQEMGTNFCLFMPLFDVLG  272



>ref|XP_011018104.1| PREDICTED: protein ECERIFERUM 3 [Populus euphratica]
Length=632

 Score =   275 bits (702),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 125/230 (54%), Positives = 168/230 (73%), Gaps = 1/230 (0%)
 Frame = +1

Query  13   SWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLI  192
            S++D WCLHIL++   R  +HQLW+S+ NMLF  R +R+++QG DF+QIDKEW WDNF++
Sbjct  37   SFKDDWCLHILIICIARAFLHQLWNSFVNMLFLTRTRRINRQGYDFKQIDKEWDWDNFIL  96

Query  193  LQAILASFA-YMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYH  369
            LQA++AS + Y+  P + N+P W  KG +  L LH+G SEPLYY +HR  H   L+  YH
Sbjct  97   LQALIASISCYIYPPFIGNVPLWNTKGFIAILTLHVGISEPLYYWVHRCFHKGYLFTQYH  156

Query  370  WLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCL  549
              HH S V HP+T   A FLEHL L  ++GIP +G+  +G+GS  +IY Y LAFDFLRCL
Sbjct  157  STHHSSPVLHPYTGADATFLEHLALSTVIGIPIIGSHMMGYGSRSMIYGYPLAFDFLRCL  216

Query  550  GYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDML  699
            G+SNVE++P  LF+T+P L+YL+Y+PTY+ LHH D  TNFCLFMP +D +
Sbjct  217  GHSNVEVVPYQLFETLPFLRYLLYTPTYHSLHHTDMGTNFCLFMPFFDAI  266



>ref|XP_009132107.1| PREDICTED: protein ECERIFERUM 3-like [Brassica rapa]
Length=631

 Score =   274 bits (701),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 126/230 (55%), Positives = 173/230 (75%), Gaps = 5/230 (2%)
 Frame = +1

Query  28   WCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAIL  207
            WCL++L++ GL+GLVH LWS+Y+NMLF  R  R++ +G+DF+QID EW WDN+++LQAIL
Sbjct  42   WCLNVLIICGLKGLVHVLWSTYNNMLFLTRTLRINPKGVDFKQIDHEWDWDNYILLQAIL  101

Query  208  AS-FAYMSFPSL---ANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSD-LYPLYHW  372
            AS   YMS PS+   + +P W  KG++  LVLH+ FSEPLYY +HR +H ++ L+  YH 
Sbjct  102  ASMICYMSTPSMLIISTIPLWNMKGLIVSLVLHVTFSEPLYYFLHRYVHRNNYLFTRYHS  161

Query  373  LHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLG  552
             HH S VP+P TA +A  LE L+LCV+ G+P +G+  LG GSI +IY Y + FDFLRCLG
Sbjct  162  FHHSSPVPNPMTANNATLLESLILCVVAGVPLIGSFLLGVGSISLIYGYAITFDFLRCLG  221

Query  553  YSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            + NV I    +F+T+P+L+YLIY+PTY+ LHH +  TNFCLFMP++D+LG
Sbjct  222  HCNVAIFSHKVFETLPILRYLIYTPTYHSLHHQNMETNFCLFMPIFDVLG  271



>gb|KHG27244.1| Protein WAX2 [Gossypium arboreum]
Length=666

 Score =   275 bits (703),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 131/234 (56%), Positives = 173/234 (74%), Gaps = 0/234 (0%)
 Frame = +1

Query  1    VWKESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWD  180
            ++++S +D+WCLHILV+  LRGL+HQLWSSYS  LF  R +R+  +G+DF+QID+EW WD
Sbjct  33   IYEDSIKDLWCLHILVICALRGLIHQLWSSYSTTLFLTRNRRIKPEGVDFKQIDREWDWD  92

Query  181  NFLILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYP  360
            NFLIL A+LA  A + FPSL +LP W  KG +  L LH+  SEPLYY  HR  H   L+ 
Sbjct  93   NFLILHALLAYMACLIFPSLDDLPLWNPKGFITLLFLHVTVSEPLYYWAHRYFHEGYLFT  152

Query  361  LYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFL  540
             YH LHH S V HP+TAG A FLEHL+LC+++GIP   +  +G+GS  ++Y Y+ AFDFL
Sbjct  153  HYHSLHHSSSVTHPYTAGHATFLEHLILCIVIGIPMAASIMMGYGSTSMVYGYVSAFDFL  212

Query  541  RCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            RCLG+SNVE++P  +F  +P LKY +Y+PTY+ LHH +  TNFCLFMPL+D +G
Sbjct  213  RCLGHSNVEVVPHEVFIKLPFLKYFLYTPTYHSLHHTEMGTNFCLFMPLFDAMG  266



>ref|XP_010904609.1| PREDICTED: protein ECERIFERUM 3-like [Elaeis guineensis]
Length=617

 Score =   273 bits (699),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 126/233 (54%), Positives = 167/233 (72%), Gaps = 0/233 (0%)
 Frame = +1

Query  4    WKESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDN  183
            W     +  CLH+L+L GLRGLV+   +S+SNMLF  R +RV   G+DF+QID+EW WDN
Sbjct  32   WVNGTSNDRCLHLLILCGLRGLVYHFRTSFSNMLFLTRTRRVITDGVDFKQIDREWDWDN  91

Query  184  FLILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPL  363
            FLILQA++ + A+   PSL  LP W+F+G +  L+LH+G SEPL+Y +HR  H+  L+  
Sbjct  92   FLILQALIGAIAFCFVPSLRGLPFWDFRGCIVALLLHVGVSEPLFYWVHRCYHTGYLFTN  151

Query  364  YHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLR  543
            YH LHH SKV  PFTAG    LEHL+L V++G P  G   +G GSI ++Y YIL FD LR
Sbjct  152  YHSLHHSSKVLRPFTAGFGTLLEHLMLGVVMGAPLRGAFLMGSGSISLMYGYILVFDSLR  211

Query  544  CLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            C+GYSNVE+    LF+ +P L+YLIY+PTY+ LHH++K +NFCLFMP+YD+ G
Sbjct  212  CMGYSNVEVFSHGLFEALPFLRYLIYTPTYHSLHHIEKNSNFCLFMPIYDVFG  264



>emb|CDY50795.1| BnaCnng19590D [Brassica napus]
Length=630

 Score =   273 bits (698),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/232 (55%), Positives = 174/232 (75%), Gaps = 4/232 (2%)
 Frame = +1

Query  19   EDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQ  198
              +WCLHIL++ GL+G +H LWS Y+NML+ +R  R++  G+DF+QID EWHWDN+++LQ
Sbjct  39   RALWCLHILIICGLKGFLHVLWSVYNNMLWVSRTLRINPNGVDFKQIDHEWHWDNYILLQ  98

Query  199  AILASF-AYMSFP--SLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSD-LYPLY  366
            AI+AS   YMS P  ++ ++P W  KG+V  +VLH+ FSEPLYY +HR  HS+  L+  Y
Sbjct  99   AIIASIICYMSLPLMTMNSIPLWNTKGLVALIVLHVTFSEPLYYFIHRTFHSNTYLFTHY  158

Query  367  HWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRC  546
            H  HH S VPHP T+G+A  LE L+LCV+ G+P +G+  LG GS+ +IY Y + FDFLRC
Sbjct  159  HSFHHSSPVPHPMTSGNATLLEGLILCVVAGVPLVGSCLLGVGSLGLIYGYAIMFDFLRC  218

Query  547  LGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            LG+ NVEI    LF+T+P+L+YLIY+PTY+ LHH +  TNFCLFMP++D+LG
Sbjct  219  LGHCNVEIFSHKLFETLPILRYLIYTPTYHSLHHHEMGTNFCLFMPIFDVLG  270



>emb|CDY51280.1| BnaA10g11680D [Brassica napus]
Length=630

 Score =   273 bits (697),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/230 (55%), Positives = 174/230 (76%), Gaps = 4/230 (2%)
 Frame = +1

Query  25   IWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAI  204
            +WCLHIL++ GL+G +H LWS Y+NML+ +R  R++  G+DF+QID EWHWDN+++LQAI
Sbjct  41   LWCLHILIICGLKGFLHVLWSVYNNMLWASRTLRINPNGVDFKQIDHEWHWDNYILLQAI  100

Query  205  LASF-AYMSFP--SLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSD-LYPLYHW  372
            +AS   YMS P  ++ ++P W  KG+V  +VLH+ FSEPLYY +HR  HS+  L+  YH 
Sbjct  101  IASIICYMSLPLMTINSIPLWNTKGLVALIVLHVTFSEPLYYFLHRTFHSNTYLFTHYHS  160

Query  373  LHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLG  552
             HH S VPHP T+G+A  LE L+LCV+ G+P +G+  LG GS+ +IY Y + FDFLRCLG
Sbjct  161  FHHSSPVPHPMTSGNATLLESLILCVVAGVPLVGSCLLGVGSLGLIYGYAIMFDFLRCLG  220

Query  553  YSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            + NVEI    LF+T+P+L+YLIY+PTY+ LHH +  TNFCLFMP++D+LG
Sbjct  221  HCNVEIFSHKLFETLPILRYLIYTPTYHSLHHHEMGTNFCLFMPIFDVLG  270



>ref|XP_010536953.1| PREDICTED: LOW QUALITY PROTEIN: protein ECERIFERUM 3-like [Tarenaya 
hassleriana]
Length=621

 Score =   272 bits (696),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/233 (54%), Positives = 172/233 (74%), Gaps = 1/233 (0%)
 Frame = +1

Query  7    KESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNF  186
            +E+     CLHIL+L+ LRGLVH LWSS+++MLF  R +R++ QG+DF QID EW+WDNF
Sbjct  36   EENTRATLCLHILILSALRGLVHVLWSSFAHMLFLTRTRRINPQGVDFNQIDHEWNWDNF  95

Query  187  LILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHS-SDLYPL  363
            ++LQAI+AS      P + +LP W  +G++  +V H+  SEPLYY+ HR LH  + L+  
Sbjct  96   ILLQAIIASMVCYMSPLVNSLPLWNPRGIIALIVFHVTISEPLYYIAHRCLHGYNRLFTH  155

Query  364  YHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLR  543
            YH  HH S VPHP TAG+A FLEHL+LC+++G+P +G+ +LG GS  + Y ++L FDFLR
Sbjct  156  YHLHHHSSPVPHPMTAGNATFLEHLILCMVIGVPLIGSCWLGVGSTSLFYGHVLVFDFLR  215

Query  544  CLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            CLG+ NVEI+  ++F T P L+YL+Y+PTY+ LHH   +TNFCLFMPL+D LG
Sbjct  216  CLGHCNVEIVSHNMFDTFPFLRYLLYTPTYHSLHHRYMKTNFCLFMPLFDALG  268



>ref|XP_010443488.1| PREDICTED: protein ECERIFERUM 3-like [Camelina sativa]
Length=632

 Score =   273 bits (697),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/233 (54%), Positives = 173/233 (74%), Gaps = 5/233 (2%)
 Frame = +1

Query  19   EDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQ  198
            + +WCLHIL++ GL+ LVH+LWS ++NMLF  R  R++ +GIDF+QID EWHWDN++ILQ
Sbjct  40   KALWCLHILIICGLKALVHELWSVFNNMLFVTRTLRINPKGIDFKQIDHEWHWDNYIILQ  99

Query  199  AILASF-AYMSFP---SLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSD-LYPL  363
            AI+A    YMS P    + +LP W  KG++  +VLH+ FSEPLYY +H+ +H ++  +  
Sbjct  100  AIIAGLICYMSPPLMMMMNSLPLWNTKGLIALIVLHVTFSEPLYYFLHKSIHRNNYFFTH  159

Query  364  YHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLR  543
            YH  HH S VPHP TAG+A  LE+L+LCV+ G+P +G+   G GS+ V+Y Y + FDF+R
Sbjct  160  YHSFHHSSPVPHPMTAGNATLLENLILCVVAGVPLIGSCLFGVGSLSVMYGYAVMFDFMR  219

Query  544  CLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            CLG+ NVEI    LF+T+P L+YLIY+PTY+ LHH +  TNFCLFMPL+D+LG
Sbjct  220  CLGHCNVEIFSHKLFETLPFLRYLIYTPTYHSLHHQEMGTNFCLFMPLFDVLG  272



>ref|XP_002325096.1| hypothetical protein POPTR_0018s10830g [Populus trichocarpa]
 gb|EEF03661.1| hypothetical protein POPTR_0018s10830g [Populus trichocarpa]
Length=652

 Score =   273 bits (697),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 124/230 (54%), Positives = 168/230 (73%), Gaps = 1/230 (0%)
 Frame = +1

Query  13   SWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLI  192
            S++  WCLHIL++   R L+HQLW+S+ NMLF  R +R+++QG DF+QIDKEW WDNF++
Sbjct  37   SFKGDWCLHILIICIARALLHQLWNSFVNMLFLTRTRRINRQGYDFKQIDKEWDWDNFIL  96

Query  193  LQAILASFA-YMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYH  369
            LQA++AS + Y+  P + N+P W  KG +  L LH+G SEPLYY +HR  H   L+  YH
Sbjct  97   LQALIASISCYIYPPFIVNVPLWNTKGFITILTLHVGISEPLYYWVHRCFHKGYLFTQYH  156

Query  370  WLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCL  549
              HH S V HP+T  +A FLEHL L  ++GIP +G+  +G+GS  +IY Y L FDFLRCL
Sbjct  157  STHHSSPVLHPYTGANATFLEHLALSTVIGIPIIGSHMMGYGSRSIIYGYPLVFDFLRCL  216

Query  550  GYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDML  699
            G+SNVE++P  LF+T+P L+YL+Y+PTY+ LHH D  TNFCLFMP +D +
Sbjct  217  GHSNVEVVPLQLFETLPFLRYLLYTPTYHSLHHTDTGTNFCLFMPFFDAI  266



>ref|XP_002864528.1| hypothetical protein ARALYDRAFT_495876 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40787.1| hypothetical protein ARALYDRAFT_495876 [Arabidopsis lyrata subsp. 
lyrata]
Length=632

 Score =   272 bits (696),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/237 (54%), Positives = 173/237 (73%), Gaps = 9/237 (4%)
 Frame = +1

Query  19   EDI----WCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNF  186
            EDI    WC+HIL++ GL+ LVH+LWS ++NMLF  R  R++ +GIDF+QID EWHWDN+
Sbjct  36   EDISKVLWCIHILIICGLKALVHELWSVFNNMLFVTRTLRINPKGIDFKQIDHEWHWDNY  95

Query  187  LILQAILASF-AYMSFP---SLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSD-  351
            +ILQAI+ S   YMS P    + +LP W  KG++  +VLH+ FSEPLYY +HR  H ++ 
Sbjct  96   IILQAIIVSLICYMSPPLMMMINSLPLWNTKGLIALIVLHVTFSEPLYYFLHRSFHRNNY  155

Query  352  LYPLYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAF  531
             +  YH  HH S VPHP TAG+A  LE+L+LCV+ G+P +G+   G GS+ VIY Y + F
Sbjct  156  FFTHYHSFHHSSPVPHPMTAGNATLLENLILCVVAGVPLIGSCLFGVGSLSVIYGYAVMF  215

Query  532  DFLRCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            DF+RCLG+ NVEI    LF+ +P+L+YLIY+PTY+ LHH +  TNFCLFMPL+D+LG
Sbjct  216  DFMRCLGHCNVEIFSHKLFEMLPILRYLIYTPTYHSLHHQEMGTNFCLFMPLFDVLG  272



>emb|CDX88639.1| BnaA03g10100D [Brassica napus]
Length=631

 Score =   272 bits (695),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 126/230 (55%), Positives = 173/230 (75%), Gaps = 5/230 (2%)
 Frame = +1

Query  28   WCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAIL  207
            WCL++L++ GL+GLVH LWS+Y+NMLF  R  R++ +G+DF+QID EW WDN+++LQAIL
Sbjct  42   WCLNVLIICGLKGLVHVLWSTYNNMLFLTRTLRINLKGVDFKQIDHEWDWDNYILLQAIL  101

Query  208  AS-FAYMSFPSL---ANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSD-LYPLYHW  372
            AS   YMS PS+   + +P W  KG++  LVLH+ FSEPLYY +HR +H ++ L+  YH 
Sbjct  102  ASMICYMSTPSMLIISTIPLWNMKGLIVSLVLHVTFSEPLYYFLHRSVHRNNYLFTRYHS  161

Query  373  LHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLG  552
             HH S VP+P TA +A  LE L+L V+ G+P +G+  LG GSI +IY Y + FDFLRCLG
Sbjct  162  FHHSSPVPNPMTANNATLLESLILFVVAGVPLIGSFLLGVGSISLIYGYAITFDFLRCLG  221

Query  553  YSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            + NVEI    +F+T+P+L+YLIY+PTY+ LHH +  TNFCLFMP++D+LG
Sbjct  222  HCNVEIFSHKVFETLPILRYLIYTPTYHSLHHQNMETNFCLFMPIFDVLG  271



>emb|CDY02769.1| BnaC02g11200D [Brassica napus]
Length=630

 Score =   271 bits (693),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 130/231 (56%), Positives = 174/231 (75%), Gaps = 6/231 (3%)
 Frame = +1

Query  25   IWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAI  204
            +WCLHIL++ GL+GLVH LWS Y+NML+  R  R++  G+D +QID EWHWDN++ILQAI
Sbjct  41   LWCLHILIICGLKGLVHVLWSVYNNMLWVTRTLRINPNGVDVQQIDHEWHWDNYIILQAI  100

Query  205  LAS-FAYMSFPSL---ANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSD-LYPLYH  369
            +AS   YMS PSL    ++P W  KG++  +V+H+ FSEPLYY +HR +H ++ L+  YH
Sbjct  101  IASMICYMS-PSLIMMNSIPLWNTKGLIALIVIHVTFSEPLYYYLHRSIHRNNYLFRHYH  159

Query  370  WLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCL  549
              HH S VPHP TAG+A  LE+L+LCV+ G+P +G+  LG GS  +IY Y + FDFLRCL
Sbjct  160  SFHHLSPVPHPMTAGNATLLENLILCVVAGVPLIGSCLLGVGSTSLIYGYAIMFDFLRCL  219

Query  550  GYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            G+ NVEI    LF+T+P+L+YLIY+PTY+ LHH +  TNFCLFMPL+D+LG
Sbjct  220  GHCNVEIFSHKLFETLPILRYLIYTPTYHTLHHQEMGTNFCLFMPLFDVLG  270



>ref|XP_009120299.1| PREDICTED: protein ECERIFERUM 3-like isoform X1 [Brassica rapa]
Length=630

 Score =   271 bits (692),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 126/230 (55%), Positives = 173/230 (75%), Gaps = 4/230 (2%)
 Frame = +1

Query  25   IWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAI  204
            +WCLHIL++ GL+G +H LWS Y+NML+ +R  R++  G+DF+QID EWHWDN+++LQAI
Sbjct  41   LWCLHILIICGLKGFLHVLWSVYNNMLWASRTLRINPNGVDFKQIDHEWHWDNYILLQAI  100

Query  205  LASF-AYMSFP--SLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSD-LYPLYHW  372
            +AS   YMS P  ++ ++P W  KG+V  +VLH+ FSEPLYY +HR  HS+  L+  YH 
Sbjct  101  IASIICYMSLPLMTINSIPLWNTKGLVALIVLHVTFSEPLYYFLHRTFHSNTYLFTHYHS  160

Query  373  LHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLG  552
             HH S VPHP T+G+A  LE L+LCV+ G+P +G+  LG GS+ +IY Y + FDFLRCLG
Sbjct  161  FHHSSPVPHPMTSGNATLLESLILCVVAGVPLVGSCLLGVGSLGLIYGYAIMFDFLRCLG  220

Query  553  YSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            + NVEI    LF+T+P+L+ LIY+PTY+ LHH +  TNFCLFMP++D+LG
Sbjct  221  HCNVEIFSHKLFETLPILRSLIYTPTYHSLHHHEMGTNFCLFMPIFDVLG  270



>ref|XP_009766364.1| PREDICTED: protein ECERIFERUM 3-like [Nicotiana sylvestris]
Length=628

 Score =   270 bits (690),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 120/232 (52%), Positives = 167/232 (72%), Gaps = 0/232 (0%)
 Frame = +1

Query  7    KESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNF  186
            +++ ++ WCLHIL++  LR  +H  W+++S+MLF  R +R+++ G+ F+QID EW WDNF
Sbjct  35   EDNIKETWCLHILIICLLRSSMHHTWNAFSSMLFLTRNRRINKDGVGFKQIDNEWDWDNF  94

Query  187  LILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLY  366
            ++L  I+ S  +     L N+P W+FKG +   +LH+  SEPLYY +H+  H S L+  Y
Sbjct  95   ILLHGIMGSIVFYMLKDLINIPLWDFKGFLAVAILHIAISEPLYYFLHKKFHGSYLFNHY  154

Query  367  HWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRC  546
            H LHH S V  PFTAG A  LEH++L  ++GIP LGT F+G+GSII+IY YIL FD LRC
Sbjct  155  HSLHHSSPVLQPFTAGHATLLEHIILAAVMGIPILGTCFMGYGSIIMIYGYILIFDCLRC  214

Query  547  LGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            LG+SN EI+P  LF+  P LKYL+Y+PTY+ LHH +  TN+CLFMPL+D+LG
Sbjct  215  LGHSNFEIIPHQLFQAFPTLKYLLYTPTYHSLHHTEMGTNYCLFMPLFDVLG  266



>ref|XP_009120300.1| PREDICTED: protein ECERIFERUM 3-like isoform X2 [Brassica rapa]
Length=630

 Score =   270 bits (690),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 126/230 (55%), Positives = 173/230 (75%), Gaps = 4/230 (2%)
 Frame = +1

Query  25   IWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAI  204
            +WCLHIL++ GL+G +H LWS Y+NML+ +R  R++  G+DF+QID EWHWDN+++LQAI
Sbjct  41   LWCLHILIICGLKGFLHVLWSVYNNMLWASRTLRINPNGVDFKQIDHEWHWDNYILLQAI  100

Query  205  LASF-AYMSFP--SLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSD-LYPLYHW  372
            +AS   YMS P  ++ ++P W  KG+V  +VLH+ FSEPLYY +HR  HS+  L+  YH 
Sbjct  101  IASIICYMSLPLMTINSIPLWNTKGLVALIVLHVTFSEPLYYFLHRTFHSNTYLFTHYHS  160

Query  373  LHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLG  552
             HH S VPHP T+G+A  LE L+LCV+ G+P +G+  LG GS+ +IY Y + FDFLRCLG
Sbjct  161  FHHSSPVPHPMTSGNATLLESLILCVVAGVPLVGSCLLGVGSLGLIYGYAIMFDFLRCLG  220

Query  553  YSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            + NVEI    LF+T+P+L+ LIY+PTY+ LHH +  TNFCLFMP++D+LG
Sbjct  221  HCNVEIFSHKLFETLPILRSLIYTPTYHSLHHHEMGTNFCLFMPIFDVLG  270



>ref|NP_200588.2| protein ECERIFERUM 3 [Arabidopsis thaliana]
 sp|Q8H1Z0.1|CER3_ARATH RecName: Full=Protein ECERIFERUM 3; AltName: Full=Protein FACELESS 
POLLEN 1; AltName: Full=Protein WAX2; AltName: Full=Protein 
YORE-YORE [Arabidopsis thaliana]
 gb|AAN06975.1| cuticle protein [Arabidopsis thaliana]
 dbj|BAC81644.1| YORE-YORE protein [Arabidopsis thaliana]
 dbj|BAD06945.1| faceless pollen-1 [Arabidopsis thaliana]
 gb|AED96953.1| protein ECERIFERUM 3 [Arabidopsis thaliana]
Length=632

 Score =   270 bits (690),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/237 (54%), Positives = 171/237 (72%), Gaps = 9/237 (4%)
 Frame = +1

Query  19   EDI----WCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNF  186
            EDI    WC+HIL++ GL+ LVH+LWS ++NMLF  R  R++ +GIDF+QID EWHWDN+
Sbjct  36   EDISKVLWCIHILIICGLKALVHELWSVFNNMLFVTRTLRINPKGIDFKQIDHEWHWDNY  95

Query  187  LILQAILASF-AYMSFP---SLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSD-  351
            +ILQAI+ S   YMS P    + +LP W  KG++  +VLH+ FSEPLYY +HR  H ++ 
Sbjct  96   IILQAIIVSLICYMSPPLMMMINSLPLWNTKGLIALIVLHVTFSEPLYYFLHRSFHRNNY  155

Query  352  LYPLYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAF  531
             +  YH  HH S VPHP TAG+A  LE+++LCV+ G+P +G    G GS+  IY Y + F
Sbjct  156  FFTHYHSFHHSSPVPHPMTAGNATLLENIILCVVAGVPLIGCCLFGVGSLSAIYGYAVMF  215

Query  532  DFLRCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            DF+RCLG+ NVEI    LF+ +PVL+YLIY+PTY+ LHH +  TNFCLFMPL+D+LG
Sbjct  216  DFMRCLGHCNVEIFSHKLFEILPVLRYLIYTPTYHSLHHQEMGTNFCLFMPLFDVLG  272



>ref|XP_004242647.1| PREDICTED: protein ECERIFERUM 3 [Solanum lycopersicum]
Length=630

 Score =   269 bits (687),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 117/228 (51%), Positives = 164/228 (72%), Gaps = 0/228 (0%)
 Frame = +1

Query  19   EDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQ  198
            E  WCLHIL++  LR  +H +W+++SNMLF  R +R+ ++G+DF+Q+D EW WDNF+ILQ
Sbjct  41   EATWCLHILIICLLRCTMHSVWNTFSNMLFLTRNRRIIKEGVDFKQVDNEWDWDNFIILQ  100

Query  199  AILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLH  378
            A++ +  +       NLP W+F+G +  ++LH+  SEPLYY +H+  H + L+  YH LH
Sbjct  101  AMIGASGFYMLQDKINLPLWDFRGFLAIIILHITISEPLYYFLHKSFHGNYLFKNYHSLH  160

Query  379  HDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYS  558
            H S VP PFTAG A   EH++L  I+GIP LG   LG+GS+ +IY Y+L FD LRCLG+ 
Sbjct  161  HSSPVPQPFTAGHATLFEHIILSGIIGIPILGCCLLGYGSLTMIYGYVLIFDMLRCLGHC  220

Query  559  NVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            N E +   LF+ IP+LKYLIY+PTY+ LHH +K TN+CLFMP++D+LG
Sbjct  221  NFEFISHQLFEAIPLLKYLIYTPTYHSLHHTEKETNYCLFMPIFDVLG  268



>ref|XP_002528208.1| sterol desaturase, putative [Ricinus communis]
 gb|EEF34165.1| sterol desaturase, putative [Ricinus communis]
Length=578

 Score =   268 bits (684),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 123/228 (54%), Positives = 173/228 (76%), Gaps = 1/228 (0%)
 Frame = +1

Query  19   EDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQ  198
            +D W LHIL+++ LR LV+ LWS + +MLF    +R+++QG DF+QID+EW+WDNF++LQ
Sbjct  42   KDDWFLHILIISFLRSLVYLLWSCFVSMLFLTYNRRINKQGYDFKQIDREWNWDNFVLLQ  101

Query  199  AILASFAYMSFPSL-ANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWL  375
            A++ S A   FPSL  N+P W  KG++  L+LH+  SEP+YY +HR  H S L+P YH +
Sbjct  102  ALIGSMACYMFPSLIENVPLWNTKGLIAMLMLHVLISEPVYYWVHRYFHGSYLFPHYHSI  161

Query  376  HHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGY  555
            HH S V HPFT   A+FLEHL+L  ++GIP +G+  +G+GSI++IY+Y+ AFDFLRCLG+
Sbjct  162  HHSSPVLHPFTGAHASFLEHLILATVIGIPIIGSLIMGYGSIVMIYAYVWAFDFLRCLGH  221

Query  556  SNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDML  699
            SNVEI+P  LF ++P L+YL Y+P+Y+ LHH +  TNFCLFMPL+D +
Sbjct  222  SNVEIVPHQLFHSLPFLRYLFYTPSYHSLHHTEMGTNFCLFMPLFDAI  269



>ref|XP_006401167.1| hypothetical protein EUTSA_v10012960mg [Eutrema salsugineum]
 dbj|BAJ33654.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ42620.1| hypothetical protein EUTSA_v10012960mg [Eutrema salsugineum]
Length=631

 Score =   269 bits (687),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 126/236 (53%), Positives = 173/236 (73%), Gaps = 4/236 (2%)
 Frame = +1

Query  7    KESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNF  186
            K+    +WCLHIL++ G++G+VH LWS + NML+ +R  R++ +G+DF+QID EWHWDN+
Sbjct  36   KDYSRALWCLHILIICGIKGVVHVLWSVFHNMLWSSRTLRINPKGVDFKQIDHEWHWDNY  95

Query  187  LILQAILAS-FAYMSFP--SLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSD-L  354
            ++LQAI+AS   YMS P  ++ ++P W  KG +  +VLH+ FSEPLYY +HR  H  +  
Sbjct  96   ILLQAIIASMICYMSTPIMTMNSIPLWNTKGFIALIVLHVTFSEPLYYFLHRSFHRHNYF  155

Query  355  YPLYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFD  534
            +  YH  HH S VPHP T+G+A  LE+LLLCV+ G+P +G   LG GSI +IY Y + FD
Sbjct  156  FTHYHSFHHSSPVPHPMTSGNATLLENLLLCVVAGVPLIGPCLLGVGSISLIYGYAIMFD  215

Query  535  FLRCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            FLRCLG+ NVEI    LF+ +P+L+YLIY+PTY+ LHH +  TNFCLFMPL+D+LG
Sbjct  216  FLRCLGHCNVEIFSHKLFEILPILRYLIYTPTYHSLHHQEMGTNFCLFMPLFDVLG  271



>emb|CDY11847.1| BnaC03g12730D [Brassica napus]
Length=635

 Score =   268 bits (685),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/234 (55%), Positives = 171/234 (73%), Gaps = 9/234 (4%)
 Frame = +1

Query  28   WCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAIL  207
            WCL+IL++ GL+GLVH  WS Y+NML+ +R  R++ +G+DF+QID EWHWDN+++LQAIL
Sbjct  42   WCLNILIICGLKGLVHVFWSVYNNMLWVSRMLRINPKGVDFKQIDHEWHWDNYILLQAIL  101

Query  208  AS-FAYMSFPSLA-------NLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSD-LYP  360
            A+   YMS P +         +P W  KG++  LVLH+ FSEPLYY +HR +H ++ L+ 
Sbjct  102  ATMICYMSPPLMMINSTIPLAIPLWNTKGLIVLLVLHVTFSEPLYYFLHRSVHRNNYLFT  161

Query  361  LYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFL  540
             YH  HH S VP+P TA +A  LE LLLCV+ G P +G+  LG GSI +IY Y + FDFL
Sbjct  162  HYHSFHHSSPVPNPMTANNATLLESLLLCVVAGAPLIGSCLLGVGSISLIYGYAITFDFL  221

Query  541  RCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            RCLG+ NVEI    LF+T+P+L+YLIY+PTY+ LHH D  TNFCLFMP++D+LG
Sbjct  222  RCLGHCNVEIFSHKLFETLPILRYLIYTPTYHSLHHQDMETNFCLFMPIFDVLG  275



>ref|XP_009798188.1| PREDICTED: protein ECERIFERUM 3-like [Nicotiana sylvestris]
Length=628

 Score =   268 bits (684),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 124/225 (55%), Positives = 168/225 (75%), Gaps = 0/225 (0%)
 Frame = +1

Query  28   WCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAIL  207
            WCLH+L+L  LRGL++QLWSS+SNMLF  R +R+ + G+DF+QIDKEW WDNF++L A++
Sbjct  42   WCLHVLILCSLRGLIYQLWSSFSNMLFLTRNRRIIKDGVDFKQIDKEWDWDNFVLLHAVM  101

Query  208  ASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLHHDS  387
            A+ A    P+L NLP W+  G+V   +LH+  SEPLYY +H+  H + L+  YH LHH S
Sbjct  102  ATLACYMLPNLVNLPIWDLSGLVVITILHIVISEPLYYCLHKCFHGNYLFSHYHSLHHSS  161

Query  388  KVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYSNVE  567
             +P PFTAG A FLE +LL  ++GIP LG+  +G+GS+ +IY Y+L FDFLRCLG+ N E
Sbjct  162  AIPQPFTAGHATFLEQILLGGVIGIPILGSCLMGYGSVAIIYGYVLVFDFLRCLGHCNFE  221

Query  568  IMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            I+P  LF   P +KYL+Y+PTY+ LHH +  TN+CLFMPL+D+LG
Sbjct  222  IIPHQLFLAFPFMKYLLYTPTYHNLHHTEIGTNYCLFMPLFDVLG  266



>ref|XP_009132284.1| PREDICTED: protein ECERIFERUM 3-like [Brassica rapa]
Length=580

 Score =   266 bits (680),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 126/234 (54%), Positives = 171/234 (73%), Gaps = 9/234 (4%)
 Frame = +1

Query  28   WCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAIL  207
            WCL+IL++ GL+GLVH  WS Y+NML+ +R  R++ +G+DF+QID EW WDN+++LQAIL
Sbjct  42   WCLNILIICGLKGLVHVFWSVYNNMLWVSRTLRINPKGVDFKQIDHEWDWDNYILLQAIL  101

Query  208  AS-FAYMSFPSLA-------NLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSD-LYP  360
            A+   YMS P +         +P W  KG++  LVLH+ FSEPLYY +HR +H ++ L+ 
Sbjct  102  ATMICYMSPPLMMINSTIPLAIPLWNTKGLIVLLVLHVTFSEPLYYFLHRYVHRNNYLFT  161

Query  361  LYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFL  540
             YH  HH S VP+P TA +A  LE LLLCV+ G+P +G+  LG GS+ +IY Y + FDFL
Sbjct  162  NYHSFHHSSPVPNPMTANNATLLESLLLCVVAGVPLIGSCLLGVGSVSLIYVYAIMFDFL  221

Query  541  RCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            RCLG+ NVEI    LF+T+P+L+YLIY+PTY+ LHH D  TNFCLFMP++D+LG
Sbjct  222  RCLGHCNVEIFSHKLFETLPILRYLIYTPTYHSLHHQDMETNFCLFMPIFDVLG  275



>ref|XP_009587593.1| PREDICTED: protein ECERIFERUM 3-like [Nicotiana tomentosiformis]
Length=628

 Score =   267 bits (683),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 119/232 (51%), Positives = 166/232 (72%), Gaps = 0/232 (0%)
 Frame = +1

Query  7    KESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNF  186
            +++ ++ WCLHIL++  LR  +H  W+++S MLF  R ++++++G+ F+QID EW WDNF
Sbjct  35   EDNIKETWCLHILIICLLRCSMHHTWNTFSGMLFLTRNRQINKEGVGFKQIDNEWDWDNF  94

Query  187  LILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLY  366
            ++L  I+ S  +     L NLP W+FKG++   +LH+  SEPLYY +H+  H S L+  Y
Sbjct  95   ILLHGIMGSLVFYMLKDLINLPLWDFKGLMAVAILHIAISEPLYYFLHKKFHGSYLFNHY  154

Query  367  HWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRC  546
            H LHH S V  PFTAG A  LEH++L  ++GIP LGT  LG+GSI +IY YIL FD LRC
Sbjct  155  HSLHHSSPVLQPFTAGHATLLEHIILAAVMGIPILGTCLLGYGSITMIYGYILIFDCLRC  214

Query  547  LGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            LG+SN EI+P  LF+  P LKYL+Y+PTY+ LHH +  TN+CLFMPL+D+LG
Sbjct  215  LGHSNFEIIPHQLFQAFPTLKYLLYTPTYHSLHHTEMETNYCLFMPLFDVLG  266



>gb|EYU34298.1| hypothetical protein MIMGU_mgv1a0095731mg [Erythranthe guttata]
Length=338

 Score =   258 bits (658),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 116/231 (50%), Positives = 162/231 (70%), Gaps = 0/231 (0%)
 Frame = +1

Query  10   ESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFL  189
            +  E+ W +HI +++ +R  ++Q  +SYSNMLF  R +R+  +G+ F QIDKEW WDNF+
Sbjct  34   QEEEESWGIHIFIISMVRLCLYQACTSYSNMLFLTRNRRIVNKGVGFHQIDKEWRWDNFI  93

Query  190  ILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYH  369
            +LQAI+AS     FP+   +      G+   LVLH+  SEPL+Y +H+  H + L+  YH
Sbjct  94   LLQAIVASVMVYIFPTSGKIELLNKNGITEALVLHIAISEPLFYTIHKFFHGNYLFTNYH  153

Query  370  WLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCL  549
             LHH S VP  +T G A FLEHL L +++G+P +G+  +GHGS+I+IY Y+L FDFLRCL
Sbjct  154  SLHHSSPVPQAYTGGHATFLEHLFLTIVIGVPIVGSFLIGHGSLILIYGYVLIFDFLRCL  213

Query  550  GYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            G+ NVEI+P H+F  IP LKY+IY+PTY+ LHH +  TN+CLFMPL+D LG
Sbjct  214  GHLNVEIIPHHVFDFIPFLKYMIYTPTYHSLHHAEMDTNYCLFMPLFDALG  264



>ref|XP_010687696.1| PREDICTED: protein ECERIFERUM 3 [Beta vulgaris subsp. vulgaris]
Length=623

 Score =   265 bits (678),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 128/233 (55%), Positives = 169/233 (73%), Gaps = 2/233 (1%)
 Frame = +1

Query  10   ESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFL  189
            E+  + W  HIL+L  LR  V+QLW +Y NM F +  +R++QQG+DF+Q+D EW+WDNF+
Sbjct  36   EAIRNTWSFHILLLCSLRYTVYQLWHTYCNMHFLSLERRINQQGVDFKQVDHEWNWDNFI  95

Query  190  ILQAILASFAYMSFPSLANLP-TWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSS-DLYPL  363
            ILQA++ S     FPS  N    W+ +G++  L+LHM  SEPLYY +HRLLH+   L+  
Sbjct  96   ILQALVGSLILYMFPSFTNWKLGWDTRGLIVALLLHMVVSEPLYYGIHRLLHTQPKLFKS  155

Query  364  YHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLR  543
            YH LHH S VP PFTAG+A FLEH+LL  I+GIP +G A LG GSI +IY ++LAFDFLR
Sbjct  156  YHSLHHLSPVPQPFTAGNATFLEHILLLTIMGIPMVGAALLGCGSISLIYIHVLAFDFLR  215

Query  544  CLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            CLG+ N EI    +F+ +P LKYL+Y+PTY+ LHH +K  NFCLFMP+YD+LG
Sbjct  216  CLGHCNTEIFAHQIFEVLPFLKYLLYTPTYHSLHHTEKDCNFCLFMPIYDLLG  268



>gb|KJB23543.1| hypothetical protein B456_004G104100 [Gossypium raimondii]
Length=611

 Score =   265 bits (676),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 123/234 (53%), Positives = 165/234 (71%), Gaps = 13/234 (6%)
 Frame = +1

Query  1    VWKESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWD  180
            ++++S +D+WCLHILV+  LRGL+HQLW+SYS  LF  R +R+ Q+G+DF+QID+EW WD
Sbjct  33   IYEDSIKDLWCLHILVICALRGLIHQLWNSYSTTLFLTRNRRIKQEGVDFKQIDREWDWD  92

Query  181  NFLILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYP  360
            NFLIL A+LA  A + FPSL +LP W  KG +  L LH+  SEPLYY  HRL  + D + 
Sbjct  93   NFLILHALLAYMACLIFPSLDDLPLWNPKGFITLLFLHVTVSEPLYYWAHRLTSAYDKF-  151

Query  361  LYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFL  540
                            AG A FLEHL+LCV++GIP  G+  +G+GS  ++Y Y+ AFDFL
Sbjct  152  ------------LSAAAGHATFLEHLILCVVIGIPMAGSITMGYGSTSMVYGYVSAFDFL  199

Query  541  RCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            RCLG+SNVE++P  +F  +P LKY +Y+PTY+ LHH +  TNFCLFMPL+D +G
Sbjct  200  RCLGHSNVEVVPHEVFNKLPFLKYFLYTPTYHSLHHTEMGTNFCLFMPLFDAMG  253



>ref|XP_004173838.1| PREDICTED: protein ECERIFERUM 3-like, partial [Cucumis sativus]
Length=392

 Score =   258 bits (660),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 128/226 (57%), Positives = 164/226 (73%), Gaps = 1/226 (0%)
 Frame = +1

Query  28   WCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAIL  207
            WCLHIL+++ LR  +H +WSSYSNMLF  R +R+ QQG+DF+QID EW WDNFL+LQA++
Sbjct  27   WCLHILLISLLRVGIHVVWSSYSNMLFLTRNRRILQQGVDFKQIDMEWEWDNFLLLQALM  86

Query  208  ASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSD-LYPLYHWLHHD  384
             S     FPSL NLP W  KG++  L+LH+  +EPL+Y  HRL HS+  L+  YH LHH 
Sbjct  87   TSMMVYLFPSLGNLPLWNPKGLIAVLILHIVIAEPLFYFFHRLFHSNHYLFTHYHSLHHS  146

Query  385  SKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYSNV  564
            S VP  FTAG+   LEHL   +++G P +GT+ LG+GS      Y+L FDFLRCLG SNV
Sbjct  147  SSVPQSFTAGNGTVLEHLAWSIVIGAPIVGTSLLGYGSTATFACYVLVFDFLRCLGLSNV  206

Query  565  EIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            EI+   LF  IPVL+YL+Y+PTY+ LHH +K TNFCLFMPL+D +G
Sbjct  207  EIVSHRLFDAIPVLRYLLYTPTYHTLHHTEKETNFCLFMPLFDAIG  252



>emb|CDX88642.1| BnaA03g10070D [Brassica napus]
Length=637

 Score =   265 bits (676),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 126/234 (54%), Positives = 168/234 (72%), Gaps = 9/234 (4%)
 Frame = +1

Query  28   WCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAIL  207
            WCL+IL+  GL+G+VH  WSSY+NMLF  R  R++  G+DF+QID EWHWDN+++LQA+L
Sbjct  42   WCLNILISCGLKGIVHVFWSSYNNMLFLTRTLRINPNGVDFKQIDHEWHWDNYILLQAVL  101

Query  208  ASF-AYMSFPSLA-------NLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSD-LYP  360
            A+   YMS P +         +P W  KG++  LVLH+ FSEPLYY +HR +H ++ L+ 
Sbjct  102  ATMICYMSPPLMMINSTIPLAIPLWNTKGLIMLLVLHVTFSEPLYYFLHRSVHRNNYLFT  161

Query  361  LYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFL  540
             YH  HH S VP+P TA +A  LE L LCV+ G+P + +  LG GSI +IY Y + FDFL
Sbjct  162  HYHSFHHSSPVPNPMTANNATLLESLFLCVVAGVPLIVSCLLGVGSISLIYGYAIMFDFL  221

Query  541  RCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            RCLG  NVEI    LF+++P+L+YLIY+PTY+GLHH D  TNFCLFMP++D+LG
Sbjct  222  RCLGQCNVEIFSHKLFESLPILRYLIYTPTYHGLHHEDMGTNFCLFMPIFDVLG  275



>emb|CDX88640.1| BnaA03g10090D [Brassica napus]
Length=600

 Score =   263 bits (672),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 125/233 (54%), Positives = 169/233 (73%), Gaps = 9/233 (4%)
 Frame = +1

Query  28   WCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAIL  207
            WCL+IL++ GL+GLVH  WS Y+NML+ +R  R++ +G+DF+QID EW WDN+++LQA L
Sbjct  42   WCLNILIICGLKGLVHVFWSVYNNMLWVSRTLRINPKGVDFKQIDHEWDWDNYILLQATL  101

Query  208  AS-FAYMSFPSLA-------NLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSD-LYP  360
            A+   YMS P +         +P W  KG++  LVLH+ FSEPLYY +HR +H ++ L+ 
Sbjct  102  ATMICYMSPPLMMINSTIPLAIPLWNTKGLIVLLVLHVTFSEPLYYFLHRYVHRNNYLFT  161

Query  361  LYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFL  540
             YH  HH S VP+P TA +A  LE LLLCV+ G+P +G+  LG GSI +IY Y + FDFL
Sbjct  162  NYHSFHHSSPVPNPMTANNATLLESLLLCVVAGVPLIGSCLLGVGSISLIYGYAIMFDFL  221

Query  541  RCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDML  699
            RCLG+ NVEI    LF+T+P+L+YLIY+PTY+ LHH D  TNFCLFMP++D+L
Sbjct  222  RCLGHCNVEIFSHKLFETLPILRYLIYTPTYHSLHHQDMETNFCLFMPIFDVL  274



>gb|KHG04940.1| Protein WAX2 [Gossypium arboreum]
Length=571

 Score =   261 bits (668),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 124/234 (53%), Positives = 173/234 (74%), Gaps = 2/234 (1%)
 Frame = +1

Query  1    VWKESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWD  180
            ++++S++  WC+HIL++  LRG +HQLW+SY+NMLF     R+ QQG++F+QID EW WD
Sbjct  17   IYEDSYKHPWCVHILIICALRGFMHQLWNSYNNMLFLGNC-RIKQQGVEFKQIDNEWDWD  75

Query  181  NFLILQAILASFAYMSFPSLAN-LPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLY  357
            NF++LQ +LA+ A + FPS+ +  P W  KG +  ++LH+  SEPLYY MHR  H   L+
Sbjct  76   NFILLQGLLATMACLMFPSMDDEFPIWNTKGFITLMLLHVMVSEPLYYWMHRFFHGRYLF  135

Query  358  PLYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDF  537
              YH LHH S VPHPFTAG A FLEHL+L +++GIP +G+  +G GS  +IY Y+L FDF
Sbjct  136  THYHSLHHSSSVPHPFTAGHATFLEHLILSMVIGIPIMGSILMGSGSTSMIYGYVLGFDF  195

Query  538  LRCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDML  699
            +RC+G+SNVE++   +F  +P L+YLIY+PTY+ LHH D  TNFCLFMPL+D +
Sbjct  196  MRCMGHSNVEVIHGAIFNKLPFLRYLIYTPTYHSLHHSDMGTNFCLFMPLFDAM  249



>gb|KJB27033.1| hypothetical protein B456_004G273200 [Gossypium raimondii]
Length=610

 Score =   262 bits (670),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 124/234 (53%), Positives = 173/234 (74%), Gaps = 2/234 (1%)
 Frame = +1

Query  1    VWKESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWD  180
            ++++S++  WC+HIL++  LRG +HQLW+SY+NMLF     R+ QQG++F+QID EW WD
Sbjct  19   IYEDSYKHPWCVHILIICALRGFMHQLWNSYNNMLFLGNC-RIKQQGVEFKQIDNEWDWD  77

Query  181  NFLILQAILASFAYMSFPSLAN-LPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLY  357
            NF++LQ +LA+ A + FPS+ +  P W  KG +  ++LH+  SEPLYY MHR  H   L+
Sbjct  78   NFILLQGLLATMACLMFPSMDDEFPIWNTKGFITLMLLHVMVSEPLYYWMHRFFHGRYLF  137

Query  358  PLYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDF  537
              YH LHH S VPHPFTAG A FLEHL+L +++GIP +G+  +G GS  +IY Y+L FDF
Sbjct  138  THYHSLHHSSSVPHPFTAGHATFLEHLILSMVIGIPIMGSILMGSGSTSMIYGYVLGFDF  197

Query  538  LRCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDML  699
            +RC+G+SNVE++   +F  +P L+YLIY+PTY+ LHH D  TNFCLFMPL+D +
Sbjct  198  MRCMGHSNVEVIHGAIFNKLPFLRYLIYTPTYHSLHHSDMGTNFCLFMPLFDAM  251



>gb|KJB27032.1| hypothetical protein B456_004G273200 [Gossypium raimondii]
Length=625

 Score =   262 bits (669),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 124/234 (53%), Positives = 173/234 (74%), Gaps = 2/234 (1%)
 Frame = +1

Query  1    VWKESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWD  180
            ++++S++  WC+HIL++  LRG +HQLW+SY+NMLF     R+ QQG++F+QID EW WD
Sbjct  34   IYEDSYKHPWCVHILIICALRGFMHQLWNSYNNMLFLGNC-RIKQQGVEFKQIDNEWDWD  92

Query  181  NFLILQAILASFAYMSFPSLAN-LPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLY  357
            NF++LQ +LA+ A + FPS+ +  P W  KG +  ++LH+  SEPLYY MHR  H   L+
Sbjct  93   NFILLQGLLATMACLMFPSMDDEFPIWNTKGFITLMLLHVMVSEPLYYWMHRFFHGRYLF  152

Query  358  PLYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDF  537
              YH LHH S VPHPFTAG A FLEHL+L +++GIP +G+  +G GS  +IY Y+L FDF
Sbjct  153  THYHSLHHSSSVPHPFTAGHATFLEHLILSMVIGIPIMGSILMGSGSTSMIYGYVLGFDF  212

Query  538  LRCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDML  699
            +RC+G+SNVE++   +F  +P L+YLIY+PTY+ LHH D  TNFCLFMPL+D +
Sbjct  213  MRCMGHSNVEVIHGAIFNKLPFLRYLIYTPTYHSLHHSDMGTNFCLFMPLFDAM  266



>gb|KHG04939.1| Protein WAX2 [Gossypium arboreum]
Length=625

 Score =   261 bits (668),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 124/234 (53%), Positives = 173/234 (74%), Gaps = 2/234 (1%)
 Frame = +1

Query  1    VWKESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWD  180
            ++++S++  WC+HIL++  LRG +HQLW+SY+NMLF     R+ QQG++F+QID EW WD
Sbjct  34   IYEDSYKHPWCVHILIICALRGFMHQLWNSYNNMLFLGNC-RIKQQGVEFKQIDNEWDWD  92

Query  181  NFLILQAILASFAYMSFPSLAN-LPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLY  357
            NF++LQ +LA+ A + FPS+ +  P W  KG +  ++LH+  SEPLYY MHR  H   L+
Sbjct  93   NFILLQGLLATMACLMFPSMDDEFPIWNTKGFITLMLLHVMVSEPLYYWMHRFFHGRYLF  152

Query  358  PLYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDF  537
              YH LHH S VPHPFTAG A FLEHL+L +++GIP +G+  +G GS  +IY Y+L FDF
Sbjct  153  THYHSLHHSSSVPHPFTAGHATFLEHLILSMVIGIPIMGSILMGSGSTSMIYGYVLGFDF  212

Query  538  LRCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDML  699
            +RC+G+SNVE++   +F  +P L+YLIY+PTY+ LHH D  TNFCLFMPL+D +
Sbjct  213  MRCMGHSNVEVIHGAIFNKLPFLRYLIYTPTYHSLHHSDMGTNFCLFMPLFDAM  266



>ref|XP_003578148.1| PREDICTED: protein ECERIFERUM 3-like [Brachypodium distachyon]
 ref|XP_010238185.1| PREDICTED: protein ECERIFERUM 3-like [Brachypodium distachyon]
Length=619

 Score =   260 bits (665),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 121/234 (52%), Positives = 167/234 (71%), Gaps = 0/234 (0%)
 Frame = +1

Query  1    VWKESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWD  180
             W+    D W L +LVL  LR   +QLWSSYSNMLF  R +R+ + G+DF QIDKEW WD
Sbjct  34   AWERGSPDQWLLLLLVLFTLRAFTYQLWSSYSNMLFLTRRRRIVRDGVDFAQIDKEWDWD  93

Query  181  NFLILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYP  360
            NFLILQ ++A+ A+ +FPSL +LP W+ KG++   +LH+  +EPL+Y+ HR  HS  L+ 
Sbjct  94   NFLILQILMAATAFYAFPSLRDLPLWDAKGLLVGALLHVVATEPLFYVAHRAFHSGHLFS  153

Query  361  LYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFL  540
             YH LHH  KVP PFTAG A  LEH++L  ++ +P  G    GHGS+ + ++Y+L FDFL
Sbjct  154  CYHALHHSIKVPTPFTAGFATPLEHMVLGALMALPLAGACAAGHGSVGLAFAYVLGFDFL  213

Query  541  RCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            R +G+ NVE+ P+ +F+ +P+L+YLIY+PTY+ +HH +K  NFCLFMPL+D LG
Sbjct  214  RAMGHCNVELFPAGIFQALPLLRYLIYTPTYHTVHHTEKDANFCLFMPLFDRLG  267



>ref|XP_009387454.1| PREDICTED: protein ECERIFERUM 3-like isoform X4 [Musa acuminata 
subsp. malaccensis]
Length=617

 Score =   260 bits (664),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 120/233 (52%), Positives = 159/233 (68%), Gaps = 0/233 (0%)
 Frame = +1

Query  4    WKESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDN  183
            W++     W LH+L+L GLR L +QLW S++NMLFF R +RV  +G+DF+QID EW+WDN
Sbjct  32   WRDGRSVGWSLHLLILFGLRSLTYQLWYSFTNMLFFTRKRRVINEGVDFKQIDNEWNWDN  91

Query  184  FLILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPL  363
            FLILQA+L S      P L  LP    +G +  L+LH+G SEP++YL +R  HS  L+  
Sbjct  92   FLILQALLGSMISHHAPPLEELPILGLQGCIIALLLHVGVSEPVFYLANRWFHSGSLFTH  151

Query  364  YHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLR  543
            YH + H S VP P TAG    LEHL+L  ++  P LG   +G GS+ ++Y Y+  FDFLR
Sbjct  152  YHSIQHASPVPTPMTAGFGTPLEHLVLGAVMAAPLLGAFLMGCGSVGLVYGYVFVFDFLR  211

Query  544  CLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            C+GYSNVE+ P  L + +P L+YLIYSPTY  LHH +K  N+CLFMPL+D+LG
Sbjct  212  CMGYSNVEVFPVRLLQALPFLRYLIYSPTYLSLHHKEKNCNYCLFMPLFDLLG  264



>ref|XP_010278025.1| PREDICTED: protein ECERIFERUM 3 [Nelumbo nucifera]
 ref|XP_010278026.1| PREDICTED: protein ECERIFERUM 3 [Nelumbo nucifera]
Length=619

 Score =   259 bits (663),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 123/234 (53%), Positives = 163/234 (70%), Gaps = 0/234 (0%)
 Frame = +1

Query  1    VWKESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWD  180
            ++++  +D+WCLHIL++  LR  + QLW S  NM F  + +R+ QQ  DF QID+EW+W+
Sbjct  33   LYEDIQKDMWCLHILLICTLRAAMFQLWCSVCNMYFLTKNRRIVQQCPDFNQIDREWNWE  92

Query  181  NFLILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYP  360
            NFLIL A +A  A   FPSL  +PTW  KG++Y ++LH+  SEPLYY +HR  HS  L+ 
Sbjct  93   NFLILHAWIAFMACYMFPSLTEIPTWNSKGLIYAVILHVLVSEPLYYWIHRQFHSDYLFT  152

Query  361  LYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFL  540
             YH LHH  K P  +TAG A  LEHL+L VI+GIP LG + +G GSI +IY Y+L FD L
Sbjct  153  HYHSLHHSIKAPTAYTAGYATPLEHLVLNVIMGIPVLGASLMGAGSISLIYGYVLIFDAL  212

Query  541  RCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            RC+G  NVE++P  +F+  P LKYLIY+ TY+ LH  +  TNFCLFMP+YD LG
Sbjct  213  RCMGLCNVEVIPHQIFRLFPFLKYLIYTATYHSLHRAEMNTNFCLFMPIYDALG  266



>ref|XP_009387452.1| PREDICTED: protein ECERIFERUM 3-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=659

 Score =   260 bits (665),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 120/233 (52%), Positives = 159/233 (68%), Gaps = 0/233 (0%)
 Frame = +1

Query  4    WKESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDN  183
            W++     W LH+L+L GLR L +QLW S++NMLFF R +RV  +G+DF+QID EW+WDN
Sbjct  32   WRDGRSVGWSLHLLILFGLRSLTYQLWYSFTNMLFFTRKRRVINEGVDFKQIDNEWNWDN  91

Query  184  FLILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPL  363
            FLILQA+L S      P L  LP    +G +  L+LH+G SEP++YL +R  HS  L+  
Sbjct  92   FLILQALLGSMISHHAPPLEELPILGLQGCIIALLLHVGVSEPVFYLANRWFHSGSLFTH  151

Query  364  YHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLR  543
            YH + H S VP P TAG    LEHL+L  ++  P LG   +G GS+ ++Y Y+  FDFLR
Sbjct  152  YHSIQHASPVPTPMTAGFGTPLEHLVLGAVMAAPLLGAFLMGCGSVGLVYGYVFVFDFLR  211

Query  544  CLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            C+GYSNVE+ P  L + +P L+YLIYSPTY  LHH +K  N+CLFMPL+D+LG
Sbjct  212  CMGYSNVEVFPVRLLQALPFLRYLIYSPTYLSLHHKEKNCNYCLFMPLFDLLG  264



>ref|XP_009387453.1| PREDICTED: protein ECERIFERUM 3-like isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=647

 Score =   260 bits (664),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 120/233 (52%), Positives = 159/233 (68%), Gaps = 0/233 (0%)
 Frame = +1

Query  4    WKESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDN  183
            W++     W LH+L+L GLR L +QLW S++NMLFF R +RV  +G+DF+QID EW+WDN
Sbjct  32   WRDGRSVGWSLHLLILFGLRSLTYQLWYSFTNMLFFTRKRRVINEGVDFKQIDNEWNWDN  91

Query  184  FLILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPL  363
            FLILQA+L S      P L  LP    +G +  L+LH+G SEP++YL +R  HS  L+  
Sbjct  92   FLILQALLGSMISHHAPPLEELPILGLQGCIIALLLHVGVSEPVFYLANRWFHSGSLFTH  151

Query  364  YHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLR  543
            YH + H S VP P TAG    LEHL+L  ++  P LG   +G GS+ ++Y Y+  FDFLR
Sbjct  152  YHSIQHASPVPTPMTAGFGTPLEHLVLGAVMAAPLLGAFLMGCGSVGLVYGYVFVFDFLR  211

Query  544  CLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            C+GYSNVE+ P  L + +P L+YLIYSPTY  LHH +K  N+CLFMPL+D+LG
Sbjct  212  CMGYSNVEVFPVRLLQALPFLRYLIYSPTYLSLHHKEKNCNYCLFMPLFDLLG  264



>ref|XP_004149879.1| PREDICTED: protein ECERIFERUM 3-like [Cucumis sativus]
 gb|KGN65271.1| hypothetical protein Csa_1G294020 [Cucumis sativus]
Length=625

 Score =   259 bits (662),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 128/226 (57%), Positives = 164/226 (73%), Gaps = 1/226 (0%)
 Frame = +1

Query  28   WCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAIL  207
            WCLHIL+++ LR  +H +WSSYSNMLF  R +R+ QQG+DF+QID EW WDNFL+LQA++
Sbjct  42   WCLHILLISLLRVGIHVVWSSYSNMLFLTRNRRILQQGVDFKQIDMEWEWDNFLLLQALM  101

Query  208  ASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSD-LYPLYHWLHHD  384
             S     FPSL NLP W  KG++  L+LH+  +EPL+Y  HRL HS+  L+  YH LHH 
Sbjct  102  TSMMVYLFPSLGNLPLWNPKGLIAVLILHIVIAEPLFYFFHRLFHSNHYLFTHYHSLHHS  161

Query  385  SKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYSNV  564
            S VP  FTAG+   LEHL   +++G P +GT+ LG+GS      Y+L FDFLRCLG SNV
Sbjct  162  SSVPQSFTAGNGTVLEHLAWSIVIGAPIVGTSLLGYGSTATFACYVLVFDFLRCLGLSNV  221

Query  565  EIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            EI+   LF  IPVL+YL+Y+PTY+ LHH +K TNFCLFMPL+D +G
Sbjct  222  EIVSHRLFDAIPVLRYLLYTPTYHTLHHTEKETNFCLFMPLFDAIG  267



>ref|XP_008443806.1| PREDICTED: protein ECERIFERUM 3 [Cucumis melo]
Length=611

 Score =   259 bits (661),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 128/226 (57%), Positives = 164/226 (73%), Gaps = 1/226 (0%)
 Frame = +1

Query  28   WCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAIL  207
            WCLHIL+++ LR  +H +WSSYSNMLF  R +R+ QQG+DF+QID EW WDNFL+L+A++
Sbjct  28   WCLHILLISLLRVGIHVVWSSYSNMLFLTRNRRILQQGVDFKQIDMEWEWDNFLLLEALM  87

Query  208  ASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSD-LYPLYHWLHHD  384
             S     FPSL NLP W  KG++  L+LH+  +EPL+Y  HRL HS+  L+  YH LHH 
Sbjct  88   TSMMVYLFPSLGNLPLWNTKGLIALLILHIVIAEPLFYFFHRLFHSNHYLFTHYHSLHHS  147

Query  385  SKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYSNV  564
            S VP  FTAG+   LEHL   +++G P +GT  LG+GS   I  Y+L FDFLRCLG SNV
Sbjct  148  SSVPQSFTAGNGTVLEHLAWSIVIGAPIVGTFLLGYGSTATIACYVLVFDFLRCLGLSNV  207

Query  565  EIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            EI+   LF  IPVL+YL+Y+PTY+ LHH +K TNFCLFMPL+D +G
Sbjct  208  EIVSHRLFDAIPVLRYLLYTPTYHTLHHTEKETNFCLFMPLFDAIG  253



>ref|XP_009387450.1| PREDICTED: protein ECERIFERUM 3-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=689

 Score =   260 bits (665),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 120/233 (52%), Positives = 159/233 (68%), Gaps = 0/233 (0%)
 Frame = +1

Query  4    WKESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDN  183
            W++     W LH+L+L GLR L +QLW S++NMLFF R +RV  +G+DF+QID EW+WDN
Sbjct  32   WRDGRSVGWSLHLLILFGLRSLTYQLWYSFTNMLFFTRKRRVINEGVDFKQIDNEWNWDN  91

Query  184  FLILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPL  363
            FLILQA+L S      P L  LP    +G +  L+LH+G SEP++YL +R  HS  L+  
Sbjct  92   FLILQALLGSMISHHAPPLEELPILGLQGCIIALLLHVGVSEPVFYLANRWFHSGSLFTH  151

Query  364  YHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLR  543
            YH + H S VP P TAG    LEHL+L  ++  P LG   +G GS+ ++Y Y+  FDFLR
Sbjct  152  YHSIQHASPVPTPMTAGFGTPLEHLVLGAVMAAPLLGAFLMGCGSVGLVYGYVFVFDFLR  211

Query  544  CLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            C+GYSNVE+ P  L + +P L+YLIYSPTY  LHH +K  N+CLFMPL+D+LG
Sbjct  212  CMGYSNVEVFPVRLLQALPFLRYLIYSPTYLSLHHKEKNCNYCLFMPLFDLLG  264



>gb|AEQ39063.1| putative sterol desaturase [Wolffia arrhiza]
Length=287

 Score =   249 bits (635),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 109/225 (48%), Positives = 162/225 (72%), Gaps = 0/225 (0%)
 Frame = +1

Query  28   WCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAIL  207
            WC+H+++L  +RG +H  W S+ NML+  R +RV ++G+DF+QID+EWHWDNFL+LQA +
Sbjct  33   WCMHVVLLCAMRGFIHTAWCSFGNMLYITRNRRVIKEGVDFKQIDREWHWDNFLLLQAFI  92

Query  208  ASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLHHDS  387
               A+  FP   ++P W  +G++  L++H+ FSE L+YL HRL H+  L+  YH LHH  
Sbjct  93   GVGAWYVFPYADSVPLWNARGLLIALLVHLTFSETLFYLAHRLFHTDFLFLSYHSLHHSV  152

Query  388  KVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYSNVE  567
             V   +TAG A  LEHL+L  ++G+P L + F G GS+ ++Y YIL FDFLR + +SNVE
Sbjct  153  PVLQSYTAGLATPLEHLVLSAVMGMPLLASFFTGQGSVALLYMYILGFDFLRAMLHSNVE  212

Query  568  IMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            ++PS LF+ +  LKYLI +PTYY +HH ++ +NFCLF+P++D++G
Sbjct  213  VLPSKLFRRLSFLKYLIATPTYYAIHHKERNSNFCLFLPIFDLMG  257



>ref|XP_009400348.1| PREDICTED: protein ECERIFERUM 3-like [Musa acuminata subsp. malaccensis]
Length=617

 Score =   257 bits (656),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 127/233 (55%), Positives = 163/233 (70%), Gaps = 0/233 (0%)
 Frame = +1

Query  4    WKESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDN  183
            W+E     W LH+L+L  LR LV+QLW S+ NMLF  R +RV + G+DF+QIDKEW WDN
Sbjct  32   WREGRSGGWSLHLLLLFALRSLVYQLWFSFGNMLFLTRRRRVVEDGVDFKQIDKEWDWDN  91

Query  184  FLILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPL  363
            FLILQA+L S    + PSL  LP  + KG +  L+LH+G SEPL+Y+ HR  H   LY  
Sbjct  92   FLILQALLGSMVLYAAPSLEELPLLQLKGCIVALLLHVGVSEPLFYVAHRCFHRGYLYAH  151

Query  364  YHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLR  543
            YH +HH S VP   TA  A  LEHL+L  ++  P LG   +GHGS+ ++Y Y+L FDFLR
Sbjct  152  YHSIHHSSPVPQSLTAAFATPLEHLVLSAVMAAPLLGAFAMGHGSLSLVYGYVLIFDFLR  211

Query  544  CLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
             +GYSNVE++P+ LF  +PVL+YLIYSPTY  LHH +K  NFCLFMP++D+LG
Sbjct  212  SMGYSNVEVLPARLFDALPVLRYLIYSPTYLSLHHKEKNCNFCLFMPVFDLLG  264



>ref|XP_009126813.1| PREDICTED: protein ECERIFERUM 3 [Brassica rapa]
Length=630

 Score =   256 bits (655),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 128/231 (55%), Positives = 173/231 (75%), Gaps = 6/231 (3%)
 Frame = +1

Query  25   IWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAI  204
            +WCLHIL++ GL+GLVH LWS Y+NML+  R  R++  G+D +QID EWHWDN+++LQAI
Sbjct  41   LWCLHILIICGLKGLVHVLWSVYNNMLWVTRTLRINPNGVDSKQIDHEWHWDNYILLQAI  100

Query  205  LASF-AYMSFPSL---ANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSD-LYPLYH  369
            +AS   YMS PSL    ++P W  KG++  +V+H+ FSEPLYY +HR  H ++  +  +H
Sbjct  101  IASMICYMS-PSLMMMNSIPLWNTKGLIALIVIHVTFSEPLYYYLHRSFHRNNYFFTHFH  159

Query  370  WLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCL  549
              HH S VPHP TAG+A  LE+L+LCV+ G+P +G+  LG GSI +IY Y + FDFLRCL
Sbjct  160  SFHHSSPVPHPMTAGNATLLENLILCVVAGVPLIGSCLLGVGSISLIYGYAIMFDFLRCL  219

Query  550  GYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            G+ NVEI    LF+T+P+L+YLIY+PTY+ LHH +  TNFCLFMPL+D+LG
Sbjct  220  GHCNVEIFSHKLFETLPILRYLIYTPTYHALHHQEMGTNFCLFMPLFDVLG  270



>emb|CDY32747.1| BnaA02g08090D [Brassica napus]
Length=630

 Score =   254 bits (649),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 128/231 (55%), Positives = 172/231 (74%), Gaps = 6/231 (3%)
 Frame = +1

Query  25   IWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAI  204
            +WCLHIL++ GL+GLVH LWS Y+NML+  R  R++  G+D +QID EWHWDN+++LQAI
Sbjct  41   LWCLHILIICGLKGLVHVLWSVYNNMLWVTRTLRINPNGVDSKQIDHEWHWDNYILLQAI  100

Query  205  LASF-AYMSFPSL---ANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSD-LYPLYH  369
            +AS   YMS PSL    ++P W  KG++  +V+H+ FSEPLYY +HR  H ++  +  +H
Sbjct  101  IASMICYMS-PSLMMMNSIPLWNTKGLIALIVIHVTFSEPLYYYLHRSFHRNNYFFTHFH  159

Query  370  WLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCL  549
              HH S VPHP TAG+A  LE+L+LCV+ G+P +G+  LG GSI +IY Y + FDFLRCL
Sbjct  160  SFHHSSPVPHPMTAGNATLLENLILCVVAGVPLIGSCLLGVGSISLIYGYAIMFDFLRCL  219

Query  550  GYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            G+ NVEI    LF T+P+L+YLIY+PTY+ LHH +  TNFCLFMPL+D+LG
Sbjct  220  GHCNVEIFSHKLFVTLPILRYLIYTPTYHTLHHQEMGTNFCLFMPLFDVLG  270



>ref|XP_006343719.1| PREDICTED: protein ECERIFERUM 3-like [Solanum tuberosum]
Length=630

 Score =   254 bits (648),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 118/228 (52%), Positives = 166/228 (73%), Gaps = 0/228 (0%)
 Frame = +1

Query  19   EDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQ  198
            E  WC HIL++  LR  +H +W+++SNMLF  R +R+ ++G+DF+Q+D EW WDNF++LQ
Sbjct  41   EATWCFHILIICLLRCTIHSVWNTFSNMLFLTRNRRIIKEGVDFKQVDNEWDWDNFILLQ  100

Query  199  AILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLH  378
            A++ S  +       NLP W+F+G +  ++LH+  SEPLYY +H+  H + L+  YH LH
Sbjct  101  AMIGSLGFYMLQDQINLPLWDFRGFLAIIILHITISEPLYYFLHKCFHGNYLFNNYHSLH  160

Query  379  HDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYS  558
            H S VP PFTAG A F EH++L  I+GIP LG+  LG+GS+ +IY Y+L FD+LRCLG+ 
Sbjct  161  HSSPVPQPFTAGHATFFEHIILGGIIGIPILGSCLLGYGSLTMIYGYVLIFDWLRCLGHC  220

Query  559  NVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            N EI+   LF+ IP LKYLIY+PTY+ LHH +K TN+CLFMP++D+LG
Sbjct  221  NFEIISHQLFEAIPFLKYLIYTPTYHSLHHTEKETNYCLFMPIFDVLG  268



>gb|AAA33934.1| lipid transfer protein, partial [Senecio odorus]
Length=524

 Score =   251 bits (640),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 121/225 (54%), Positives = 162/225 (72%), Gaps = 1/225 (0%)
 Frame = +1

Query  28   WCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAIL  207
            WC HILV++ LR  ++  +++  NMLF  R +R+  Q IDF QIDKEW+WDNF+ILQA++
Sbjct  9    WCFHILVISLLRFNLYMWYTNICNMLFLTRNRRILHQSIDFNQIDKEWNWDNFVILQALI  68

Query  208  ASFAYMSFP-SLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLHHD  384
            AS A   FP   ANLP W+ KG+V  +V+H+  SEPLYY +HRLLH++ L+  YH  HH 
Sbjct  69   ASLAIYMFPQEFANLPVWKTKGLVAIVVIHVVVSEPLYYWLHRLLHTNYLFTPYHSFHHS  128

Query  385  SKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYSNV  564
            S VP P T GS  FLE LL+  ++G+P LG +  G+GS  +IY Y+L FDFLRCLG+SNV
Sbjct  129  SAVPQPVTVGSTTFLEELLVTAVLGLPILGCSLSGYGSKSIIYGYVLVFDFLRCLGHSNV  188

Query  565  EIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDML  699
            EIMP  +F   P  +++IY+PTYY LHH + ++N+CLFMPLYD +
Sbjct  189  EIMPHWIFDYFPFFRFIIYTPTYYSLHHSEMKSNYCLFMPLYDTM  233



>ref|XP_009390985.1| PREDICTED: protein ECERIFERUM 3-like [Musa acuminata subsp. malaccensis]
Length=617

 Score =   249 bits (637),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 124/233 (53%), Positives = 158/233 (68%), Gaps = 0/233 (0%)
 Frame = +1

Query  4    WKESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDN  183
            W++     W LH+L+L  LR L +QLW S++NMLF  R +RV + G++F+QID EW WDN
Sbjct  32   WRDGRAGGWWLHLLLLFVLRSLTYQLWYSFANMLFLTRTRRVIKDGVEFKQIDSEWDWDN  91

Query  184  FLILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPL  363
            FLILQA+L S      PS  +LP  + KG V  LVLH+G SEPL+Y+ HR  H   L+  
Sbjct  92   FLILQALLGSVVLCRAPSFEDLPLLQLKGCVIALVLHVGVSEPLFYMAHRCFHRGYLFTH  151

Query  364  YHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLR  543
            YH +HH S VP P TAG    LE+L+L   +  P LG    GHGS  + Y Y+L FDFLR
Sbjct  152  YHSIHHSSPVPQPITAGFGTLLENLVLSAAMAAPLLGPFATGHGSASLAYGYVLVFDFLR  211

Query  544  CLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            C+GYSNVE++PS LF+ +P L+YL+YSPTY  LHH +K  NFCLFMPL+D LG
Sbjct  212  CMGYSNVEVLPSRLFEALPALRYLLYSPTYLSLHHKEKNCNFCLFMPLFDFLG  264



>gb|KDP38762.1| hypothetical protein JCGZ_04115 [Jatropha curcas]
Length=628

 Score =   249 bits (636),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 119/229 (52%), Positives = 158/229 (69%), Gaps = 1/229 (0%)
 Frame = +1

Query  16   WEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLIL  195
            +++ WCL ILV+  LR LV+  + S  NMLF    +R++ QG DF+QIDKEW WDN +IL
Sbjct  40   FKNDWCLQILVICILRALVYFFYDSLVNMLFLTSTRRINPQGYDFKQIDKEWEWDNLIIL  99

Query  196  QAILASFAYMSFPS-LANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHW  372
            Q ++AS A   FP  + N+P W  KG++  L+LH+G SEPLYY +HR  H S L+  YH 
Sbjct  100  QGLIASLACYIFPPFIENIPLWNTKGLILILILHVGISEPLYYWVHRCFHGSFLFTHYHS  159

Query  373  LHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLG  552
            LHH S V HPFT  +A FLEHL+L  I GIP +    +G  S  +IY Y+L FDFL CLG
Sbjct  160  LHHSSPVLHPFTGATATFLEHLILTTITGIPIIAAYMMGFESRNMIYGYLLVFDFLTCLG  219

Query  553  YSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDML  699
            +SN+EI+P  LF+ +P  KYL+Y+P+Y+ LHH +  TNFCLFMPL+D +
Sbjct  220  HSNIEIIPHRLFEILPFFKYLLYTPSYHSLHHTEMGTNFCLFMPLFDAI  268



>ref|XP_004956872.1| PREDICTED: protein ECERIFERUM 3-like [Setaria italica]
Length=620

 Score =   246 bits (628),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 123/228 (54%), Positives = 164/228 (72%), Gaps = 1/228 (0%)
 Frame = +1

Query  22   DIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQA  201
            D W L +LVL GLR L +QLWSS+SNMLF  R +R+ + G+DFEQIDKEW WDNFL+LQ 
Sbjct  41   DRWILLLLVLFGLRALTYQLWSSFSNMLFATRRRRIVRDGVDFEQIDKEWDWDNFLMLQV  100

Query  202  ILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLH-SSDLYPLYHWLH  378
            ++ + A+ +FPSL +LP W+ +G    L++H   +EPL+Y  HR  H SS LY  YH LH
Sbjct  101  LMTATAFYAFPSLRHLPLWDARGFAVALLIHAAATEPLFYAAHRAFHASSRLYARYHSLH  160

Query  379  HDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYS  558
            H S+VP PFTAGSA  LE ++L   + +P  G    G GS+ + ++Y+LAFD LR +G+ 
Sbjct  161  HSSRVPQPFTAGSATPLEGIVLAAAMALPLAGACAAGCGSVALAFAYVLAFDSLRAMGHC  220

Query  559  NVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            NVE+ PS LF+ IPVL+YLIY+PTY+ +HH  +  NFCLFMPL+D+LG
Sbjct  221  NVEVFPSSLFQAIPVLRYLIYTPTYHTIHHTKREANFCLFMPLFDLLG  268



>ref|NP_001063227.1| Os09g0426800 [Oryza sativa Japonica Group]
 dbj|BAD33619.1| putative Gl1 protein [Oryza sativa Japonica Group]
 dbj|BAF25141.1| Os09g0426800 [Oryza sativa Japonica Group]
 gb|EAZ09166.1| hypothetical protein OsI_31436 [Oryza sativa Indica Group]
Length=619

 Score =   245 bits (626),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 116/234 (50%), Positives = 163/234 (70%), Gaps = 0/234 (0%)
 Frame = +1

Query  1    VWKESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWD  180
             W+ +  D W L +LVL G+R L +QLWSS+SNMLF  R +R+ + G+DF QID+EW WD
Sbjct  34   AWERASPDHWLLLLLVLFGVRALTYQLWSSFSNMLFATRRRRIVRDGVDFGQIDREWDWD  93

Query  181  NFLILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYP  360
            NFLILQ  +A+ A+ +FPSL +LP W+ +G+    +LH+  +EPL+Y  HR  H   L+ 
Sbjct  94   NFLILQVHMAAAAFYAFPSLRHLPLWDARGLAVAALLHVAATEPLFYAAHRAFHRGHLFS  153

Query  361  LYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFL  540
             YH  HH +KVP PFTAG A  LE L+L  ++ +P       GHGS+ + ++Y+L FD L
Sbjct  154  CYHLQHHSAKVPQPFTAGFATPLEQLVLGALMAVPLAAACAAGHGSVALAFAYVLGFDNL  213

Query  541  RCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            R +G+ NVE+ P  LF+++PVLKYLIY+PTY+ +HH  +  NFCLFMPL+D++G
Sbjct  214  RAMGHCNVEVFPGGLFQSLPVLKYLIYTPTYHTIHHTKEDANFCLFMPLFDLIG  267



>gb|EAZ44800.1| hypothetical protein OsJ_29433 [Oryza sativa Japonica Group]
Length=621

 Score =   245 bits (626),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 116/234 (50%), Positives = 163/234 (70%), Gaps = 0/234 (0%)
 Frame = +1

Query  1    VWKESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWD  180
             W+ +  D W L +LVL G+R L +QLWSS+SNMLF  R +R+ + G+DF QID+EW WD
Sbjct  34   AWERASPDHWLLLLLVLFGVRALTYQLWSSFSNMLFATRRRRIVRDGVDFGQIDREWDWD  93

Query  181  NFLILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYP  360
            NFLILQ  +A+ A+ +FPSL +LP W+ +G+    +LH+  +EPL+Y  HR  H   L+ 
Sbjct  94   NFLILQVHMAAAAFYAFPSLRHLPLWDARGLAVAALLHVAATEPLFYAAHRAFHRGHLFS  153

Query  361  LYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFL  540
             YH  HH +KVP PFTAG A  LE L+L  ++ +P       GHGS+ + ++Y+L FD L
Sbjct  154  CYHLQHHSAKVPQPFTAGFATPLEQLVLGALMAVPLAAACAAGHGSVALAFAYVLGFDNL  213

Query  541  RCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            R +G+ NVE+ P  LF+++PVLKYLIY+PTY+ +HH  +  NFCLFMPL+D++G
Sbjct  214  RAMGHCNVEVFPGGLFQSLPVLKYLIYTPTYHTIHHTKEDANFCLFMPLFDLIG  267



>gb|KDO62363.1| hypothetical protein CISIN_1g006768mg [Citrus sinensis]
 gb|KDO62364.1| hypothetical protein CISIN_1g006768mg [Citrus sinensis]
 gb|KDO62365.1| hypothetical protein CISIN_1g006768mg [Citrus sinensis]
Length=567

 Score =   243 bits (619),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/202 (56%), Positives = 149/202 (74%), Gaps = 1/202 (0%)
 Frame = +1

Query  100  MLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPSLANLPTWEFKGVVY  279
            MLF NRA++++Q+G+DF+QID EW+WDNF++LQA +AS  Y  FP   +LP W  KG + 
Sbjct  1    MLFLNRARQINQRGVDFKQIDNEWNWDNFILLQAAIASMGYYIFPCSESLPRWNTKGFIA  60

Query  280  CLVLHMGFSEPLYYLMHRLLHSSD-LYPLYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIV  456
              +LH+  SEPLYY++HR  H +  L+  YH LHH S VP   TAG A  LEH++L  IV
Sbjct  61   LQILHVAVSEPLYYVLHRHFHRNKYLFIHYHSLHHSSPVPQIPTAGHATLLEHIVLSAIV  120

Query  457  GIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYY  636
             IP LG++ +G+GSI +IY YIL FDFLRCLG+ NVEI+P   F+T P L+YL+Y+PTY+
Sbjct  121  AIPILGSSIIGYGSISLIYGYILMFDFLRCLGHCNVEIIPHRWFETFPFLRYLLYTPTYH  180

Query  637  GLHHMDKRTNFCLFMPLYDMLG  702
             LHH +K +NFCLFMPL+D LG
Sbjct  181  SLHHTEKDSNFCLFMPLFDALG  202



>ref|XP_006845484.1| hypothetical protein AMTR_s00019p00142280 [Amborella trichopoda]
 gb|ERN07159.1| hypothetical protein AMTR_s00019p00142280 [Amborella trichopoda]
Length=555

 Score =   241 bits (616),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/201 (56%), Positives = 152/201 (76%), Gaps = 1/201 (0%)
 Frame = +1

Query  100  MLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPSLA-NLPTWEFKGVV  276
            MLF  +  RV QQG+DF+QID+EWHWDNF++LQA++A+FA   FPS   +LP +   G +
Sbjct  1    MLFLTKKLRVLQQGVDFKQIDREWHWDNFILLQALMATFACYYFPSFTKSLPLYNTTGFI  60

Query  277  YCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIV  456
              L+LHMGFSE LYY +HRL HS  LY  YH  HH S V   FTAGSA+ LEH++LC I+
Sbjct  61   CVLLLHMGFSESLYYGVHRLFHSDYLYTNYHSFHHKSMVSQSFTAGSASLLEHIVLCFIM  120

Query  457  GIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYY  636
            GIP +G +++   S+ ++Y+YI+AFDF+RCLG+ NVEI+P  LF+ +P+L+Y+ Y+PTY+
Sbjct  121  GIPIVGASWMDCASLSMVYAYIMAFDFMRCLGHCNVEIIPHSLFEWMPLLRYIFYTPTYH  180

Query  637  GLHHMDKRTNFCLFMPLYDML  699
             LHH +K TNFCLFMP+YD L
Sbjct  181  SLHHNEKSTNFCLFMPIYDAL  201



>dbj|BAK02959.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=619

 Score =   242 bits (617),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 120/234 (51%), Positives = 159/234 (68%), Gaps = 0/234 (0%)
 Frame = +1

Query  1    VWKESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWD  180
             W+ +  D W   +L L  LR   +QLWSSYSNMLF  R +R+ + G+DFEQIDKEW WD
Sbjct  34   AWEPASPDHWLCLLLALFALRAFTYQLWSSYSNMLFLTRRRRIVRDGVDFEQIDKEWDWD  93

Query  181  NFLILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYP  360
            NFLILQ ++AS A  +FPSL +LP W   G     VLH+  +EPL+Y+ HR  H   L+ 
Sbjct  94   NFLILQILMASTALYAFPSLRHLPGWNTAGFAVAAVLHVAATEPLFYVAHRAFHGDHLFA  153

Query  361  LYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFL  540
             YH  HH  KVP PFTAG A  LEH++L  ++ +P  G    G GS+ + ++Y+LAFDFL
Sbjct  154  RYHAPHHSIKVPTPFTAGFATPLEHMVLGALMALPLAGAYAAGVGSVGLAFAYVLAFDFL  213

Query  541  RCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            R +G+ NVE+ P  LF+++P L+YLIY+PTY+ +HH  K+ NFCLFMPL+D LG
Sbjct  214  RAMGHCNVELFPGGLFRSLPFLRYLIYTPTYHTIHHAGKKANFCLFMPLFDRLG  267



>ref|XP_003570600.1| PREDICTED: protein ECERIFERUM 3-like [Brachypodium distachyon]
Length=626

 Score =   242 bits (617),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 114/229 (50%), Positives = 154/229 (67%), Gaps = 2/229 (1%)
 Frame = +1

Query  22   DIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQA  201
            D W LH+L L   RGL +Q W SYS+MLF  R +RV   G+DF Q+D EW WDNFL+LQ 
Sbjct  45   DSWWLHLLALFWARGLTYQFWYSYSSMLFLTRRRRVVPDGVDFRQVDLEWDWDNFLLLQT  104

Query  202  ILASFAYMS--FPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWL  375
            ++ +        P   +L  W+ +G+   L+LH+GFSEP++YL HR LH + L+  YH  
Sbjct  105  LIGAVVVNGPLLPGPKHLSLWDPRGLAIVLLLHVGFSEPVFYLAHRALHGASLFRQYHAA  164

Query  376  HHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGY  555
            HH S+V  P TAG    LE LLL +  G+P  G   +G GSI ++Y Y+LAFD+LR +GY
Sbjct  165  HHSSRVTQPLTAGFGTPLEALLLMLTTGVPLAGAFLMGSGSIGLVYVYLLAFDYLRSMGY  224

Query  556  SNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            SNVE++   +F+ +P L+YLIY+P+Y  LHH +K +NFCLFMPLYD+LG
Sbjct  225  SNVEVISHRVFEALPPLRYLIYTPSYLSLHHREKDSNFCLFMPLYDLLG  273



>dbj|BAB08850.1| lipid transfer protein; glossy1 homolog [Arabidopsis thaliana]
Length=566

 Score =   234 bits (597),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/206 (54%), Positives = 147/206 (71%), Gaps = 5/206 (2%)
 Frame = +1

Query  100  MLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASF-AYMSFP---SLANLPTWEFK  267
            MLF  R  R++ +GIDF+QID EWHWDN++ILQAI+ S   YMS P    + +LP W  K
Sbjct  1    MLFVTRTLRINPKGIDFKQIDHEWHWDNYIILQAIIVSLICYMSPPLMMMINSLPLWNTK  60

Query  268  GVVYCLVLHMGFSEPLYYLMHRLLHSSD-LYPLYHWLHHDSKVPHPFTAGSAAFLEHLLL  444
            G++  +VLH+ FSEPLYY +HR  H ++  +  YH  HH S VPHP TAG+A  LE+++L
Sbjct  61   GLIALIVLHVTFSEPLYYFLHRSFHRNNYFFTHYHSFHHSSPVPHPMTAGNATLLENIIL  120

Query  445  CVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYSNVEIMPSHLFKTIPVLKYLIYS  624
            CV+ G+P +G    G GS+  IY Y + FDF+RCLG+ NVEI    LF+ +PVL+YLIY+
Sbjct  121  CVVAGVPLIGCCLFGVGSLSAIYGYAVMFDFMRCLGHCNVEIFSHKLFEILPVLRYLIYT  180

Query  625  PTYYGLHHMDKRTNFCLFMPLYDMLG  702
            PTY+ LHH +  TNFCLFMPL+D+LG
Sbjct  181  PTYHSLHHQEMGTNFCLFMPLFDVLG  206



>ref|XP_004973574.1| PREDICTED: protein ECERIFERUM 3-like [Setaria italica]
Length=618

 Score =   233 bits (595),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 114/234 (49%), Positives = 156/234 (67%), Gaps = 0/234 (0%)
 Frame = +1

Query  1    VWKESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWD  180
             W+    D WC  +L+L  LR   +  W  +SNMLF NR + + + G+D+EQIDKEWHWD
Sbjct  33   AWESGSPDRWCFLLLLLFVLRAATYHSWGIFSNMLFLNRRRVIVRDGVDYEQIDKEWHWD  92

Query  181  NFLILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYP  360
            NFLILQ  LA+ A  +FPSL +LP W+ +G    L+LH+  +EPL+YL+HR LH   L+ 
Sbjct  93   NFLILQLWLAAMALYAFPSLRHLPLWDARGAAVALLLHVAATEPLFYLLHRALHREHLFS  152

Query  361  LYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFL  540
             YH LHH  +V  P+TAG A  LE L +  ++ +P       G GS  +++ Y LAFDFL
Sbjct  153  DYHSLHHSIRVLQPYTAGLATPLEILAISGLMAVPVAAACAAGLGSACLLFGYALAFDFL  212

Query  541  RCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            R +G+ NVE+ P  LF+T+P  +YLI +PTY+ +HH DK +NFCLFMPL+D+LG
Sbjct  213  RAMGHCNVEVFPGWLFETVPAARYLIGTPTYHTIHHTDKDSNFCLFMPLFDLLG  266



>gb|ACN25333.1| unknown [Zea mays]
 gb|ACN28101.1| unknown [Zea mays]
 gb|AFW70399.1| hypothetical protein ZEAMMB73_833522 [Zea mays]
Length=627

 Score =   233 bits (593),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 114/245 (47%), Positives = 155/245 (63%), Gaps = 11/245 (4%)
 Frame = +1

Query  1    VWK--ESWED-------IWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFE  153
            VWK  + W +        W LH+L+L   RGL +Q W SY NMLFF R +RV   G+DF 
Sbjct  26   VWKVLQEWREQAGLPLGSWWLHLLLLFAARGLTYQFWFSYGNMLFFTRRRRVVADGVDFR  85

Query  154  QIDKEWHWDNFLILQAILASFAYMS--FPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLM  327
            QID EW WDNFL+LQ ++ +    S   P L  L  W+ +G    L+LH+GFSEP++YL 
Sbjct  86   QIDAEWDWDNFLVLQTLIGATVVNSPLLPGLRQLCLWDPRGWAVALLLHVGFSEPVFYLA  145

Query  328  HRLLHSSDLYPLYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIV  507
            HR LH + L+  YH  HH S V  P TAG    LE LLL +++G P  G   +G GSI +
Sbjct  146  HRALHRAPLFARYHAAHHSSGVTQPLTAGFGTPLEVLLLTLVMGAPLAGAFLVGAGSIGL  205

Query  508  IYSYILAFDFLRCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPL  687
            +Y + LAFD+LR +GYSNVE++   +F+  P+L+Y++Y+P+Y  LHH ++  NFCLFMP 
Sbjct  206  VYVHALAFDYLRAMGYSNVEVVSPRVFEAFPLLRYILYTPSYLSLHHRERCRNFCLFMPA  265

Query  688  YDMLG  702
             D+ G
Sbjct  266  LDLAG  270



>gb|ADE75704.1| unknown [Picea sitchensis]
Length=623

 Score =   232 bits (591),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 109/227 (48%), Positives = 156/227 (69%), Gaps = 0/227 (0%)
 Frame = +1

Query  22   DIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQA  201
            D WC HIL+LT LR + +QLW+++SNM   +   ++ ++G +F+Q+D+EW WDNFL+LQA
Sbjct  43   DNWCFHILLLTSLRYVTYQLWATFSNMYCLSHRYKICKKGAEFDQMDREWDWDNFLLLQA  102

Query  202  ILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLHH  381
             +A+ A+   P   ++P W   G++   +L MG +E LYY  HR  H   L+  YH LHH
Sbjct  103  FMATAAHHFLPFFRDMPAWNAGGLICLAILRMGPAEVLYYWAHRAFHKDFLFQRYHSLHH  162

Query  382  DSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYSN  561
             + V  P TAG+A FLEH+ L +I+ +P +G +++G  S+ +IY Y L FDFLR +G+SN
Sbjct  163  AAIVLQPQTAGTATFLEHIGLTIIMAVPMVGASWMGGASMGMIYIYCLLFDFLRYMGHSN  222

Query  562  VEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            VEI+P  +F+ +P LKYLIY+P Y+ LHH +  TNFC FMPLYD LG
Sbjct  223  VEIVPETIFRCLPPLKYLIYTPLYHTLHHTEMDTNFCPFMPLYDYLG  269



>ref|XP_004951702.1| PREDICTED: protein ECERIFERUM 3-like isoform X3 [Setaria italica]
Length=626

 Score =   232 bits (591),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 114/242 (47%), Positives = 152/242 (63%), Gaps = 11/242 (5%)
 Frame = +1

Query  1    VWK--ESWED-------IWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFE  153
            VWK  + W +        W LH+LVL  +RGL++Q W +Y NMLFF R +RV   G+DF 
Sbjct  25   VWKVVQEWREQGGLPLGSWWLHLLVLFAVRGLIYQFWFTYGNMLFFTRRRRVVADGVDFR  84

Query  154  QIDKEWHWDNFLILQAILASFAYMS--FPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLM  327
            QID EW WDNFLILQ ++ +    S   P L  L  W+ +G    L+LH+GFSEP++YL 
Sbjct  85   QIDAEWDWDNFLILQTLIGATVVNSPLLPGLRQLCLWDPRGWAVALLLHVGFSEPVFYLA  144

Query  328  HRLLHSSDLYPLYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIV  507
            HR LH + L+  YH  HH S V    TAG    LE LLL + +G P  G   LG GSI +
Sbjct  145  HRALHRAPLFARYHAAHHSSGVTQALTAGFGTPLESLLLTLAMGAPLAGAFLLGAGSIGL  204

Query  508  IYSYILAFDFLRCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPL  687
            +Y++   FD+LR +GYSNVE++   +F   P L+Y++Y+P+Y  LHH++KR NFCLFMP 
Sbjct  205  VYAHAFVFDYLRAMGYSNVEVVSPRVFDAFPPLRYILYTPSYLSLHHLEKRGNFCLFMPA  264

Query  688  YD  693
             D
Sbjct  265  LD  266



>gb|EPS65188.1| hypothetical protein M569_09590, partial [Genlisea aurea]
Length=223

 Score =   221 bits (562),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 103/201 (51%), Positives = 141/201 (70%), Gaps = 0/201 (0%)
 Frame = +1

Query  28   WCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAIL  207
            W LH+ +L  LR L+HQLWS+YSN LF    + + ++G+ F QID+E HWDNF++LQAI+
Sbjct  23   WGLHVFLLCMLRLLMHQLWSAYSNTLFLTHNRLILKKGVGFRQIDQELHWDNFILLQAIV  82

Query  208  ASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLHHDS  387
             S    +FP    +PTWE  GV+  LVLH   SEPL+Y +H+  H + L+  YH+LHH S
Sbjct  83   TSVVLHAFPPAETVPTWEKNGVLSALVLHAALSEPLFYAIHKRFHGNQLFTNYHFLHHSS  142

Query  388  KVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYSNVE  567
             VP PFTAG A+FLE L L V++GIP   +  +G GSI ++Y Y+L FD LRCLG+SNVE
Sbjct  143  PVPQPFTAGHASFLEQLGLTVVMGIPLAVSFLIGGGSIGLLYCYVLGFDSLRCLGHSNVE  202

Query  568  IMPSHLFKTIPVLKYLIYSPT  630
            I+P  LF+  P ++Y++Y+PT
Sbjct  203  IVPHRLFEAFPFMRYILYTPT  223



>ref|XP_002451653.1| hypothetical protein SORBIDRAFT_04g005330 [Sorghum bicolor]
 gb|EES04629.1| hypothetical protein SORBIDRAFT_04g005330 [Sorghum bicolor]
Length=630

 Score =   232 bits (591),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 109/227 (48%), Positives = 150/227 (66%), Gaps = 2/227 (1%)
 Frame = +1

Query  28   WCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAIL  207
            W LH+L+L  +RGL +Q W +Y NMLFF R +RV   G+DF QID EW WDNFL+LQ ++
Sbjct  47   WWLHLLLLFVVRGLTYQFWFTYGNMLFFTRRRRVVADGVDFRQIDAEWDWDNFLVLQTLI  106

Query  208  ASFAYMS--FPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLHH  381
             +    S   P L  L  W+ +G    L+LH+GFSEP++YL HR LH   L+  +H  HH
Sbjct  107  GATVVNSPLLPGLRQLCLWDARGWAVALLLHVGFSEPVFYLAHRALHRDPLFARHHAAHH  166

Query  382  DSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYSN  561
             S V    TAG    LE LLL +++G+P  G   +G GSI ++Y + LAFD+LR +GYSN
Sbjct  167  SSGVTQSLTAGFGTPLEALLLTLVMGVPLAGAFLVGAGSIGLVYVHALAFDYLRAMGYSN  226

Query  562  VEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            VE++   +F+  P+L+Y++Y+P+Y  LHH ++R NFCLFMP  D LG
Sbjct  227  VEVVSPRVFEAFPLLRYILYTPSYLSLHHRERRGNFCLFMPALDWLG  273



>gb|AGT16346.1| glossy1 protein [Saccharum hybrid cultivar R570]
 gb|AGT16349.1| glossy1 protein [Saccharum hybrid cultivar R570]
Length=622

 Score =   231 bits (590),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 122/237 (51%), Positives = 166/237 (70%), Gaps = 3/237 (1%)
 Frame = +1

Query  1    VWKESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWD  180
             W+ +  D W L +L+L GLR L +QLWSSYSNMLF  R +RV + G+DF QIDKEW WD
Sbjct  34   AWEAASPDRWILLLLLLFGLRALTYQLWSSYSNMLFATRRRRVVRDGVDFHQIDKEWDWD  93

Query  181  NFLILQAILASFAYMSFPSLANLPTW--EFKGVVYCLVLHMGFSEPLYYLMHRLLHSS-D  351
            NFLIL  ++A+ A  +FPSL +LP W  + +G+   +++H   +EPL YL HR  H+S  
Sbjct  94   NFLILHVLMAATALYAFPSLRHLPLWPVDARGLAVAVLVHAAATEPLAYLEHRAFHASGS  153

Query  352  LYPLYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAF  531
            LY  YH LHH ++VP PFTAG A  LEH+ L  ++ +P       G GS+ + ++Y+L F
Sbjct  154  LYARYHSLHHSTRVPQPFTAGLATPLEHMALGALMALPVAAACAAGSGSVALAFAYVLGF  213

Query  532  DFLRCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            DFLR +G+ NVE++PS LF+ +PVL+YLIY+PTY+ +HH  K  NFCLFMPL+D+LG
Sbjct  214  DFLRAMGHCNVEVIPSSLFQAVPVLRYLIYTPTYHAIHHTKKEANFCLFMPLFDLLG  270



>ref|XP_008643558.1| PREDICTED: uncharacterized protein LOC100280351 isoform X1 [Zea 
mays]
Length=747

 Score =   233 bits (594),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 114/245 (47%), Positives = 155/245 (63%), Gaps = 11/245 (4%)
 Frame = +1

Query  1    VWK--ESWED-------IWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFE  153
            VWK  + W +        W LH+L+L   RGL +Q W SY NMLFF R +RV   G+DF 
Sbjct  146  VWKVLQEWREQAGLPLGSWWLHLLLLFAARGLTYQFWFSYGNMLFFTRRRRVVADGVDFR  205

Query  154  QIDKEWHWDNFLILQAILASFAYMS--FPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLM  327
            QID EW WDNFL+LQ ++ +    S   P L  L  W+ +G    L+LH+GFSEP++YL 
Sbjct  206  QIDAEWDWDNFLVLQTLIGATVVNSPLLPGLRQLCLWDPRGWAVALLLHVGFSEPVFYLA  265

Query  328  HRLLHSSDLYPLYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIV  507
            HR LH + L+  YH  HH S V  P TAG    LE LLL +++G P  G   +G GSI +
Sbjct  266  HRALHRAPLFARYHAAHHSSGVTQPLTAGFGTPLEVLLLTLVMGAPLAGAFLVGAGSIGL  325

Query  508  IYSYILAFDFLRCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPL  687
            +Y + LAFD+LR +GYSNVE++   +F+  P+L+Y++Y+P+Y  LHH ++  NFCLFMP 
Sbjct  326  VYVHALAFDYLRAMGYSNVEVVSPRVFEAFPLLRYILYTPSYLSLHHRERCRNFCLFMPA  385

Query  688  YDMLG  702
             D+ G
Sbjct  386  LDLAG  390



>gb|EEE56435.1| hypothetical protein OsJ_05611 [Oryza sativa Japonica Group]
Length=550

 Score =   229 bits (584),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 114/251 (45%), Positives = 160/251 (64%), Gaps = 18/251 (7%)
 Frame = +1

Query  1    VWK--ESWED-------IWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFE  153
            VWK  E W          W LH+L+L   RGL +Q W SY NMLFF R +RV    +DF 
Sbjct  11   VWKVAEEWRQQGAAPVGSWWLHLLLLFAARGLTYQFWFSYGNMLFFTRRRRVVPDSVDFR  70

Query  154  QIDKEWHWDNFLILQAILASFAYMSFPSLAN----LPT----WEFKGVVYCLVLHMGFSE  309
            Q+D EW WDNFL+LQ ++ +   +  P++A     LP+    W+ +G    L+LH+  +E
Sbjct  71   QVDAEWDWDNFLLLQTLIGA-TLVGSPAVARQQLLLPSLKQAWDPRGWAIALLLHVLVAE  129

Query  310  PLYYLMHRLLHSSDLYPLYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLG  489
            PL+Y  HR LH + L+  YH  HH + V  P TAG    LE LLL V++G+P  G   +G
Sbjct  130  PLFYWAHRALHRAPLFSRYHAAHHHASVTTPLTAGFGTPLESLLLTVVIGVPLAGAFLMG  189

Query  490  HGSIIVIYSYILAFDFLRCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNF  669
             GS+ ++Y ++L FDFLR +GYSNVE++   +F+ +P+L+YLIY+PTY  LHH +K +NF
Sbjct  190  VGSVGLVYGHVLLFDFLRSMGYSNVEVISPRVFQAVPLLRYLIYTPTYLSLHHREKDSNF  249

Query  670  CLFMPLYDMLG  702
            CLFMP++D+LG
Sbjct  250  CLFMPIFDLLG  260



>dbj|BAJ85039.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ90842.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=624

 Score =   231 bits (588),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 109/227 (48%), Positives = 153/227 (67%), Gaps = 4/227 (2%)
 Frame = +1

Query  34   LHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILAS  213
            LH+L+L   RGL +Q W SYSNMLF  R +RV   G+DF Q+D EW WDNFL+LQ ++ +
Sbjct  45   LHLLLLFSARGLTYQFWFSYSNMLFLTRRRRVVPDGVDFRQVDHEWDWDNFLVLQTLIGA  104

Query  214  F---AYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLY-PLYHWLHH  381
                  +  P L NL  W+ +G+   L+LH+GFSEP++Y  HR LH + L+   YH  HH
Sbjct  105  ALVNGPLLLPGLENLRVWDPRGLGIALLLHVGFSEPVFYWAHRALHGAPLFFSQYHAGHH  164

Query  382  DSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYSN  561
             + V  P TAG    LE LLL + +G+P  G   +G GS+ ++Y ++L FD+LR +GYSN
Sbjct  165  STPVTQPLTAGFGTPLEALLLTLTMGVPLAGAFLMGAGSVGLVYVHLLTFDYLRSMGYSN  224

Query  562  VEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            VE++   +F+ +P L+YL+Y+PTY  LHH +K +NFCLFMPL+D+LG
Sbjct  225  VEVISHRVFEAVPPLRYLLYTPTYLSLHHREKDSNFCLFMPLFDLLG  271



>dbj|BAJ87617.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=624

 Score =   230 bits (587),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 109/227 (48%), Positives = 153/227 (67%), Gaps = 4/227 (2%)
 Frame = +1

Query  34   LHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILAS  213
            LH+L+L   RGL +Q W SYSNMLF  R +RV   G+DF Q+D EW WDNFL+LQ ++ +
Sbjct  45   LHLLLLFSARGLTYQFWFSYSNMLFLTRRRRVVPDGVDFRQVDHEWDWDNFLVLQTLIGA  104

Query  214  F---AYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLY-PLYHWLHH  381
                  +  P L NL  W+ +G+   L+LH+GFSEP++Y  HR LH + L+   YH  HH
Sbjct  105  ALVNGPLLLPGLENLRVWDPRGLGIALLLHVGFSEPVFYWAHRALHGAPLFFSQYHAGHH  164

Query  382  DSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYSN  561
             + V  P TAG    LE LLL + +G+P  G   +G GS+ ++Y ++L FD+LR +GYSN
Sbjct  165  STPVTQPLTAGFGTPLEALLLTLTMGVPLAGAFLMGAGSVGLVYVHLLTFDYLRSMGYSN  224

Query  562  VEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            VE++   +F+ +P L+YL+Y+PTY  LHH +K +NFCLFMPL+D+LG
Sbjct  225  VEVISHRVFEAVPPLRYLLYTPTYLSLHHREKDSNFCLFMPLFDLLG  271



>ref|NP_001046080.1| Os02g0178800 [Oryza sativa Japonica Group]
 dbj|BAD28002.1| putative glossy1 protein [Oryza sativa Japonica Group]
 dbj|BAF07994.1| Os02g0178800 [Oryza sativa Japonica Group]
 dbj|BAG90034.1| unnamed protein product [Oryza sativa Japonica Group]
Length=628

 Score =   229 bits (583),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 114/251 (45%), Positives = 160/251 (64%), Gaps = 18/251 (7%)
 Frame = +1

Query  1    VWK--ESWED-------IWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFE  153
            VWK  E W          W LH+L+L   RGL +Q W SY NMLFF R +RV    +DF 
Sbjct  26   VWKVAEEWRQQGAAPVGSWWLHLLLLFAARGLTYQFWFSYGNMLFFTRRRRVVPDSVDFR  85

Query  154  QIDKEWHWDNFLILQAILASFAYMSFPSLAN----LPT----WEFKGVVYCLVLHMGFSE  309
            Q+D EW WDNFL+LQ ++ +   +  P++A     LP+    W+ +G    L+LH+  +E
Sbjct  86   QVDAEWDWDNFLLLQTLIGA-TLVGSPAVARQQLLLPSLKQAWDPRGWAIALLLHVLVAE  144

Query  310  PLYYLMHRLLHSSDLYPLYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLG  489
            PL+Y  HR LH + L+  YH  HH + V  P TAG    LE LLL V++G+P  G   +G
Sbjct  145  PLFYWAHRALHRAPLFSRYHAAHHHASVTTPLTAGFGTPLESLLLTVVIGVPLAGAFLMG  204

Query  490  HGSIIVIYSYILAFDFLRCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNF  669
             GS+ ++Y ++L FDFLR +GYSNVE++   +F+ +P+L+YLIY+PTY  LHH +K +NF
Sbjct  205  VGSVGLVYGHVLLFDFLRSMGYSNVEVISPRVFQAVPLLRYLIYTPTYLSLHHREKDSNF  264

Query  670  CLFMPLYDMLG  702
            CLFMP++D+LG
Sbjct  265  CLFMPIFDLLG  275



>gb|EEC72610.1| hypothetical protein OsI_06088 [Oryza sativa Indica Group]
Length=628

 Score =   229 bits (583),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 114/251 (45%), Positives = 160/251 (64%), Gaps = 18/251 (7%)
 Frame = +1

Query  1    VWK--ESWED-------IWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFE  153
            VWK  E W          W LH+L+L   RGL +Q W SY NMLFF R +RV    +DF 
Sbjct  26   VWKVAEEWRQQGAAPVGSWWLHLLLLFAARGLTYQFWFSYGNMLFFTRRRRVVPDSVDFR  85

Query  154  QIDKEWHWDNFLILQAILASFAYMSFPSLAN----LPT----WEFKGVVYCLVLHMGFSE  309
            Q+D EW WDNFL+LQ ++ +   +  P++A     LP+    W+ +G    L+LH+  +E
Sbjct  86   QVDAEWDWDNFLLLQTLIGA-TLVGSPAVARQQLLLPSLKQAWDPRGWAIALLLHVLVAE  144

Query  310  PLYYLMHRLLHSSDLYPLYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLG  489
            PL+Y  HR LH + L+  YH  HH + V  P TAG    LE LLL V++G+P  G   +G
Sbjct  145  PLFYWAHRALHRAPLFSRYHAAHHHASVTTPLTAGFGTPLESLLLTVVIGVPLAGAFLMG  204

Query  490  HGSIIVIYSYILAFDFLRCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNF  669
             GS+ ++Y ++L FDFLR +GYSNVE++   +F+ +P+L+YLIY+PTY  LHH +K +NF
Sbjct  205  VGSVGLVYGHVLLFDFLRSMGYSNVEVISPRVFQAVPLLRYLIYTPTYLSLHHREKDSNF  264

Query  670  CLFMPLYDMLG  702
            CLFMP++D+LG
Sbjct  265  CLFMPIFDLLG  275



>gb|AFW87578.1| hypothetical protein ZEAMMB73_499314, partial [Zea mays]
Length=431

 Score =   224 bits (570),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 117/239 (49%), Positives = 152/239 (64%), Gaps = 5/239 (2%)
 Frame = +1

Query  1    VWKESWE---DIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEW  171
             W+E+       WCLH+L+L  LR L  QLW SY NMLFF R +RV + G+DF QID EW
Sbjct  31   AWRETGSLPLGSWCLHLLLLLALRSLTFQLWFSYGNMLFFTRRRRVVKDGVDFRQIDAEW  90

Query  172  HWDNFLILQAILASFAYMS--FPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHS  345
             WDN +ILQ ++A+ A  S  FP+++ L  W+ +G    L+LH+  SEP++Y  HR LH 
Sbjct  91   DWDNMVILQTLVAAVAMGSAAFPAVSELRAWDPRGWALALLLHVAVSEPVFYWTHRALHR  150

Query  346  SDLYPLYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYIL  525
              L+  YH  HH S V  PFTAG    LE LLL + +G P  G    G GS+ ++Y ++L
Sbjct  151  GPLFSQYHARHHSSPVTQPFTAGFGTPLEALLLTLAMGAPLAGAFLAGAGSVSLVYGHVL  210

Query  526  AFDFLRCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
             FD LRC+GYSNVE++    F   P L+YL+Y+ TY  LHH +K  NFCLFMPLYD LG
Sbjct  211  LFDCLRCMGYSNVEVISHRAFAAFPPLRYLVYTATYLSLHHREKDCNFCLFMPLYDALG  269



>gb|EMT05456.1| Protein WAX2 [Aegilops tauschii]
Length=575

 Score =   227 bits (579),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 114/238 (48%), Positives = 155/238 (65%), Gaps = 5/238 (2%)
 Frame = +1

Query  4    WKESW---EDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWH  174
            W+E      D WCLH+L+L  LR L+HQLW SY+NMLFF R +RV   G+DF QID EW 
Sbjct  23   WREQGGAPTDSWCLHLLLLLALRSLIHQLWFSYANMLFFTRRRRVVPDGVDFHQIDAEWD  82

Query  175  WDNFLILQAILASFAYMS--FPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSS  348
            WDN +I+Q +L + A  S  FP+++ L  W+ +G    L+LH+  SEP +   HR LH  
Sbjct  83   WDNMVIMQTLLGAMAISSPLFPAMSELRAWDPRGWAVALLLHVAVSEPGFRWAHRALHRG  142

Query  349  DLYPLYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILA  528
             L+  YH  HH S V  P T+     LE L+L + +  P  G   +G GS+ ++Y +I A
Sbjct  143  PLFSRYHSKHHSSPVTQPLTSAYGTPLESLVLTLAMAAPLAGAFLVGAGSVSLVYGHIFA  202

Query  529  FDFLRCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            FD+LRC+GYSNVE++    F+  P+L+YLIY+PTY  LHH +K +NFCLFMPL+D+LG
Sbjct  203  FDYLRCMGYSNVEVISHRAFQAFPLLRYLIYTPTYLSLHHQEKDSNFCLFMPLFDLLG  260



>ref|XP_008658046.1| PREDICTED: uncharacterized protein LOC100192547 isoform X1 [Zea 
mays]
 gb|AFW87577.1| gl1 protein [Zea mays]
Length=622

 Score =   225 bits (573),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 117/239 (49%), Positives = 152/239 (64%), Gaps = 5/239 (2%)
 Frame = +1

Query  1    VWKESWE---DIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEW  171
             W+E+       WCLH+L+L  LR L  QLW SY NMLFF R +RV + G+DF QID EW
Sbjct  31   AWRETGSLPLGSWCLHLLLLLALRSLTFQLWFSYGNMLFFTRRRRVVKDGVDFRQIDAEW  90

Query  172  HWDNFLILQAILASFAYMS--FPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHS  345
             WDN +ILQ ++A+ A  S  FP+++ L  W+ +G    L+LH+  SEP++Y  HR LH 
Sbjct  91   DWDNMVILQTLVAAVAMGSAAFPAVSELRAWDPRGWALALLLHVAVSEPVFYWTHRALHR  150

Query  346  SDLYPLYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYIL  525
              L+  YH  HH S V  PFTAG    LE LLL + +G P  G    G GS+ ++Y ++L
Sbjct  151  GPLFSQYHARHHSSPVTQPFTAGFGTPLEALLLTLAMGAPLAGAFLAGAGSVSLVYGHVL  210

Query  526  AFDFLRCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
             FD LRC+GYSNVE++    F   P L+YL+Y+ TY  LHH +K  NFCLFMPLYD LG
Sbjct  211  LFDCLRCMGYSNVEVISHRAFAAFPPLRYLVYTATYLSLHHREKDCNFCLFMPLYDALG  269



>ref|NP_001266321.1| gl1 protein [Zea mays]
 gb|ACG43105.1| gl1 protein [Zea mays]
Length=622

 Score =   224 bits (571),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 117/239 (49%), Positives = 151/239 (63%), Gaps = 5/239 (2%)
 Frame = +1

Query  1    VWKESWE---DIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEW  171
             W+E+       WCLH+L+L  LR L  QLW SY NMLFF R +RV + G+DF QID EW
Sbjct  31   AWRETGSLPLGSWCLHLLLLLALRSLTFQLWFSYGNMLFFTRRRRVVKDGVDFRQIDAEW  90

Query  172  HWDNFLILQAILASFAYMS--FPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHS  345
             WDN +ILQ ++A+ A  S  FP+++ L  W+ +G    L+LH+  SEP +Y  HR LH 
Sbjct  91   DWDNMVILQTLVAAVAMGSAAFPAVSELRAWDPRGWALALLLHVAVSEPAFYWAHRALHR  150

Query  346  SDLYPLYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYIL  525
              L+  YH  HH S V  PFTAG    LE LLL + +G P  G    G GS+ ++Y ++L
Sbjct  151  GPLFSQYHARHHSSPVTQPFTAGFGTPLEALLLTLAMGAPLAGAFLAGAGSVSLVYGHVL  210

Query  526  AFDFLRCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
             FD LRC+GYSNVE++    F   P L+YL+Y+ TY  LHH +K  NFCLFMPLYD LG
Sbjct  211  LFDCLRCMGYSNVEVISHRAFAAFPPLRYLVYTATYLSLHHREKDCNFCLFMPLYDALG  269



>ref|XP_004965700.1| PREDICTED: protein ECERIFERUM 3-like [Setaria italica]
Length=622

 Score =   223 bits (568),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 116/239 (49%), Positives = 150/239 (63%), Gaps = 5/239 (2%)
 Frame = +1

Query  1    VWKESWE---DIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEW  171
             W+E+     D WCLH+L+L  LR L  QLW SY NMLFF R +RV + G+DF QID EW
Sbjct  31   AWRETGSPPLDSWCLHLLLLLALRSLTFQLWFSYGNMLFFTRRRRVVKDGVDFRQIDAEW  90

Query  172  HWDNFLILQAILASFAYMS--FPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHS  345
             WDN +ILQ ++A+    S  FP +  L  W+ +G    L+LH+  SEP +Y  HR LH 
Sbjct  91   DWDNLVILQTLIAAMVANSPAFPGVPELRAWDPRGWALALLLHVTVSEPAFYWAHRALHR  150

Query  346  SDLYPLYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYIL  525
              L   YH  HH S V  PFTAG    LE L+L   +  P  G    G GS+ ++Y+++L
Sbjct  151  VPLLSQYHAKHHSSPVTQPFTAGFGTPLEALILTAAMVAPLAGAFTAGAGSVSLVYAHVL  210

Query  526  AFDFLRCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
             FD+LRC+GYSNVE++    F  +P L+YLIY+PTY  LHH +K  NFCLFMPL+D LG
Sbjct  211  LFDYLRCMGYSNVEVISHRAFAAVPALRYLIYTPTYLSLHHREKDCNFCLFMPLFDALG  269



>gb|EMT23422.1| Protein WAX2 [Aegilops tauschii]
Length=694

 Score =   224 bits (571),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 108/226 (48%), Positives = 151/226 (67%), Gaps = 3/226 (1%)
 Frame = +1

Query  34   LHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILAS  213
            LH+L+L   RGL +Q W SYSNMLF  R +RV   G+DF Q+D EW WDNFL+LQ ++ +
Sbjct  60   LHLLLLFSARGLTYQFWFSYSNMLFLTRRRRVVPDGVDFRQVDHEWDWDNFLVLQTLIGA  119

Query  214  F---AYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLHHD  384
                  +  P L +L  W+ +G+   L+LH+G SEP++Y  HR LH + L+  YH  HH 
Sbjct  120  ALVNGPLPLPGLEDLRVWDPRGLGIALLLHVGLSEPVFYWAHRALHGAPLFGQYHAGHHS  179

Query  385  SKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYSNV  564
            + V  P TAG    LE LLL +  G+P  G   +G GS+ ++Y ++L FD+LR +GYSNV
Sbjct  180  TPVTQPLTAGFGTPLEALLLTLTTGVPLAGAFLMGAGSLGLVYVHLLTFDYLRSMGYSNV  239

Query  565  EIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            E++   +F+ +P L+YLIY+PTY  LHH +K +NFCLFMPL+D+LG
Sbjct  240  EVISHRVFEALPPLRYLIYTPTYLSLHHREKDSNFCLFMPLFDLLG  285



>dbj|BAJ85064.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=660

 Score =   223 bits (567),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 114/239 (48%), Positives = 153/239 (64%), Gaps = 5/239 (2%)
 Frame = +1

Query  1    VWKESW---EDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEW  171
             W+E      D WCLH+L+L  LR L HQLW SY+NMLFF R  RV   G+DF QID EW
Sbjct  69   AWREQGGAPTDSWCLHLLLLLALRSLTHQLWFSYANMLFFTRRHRVVPDGVDFVQIDAEW  128

Query  172  HWDNFLILQAILASFAYMS--FPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHS  345
             WDN +I+Q +L + A  S  FP++++L  WE +G    L+LH+  SEP +   HR LH 
Sbjct  129  DWDNMVIMQTLLGAMAISSPVFPAVSDLRVWEPRGWAVALLLHVAVSEPGFRWAHRALHR  188

Query  346  SDLYPLYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYIL  525
              L+  YH  HH S V  P T+     LE L+L + +  P  G    G GS+ ++Y +IL
Sbjct  189  GPLFSRYHSKHHASPVTQPLTSAYGTPLESLVLTLAMAAPLAGAFLAGAGSVSLVYGHIL  248

Query  526  AFDFLRCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
             FD+LRC+GYSNVE++    F+  P+L+YL+Y+PTY  LHH +K +NFCLFMPL+D+LG
Sbjct  249  VFDYLRCMGYSNVEVISHRTFRAFPLLRYLMYTPTYLSLHHQEKDSNFCLFMPLFDLLG  307



>ref|XP_002437383.1| hypothetical protein SORBIDRAFT_10g025920 [Sorghum bicolor]
 gb|EER88750.1| hypothetical protein SORBIDRAFT_10g025920 [Sorghum bicolor]
Length=623

 Score =   218 bits (556),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 112/227 (49%), Positives = 147/227 (65%), Gaps = 2/227 (1%)
 Frame = +1

Query  28   WCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAIL  207
            WCLH+L+L  LR L  QLW SY NMLFF R +RV + G+DF QID EW WDN +ILQ ++
Sbjct  44   WCLHLLLLLALRSLTFQLWFSYGNMLFFTRRRRVVKDGVDFRQIDAEWDWDNMVILQTLI  103

Query  208  ASFAYMS--FPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLHH  381
            A+    S  FP ++ +  W+ +G    L+LH+  SEP++Y  HR LH + L+  YH  HH
Sbjct  104  AAAVVGSPAFPGVSEVRVWDPRGWGLALLLHVTVSEPIFYWTHRALHRAPLFSHYHAKHH  163

Query  382  DSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYSN  561
             S V  P TAG    +E LLL + +G P  G    G GS+ ++Y Y+L FD+LRC+GYSN
Sbjct  164  SSPVTQPLTAGFGTPVEALLLTLAMGAPLAGAFLAGAGSVSLVYGYVLLFDYLRCMGYSN  223

Query  562  VEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            VE++    F   P L+YLIY+ TY  LHH +K  NFCLFMPL+D LG
Sbjct  224  VEVISHKTFAAFPPLRYLIYTATYLSLHHREKDCNFCLFMPLFDALG  270



>ref|NP_001058237.1| Os06g0653000 [Oryza sativa Japonica Group]
 dbj|BAD37412.1| putative Gl1 [Oryza sativa Japonica Group]
 dbj|BAF20151.1| Os06g0653000 [Oryza sativa Japonica Group]
 gb|EEE66138.1| hypothetical protein OsJ_22195 [Oryza sativa Japonica Group]
Length=627

 Score =   216 bits (551),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 108/227 (48%), Positives = 147/227 (65%), Gaps = 2/227 (1%)
 Frame = +1

Query  28   WCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAIL  207
            WCLH+++L  LR L +QLW SY NMLFF R +RV   G+DF QID EW WDN +I+Q ++
Sbjct  48   WCLHLILLLALRSLTYQLWFSYGNMLFFTRRRRVVDDGVDFRQIDTEWDWDNMVIMQTLI  107

Query  208  ASFAYMS--FPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLHH  381
            A+    S  FP+ ++L  W+ +G    +VLH+  SEP +Y  HR LH   L+  YH LHH
Sbjct  108  AAVLVTSRVFPATSDLSAWDLRGWAIAVVLHVAVSEPAFYWAHRALHLGPLFSRYHSLHH  167

Query  382  DSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYSN  561
              +     TAG    LE L+L ++   P  G    GHGS+ ++Y +IL FD+LR +GYSN
Sbjct  168  SFQATQALTAGFVTPLESLILTLVAWAPLAGAFMAGHGSVSLVYGHILLFDYLRSMGYSN  227

Query  562  VEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            VE++    F+  P L+YLIY+P+Y  LHH +K +NFCLFMPL+D LG
Sbjct  228  VEVISHKTFQDFPFLRYLIYTPSYLSLHHREKDSNFCLFMPLFDALG  274



>ref|XP_003563334.1| PREDICTED: protein ECERIFERUM 3-like [Brachypodium distachyon]
Length=626

 Score =   215 bits (547),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 108/238 (45%), Positives = 148/238 (62%), Gaps = 6/238 (3%)
 Frame = +1

Query  7    KESWEDI---WCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHW  177
            + SW  +   WC+H+++L  LR L +QLW SY NMLF  R +RV   G+DF+QID EWHW
Sbjct  36   ESSWSSLMESWCVHLVLLLALRSLTYQLWFSYGNMLFLTRRRRVVPDGVDFQQIDAEWHW  95

Query  178  DNFLILQAILASFAYMSFP-SLAN--LPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSS  348
            DN +++Q ++ +    S P S A   +  W+ +G    L+LH+  SEP +   H  LH  
Sbjct  96   DNMVMMQTLIGAMVMNSSPFSSAGGLIRAWDPRGWAVALLLHVALSEPFFRWAHMALHRD  155

Query  349  DLYPLYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILA  528
             L+  YH  HH S V  P TA     LE LLL + +G+P  G    G GS+ ++Y Y+  
Sbjct  156  PLFSRYHSKHHSSPVTQPLTAAYGTPLESLLLTLAMGVPLAGAFLAGSGSLSLVYGYVFL  215

Query  529  FDFLRCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            FD+LRC+GYSNVE++    F+  P L+YLIY+PTY  LHH +K  N+CLFMPLYD+LG
Sbjct  216  FDYLRCMGYSNVEVISHRAFQAFPPLRYLIYTPTYLSLHHKEKDCNYCLFMPLYDLLG  273



>gb|AAR90847.1| glossy1 protein [Zea mays]
Length=621

 Score =   214 bits (546),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 121/236 (51%), Positives = 163/236 (69%), Gaps = 2/236 (1%)
 Frame = +1

Query  1    VWKESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWD  180
             W+ +  D W L +L+L GLR L +QLWSS+SNMLF  R +RV + G+DF+QIDKEW WD
Sbjct  34   AWEAASPDRWILLLLLLFGLRALTYQLWSSFSNMLFATRRRRVVRDGVDFDQIDKEWDWD  93

Query  181  NFLILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSD--L  354
            NFLIL A++A+ A  +FPSL +LP W+ +G    L  H   +EPL YL HR LH S   L
Sbjct  94   NFLILHALMAAAALCAFPSLRHLPAWDGRGFAVALDAHAAATEPLSYLAHRALHGSSGRL  153

Query  355  YPLYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFD  534
            Y  YH LHH S+VP PFTAG A  LEH+ L  ++ +P       G  S+ + ++Y+LAFD
Sbjct  154  YARYHSLHHSSRVPQPFTAGLATALEHVALGALMSLPLAAARAAGCASVALAFAYVLAFD  213

Query  535  FLRCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
             LR +G+ NVE++P+ LF+ IP L+Y++Y+PTY+ +HH  K  NFCLFMPL+D+LG
Sbjct  214  SLRAMGHCNVEVVPASLFRAIPALRYVLYTPTYHAIHHTKKEANFCLFMPLFDLLG  269



>gb|EAZ01917.1| hypothetical protein OsI_23945 [Oryza sativa Indica Group]
Length=631

 Score =   214 bits (545),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 107/227 (47%), Positives = 146/227 (64%), Gaps = 2/227 (1%)
 Frame = +1

Query  28   WCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAIL  207
            WCLH+++L  LR L +QLW SY NMLFF R +RV   G+DF QID EW WDN +I+Q ++
Sbjct  40   WCLHLILLLALRSLTYQLWFSYGNMLFFTRRRRVVDDGVDFRQIDTEWDWDNMVIMQTLI  99

Query  208  ASFAYMS--FPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLHH  381
            A+    S  FP+ ++L  W+ +G    +VLH+  SEP +Y  HR LH   L+  YH LHH
Sbjct  100  AAVLVTSRVFPATSDLSAWDLRGWAIAVVLHVAVSEPAFYWAHRALHLGPLFSRYHSLHH  159

Query  382  DSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYSN  561
              +     TAG    LE L+L ++   P  G    GHGS+ ++Y +IL FD+LR +GYSN
Sbjct  160  SFQATQALTAGFVTPLESLILTLVAWAPLAGAFMAGHGSVSLVYGHILLFDYLRSMGYSN  219

Query  562  VEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            VE++    F+  P L+YLIY+P+Y  LHH +K +NFCLFMPL+D  G
Sbjct  220  VEVISHKTFQDFPFLRYLIYTPSYLSLHHREKDSNFCLFMPLFDAPG  266



>tpg|DAA61563.1| TPA: glossy1 [Zea mays]
Length=621

 Score =   214 bits (544),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 122/236 (52%), Positives = 164/236 (69%), Gaps = 2/236 (1%)
 Frame = +1

Query  1    VWKESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWD  180
             W+ +  D W L +L+L GLR L +QLWSS+SNMLF  R +RV + G+DF+QIDKEW WD
Sbjct  34   AWEAASPDRWILLLLLLFGLRALTYQLWSSFSNMLFATRRRRVVRDGVDFDQIDKEWDWD  93

Query  181  NFLILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSD--L  354
            NFLIL A++A+ A  +FPSL +LP W+ +G    LV H   +EPL YL HR LH S   L
Sbjct  94   NFLILHALMAAAALCAFPSLRHLPAWDGRGFAVALVAHAAATEPLSYLAHRALHGSSGRL  153

Query  355  YPLYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFD  534
            Y  YH LHH S+VP PFTAG A  LEH+ L  ++ +P       G  S+ + ++Y+LAFD
Sbjct  154  YARYHSLHHSSRVPQPFTAGLATPLEHVALGALMSLPLAAARAAGCASVALAFAYVLAFD  213

Query  535  FLRCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
             LR +G+ NVE++P+ LF+ IP L+Y++Y+PTY+ +HH  K  NFCLFMPL+D+LG
Sbjct  214  SLRAMGHCNVEVVPASLFRAIPALRYVLYTPTYHAIHHTKKEANFCLFMPLFDLLG  269



>ref|NP_001105247.1| glossy1 [Zea mays]
 gb|AAR97643.1| Gl1 protein [Zea mays]
Length=621

 Score =   214 bits (544),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 122/236 (52%), Positives = 164/236 (69%), Gaps = 2/236 (1%)
 Frame = +1

Query  1    VWKESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWD  180
             W+ +  D W L +L+L GLR L +QLWSS+SNMLF  R +RV + G+DF+QIDKEW WD
Sbjct  34   AWEAASPDRWILLLLLLFGLRALTYQLWSSFSNMLFATRRRRVVRDGVDFDQIDKEWDWD  93

Query  181  NFLILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSD--L  354
            NFLIL A++A+ A  +FPSL +LP W+ +G    LV H   +EPL YL HR LH S   L
Sbjct  94   NFLILHALMAAAALCAFPSLRHLPAWDGRGFAVALVAHAAATEPLSYLAHRALHGSSGRL  153

Query  355  YPLYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFD  534
            Y  YH LHH S+VP PFTAG A  LEH+ L  ++ +P       G  S+ + ++Y+LAFD
Sbjct  154  YARYHSLHHSSRVPQPFTAGLATPLEHVALGALMSLPLAAARAAGCASVALAFAYVLAFD  213

Query  535  FLRCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
             LR +G+ NVE++P+ LF+ IP L+Y++Y+PTY+ +HH  K  NFCLFMPL+D+LG
Sbjct  214  SLRAMGHCNVEVVPASLFRAIPALRYVLYTPTYHAIHHTKKEANFCLFMPLFDLLG  269



>ref|XP_006646964.1| PREDICTED: protein ECERIFERUM 3-like [Oryza brachyantha]
Length=633

 Score =   214 bits (544),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 114/255 (45%), Positives = 154/255 (60%), Gaps = 21/255 (8%)
 Frame = +1

Query  1    VWK--ESWED-------IWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFE  153
            VWK  E W +        W LH+L+L   RGL +Q W SY NMLFF R +RV    +DF 
Sbjct  26   VWKVAEEWREQGAAPVGSWWLHLLLLFAARGLTYQFWFSYGNMLFFTRRRRVVPDSVDFR  85

Query  154  QIDKEWHWDNFLILQAILAS--FAYMSFPS--LANLP-------TWEFKGVVYCLVLHMG  300
            Q+D EW WDN ++LQ ++ +   A M  P+  LA L         W+ +G    L+LH+ 
Sbjct  86   QVDAEWDWDNLVLLQTLIGATAVAQMRTPTQTLAGLRLEQQLQRGWDPRGWAIALLLHVF  145

Query  301  FSEPLYYLMHRLLHS-SDLYPLYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGT  477
             SEPL+Y  HR LH  + L+  YH  HH S V  P TA     LE LLL V++G P  G 
Sbjct  146  VSEPLFYWAHRALHRWAPLFSRYHAEHHRSPVTTPLTAAFGTPLESLLLTVVMGAPLAGA  205

Query  478  AFLGHGSIIVIYSYILAFDFLRCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDK  657
              +G GS+ ++Y + L FD+LR +GYSNVE++   LF+  P L+YL+Y+P+Y  LHH +K
Sbjct  206  FLMGAGSVGLVYGHALLFDYLRSMGYSNVEVISPRLFQAFPPLRYLLYTPSYLSLHHREK  265

Query  658  RTNFCLFMPLYDMLG  702
             +NFCLFMPL+D+LG
Sbjct  266  DSNFCLFMPLFDLLG  280



>gb|ACN25689.1| unknown [Zea mays]
 gb|AFW87576.1| hypothetical protein ZEAMMB73_499314 [Zea mays]
Length=635

 Score =   211 bits (538),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 117/252 (46%), Positives = 152/252 (60%), Gaps = 18/252 (7%)
 Frame = +1

Query  1    VWKESWE---DIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEW  171
             W+E+       WCLH+L+L  LR L  QLW SY NMLFF R +RV + G+DF QID EW
Sbjct  31   AWRETGSLPLGSWCLHLLLLLALRSLTFQLWFSYGNMLFFTRRRRVVKDGVDFRQIDAEW  90

Query  172  H-------W------DNFLILQAILASFAYMS--FPSLANLPTWEFKGVVYCLVLHMGFS  306
                    W      DN +ILQ ++A+ A  S  FP+++ L  W+ +G    L+LH+  S
Sbjct  91   DCWCASSDWLELLLRDNMVILQTLVAAVAMGSAAFPAVSELRAWDPRGWALALLLHVAVS  150

Query  307  EPLYYLMHRLLHSSDLYPLYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFL  486
            EP++Y  HR LH   L+  YH  HH S V  PFTAG    LE LLL + +G P  G    
Sbjct  151  EPVFYWTHRALHRGPLFSQYHARHHSSPVTQPFTAGFGTPLEALLLTLAMGAPLAGAFLA  210

Query  487  GHGSIIVIYSYILAFDFLRCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTN  666
            G GS+ ++Y ++L FD LRC+GYSNVE++    F   P L+YL+Y+ TY  LHH +K  N
Sbjct  211  GAGSVSLVYGHVLLFDCLRCMGYSNVEVISHRAFAAFPPLRYLVYTATYLSLHHREKDCN  270

Query  667  FCLFMPLYDMLG  702
            FCLFMPLYD LG
Sbjct  271  FCLFMPLYDALG  282



>ref|XP_002975687.1| hypothetical protein SELMODRAFT_103982 [Selaginella moellendorffii]
 gb|EFJ23316.1| hypothetical protein SELMODRAFT_103982 [Selaginella moellendorffii]
Length=628

 Score =   207 bits (528),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 99/233 (42%), Positives = 154/233 (66%), Gaps = 1/233 (0%)
 Frame = +1

Query  7    KESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNF  186
            + S  D W  H+++L  LR L  Q W + S + F  +  ++ Q  + +EQ+D+E+H DN 
Sbjct  40   RHSSTDSWWFHLVLLVLLRYLQQQAWITVSRLYFLVKKYQIQQFALSYEQVDREFHCDNH  99

Query  187  LILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSD-LYPL  363
            +I Q++  + A++  P+  +LP + + G++  +  H+ F+EP+YY +HR +HSS  L+  
Sbjct  100  MIFQSLALAAAHVWIPAFRDLPLFNWTGLLLLVFFHVVFTEPIYYFVHRAMHSSHILFCN  159

Query  364  YHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLR  543
            YH LHH S  P P TAG+  FLE L+   ++ IP +G   LG GS+++IY+Y+L+FDF +
Sbjct  160  YHSLHHASTTPEPATAGTRTFLEELIQAALIAIPIIGVMALGGGSVVMIYAYLLSFDFFK  219

Query  544  CLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
             LG+ N EI+P  LFK  P L+YL+Y+P+Y+ LHH +  TNFCLFMPL+D+LG
Sbjct  220  QLGHCNFEIVPEALFKAFPPLRYLVYTPSYHSLHHTELETNFCLFMPLFDVLG  272



>ref|XP_002960347.1| hypothetical protein SELMODRAFT_437448 [Selaginella moellendorffii]
 gb|EFJ37886.1| hypothetical protein SELMODRAFT_437448 [Selaginella moellendorffii]
Length=626

 Score =   204 bits (518),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 101/227 (44%), Positives = 142/227 (63%), Gaps = 0/227 (0%)
 Frame = +1

Query  22   DIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQA  201
            D WCLHI VL  +R       S + ++    +  RVS   I FEQ+D+E+HWDNF+ILQ 
Sbjct  46   DNWCLHIFVLCLIRYQTFFYASLFQHLHGVVKKHRVSAFKITFEQLDREFHWDNFIILQG  105

Query  202  ILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLHH  381
            ++A  A+   P  +NLP W +KG +Y ++ H   +EPLYY +HR  H   L+  YH LHH
Sbjct  106  LIALAAHSWVPGFSNLPVWNYKGWLYVVIFHALVTEPLYYWIHRAFHDGHLFKNYHSLHH  165

Query  382  DSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYSN  561
             S  P   T G++ FLEHL+   ++ +P LG A +G  SI + Y YIL++D L+  G+ N
Sbjct  166  ASVNPEVATTGNSTFLEHLVQTGLIALPLLGAAVMGAASISMFYFYILSYDVLKMYGHFN  225

Query  562  VEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
             EI P  LF+  P+LK ++Y+P+Y+ LHH    +NFCLFMP+YD LG
Sbjct  226  CEIFPESLFRAFPLLKLVVYTPSYHSLHHSSLNSNFCLFMPVYDYLG  272



>ref|XP_002967368.1| hypothetical protein SELMODRAFT_408343 [Selaginella moellendorffii]
 gb|EFJ31967.1| hypothetical protein SELMODRAFT_408343 [Selaginella moellendorffii]
Length=626

 Score =   203 bits (516),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 100/227 (44%), Positives = 142/227 (63%), Gaps = 0/227 (0%)
 Frame = +1

Query  22   DIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQA  201
            D WCLHI VL  +R       S + ++    +  RVS   I FEQ+D+E+HWDNF+ILQ 
Sbjct  46   DNWCLHIFVLCLIRYQTFFYASLFQHLHGVVKKHRVSAFKITFEQLDREFHWDNFIILQG  105

Query  202  ILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLHH  381
            ++A  A+   P  +NLP W ++G +Y ++ H   +EPLYY +HR  H   L+  YH LHH
Sbjct  106  LIALAAHSWVPGFSNLPVWNYRGWLYVVIFHALVTEPLYYWIHRAFHDGHLFKNYHSLHH  165

Query  382  DSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYSN  561
             S  P   T G++ FLEHL+   ++ +P LG A +G  SI + Y YIL++D L+  G+ N
Sbjct  166  ASVNPEVATTGNSTFLEHLVQTGLIALPLLGAAVMGAASISMFYFYILSYDVLKMYGHFN  225

Query  562  VEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
             EI P  LF+  P+LK ++Y+P+Y+ LHH    +NFCLFMP+YD LG
Sbjct  226  CEIFPESLFRAFPLLKLVVYTPSYHSLHHSSLNSNFCLFMPVYDYLG  272



>gb|KJB83325.1| hypothetical protein B456_013G242200 [Gossypium raimondii]
Length=527

 Score =   200 bits (509),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 92/167 (55%), Positives = 118/167 (71%), Gaps = 0/167 (0%)
 Frame = +1

Query  202  ILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLHH  381
            +LAS A + FPSL  LP W  KG +  L+LH+  SEPLYY  HR  H   L+  YH LHH
Sbjct  1    MLASMASLIFPSLNTLPLWNLKGFIASLLLHVTISEPLYYWAHRFFHKPYLFNHYHSLHH  60

Query  382  DSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYSN  561
             S VPHPFTAG A  LEHL+LC ++GIP  G+  +G+GS  +IY ++L FDF RCLG+SN
Sbjct  61   SSPVPHPFTAGHATPLEHLVLCTVIGIPITGSILMGYGSTAMIYGHVLVFDFFRCLGHSN  120

Query  562  VEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
             E++P  +F  +P+L+Y IY+PTY+ LHH +  TNFCLFMPL+D LG
Sbjct  121  AEVVPHEVFNKLPLLRYFIYTPTYHSLHHTEMETNFCLFMPLFDALG  167



>ref|XP_001782380.1| predicted protein [Physcomitrella patens]
 gb|EDQ52834.1| predicted protein [Physcomitrella patens]
Length=621

 Score =   200 bits (508),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 95/227 (42%), Positives = 145/227 (64%), Gaps = 1/227 (0%)
 Frame = +1

Query  22   DIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQA  201
            D W  ++LVL   R  V Q W++ + +    +   +    + FEQID+E+H DN ++LQ 
Sbjct  44   DTWYFYMLVLMIGRYAVQQFWNTLTRLHSLVQKYEIHAYAVGFEQIDREFHSDNHIMLQF  103

Query  202  ILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLHH  381
            +  S A+  FP L N+P W  +G+++ ++ H G +EP+YY MHR  H+  LY  YH LHH
Sbjct  104  LFISLAHAWFPGLRNMPNWNAQGLLWVILFHAGVTEPVYYWMHRAFHTDSLYKKYHSLHH  163

Query  382  DSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYSN  561
             S VP P T      LE  L  ++V IP +G A +G  S+ +++ Y+L FDFL+C G+SN
Sbjct  164  LSVVPEPPTGFVTTMLEQGLQSILVCIPIVGAAAMGTASMGLVFVYVLTFDFLKCWGHSN  223

Query  562  VEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            VE +P+  F+ +P +KYL+Y+P+Y+ LHH ++++NFCLFMP+ D LG
Sbjct  224  VEFVPA-WFRNLPGVKYLLYTPSYHSLHHTEQKSNFCLFMPINDYLG  269



>ref|XP_006657201.1| PREDICTED: protein ECERIFERUM 3-like [Oryza brachyantha]
Length=623

 Score =   195 bits (496),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 108/239 (45%), Positives = 149/239 (62%), Gaps = 6/239 (3%)
 Frame = +1

Query  4    WKE-SWEDI---WCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEW  171
            W+E  W  +   WCLH++VL  LR L +QLW SY NMLFF R +RV   G+DF QID EW
Sbjct  32   WREQGWAGLGSSWCLHLVVLLALRSLTYQLWFSYGNMLFFTRRRRVVDVGVDFHQIDTEW  91

Query  172  HWDNFLILQAILASFAYMS--FPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHS  345
             WDN +I+Q ++A+    S  FP+ ++L  W+ +G    ++LH+  SEP +Y  HR LH 
Sbjct  92   DWDNMVIMQTLIAAALVSSPLFPATSDLWVWDPRGWAIAVLLHVAVSEPAFYWAHRALHR  151

Query  346  SDLYPLYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYIL  525
              L+  YH +HH   V    TAG    LE L+L      P  G    G+GS+ ++Y ++L
Sbjct  152  GPLFSRYHSMHHTFPVTQALTAGFITPLESLILTAAAWAPLAGAFLAGYGSVGLVYGHLL  211

Query  526  AFDFLRCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
             FD+LR +GYSNVE++    F+  P L+YL+Y+P+Y  LHH +K  NFCLFMPL+D LG
Sbjct  212  LFDYLRSMGYSNVEVISHKTFEDHPSLRYLVYTPSYLSLHHREKDCNFCLFMPLFDALG  270



>ref|XP_002961424.1| hypothetical protein SELMODRAFT_164680 [Selaginella moellendorffii]
 gb|EFJ36684.1| hypothetical protein SELMODRAFT_164680 [Selaginella moellendorffii]
Length=620

 Score =   192 bits (487),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 96/231 (42%), Positives = 143/231 (62%), Gaps = 4/231 (2%)
 Frame = +1

Query  13   SWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLI  192
            S  D WC HILV+  LR  ++Q WSS++ +    +  ++    + +EQ+D+E+  DN +I
Sbjct  39   SPRDNWCFHILVIAALRYALYQAWSSFARLHAVVKHHQIISYALTYEQVDREFDCDNGII  98

Query  193  LQAILASFAYMSFPS-LANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYH  369
            L ++LA   Y   P+ ++    W  +G+VY +  H G +E  YY +HR  H+  L+  +H
Sbjct  99   LHSLLA---YALGPNDISGFSIWNLRGLVYLIAFHAGVTESAYYWLHRAFHTKSLFRSFH  155

Query  370  WLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCL  549
              HH S  P P TA +  FLE LL  V++ +P   + FLG   + + Y Y LAFDF + L
Sbjct  156  SYHHASTAPEPATAFTHTFLEALLQTVLMSVPIFASCFLGGSCLALFYVYPLAFDFFKYL  215

Query  550  GYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            G+ N EI+P   F+ +P+LKYLIY+P+Y+ LHH+D ++NFCLFMPLYD LG
Sbjct  216  GHFNCEIVPLWAFQKLPLLKYLIYTPSYHSLHHLDLKSNFCLFMPLYDYLG  266



>ref|XP_002990278.1| hypothetical protein SELMODRAFT_185167 [Selaginella moellendorffii]
 gb|EFJ08693.1| hypothetical protein SELMODRAFT_185167 [Selaginella moellendorffii]
Length=620

 Score =   191 bits (485),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 96/231 (42%), Positives = 143/231 (62%), Gaps = 4/231 (2%)
 Frame = +1

Query  13   SWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLI  192
            S  D WC HILV+  LR  ++Q WSS++ +    +  ++    + +EQ+D+E+  DN +I
Sbjct  39   SPRDNWCFHILVIAALRYTLYQAWSSFARLHAVVKHHQIISYALTYEQVDREFDCDNGII  98

Query  193  LQAILASFAYMSFPS-LANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYH  369
            L ++LA   Y   P+ ++    W  +G+VY +  H G +E  YY +HR  H+  L+  +H
Sbjct  99   LHSLLA---YALGPNDISGFSIWNLRGLVYLIAFHAGVTESGYYWLHRAFHTKSLFRSFH  155

Query  370  WLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCL  549
              HH S  P P TA +  FLE LL  V++ +P   + FLG   + + Y Y LAFDF + L
Sbjct  156  SYHHASTAPEPATAFTHTFLEALLQTVLMSVPIFASCFLGGSCLALFYVYPLAFDFFKYL  215

Query  550  GYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            G+ N EI+P   F+ +P+LKYLIY+P+Y+ LHH+D ++NFCLFMPLYD LG
Sbjct  216  GHFNCEIVPLWAFQKLPLLKYLIYTPSYHSLHHLDLKSNFCLFMPLYDYLG  266



>gb|EMS67420.1| Protein WAX2 [Triticum urartu]
Length=697

 Score =   191 bits (486),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/190 (46%), Positives = 127/190 (67%), Gaps = 4/190 (2%)
 Frame = +1

Query  145  DFEQIDKEWHWDNFLILQAILASFAYMS----FPSLANLPTWEFKGVVYCLVLHMGFSEP  312
            + E++D EW WDNFL+LQ ++ +          P L +L  W+ +G+   L+LH+GFSEP
Sbjct  36   EGEKVDHEWDWDNFLVLQTLIGAALVNGPLPLLPGLKDLRVWDPRGLGIALLLHVGFSEP  95

Query  313  LYYLMHRLLHSSDLYPLYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGH  492
            ++Y  HR LH + L+  YH  HH + V  P TAG    LE LLL + +G+P  G   +G 
Sbjct  96   VFYWAHRALHGAPLFGRYHAGHHSTPVTQPLTAGFGTPLEALLLTLTMGVPLAGAFLMGA  155

Query  493  GSIIVIYSYILAFDFLRCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFC  672
            GS+ ++Y ++L FD+LR +GYSNVE++   +F+ +P L+YLIY+PTY  LHH +K +NFC
Sbjct  156  GSLGLVYVHLLTFDYLRSMGYSNVEVISHRVFEAVPPLRYLIYTPTYLSLHHREKDSNFC  215

Query  673  LFMPLYDMLG  702
            LFMPL+D+LG
Sbjct  216  LFMPLFDLLG  225



>tpg|DAA61565.1| TPA: glossy1 [Zea mays]
Length=278

 Score =   178 bits (451),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 108/213 (51%), Positives = 146/213 (69%), Gaps = 2/213 (1%)
 Frame = +1

Query  1    VWKESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWD  180
             W+ +  D W L +L+L GLR L +QLWSS+SNMLF  R +RV + G+DF+QIDKEW WD
Sbjct  34   AWEAASPDRWILLLLLLFGLRALTYQLWSSFSNMLFATRRRRVVRDGVDFDQIDKEWDWD  93

Query  181  NFLILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSD--L  354
            NFLIL A++A+ A  +FPSL +LP W+ +G    LV H   +EPL YL HR LH S   L
Sbjct  94   NFLILHALMAAAALCAFPSLRHLPAWDGRGFAVALVAHAAATEPLSYLAHRALHGSSGRL  153

Query  355  YPLYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFD  534
            Y  YH LHH S+VP PFTAG A  LEH+ L  ++ +P       G  S+ + ++Y+LAFD
Sbjct  154  YARYHSLHHSSRVPQPFTAGLATPLEHVALGALMSLPLAAARAAGCASVALAFAYVLAFD  213

Query  535  FLRCLGYSNVEIMPSHLFKTIPVLKYLIYSPTY  633
             LR +G+ NVE++P+ LF+ IP L+Y++Y+PTY
Sbjct  214  SLRAMGHCNVEVVPASLFRAIPALRYVLYTPTY  246



>ref|XP_001783415.1| predicted protein [Physcomitrella patens]
 gb|EDQ51755.1| predicted protein [Physcomitrella patens]
Length=626

 Score =   185 bits (470),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 97/231 (42%), Positives = 134/231 (58%), Gaps = 4/231 (2%)
 Frame = +1

Query  22   DIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHW----DNFL  189
            D WC H+L+ + LR L  Q W S S   +     R+  +GI+F+Q+D+E +W    D+++
Sbjct  43   DNWCFHMLLSSALRYLHGQAWMSLSRCHWLTGKYRIQTKGINFDQVDRESNWYNSSDDYI  102

Query  190  ILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYH  369
            +L  I A+  +   P  AN P W+ +G+   L+LH G +E LYY +HR LH   LY  YH
Sbjct  103  LLHIITATLVHEILPGFANFPVWDLRGIAILLLLHAGPTEFLYYWLHRALHHHFLYNKYH  162

Query  370  WLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCL  549
              HH S V  P +     F EHL+      +P LGT  LG  SI + Y Y L FDF+  +
Sbjct  163  SHHHASFVTEPVSGSVHPFAEHLMYTATFALPFLGTWALGGASIGMFYFYWLFFDFMNAI  222

Query  550  GYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            G+ N E  P+ +F+  P LKYL+Y+PT++ LHH    TNF LFMPLYD LG
Sbjct  223  GHCNFEFFPTWMFRVFPPLKYLVYTPTFHSLHHSHVHTNFALFMPLYDYLG  273



>gb|AAB87597.1| gl1 [Zea mays]
 tpg|DAA61564.1| TPA: glossy1 [Zea mays]
Length=319

 Score =   179 bits (453),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 108/213 (51%), Positives = 146/213 (69%), Gaps = 2/213 (1%)
 Frame = +1

Query  1    VWKESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWD  180
             W+ +  D W L +L+L GLR L +QLWSS+SNMLF  R +RV + G+DF+QIDKEW WD
Sbjct  34   AWEAASPDRWILLLLLLFGLRALTYQLWSSFSNMLFATRRRRVVRDGVDFDQIDKEWDWD  93

Query  181  NFLILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSD--L  354
            NFLIL A++A+ A  +FPSL +LP W+ +G    LV H   +EPL YL HR LH S   L
Sbjct  94   NFLILHALMAAAALCAFPSLRHLPAWDGRGFAVALVAHAAATEPLSYLAHRALHGSSGRL  153

Query  355  YPLYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFD  534
            Y  YH LHH S+VP PFTAG A  LEH+ L  ++ +P       G  S+ + ++Y+LAFD
Sbjct  154  YARYHSLHHSSRVPQPFTAGLATPLEHVALGALMSLPLAAARAAGCASVALAFAYVLAFD  213

Query  535  FLRCLGYSNVEIMPSHLFKTIPVLKYLIYSPTY  633
             LR +G+ NVE++P+ LF+ IP L+Y++Y+PTY
Sbjct  214  SLRAMGHCNVEVVPASLFRAIPALRYVLYTPTY  246



>ref|XP_001420263.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98556.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=621

 Score =   182 bits (462),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 97/225 (43%), Positives = 133/225 (59%), Gaps = 2/225 (1%)
 Frame = +1

Query  22   DIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQA  201
            D +C H+L +  LR    QLW S S +  + R  R+  +GIDF+Q+D+E +WD++++LQ 
Sbjct  39   DSFCWHLLAIAALRYASAQLWISLSRVHAWTRKTRIQARGIDFKQVDREDNWDDYILLQT  98

Query  202  -ILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLH  378
             ++A   +M      N P    K  V  L+LH G +E +YY +HR LH   LY  YH  H
Sbjct  99   LVIALVHWMPGLGFNNFPATNEKTAVQLLLLHAGPTEFIYYWLHRALHHHKLYSAYHSHH  158

Query  379  HDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYS  558
            H S V  P T     F+EHL+      IP +GT  LG GSI + Y Y+L FD L  +G+ 
Sbjct  159  HASFVTEPITGSVHPFMEHLMYTANFAIPLIGTWALGGGSIAMFYMYLLGFDMLNAIGHC  218

Query  559  NVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYD  693
            N E +P   F  +P++KYLIY+P+Y+ LHH    TNFCLFMPLYD
Sbjct  219  NFEFIP-RWFMRLPLMKYLIYTPSYHSLHHSRVHTNFCLFMPLYD  262



>ref|XP_001781794.1| predicted protein [Physcomitrella patens]
 gb|EDQ53442.1| predicted protein [Physcomitrella patens]
Length=625

 Score =   181 bits (458),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 97/227 (43%), Positives = 141/227 (62%), Gaps = 1/227 (0%)
 Frame = +1

Query  22   DIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQA  201
            D W +H+  L   R    QLW S S + +      V ++   +EQ+D+E+H DN L+LQ 
Sbjct  44   DNWAMHMFFLMVARYFHQQLWVSASRVPWLTEKFVVDERQSGYEQVDREYHSDNHLMLQL  103

Query  202  ILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLHH  381
            I  S A+  FP  +N+  W  +G +Y L+ H+G  E LYY +HR  H+  L+  YH+ HH
Sbjct  104  IFISVAHSWFPGFSNVVAWNTQGFLYVLLFHVGVVEVLYYWIHRAFHTEVLFRNYHFYHH  163

Query  382  DSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYSN  561
             S VP P T      LE +L  ++V +P LG A LG GS+ +IY Y++AFDF +C G+SN
Sbjct  164  MSVVPEPPTGSITTMLEQILQSLLVCVPLLGAAALGGGSMAMIYIYLIAFDFFKCWGHSN  223

Query  562  VEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
             E +P   F+  P +KYL+Y+P+Y+ LHH+++ +NFCLFMPL+D LG
Sbjct  224  FEFVPE-WFRGFPGVKYLLYTPSYHSLHHLEQNSNFCLFMPLFDYLG  269



>emb|CEF99557.1| Uncharacterised domain Wax2, C-terminal [Ostreococcus tauri]
Length=621

 Score =   179 bits (455),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 93/225 (41%), Positives = 132/225 (59%), Gaps = 2/225 (1%)
 Frame = +1

Query  22   DIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQA  201
            D +C H+L +   R +  QLW S S +  + R  R+  +GIDF+Q+D+E HWD++++LQ 
Sbjct  39   DSFCWHLLAIAAARYVNAQLWISLSRVHAWTRNTRIQAKGIDFKQVDREDHWDDYILLQT  98

Query  202  -ILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLH  378
             ++A+  +M      + P +  K      +LH G +E +YY +HR LH   LY  YH  H
Sbjct  99   LVIAAVHWMPGLGFKDFPLYSGKSFAQLALLHAGPTEFIYYWLHRALHHHKLYSAYHSHH  158

Query  379  HDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYS  558
            H S V  P T     F+EHL+      IP LGT  LG G I + Y+Y++ FD L  +G+ 
Sbjct  159  HASFVTEPITGSVHPFMEHLMYTANFAIPLLGTWALGGGDIAMFYTYLIGFDILNAIGHC  218

Query  559  NVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYD  693
            N E +P   F  +P +KYLIY+P+Y+ LHH    TNFCLFMPLYD
Sbjct  219  NFEFVP-RWFMRLPGMKYLIYTPSYHSLHHSRVHTNFCLFMPLYD  262



>ref|XP_003081883.1| faceless pollen-1 (ISS) [Ostreococcus tauri]
Length=675

 Score =   179 bits (454),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 93/225 (41%), Positives = 132/225 (59%), Gaps = 2/225 (1%)
 Frame = +1

Query  22   DIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQA  201
            D +C H+L +   R +  QLW S S +  + R  R+  +GIDF+Q+D+E HWD++++LQ 
Sbjct  93   DSFCWHLLAIAAARYVNAQLWISLSRVHAWTRNTRIQAKGIDFKQVDREDHWDDYILLQT  152

Query  202  -ILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLH  378
             ++A+  +M      + P +  K      +LH G +E +YY +HR LH   LY  YH  H
Sbjct  153  LVIAAVHWMPGLGFKDFPLYSGKSFAQLALLHAGPTEFIYYWLHRALHHHKLYSAYHSHH  212

Query  379  HDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYS  558
            H S V  P T     F+EHL+      IP LGT  LG G I + Y+Y++ FD L  +G+ 
Sbjct  213  HASFVTEPITGSVHPFMEHLMYTANFAIPLLGTWALGGGDIAMFYTYLIGFDILNAIGHC  272

Query  559  NVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYD  693
            N E +P   F  +P +KYLIY+P+Y+ LHH    TNFCLFMPLYD
Sbjct  273  NFEFVP-RWFMRLPGMKYLIYTPSYHSLHHSRVHTNFCLFMPLYD  316



>ref|XP_002509294.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO70552.1| predicted protein [Micromonas sp. RCC299]
Length=620

 Score =   177 bits (450),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 92/225 (41%), Positives = 132/225 (59%), Gaps = 2/225 (1%)
 Frame = +1

Query  22   DIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQA  201
            D W  H+LV+  +R +  Q W S S +    +  ++  +GID++Q+D+E HWD+++ILQA
Sbjct  39   DNWAYHMLVIAAIRYVHAQFWISLSRIHAVTQHTKIQAKGIDYKQVDREDHWDDYIILQA  98

Query  202  ILASFAY-MSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLH  378
            I+ +  + M +    N P +   G+   L+LH G +E +YY +HR LH   LY  YH  H
Sbjct  99   IIMTLVHKMPYLGYNNFPQYNAMGMWQLLLLHAGPTEFIYYWLHRALHHHTLYSWYHSHH  158

Query  379  HDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYS  558
            H S V  P T     F+EH++      IP +GT   G  SI + Y+Y++ FD L  +G+ 
Sbjct  159  HASFVTEPITGSVHPFMEHIMYTANFAIPLVGTWAFGGASIAMFYAYLIGFDLLNNIGHC  218

Query  559  NVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYD  693
            N E MP   F  IP +KYLIY+PTY+ LHH     NFCLFMP+YD
Sbjct  219  NFEFMPQ-WFMNIPGVKYLIYTPTYHSLHHSKVHVNFCLFMPIYD  262



>gb|EMS58990.1| Protein WAX2 [Triticum urartu]
Length=532

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 93/234 (40%), Positives = 128/234 (55%), Gaps = 52/234 (22%)
 Frame = +1

Query  1    VWKESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWD  180
             W+ +  D W   +L L  LR L +QLWSSYSNMLF  R +R+ + G+DFEQIDKEW W 
Sbjct  34   AWEAASPDRWLCLLLALFALRALTYQLWSSYSNMLFLTRRRRIVRDGVDFEQIDKEWDWA  93

Query  181  NFLILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYP  360
                                                                 H + L+ 
Sbjct  94   ----------------------------------------------------FHGARLFA  101

Query  361  LYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFL  540
             YH LHH + VP PFTAG A  LEH++L +++ +P  G    G GS+ + ++Y+L+FDFL
Sbjct  102  RYHALHHSNMVPTPFTAGFATPLEHVVLGLLMALPLAGACAAGLGSVGLTFAYVLSFDFL  161

Query  541  RCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            R +G+ NVE+ P  LF+++P L+YLIY+PTY+ +HH  K+ NFCLFMPL+D LG
Sbjct  162  RAMGHCNVELFPGGLFRSLPFLRYLIYTPTYHTIHHTGKKANFCLFMPLFDRLG  215



>ref|XP_002989550.1| hypothetical protein SELMODRAFT_129942 [Selaginella moellendorffii]
 gb|EFJ09426.1| hypothetical protein SELMODRAFT_129942 [Selaginella moellendorffii]
Length=621

 Score =   174 bits (441),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 95/226 (42%), Positives = 139/226 (62%), Gaps = 2/226 (1%)
 Frame = +1

Query  19   EDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQ  198
             D + LHILVL  LR +  QLW + +++    +  +V  +G+ F+Q+D+E  W++F++LQ
Sbjct  43   RDNFSLHILVLAALRYIQGQLWITVTSVHDIVKKHQVQTKGMKFDQLDRERDWEDFILLQ  102

Query  199  AILASFAYMSFP-SLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWL  375
            A++   AY   P  L N   W+++G+V  ++ H+G  E LYY  HR LH   LY  YH  
Sbjct  103  ALML-LAYQFSPLCLPNHAVWDWRGLVITILWHLGPVEFLYYWFHRALHHHSLYRRYHSH  161

Query  376  HHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGY  555
            HH S V    T     F EHL   V+ G   +   FLG  S+ +IYSY+L FDF+  +G+
Sbjct  162  HHLSFVTQAVTGNVHPFAEHLSYAVLFGSTLIVNLFLGTASLALIYSYMLWFDFMNYIGH  221

Query  556  SNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYD  693
             N E MPS +F+ +P+LKYL+Y+P+++ LHH    TNFCLF+PLYD
Sbjct  222  CNWEFMPSWMFQALPLLKYLVYTPSFHSLHHTQVHTNFCLFVPLYD  267



>gb|EMS51792.1| Protein WAX2 [Triticum urartu]
Length=423

 Score =   171 bits (432),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 90/233 (39%), Positives = 131/233 (56%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    VWKESWEDIWCLHILVLT--GLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWH  174
            V  + W DI   + L+L    LR + +Q+W S S         R+  +GI+FEQ+D+E  
Sbjct  35   VMTKGWGDIDLAYSLILPSLALRMIHNQIWISLSRYQTARSKHRIVDRGIEFEQVDRERG  94

Query  175  WDNFLILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDL  354
            WD+ ++   +L    Y++ PS+   P W   G V   +LH G  E LYY  HR LH   L
Sbjct  95   WDDQIVFNGLLFYAGYLAMPSVRRFPLWRTDGAVATALLHAGPVEFLYYWFHRALHHHFL  154

Query  355  YPLYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFD  534
            Y  YH  HH S V  P T+    F EH++   +  IP L T ++G+GS +V   YI+  D
Sbjct  155  YSRYHSHHHASIVTEPITSVIHPFGEHIVYFTLFAIPMLSTVYMGNGSALVFVLYIVYID  214

Query  535  FLRCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYD  693
            F+  +G+ N E++P  +F+  P LKYL+Y+P+++ LHH   RTN+ LFMP YD
Sbjct  215  FMNNMGHCNFELVPKWMFQVFPPLKYLMYTPSFHSLHHTQFRTNYSLFMPFYD  267



>dbj|BAJ85405.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=436

 Score =   170 bits (431),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 89/233 (38%), Positives = 132/233 (57%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    VWKESWEDIWCLHILVLT--GLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWH  174
            V  + W DI   + L+L    LR + +Q+W S S         R+  +GI+F+Q+D+E  
Sbjct  35   VMNKGWGDIDLAYALILPSLALRMIHNQIWISLSRYQTARSKHRIVDRGIEFDQVDRERG  94

Query  175  WDNFLILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDL  354
            WD+ ++   +L    Y++ P++  LP W   G V   +LH G  E LYY  HR LH   L
Sbjct  95   WDDQIVFNGLLFYVGYLAIPNVRGLPLWRTDGAVATALLHAGPVEFLYYWFHRALHHHFL  154

Query  355  YPLYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFD  534
            Y  YH  HH S V  P T+    F EH++   +  IP L T ++G+GS +V   YI+  D
Sbjct  155  YSRYHSHHHASIVTEPITSVIHPFGEHIVYFTLFAIPMLSTLYMGNGSALVFVMYIVYID  214

Query  535  FLRCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYD  693
            F+  +G+ N E++P  +F+  P LKYL+Y+P+++ LHH   RTN+ LFMP YD
Sbjct  215  FMNNMGHCNFELVPKWMFQVFPPLKYLMYTPSFHSLHHTQFRTNYSLFMPFYD  267



>ref|XP_010920377.1| PREDICTED: protein ECERIFERUM 1-like [Elaeis guineensis]
Length=519

 Score =   171 bits (434),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 92/230 (40%), Positives = 127/230 (55%), Gaps = 2/230 (1%)
 Frame = +1

Query  4    WKESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDN  183
            W+E+  D+  L I     LR L +Q+W S +         R+  + I+FEQ+D+E +WD+
Sbjct  40   WRET--DLTFLSIFASLLLRILHNQVWISLARFQNARSNHRIVDKSIEFEQVDRERNWDD  97

Query  184  FLILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPL  363
             ++    L    +   P   NLP W   G V   +LHMG  E LYY  HR LH   LY  
Sbjct  98   QILFNGWLLHLGHTFIPGARNLPLWRTDGAVIAALLHMGPVEFLYYWFHRALHHHFLYSR  157

Query  364  YHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLR  543
            YH  HH S V  P T+    F EH+   ++  IP L TAF G  S++ I  YI+  DF+ 
Sbjct  158  YHSHHHASIVTEPITSVIHPFAEHVAYSLLFSIPMLATAFTGTASVVAIVGYIVYIDFMN  217

Query  544  CLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYD  693
             LG+ N E++P  LF+  P LKYL+Y+P+++ LHH   RTN+ LFMP YD
Sbjct  218  NLGHCNFELVPQWLFRAFPPLKYLMYTPSFHSLHHTQFRTNYSLFMPFYD  267



>ref|XP_002964260.1| hypothetical protein SELMODRAFT_230422 [Selaginella moellendorffii]
 gb|EFJ34593.1| hypothetical protein SELMODRAFT_230422 [Selaginella moellendorffii]
Length=615

 Score =   169 bits (428),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 94/226 (42%), Positives = 138/226 (61%), Gaps = 2/226 (1%)
 Frame = +1

Query  19   EDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQ  198
             D + LHILVL  LR +  QLW + +++    +  +V  +G+ F+Q+D+E  W++F++LQ
Sbjct  43   RDNFSLHILVLAALRYIQGQLWITVTSVHDIVKKHQVQTKGMKFDQLDRERDWEDFILLQ  102

Query  199  AILASFAYMSFP-SLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWL  375
            A++   AY   P  L N    +++G+V  ++ H+G  E LYY  HR LH   LY  YH  
Sbjct  103  ALML-LAYQFSPLCLPNHAVSDWRGLVITILWHLGPVEFLYYWFHRALHHHSLYRRYHSH  161

Query  376  HHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGY  555
            HH S V    T     F EHL   V+ G   +   FLG  S+ +IYSY+L FDF+  +G+
Sbjct  162  HHLSFVTQAVTGNVHPFAEHLSYAVLFGSTLIVNLFLGTASLALIYSYMLWFDFMNYIGH  221

Query  556  SNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYD  693
             N E MPS +F+ +P+LKYL+Y+P+++ LHH    TNFCLF+PLYD
Sbjct  222  CNWEFMPSWMFQALPLLKYLVYTPSFHSLHHTQVHTNFCLFVPLYD  267



>gb|EMT33049.1| Protein WAX2 [Aegilops tauschii]
Length=619

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 89/233 (38%), Positives = 130/233 (56%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    VWKESWEDIWCLHILVLT--GLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWH  174
            V  + W DI   + L+L    LR + +Q+W S S         R+  + I+FEQ+D+E  
Sbjct  35   VMNKGWGDIDLAYSLILPSLALRMIHNQIWISLSRYQTARSKHRIVDRDIEFEQVDRERG  94

Query  175  WDNFLILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDL  354
            WD+ ++   +L    Y++ PS+   P W   G V   +LH G  E LYY  HR LH   L
Sbjct  95   WDDQIVFNGLLFYVGYLAMPSVRRFPLWRTDGAVATALLHAGPVEFLYYWFHRALHHHFL  154

Query  355  YPLYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFD  534
            Y  YH  HH S V  P T+    F EH++   +  IP L T ++G+GS +V   YI+  D
Sbjct  155  YSRYHSHHHASIVTEPITSVIHPFGEHIVYFTLFAIPMLSTVYMGNGSALVFVLYIVYID  214

Query  535  FLRCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYD  693
            F+  +G+ N E++P  +F+  P LKYL+Y+P+++ LHH   RTN+ LFMP YD
Sbjct  215  FMNNMGHCNFELVPKWMFQVFPPLKYLMYTPSFHSLHHTQFRTNYSLFMPFYD  267



>dbj|BAK04216.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=545

 Score =   167 bits (423),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 79/177 (45%), Positives = 113/177 (64%), Gaps = 2/177 (1%)
 Frame = +1

Query  178  DNFLILQAILASFAYMS--FPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSD  351
            DN +I+Q +L + A  S  FP++++L  WE +G    L+LH+  SEP +   HR LH   
Sbjct  16   DNMVIMQTLLGAMAISSPVFPAVSDLRVWEPRGWAVALLLHVAVSEPGFRWAHRALHRGP  75

Query  352  LYPLYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAF  531
            L+  YH  HH S V  P T+     LE L+L + +  P  G    G GS+ ++Y +IL F
Sbjct  76   LFSRYHSKHHASPVTQPLTSAYGTPLESLVLTLAMAAPLAGAFLAGAGSVSLVYGHILVF  135

Query  532  DFLRCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            D+LRC+GYSNVE++    F+  P+L+YL+Y+PTY  LHH +K +NFCLFMPL+D+LG
Sbjct  136  DYLRCMGYSNVEVISHRTFRAFPLLRYLMYTPTYLSLHHQEKDSNFCLFMPLFDLLG  192



>ref|XP_003575378.1| PREDICTED: protein ECERIFERUM 1-like [Brachypodium distachyon]
Length=619

 Score =   167 bits (424),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 90/233 (39%), Positives = 130/233 (56%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    VWKESWEDIWCLHILVLTGL--RGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWH  174
            V  + W DI   + L+L  L  R + +Q+W S S         R+  +GI+F+Q+D+E  
Sbjct  35   VMTKGWGDIDLAYALILPSLLLRMIHNQIWISLSRYQTARSKHRIVDRGIEFDQVDRERG  94

Query  175  WDNFLILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDL  354
            WD+ +I   +L    Y++ PS+   P W   G V   +LH G  E LYY  HR LH   L
Sbjct  95   WDDQIIFNGLLFYAGYLAMPSVRGFPLWRTDGAVMTALLHAGPVEFLYYWFHRALHHHFL  154

Query  355  YPLYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFD  534
            Y  YH  HH S V  P T+    F EH++   +  IP L T ++G+GS +V   YI+  D
Sbjct  155  YSRYHSHHHASIVTEPITSVIHPFGEHVVYFTLFAIPMLSTIYMGNGSALVFVLYIVYID  214

Query  535  FLRCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYD  693
            F+  +G+ N E++P   F+  P LKYL+Y+P+++ LHH   RTN+ LFMP YD
Sbjct  215  FMNNMGHCNFELVPKWAFQVFPPLKYLMYTPSFHSLHHTQFRTNYSLFMPFYD  267



>ref|XP_006647531.1| PREDICTED: protein ECERIFERUM 1-like [Oryza brachyantha]
Length=619

 Score =   167 bits (422),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 88/233 (38%), Positives = 133/233 (57%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    VWKESWEDIWCLHILVLTGL--RGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWH  174
            V  + W DI   + L+L  L  R + +Q+W S S         R+  +GI+F+Q+D+E  
Sbjct  35   VVSKGWGDIDLAYSLILPSLLLRMIHNQIWISLSRYQTARSKHRIVDRGIEFDQVDRERG  94

Query  175  WDNFLILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDL  354
            WD+ ++   +L    Y++ PS+  +P W   G V   ++H G  E LYY  HR LH   L
Sbjct  95   WDDQILFNGLLFYVGYLAMPSVRRMPLWRTDGAVMTALVHTGPVEFLYYWFHRALHHHFL  154

Query  355  YPLYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFD  534
            Y  YH  HH S V  P T+    F EH++  ++  IP L T ++G+ S + I +YI   D
Sbjct  155  YSRYHSHHHASIVTEPITSVIHPFAEHVVYFILFAIPILSTIYVGNVSAMGIVAYIAYID  214

Query  535  FLRCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYD  693
            F+  +G+ N E++PS +F+  P LKY+IY+P+++ LHH   RTN+ LFMP YD
Sbjct  215  FMNNMGHCNFELVPSWIFQIFPPLKYMIYTPSFHSLHHTQFRTNYSLFMPFYD  267



>ref|XP_001756318.1| predicted protein [Physcomitrella patens]
 gb|EDQ78714.1| predicted protein [Physcomitrella patens]
Length=628

 Score =   166 bits (421),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 94/224 (42%), Positives = 126/224 (56%), Gaps = 3/224 (1%)
 Frame = +1

Query  37   HILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASF  216
            H+L+L  LR    QL  S S   + +   ++ ++G  F+ +D   +WD+++IL  +L S 
Sbjct  49   HVLLLAVLRHFFGQLGISLSRWPYLSSRYQIQKKGFSFDAVDLSSNWDDYIILDTLLLSV  108

Query  217  AYMSFPSLANL--PTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLHHDSK  390
              M  P   N   P W++ G+V C +LHMG +E +YY +HR LH   LY  YH  HH   
Sbjct  109  TVM-IPMFGNRYYPPWDWTGLVICALLHMGPAEAIYYWLHRALHGHYLYTRYHSHHHSLF  167

Query  391  VPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYSNVEI  570
            V    +     FLEHL+      IP  GT  LG  SI  +Y Y L FD L  +G+ NVE 
Sbjct  168  VTEANSGTVHPFLEHLMYASNFAIPLFGTWALGRFSISTLYVYTLTFDTLNAIGHCNVEF  227

Query  571  MPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDMLG  702
            +PS LF   P LKYLIY+P+Y+ LHH    TNFCLFMP+YD  G
Sbjct  228  VPSWLFDAFPPLKYLIYTPSYHSLHHSQVHTNFCLFMPIYDYWG  271



>ref|XP_010936012.1| PREDICTED: protein ECERIFERUM 1-like isoform X2 [Elaeis guineensis]
Length=624

 Score =   166 bits (420),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 85/206 (41%), Positives = 120/206 (58%), Gaps = 0/206 (0%)
 Frame = +1

Query  76   QLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPSLANLPT  255
            QLW ++S         R+  + +DF+Q+D+E +WD+ +IL A+L     M  P  ++LP 
Sbjct  62   QLWITFSRYQTAKSKHRIVDKSLDFDQVDRERNWDDQIILTALLMYMGNMVVPGASHLPW  121

Query  256  WEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLHHDSKVPHPFTAGSAAFLEH  435
            WE +GV   ++LHMG  E +YY +HR LH   LY  YH  HH S V  P T+    F E 
Sbjct  122  WETRGVAITILLHMGPVEFIYYWLHRALHHHFLYSRYHSHHHASIVTEPITSVIHPFAEE  181

Query  436  LLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYSNVEIMPSHLFKTIPVLKYL  615
            L   V+  IP +  AF G GSI     Y++  DF+  +G+ N E++P  LF   P LKYL
Sbjct  182  LSYFVLFAIPLMTMAFTGTGSIAAAVGYLMYIDFMNYMGHCNFELVPKWLFSIFPPLKYL  241

Query  616  IYSPTYYGLHHMDKRTNFCLFMPLYD  693
            +Y+P+++ LHH   RTN+ LFMP YD
Sbjct  242  MYTPSFHSLHHTQFRTNYSLFMPFYD  267



>ref|XP_004976194.1| PREDICTED: protein ECERIFERUM 1-like [Setaria italica]
Length=619

 Score =   166 bits (420),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 90/233 (39%), Positives = 131/233 (56%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    VWKESWEDIWCLHILVLTGL--RGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWH  174
            V  + W D+   +I +L  L  R + +Q+W S S      R   +  + I+FEQ+D+E  
Sbjct  35   VATKGWGDLDPAYITMLPALLLRMIHNQIWISLSRYQTARRKNVIVDRSIEFEQVDRERS  94

Query  175  WDNFLILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDL  354
            WD+ +I   +    AY   P++  LP W   G +  ++LHMG  E LYY  HR LH   L
Sbjct  95   WDDQIIFNGLEFYLAYAMIPNVRLLPVWRTDGAIITVLLHMGPVEFLYYWFHRALHHHFL  154

Query  355  YPLYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFD  534
            Y  YH  HH S V  P T+    F EH++  ++  IPTL   F+G GS++ +  YI   D
Sbjct  155  YSRYHSHHHASIVTEPITSVIHPFAEHVVYFMLFSIPTLTPIFMGCGSVLGVVLYIAYID  214

Query  535  FLRCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYD  693
            F+  +G+ N E++P  +FK  P LKYL+Y+P+++ LHH   RTN+ LFMP YD
Sbjct  215  FMNNMGHCNFELVPKWIFKAFPPLKYLMYTPSFHSLHHTQFRTNYSLFMPFYD  267



>gb|EMT06855.1| Protein WAX2 [Aegilops tauschii]
Length=619

 Score =   165 bits (418),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 93/230 (40%), Positives = 129/230 (56%), Gaps = 2/230 (1%)
 Frame = +1

Query  4    WKESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDN  183
            W+E+  D+  L IL    LRGL +Q W + S +      +++  +GI+FEQID+E +WD+
Sbjct  40   WREA--DLGYLVILPSMMLRGLHNQAWITVSRLQNARGKRQIVDRGIEFEQIDRERNWDD  97

Query  184  FLILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPL  363
             +IL AIL     +  P   NLP W   G V   +LH G  E +YY  HR LH   LY  
Sbjct  98   QIILSAILFFLGALHLPGAQNLPLWRTDGAVLIALLHAGPVELIYYWFHRALHHHFLYTR  157

Query  364  YHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLR  543
            YH  HH S V  P T+    F E +   ++  IP +  A  G  SI+    Y+L  DF+ 
Sbjct  158  YHSHHHASIVTEPITSVIHPFAELVAYELLFSIPMIACALTGTASIMTFELYMLYIDFMN  217

Query  544  CLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYD  693
             +G+ N E++PS LF   P LKYL+Y+P+++ LHH   RTN+ LFMP YD
Sbjct  218  NMGHCNFELVPSWLFTWFPPLKYLMYTPSFHSLHHTQFRTNYSLFMPFYD  267



>gb|EEC73617.1| hypothetical protein OsI_08114 [Oryza sativa Indica Group]
Length=619

 Score =   165 bits (417),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 87/233 (37%), Positives = 130/233 (56%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    VWKESWEDIWCLHILVLTGL--RGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWH  174
            V +  W D+     L+L  L  R + +Q+W S S         R+  +GI+F+Q+D+E  
Sbjct  35   VMRNGWGDLDIAFSLILPSLLLRMIHNQIWISLSRYQTARSKHRIVDRGIEFDQVDRERG  94

Query  175  WDNFLILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDL  354
            WD+ ++   ++    Y++ PS+  +P W   G V   ++H G  E LYY  HR LH   L
Sbjct  95   WDDQILFNGLVFYAGYLAMPSVRRMPVWRTDGAVVTALVHTGPVEFLYYWFHRALHHHFL  154

Query  355  YPLYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFD  534
            Y  YH  HH S V  P T+    F EH++  ++  IP L T +LG+ S + I  YI   D
Sbjct  155  YSRYHSHHHASIVTEPITSVIHPFAEHVVYFILFAIPILSTIYLGNVSAMGIVGYIAYID  214

Query  535  FLRCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYD  693
            F+  +G+ N E++P  +F+  P LKYLIY+P+++ LHH   RTN+ LFMP YD
Sbjct  215  FMNNMGHCNFELVPEWIFQIFPPLKYLIYTPSFHSLHHTQFRTNYSLFMPFYD  267



>ref|NP_001047459.1| Os02g0621300 [Oryza sativa Japonica Group]
 dbj|BAD21539.1| putative CER1 protein [Oryza sativa Japonica Group]
 dbj|BAD21579.1| putative CER1 protein [Oryza sativa Japonica Group]
 dbj|BAF09373.1| Os02g0621300 [Oryza sativa Japonica Group]
Length=619

 Score =   165 bits (417),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 87/233 (37%), Positives = 130/233 (56%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    VWKESWEDIWCLHILVLTGL--RGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWH  174
            V +  W D+     L+L  L  R + +Q+W S S         R+  +GI+F+Q+D+E  
Sbjct  35   VMRNGWGDLDIAFSLILPSLLLRMIHNQIWISLSRYQTARSKHRIVDRGIEFDQVDRERG  94

Query  175  WDNFLILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDL  354
            WD+ ++   ++    Y++ PS+  +P W   G V   ++H G  E LYY  HR LH   L
Sbjct  95   WDDQILFNGLVFYAGYLAMPSVRRMPVWRTDGAVVTALVHTGPVEFLYYWFHRALHHHFL  154

Query  355  YPLYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFD  534
            Y  YH  HH S V  P T+    F EH++  ++  IP L T +LG+ S + I  YI   D
Sbjct  155  YSRYHSHHHASIVTEPITSVIHPFAEHVVYFILFAIPILSTIYLGNVSAMGIVGYIAYID  214

Query  535  FLRCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYD  693
            F+  +G+ N E++P  +F+  P LKYLIY+P+++ LHH   RTN+ LFMP YD
Sbjct  215  FMNNMGHCNFELVPEWIFQIFPPLKYLIYTPSFHSLHHTQFRTNYSLFMPFYD  267



>gb|EEE57393.1| hypothetical protein OsJ_07566 [Oryza sativa Japonica Group]
Length=619

 Score =   165 bits (417),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 87/233 (37%), Positives = 130/233 (56%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    VWKESWEDIWCLHILVLTGL--RGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWH  174
            V +  W D+     L+L  L  R + +Q+W S S         R+  +GI+F+Q+D+E  
Sbjct  35   VMRNGWGDLDIAFSLILPSLLLRMIHNQIWISLSRYQTARSKHRIVDRGIEFDQVDRERG  94

Query  175  WDNFLILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDL  354
            WD+ ++   ++    Y++ PS+  +P W   G V   ++H G  E LYY  HR LH   L
Sbjct  95   WDDQILFNGLVFYAGYLAMPSVRRMPVWRTDGAVVTALVHTGPVEFLYYWFHRALHHHFL  154

Query  355  YPLYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFD  534
            Y  YH  HH S V  P T+    F EH++  ++  IP L T +LG+ S + I  YI   D
Sbjct  155  YSRYHSHHHASIVTEPITSVIHPFAEHVVYFILFAIPILSTIYLGNVSAMGIVGYIAYID  214

Query  535  FLRCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYD  693
            F+  +G+ N E++P  +F+  P LKYLIY+P+++ LHH   RTN+ LFMP YD
Sbjct  215  FMNNMGHCNFELVPEWIFQIFPPLKYLIYTPSFHSLHHTQFRTNYSLFMPFYD  267



>ref|XP_010920316.1| PREDICTED: protein ECERIFERUM 1-like [Elaeis guineensis]
Length=618

 Score =   165 bits (417),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 92/230 (40%), Positives = 127/230 (55%), Gaps = 2/230 (1%)
 Frame = +1

Query  4    WKESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDN  183
            W+E+  D+  L I     LR L +Q+W S +         R+  + I+FEQ+D+E +WD+
Sbjct  40   WRET--DLSYLTIFPSLLLRMLHNQVWISLARFQNARSKHRIVDKSIEFEQVDRERNWDD  97

Query  184  FLILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPL  363
             ++L   L    +   P   N P W   G V  ++LHMG  E LYY  HR LH   LY  
Sbjct  98   QILLYGWLLYLGHTFIPGAQNAPLWRTDGAVIAVLLHMGPVEFLYYWFHRALHHHFLYSR  157

Query  364  YHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLR  543
            YH  HH S V  P T+    F EH+   ++  IP L TAF G  SI+    YI+  DF+ 
Sbjct  158  YHSHHHASIVTEPITSVIHPFAEHVAYALLFSIPILATAFTGTASILATLGYIVYVDFMN  217

Query  544  CLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYD  693
             LG+ N E++P  LF+  P LKYL+Y+P+++ LHH   RTN+ LFMP YD
Sbjct  218  NLGHCNFELVPQWLFRAFPPLKYLMYTPSFHSLHHTQFRTNYSLFMPFYD  267



>gb|ACA14353.1| TCER1 [Triticum aestivum]
Length=619

 Score =   165 bits (417),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 87/233 (37%), Positives = 128/233 (55%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    VWKESWEDIWCLHILVLT--GLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWH  174
            V  + W DI   + L+L    LR + +Q+W   S         R+  +GI+F+Q+D+E  
Sbjct  35   VMNKGWGDIDLAYSLILPSLALRMIHNQIWIGLSRYQTARSKHRIVDRGIEFDQVDRERG  94

Query  175  WDNFLILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDL  354
            WD+ ++   +L    Y++ PS+   P W   G V   +LH G  E LYY  HR LH   L
Sbjct  95   WDDQIVFNGLLFYVGYLAMPSVRRFPLWRTDGAVATALLHAGPVEFLYYWFHRALHHHFL  154

Query  355  YPLYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFD  534
            Y  YH  HH S V  P T+    F EH++   +  IP L T ++G+GS +V   YI+  D
Sbjct  155  YSRYHSHHHASIVTEPITSVIHPFGEHIVYFTLFAIPMLSTVYMGNGSALVFVLYIVYID  214

Query  535  FLRCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYD  693
            F+  +G+ N E+ P  +F+  P LKYL+Y+P+++  HH   RTN+ LFMP YD
Sbjct  215  FMNNMGHCNFELAPKWMFQVFPPLKYLMYTPSFHSPHHTQFRTNYSLFMPFYD  267



>ref|XP_002448160.1| hypothetical protein SORBIDRAFT_06g022320 [Sorghum bicolor]
 gb|EES12488.1| hypothetical protein SORBIDRAFT_06g022320 [Sorghum bicolor]
Length=619

 Score =   164 bits (416),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 90/233 (39%), Positives = 130/233 (56%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    VWKESWEDIWCLHILVLTGL--RGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWH  174
            V  + W D+   +  +L  L  R + +Q+W S S      R   +  + I+FEQ+D+E  
Sbjct  35   VATKGWGDLDPAYATMLPALLLRMIHNQIWISLSRYQTARRKNVIVDRSIEFEQVDRERS  94

Query  175  WDNFLILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDL  354
            WD+ +I   +    AY   P++  LP W   G +  ++LHMG  E LYY  HR LH   L
Sbjct  95   WDDQIIFNGLEFYLAYAMIPNVRLLPIWRTDGAIVTVLLHMGPVEFLYYWFHRALHHHFL  154

Query  355  YPLYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFD  534
            Y  YH  HH S V  P T+    F EH++  ++  IPTL   F+G GS++ I  YI   D
Sbjct  155  YSRYHSHHHASIVTEPITSVIHPFAEHVVYFMLFSIPTLTPIFMGCGSVLGIVLYIAYID  214

Query  535  FLRCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYD  693
            F+  +G+ N E++P  +FK  P LKYL+Y+P+++ LHH   RTN+ LFMP YD
Sbjct  215  FMNNMGHCNFELVPKWIFKAFPPLKYLMYTPSFHSLHHTQFRTNYSLFMPFYD  267



>ref|XP_003580122.1| PREDICTED: protein ECERIFERUM 1-like [Brachypodium distachyon]
Length=620

 Score =   164 bits (416),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 85/218 (39%), Positives = 127/218 (58%), Gaps = 0/218 (0%)
 Frame = +1

Query  40   ILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFA  219
            IL +  LR +  Q+W S S      R   +  + ++FEQ+D+E  WD+ +I   +L+  A
Sbjct  50   ILPILLLRMMHSQIWISLSRHQTARRKHIIVDRSLEFEQVDRERSWDDQIIFSGLLSYMA  109

Query  220  YMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLHHDSKVPH  399
            Y++ P+++ +P W  KG +   +LH+G  E LYY  HR LH   LY  YH  HH S V  
Sbjct  110  YLAIPNVSLIPVWSTKGAIITALLHIGPVEFLYYWFHRALHHHFLYSRYHSHHHASIVVE  169

Query  400  PFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYSNVEIMPS  579
            P T+    F EHL+  ++  IPTL    +G GSII +  Y+   DF+  +G+ N E++P 
Sbjct  170  PITSTIHPFAEHLVYFLLFAIPTLVPTLMGRGSIIGVLLYLSYVDFMNNMGHCNFELVPK  229

Query  580  HLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYD  693
             + K  P +KYL+Y+P+++ LHH   RTN+ LFMP YD
Sbjct  230  WILKVFPPMKYLMYTPSFHSLHHTQFRTNYSLFMPFYD  267



>dbj|BAK01778.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=424

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 82/230 (36%), Positives = 130/230 (57%), Gaps = 2/230 (1%)
 Frame = +1

Query  10   ESWEDIWCLHILVLTGL--RGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDN  183
            + W D+   +  +L  L  R + +Q+W S S      R   +  + ++F+Q+D+E  WD+
Sbjct  38   KGWGDMNLAYATMLPALLLRMIHNQIWISLSRHQTARRKHIIVDRSLEFDQVDRESSWDD  97

Query  184  FLILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPL  363
             +I   +    AY++ P+++ +P W  +GV+   +LH+G  E LYY  HR LH   LY  
Sbjct  98   QIIFNGLFFYLAYVAVPNVSQMPVWRTEGVIITALLHIGPVEFLYYWFHRALHHHFLYSR  157

Query  364  YHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLR  543
            YH  HH S V  P T+    F E ++  ++  IPT+   F+G GS++ +  YI   DF+ 
Sbjct  158  YHSHHHASIVTEPITSVIHPFAEQVVYFLLFSIPTMTPTFMGCGSVLAVVLYITYIDFMN  217

Query  544  CLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYD  693
             +G+ N E++P   F   P LKYL+Y+P+++ LHH   RTN+ LFMP YD
Sbjct  218  NMGHCNFELVPKRFFHAFPPLKYLMYTPSFHSLHHTQFRTNYSLFMPFYD  267



>ref|XP_006857470.1| hypothetical protein AMTR_s00067p00188650 [Amborella trichopoda]
 gb|ERN18937.1| hypothetical protein AMTR_s00067p00188650 [Amborella trichopoda]
Length=621

 Score =   164 bits (416),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 88/215 (41%), Positives = 117/215 (54%), Gaps = 1/215 (0%)
 Frame = +1

Query  58   LRGLVH-QLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFP  234
            L  ++H QLW + S         R+  +GIDFEQ+D+E +WD+  IL AI+     +  P
Sbjct  55   LSRIIHDQLWITLSRFQTARSKHRIQSRGIDFEQVDRERNWDDQAILHAIIFYIGELFLP  114

Query  235  SLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLHHDSKVPHPFTAG  414
               NLP W  KGV+  ++ H G  E +YY  HR LH   LY  YH  HH S V  P T+ 
Sbjct  115  GAQNLPLWNTKGVIIAVLCHAGPVEYIYYWAHRALHHHFLYTRYHSHHHSSFVTEPITSV  174

Query  415  SAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYSNVEIMPSHLFKT  594
               F EH+L  +I  +P L T      S  V+  Y+   DF+  +G+ N E  P   FK 
Sbjct  175  VHPFAEHILYALIFAVPFLATVLTYTASYTVLIGYMTFIDFMNNMGHCNFEFFPKWTFKI  234

Query  595  IPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDML  699
             P LKYLIY+P+Y+ LHH    TNF LFMP+YD +
Sbjct  235  FPPLKYLIYTPSYHSLHHSQVHTNFSLFMPIYDYM  269



>gb|EMS48098.1| Protein WAX2 [Triticum urartu]
Length=654

 Score =   162 bits (410),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 83/233 (36%), Positives = 130/233 (56%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    VWKESWEDIWCLHILVLTGL--RGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWH  174
            V  + W D+   +  +L  L  R + +Q+W S S      R   +  +G++F+Q+D+E  
Sbjct  35   VVTKGWGDMSLAYAAMLPALLLRMIHNQIWISLSRHQTARRKHIIVDRGLEFDQVDRESS  94

Query  175  WDNFLILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDL  354
            WD+ +I   +    AY + P+++ +P W   G +   +LH+G  E LYY  HR LH   L
Sbjct  95   WDDQIIFNGLFFYLAYAAVPNVSRMPVWRTDGAIITALLHIGPVEFLYYWFHRALHHHFL  154

Query  355  YPLYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFD  534
            Y  YH  HH S V  P T+    F EH++  ++  IP +   F+G GS++ +  YI   D
Sbjct  155  YSRYHSHHHASIVTEPITSVIHPFAEHVVYFLLFSIPMMTPIFMGCGSVLAVVLYITYID  214

Query  535  FLRCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYD  693
            F+  +G+ N E++P  +F   P LKYL+Y+P+++ LHH   RTN+ LFMP YD
Sbjct  215  FMNNMGHCNFELVPKRVFHVFPALKYLMYTPSFHSLHHTQFRTNYSLFMPFYD  267



>gb|EMS48099.1| Protein WAX2 [Triticum urartu]
Length=575

 Score =   162 bits (409),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 90/233 (39%), Positives = 129/233 (55%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    VWKESWEDIWCLHILVLTGL--RGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWH  174
            V    W D+   +  +L  L  R + +Q+W S S      R   +  +G++FEQ+D+E  
Sbjct  27   VVTSGWGDMDTAYAAMLPALLLRMIHNQIWISLSRHQTARRKHIIVDRGLEFEQVDRERS  86

Query  175  WDNFLILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDL  354
            WD+ +IL  +     Y + PS   +P WE KG +   +LH+G  E LYY  HR LH   L
Sbjct  87   WDDQIILSGLFFYLGYAAIPSARFMPMWETKGAIIMALLHIGPVEFLYYWFHRALHHHFL  146

Query  355  YPLYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFD  534
            Y  YH  HH S V  P T+    F E L   ++  IP L   F+G+GSI+ I  Y+   D
Sbjct  147  YSRYHSHHHASIVTEPITSVVHPFAEILAYFLLFSIPMLIPIFMGYGSILGIVLYLAYID  206

Query  535  FLRCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYD  693
            F+  +G+ N E++P  +F+  P LKYL+Y+P+Y+ LHH   RTN+ LFMP YD
Sbjct  207  FMNNMGHCNFEMLPKWIFQVFPPLKYLMYTPSYHSLHHTQFRTNYSLFMPFYD  259



>ref|XP_009410811.1| PREDICTED: protein ECERIFERUM 1-like [Musa acuminata subsp. malaccensis]
Length=620

 Score =   162 bits (409),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 90/227 (40%), Positives = 127/227 (56%), Gaps = 2/227 (1%)
 Frame = +1

Query  19   EDIWCLHILVLTGL--RGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLI  192
            ED    + L++  L  R L  QLW + S M   N    +  + +DFEQ+D+E +WD+ +I
Sbjct  41   EDRDMFNFLIIPSLLMRLLHAQLWITLSRMKTANSKHSIVDKSLDFEQVDRERNWDDQII  100

Query  193  LQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHW  372
              AILA       P  ++LP W  +G +   +LH+G  E LYY  HR LH   LY  YH 
Sbjct  101  FTAILAYVVNKVIPGASHLPWWNTRGAILISLLHIGPVEFLYYWFHRALHHHYLYSRYHS  160

Query  373  LHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLG  552
             HH S V  P T+    F E L+  ++  IP + T   G GSII  Y Y+   DF+  +G
Sbjct  161  HHHASVVTEPITSVIHPFAEELVYFLLFAIPPIITVLTGSGSIITSYGYLNYIDFMNYMG  220

Query  553  YSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYD  693
            + N E++P  L  + P LKYL+Y+P+++ LHH   RTN+ LFMP+YD
Sbjct  221  HCNFEMVPKWLLDSFPPLKYLMYTPSFHSLHHTRFRTNYSLFMPIYD  267



>ref|XP_003574039.1| PREDICTED: protein ECERIFERUM 1-like [Brachypodium distachyon]
Length=619

 Score =   161 bits (408),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 89/230 (39%), Positives = 129/230 (56%), Gaps = 2/230 (1%)
 Frame = +1

Query  4    WKESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDN  183
            W+E+  D+  + IL    LR L +Q W + S +      K++  +GI+FEQ+D+E +WD+
Sbjct  40   WRET--DLGYIAILPSMLLRALHNQAWITVSRLQNARGRKQIVDRGIEFEQVDRERNWDD  97

Query  184  FLILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPL  363
             +IL AIL     +  P   +LP W   G V   +LH G  E LYY  HR LH   LY  
Sbjct  98   QIILSAILFYLGALHLPGGQHLPLWRTDGAVLVALLHAGPVELLYYWFHRALHHHFLYTR  157

Query  364  YHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLR  543
            YH  HH S V  P T+    F E +   ++  IP + +A  G  SI+    Y+L  DF+ 
Sbjct  158  YHSHHHASIVTEPITSVIHPFAELVAYELLFSIPMIASALTGTASIVAFEMYMLYIDFMN  217

Query  544  CLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYD  693
             +G+ N E++P+ LF+  P LKY +Y+P+++ LHH   RTN+ LFMP YD
Sbjct  218  NMGHCNFELVPTWLFRWFPPLKYFMYTPSFHSLHHTQFRTNYSLFMPFYD  267



>ref|XP_010255640.1| PREDICTED: protein ECERIFERUM 1-like [Nelumbo nucifera]
Length=627

 Score =   161 bits (407),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 85/213 (40%), Positives = 119/213 (56%), Gaps = 0/213 (0%)
 Frame = +1

Query  61   RGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPSL  240
            R L  QLW S +         R+  +GI+FEQ+D+E +WD+ +IL  I+       FP  
Sbjct  57   RMLHSQLWISLARYQTAKSKHRIVHKGIEFEQVDRERNWDDQIILNGIVNYIIPQIFPGA  116

Query  241  ANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLHHDSKVPHPFTAGSA  420
            + LP W + G+   ++ H G  E LYY +HR+LH   LY  YH  HH S V  P T+   
Sbjct  117  SRLPMWRWDGIFLVILFHAGPVEFLYYWLHRVLHHHFLYSRYHSHHHASVVTEPITSVVH  176

Query  421  AFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYSNVEIMPSHLFKTIP  600
             F EHLL   +  IP + T F G  S+  I  Y    DF+  +G+ N E++P  LF   P
Sbjct  177  PFAEHLLYFSLFSIPIMATVFTGTISLGAIGLYFTYVDFMNNMGHCNFEMVPKRLFSIFP  236

Query  601  VLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDML  699
             LKYL+Y+P+++ LHH   RTN+ LFMP+YD +
Sbjct  237  FLKYLMYTPSFHSLHHTKFRTNYSLFMPIYDYM  269



>ref|XP_010052747.1| PREDICTED: protein ECERIFERUM 1-like isoform X2 [Eucalyptus grandis]
Length=620

 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/211 (38%), Positives = 118/211 (56%), Gaps = 0/211 (0%)
 Frame = +1

Query  61   RGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPSL  240
            R + +Q+W + S         R+  +GI+F Q+D+E +WD+ ++L  ++     M+ P  
Sbjct  57   RMVHNQIWMTLSRYRNARGNGRIIDKGIEFGQVDRERNWDDQILLNGLIFYIGAMTLPGA  116

Query  241  ANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLHHDSKVPHPFTAGSA  420
            + LP W F GV+   +LHMG  E LYY +HR LH   LY  YH  HH S V  P T+   
Sbjct  117  SRLPMWRFDGVITTALLHMGPVEFLYYWLHRALHHHYLYSRYHSHHHASIVTEPITSVIH  176

Query  421  AFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYSNVEIMPSHLFKTIP  600
             F EHL    +  IP   T ++G  SI+  Y Y+   D +  +G+ N E++P  +F   P
Sbjct  177  PFAEHLAYFTLFAIPLYTTVWMGTASIVSFYGYVTYIDLMNNMGHCNFELIPKWIFSYFP  236

Query  601  VLKYLIYSPTYYGLHHMDKRTNFCLFMPLYD  693
             LKYL+Y+P+++ LHH   RTN  LFMP YD
Sbjct  237  PLKYLMYTPSFHSLHHTQFRTNCSLFMPFYD  267



>ref|XP_010052746.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Eucalyptus grandis]
 gb|KCW76818.1| hypothetical protein EUGRSUZ_D01172 [Eucalyptus grandis]
Length=627

 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/211 (38%), Positives = 118/211 (56%), Gaps = 0/211 (0%)
 Frame = +1

Query  61   RGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPSL  240
            R + +Q+W + S         R+  +GI+F Q+D+E +WD+ ++L  ++     M+ P  
Sbjct  57   RMVHNQIWMTLSRYRNARGNGRIIDKGIEFGQVDRERNWDDQILLNGLIFYIGAMTLPGA  116

Query  241  ANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLHHDSKVPHPFTAGSA  420
            + LP W F GV+   +LHMG  E LYY +HR LH   LY  YH  HH S V  P T+   
Sbjct  117  SRLPMWRFDGVITTALLHMGPVEFLYYWLHRALHHHYLYSRYHSHHHASIVTEPITSVIH  176

Query  421  AFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYSNVEIMPSHLFKTIP  600
             F EHL    +  IP   T ++G  SI+  Y Y+   D +  +G+ N E++P  +F   P
Sbjct  177  PFAEHLAYFTLFAIPLYTTVWMGTASIVSFYGYVTYIDLMNNMGHCNFELIPKWIFSYFP  236

Query  601  VLKYLIYSPTYYGLHHMDKRTNFCLFMPLYD  693
             LKYL+Y+P+++ LHH   RTN  LFMP YD
Sbjct  237  PLKYLMYTPSFHSLHHTQFRTNCSLFMPFYD  267



>ref|XP_009384064.1| PREDICTED: protein ECERIFERUM 1-like [Musa acuminata subsp. malaccensis]
Length=625

 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 90/232 (39%), Positives = 124/232 (53%), Gaps = 1/232 (0%)
 Frame = +1

Query  1    VWKESWE-DIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHW  177
            V KE  E D+  L IL    LR L +Q+W S +         R+  + I+FEQ+D+E +W
Sbjct  36   VSKERKELDLTYLIILPSLLLRMLHNQVWISLARFQNARSKNRIVDKSIEFEQVDRERNW  95

Query  178  DNFLILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLY  357
            D+ +I   IL    Y   P   NLP W   G +   +LHMG  E LYY  HR LH   LY
Sbjct  96   DDQIIFNGILFYLGYFYIPGATNLPVWRTDGALLMALLHMGPVEFLYYWFHRALHHHFLY  155

Query  358  PLYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDF  537
              YH  HH S V  P T+    F EH++  ++  IP + T      SI+ +  Y+   D 
Sbjct  156  SRYHSHHHASVVTEPITSVIHPFAEHVVYFLLFSIPMVTTIVTRRASILALLGYVAYIDL  215

Query  538  LRCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYD  693
            +  +G+ N E++P  LF   P LKYL+Y+P+++ LHH   RTN+ LFMP YD
Sbjct  216  MNNMGHCNFELVPKWLFTVFPPLKYLMYTPSFHSLHHTQFRTNYSLFMPFYD  267



>emb|CDP09363.1| unnamed protein product [Coffea canephora]
Length=611

 Score =   159 bits (401),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 85/212 (40%), Positives = 122/212 (58%), Gaps = 1/212 (0%)
 Frame = +1

Query  58   LRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPS  237
            LR L +Q+W SYS         R+  + I+FEQID+E +WD+ +I   I+  +   +  +
Sbjct  56   LRMLHNQIWISYSRYRTAKGTNRIVDKSIEFEQIDRERNWDDNIIFNGIVF-YMVATLKN  114

Query  238  LANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLHHDSKVPHPFTAGS  417
             A++P W   GV+  ++LH+G  E LYY +HR LH   LY  YH  HH S V  P T+  
Sbjct  115  TADMPIWRTDGVIITILLHVGPVEFLYYWLHRALHHHFLYSRYHSHHHASIVTEPITSVI  174

Query  418  AAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYSNVEIMPSHLFKTI  597
              F EH+   ++  IP   T F G   I+    YI   DF+  +G+ N E++P+ LF   
Sbjct  175  HPFGEHVAYFLLFAIPMATTFFSGTACIVSFIGYISYIDFMNNMGHCNFELIPNWLFSIF  234

Query  598  PVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYD  693
            P LKYL+Y+P+++ LHH   RTN+ LFMPLYD
Sbjct  235  PPLKYLMYTPSFHSLHHTQFRTNYSLFMPLYD  266



>gb|EMT07276.1| Protein WAX2 [Aegilops tauschii]
Length=604

 Score =   158 bits (399),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 89/233 (38%), Positives = 130/233 (56%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    VWKESWEDIWCLHILVLTGL--RGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWH  174
            V  + W D+   +  +L  L  R L +Q+W S S      R   +  + ++FEQ+D+E  
Sbjct  35   VVTKGWGDMNLAYAAILPALLLRMLHNQIWISLSRHQTARRKHIIVDRSLEFEQVDRERS  94

Query  175  WDNFLILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDL  354
            WD+ +IL  +    AY + PS+  +P WE KG +   +LH G  E LYY  HR LH   L
Sbjct  95   WDDQIILSGLYFYLAYAAIPSVRLMPMWETKGAIIMALLHAGPVEFLYYWFHRALHHHFL  154

Query  355  YPLYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFD  534
            Y  YH  HH S V  P T+    F E L+  ++  IP L    +G+GSI+ I  Y+   D
Sbjct  155  YSRYHSHHHASIVTEPITSVIHPFAEMLVYFLLFLIPMLIPILMGYGSILGIVLYVAYID  214

Query  535  FLRCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYD  693
            F+  +G+ N E++P  +F+  P LKYL+Y+P+Y+ LHH   RTN+ L MP+YD
Sbjct  215  FMNNMGHCNFELLPKWIFQVFPPLKYLMYTPSYHSLHHTKFRTNYSLAMPIYD  267



>ref|XP_008796440.1| PREDICTED: uncharacterized protein LOC103711898 [Phoenix dactylifera]
Length=2179

 Score =   161 bits (408),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 83/206 (40%), Positives = 118/206 (57%), Gaps = 0/206 (0%)
 Frame = +1

Query  76   QLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPSLANLPT  255
            QLW ++S         R+  + +DF+Q+D+E +WD+ +IL A+    A M  P  ++LP 
Sbjct  62   QLWITFSRFQTAKSKHRIVDKSLDFDQVDRERNWDDQIILTALFMYMANMVVPGASHLPW  121

Query  256  WEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLHHDSKVPHPFTAGSAAFLEH  435
            WE +GVV  ++LHMG  E +YY +HR LH   LY  YH  HH S V  P T+    F E 
Sbjct  122  WETRGVVLIILLHMGPVEFIYYWLHRALHHHFLYSRYHSHHHASVVTEPITSVIHPFAEE  181

Query  436  LLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYSNVEIMPSHLFKTIPVLKYL  615
            L   V+  IP +     G  SI  +  Y +  DF+  +G+ N E++P  LF   P LKYL
Sbjct  182  LSYFVLFAIPPMTGVLTGTASIAAVVGYPMYIDFMNYMGHCNFELVPKWLFDVFPPLKYL  241

Query  616  IYSPTYYGLHHMDKRTNFCLFMPLYD  693
            +Y+P+++ LHH   RTN+ LFMP YD
Sbjct  242  MYTPSFHSLHHTQFRTNYSLFMPFYD  267


 Score =   123 bits (309),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 89/157 (57%), Gaps = 0/157 (0%)
 Frame = +1

Query  223   MSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLHHDSKVPHP  402
             M  P  ++LP WE +GVV  ++LHMG  E +YY +HR LH   LY  YH  HH S    P
Sbjct  1669  MVVPGASHLPWWESRGVVLIILLHMGPVEFIYYWLHRALHHHFLYSRYHSHHHASIATEP  1728

Query  403   FTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYSNVEIMPSH  582
              T+    F E L   V+  IP +     G  SI  +  Y +  DF+  +G+ N E++P  
Sbjct  1729  ITSVIHPFAEELSYFVLFAIPPMTGILTGTASIAAVVGYPMYVDFMNYMGHCNFELVPKW  1788

Query  583   LFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYD  693
             LF   P LKYL+Y+P+++ LHH   RTN+ LFMP YD
Sbjct  1789  LFDVFPPLKYLMYTPSFHSLHHTQFRTNYSLFMPFYD  1825



>ref|XP_006661851.1| PREDICTED: protein ECERIFERUM 1-like [Oryza brachyantha]
Length=635

 Score =   157 bits (397),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 84/212 (40%), Positives = 117/212 (55%), Gaps = 0/212 (0%)
 Frame = +1

Query  58   LRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPS  237
            LR + +Q+W S S         R+  +GI+F+Q+D+E +WD+ +IL   L     +  P 
Sbjct  70   LRMIHNQIWISLSRYQTARSKHRIVDRGIEFDQVDRERNWDDQIILSGFLLYLGALYLPG  129

Query  238  LANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLHHDSKVPHPFTAGS  417
               LP W   G     +LH G  E LYY +HR LH   LY  YH  HH S V  P T+  
Sbjct  130  GQRLPLWRADGAAVIALLHAGPVEFLYYWLHRALHHHWLYTRYHSHHHASIVTEPITSVI  189

Query  418  AAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYSNVEIMPSHLFKTI  597
              F E +   V+  +P + +A  G  SII   +YI+  D +  +G+ N E++PS LFK  
Sbjct  190  HPFAELVAYEVLFSVPLIASALTGTASIIAFEAYIIYIDLMNNMGHCNFELVPSWLFKWF  249

Query  598  PVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYD  693
            P LKYL+Y+P+Y+ LHH   RTN+ LFMP YD
Sbjct  250  PPLKYLMYTPSYHSLHHTQFRTNYSLFMPFYD  281



>ref|XP_003625024.1| Protein WAX2 [Medicago truncatula]
 gb|ABN07985.1| Sterol desaturase [Medicago truncatula]
 gb|AES81242.1| fatty acid hydroxylase superfamily protein [Medicago truncatula]
Length=617

 Score =   157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 85/212 (40%), Positives = 121/212 (57%), Gaps = 0/212 (0%)
 Frame = +1

Query  58   LRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPS  237
            +R L +Q+W+S S         R+  +G++FEQ+D+E HWD+ ++   ++   AY  FP 
Sbjct  53   VRMLHNQIWTSVSRYQTAKGKNRIVDKGLEFEQVDRETHWDDQMLFTVLVYCIAYFIFPM  112

Query  238  LANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLHHDSKVPHPFTAGS  417
             +NLP W   GV+   +LH G  E LYY +HR LH   LY  YH  HH S V  P T+ +
Sbjct  113  ASNLPWWRIDGVILTAILHAGPVEFLYYWLHRALHHHYLYSRYHSHHHSSIVTEPITSVA  172

Query  418  AAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYSNVEIMPSHLFKTI  597
              F EHL    +  IP L T F+   S+  +Y YI   DF+  +G+ N E  P  L    
Sbjct  173  HPFAEHLSYFTLFAIPMLTTLFINKSSVAALYGYIFYIDFMNNMGHCNFEFFPKKLLSYF  232

Query  598  PVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYD  693
            P+LKYL Y+P+++ LHH   R+N+ LFMP+YD
Sbjct  233  PILKYLSYTPSFHSLHHTKFRSNYSLFMPIYD  264



>ref|XP_004954341.1| PREDICTED: protein ECERIFERUM 1-like [Setaria italica]
Length=626

 Score =   157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 84/208 (40%), Positives = 118/208 (57%), Gaps = 0/208 (0%)
 Frame = +1

Query  76   QLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPSLANLPT  255
            QLW S S         R+  + +DFEQ+D+E +WD+ ++L A+L      + P    +P 
Sbjct  64   QLWISVSRHQTARSKHRIVNKSLDFEQVDRERNWDDQILLTALLFYAVNAAVPVAQGVPW  123

Query  256  WEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLHHDSKVPHPFTAGSAAFLEH  435
            W  KG+V   +LH G  E LYY +HR LH   LY  YH  HH S V  P T+    F E 
Sbjct  124  WNPKGLVVTALLHAGPVEFLYYWLHRALHHHFLYSRYHSHHHASIVTEPITSVIHPFAEE  183

Query  436  LLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYSNVEIMPSHLFKTIPVLKYL  615
            ++   +  IP L T   G  S++V  +Y++  DF+  LG+ N E++P  LF   P LKYL
Sbjct  184  VIYFALFAIPLLTTVGTGTASVLVANAYLVYIDFMNYLGHCNFELVPKLLFDVFPPLKYL  243

Query  616  IYSPTYYGLHHMDKRTNFCLFMPLYDML  699
            +Y+P+++ LHH   RTN+ LFMPLYD L
Sbjct  244  MYTPSFHSLHHTQFRTNYSLFMPLYDYL  271



>ref|XP_010054532.1| PREDICTED: protein ECERIFERUM 1-like [Eucalyptus grandis]
 gb|KCW76800.1| hypothetical protein EUGRSUZ_D01151 [Eucalyptus grandis]
Length=536

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 82/229 (36%), Positives = 124/229 (54%), Gaps = 0/229 (0%)
 Frame = +1

Query  7    KESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNF  186
            +E   D++   I      R + +Q+W + S         R+  +GI+F Q+D+E +WD+ 
Sbjct  39   EERERDLFTFLIFPFLLWRMVHNQIWITLSRYRNARGNGRIIDKGIEFVQVDRERNWDDQ  98

Query  187  LILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLY  366
            ++L  ++     M+      LP W F GV+   +LHMG  E LYY +HR LH   LY  Y
Sbjct  99   ILLNGLIFYIGAMTLAGAPRLPMWRFDGVITTALLHMGPVEFLYYWLHRALHHHYLYSRY  158

Query  367  HWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRC  546
            H  HH S V  P T+ +  F EHL    +  IP   T ++G  SI+ +  Y+   D +  
Sbjct  159  HSHHHASIVTEPITSVNHPFAEHLAYFTLFAIPLYTTVWMGTASIVSLSGYVTYIDLMNN  218

Query  547  LGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYD  693
            +G+ N E++P  +F   P+LKYL+Y+P+++ LHH   RTN  LFMP YD
Sbjct  219  MGHCNFELIPKWIFSYFPLLKYLMYTPSFHSLHHTQFRTNCSLFMPFYD  267



>ref|XP_007509665.1| predicted protein [Bathycoccus prasinos]
 emb|CCO19468.1| predicted protein [Bathycoccus prasinos]
Length=681

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 91/226 (40%), Positives = 132/226 (58%), Gaps = 4/226 (2%)
 Frame = +1

Query  22   DIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQA  201
            D W  H+ ++  LR ++ Q + S S +       R+  +GIDF+Q+D+E HWD++++LQ 
Sbjct  41   DQWHFHMTMIVLLRYVMAQFFISLSRIHAITEKTRIQSKGIDFKQVDREDHWDDYILLQY  100

Query  202  ILASFAYMSFPSLA--NLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWL  375
            I+ S  +   P L   N P +E KG+   L+LH+G +E +YY +HRLLH   LY  YH  
Sbjct  101  IVMSMVHFC-PGLGFKNFPLFEKKGMWQLLLLHVGPTEYVYYWLHRLLHHHTLYSAYHSH  159

Query  376  HHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGY  555
            HH S V  P T     F+EH++      IP LGT      S+ + Y Y++ FD L  +G+
Sbjct  160  HHASFVTEPITGSVHPFMEHIMYTANFAIPLLGTWMCNGASMAMFYVYLMGFDLLNAIGH  219

Query  556  SNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYD  693
             N E +P   F   P +KYL+Y+P+Y+ LHH    TNFCLFMP+YD
Sbjct  220  CNFEFVPK-FFAKFPGVKYLLYTPSYHSLHHSRVHTNFCLFMPIYD  264



>ref|XP_002454767.1| hypothetical protein SORBIDRAFT_04g036940 [Sorghum bicolor]
 gb|EES07743.1| hypothetical protein SORBIDRAFT_04g036940 [Sorghum bicolor]
Length=673

 Score =   155 bits (392),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 83/208 (40%), Positives = 117/208 (56%), Gaps = 0/208 (0%)
 Frame = +1

Query  76   QLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPSLANLPT  255
            QLW + S         R+  + +DF+Q+D+E +WD+ ++L A+L      + P+  +LP 
Sbjct  93   QLWITVSRHQTARSRHRIVDKSLDFDQVDRERNWDDQILLTALLFYVVNAALPAAQSLPW  152

Query  256  WEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLHHDSKVPHPFTAGSAAFLEH  435
            W  KG+V   +LH G  E LYY +HR LH   LY  YH  HH S V  P T+    F E 
Sbjct  153  WNSKGLVMVSLLHAGPVEFLYYWLHRALHHHYLYSRYHSHHHASIVTEPITSVIHPFAEE  212

Query  436  LLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYSNVEIMPSHLFKTIPVLKYL  615
            L+   +  IP L     G  S+ V   Y++  DF+  LG+ N E++P  LF   P LKYL
Sbjct  213  LVYFTLFAIPLLTMVGTGTASVAVANGYLIYIDFMNYLGHCNFEVVPKLLFDVFPPLKYL  272

Query  616  IYSPTYYGLHHMDKRTNFCLFMPLYDML  699
            +Y+P+++ LHH   RTN+ LFMPLYD L
Sbjct  273  VYTPSFHSLHHTQFRTNYSLFMPLYDHL  300



>gb|EMS58051.1| Protein WAX2 [Triticum urartu]
Length=605

 Score =   154 bits (390),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 85/233 (36%), Positives = 131/233 (56%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    VWKESWEDIWCLHILVLTGL--RGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWH  174
            V  + W D+  ++  +L  L  R   +Q+W S S      R   +  + ++F+Q+D+E  
Sbjct  35   VGTKGWGDMNLVYAAMLPALLLRLFHNQIWISLSRHQTARRKHIIVDRSLEFDQVDRERS  94

Query  175  WDNFLILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDL  354
            WD+  IL  +    AY + PS+  +P WE KG +   +LH+G  E +YY  HR LH   L
Sbjct  95   WDDQAILATLFFYVAYAAIPSVRLMPMWEAKGAIIMALLHVGPVEFIYYWFHRALHHHFL  154

Query  355  YPLYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFD  534
            Y  YH  HH S V  P TA    F+E L   ++  IP L   ++G+GS++ +  Y+   D
Sbjct  155  YSRYHSHHHASIVTEPITAVIHPFVETLAYFLLFSIPMLIPIYMGYGSVLGVVLYLAYND  214

Query  535  FLRCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYD  693
            F+  +G+ N E++P  +F+  P LKYL+Y+P+Y+ LHH   RTN+ L MP+YD
Sbjct  215  FINNMGHCNFEMLPKWIFQRFPPLKYLMYTPSYHSLHHTKFRTNYSLAMPIYD  267



>gb|EAY87991.1| hypothetical protein OsI_09413 [Oryza sativa Indica Group]
Length=635

 Score =   154 bits (390),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 82/206 (40%), Positives = 116/206 (56%), Gaps = 0/206 (0%)
 Frame = +1

Query  76   QLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPSLANLPT  255
            QLW + S         ++  + +DFEQID+E +WD+ +IL A++      + P     P 
Sbjct  63   QLWITVSRHQTARSKHKIVNKSLDFEQIDRERNWDDQIILTALVFYLVSATMPQAQVAPW  122

Query  256  WEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLHHDSKVPHPFTAGSAAFLEH  435
            W  KG+V   VLH G  E LYY +HR LH   LY  YH  HH S V  P T+    F E 
Sbjct  123  WSTKGMVVTAVLHAGPVEFLYYWLHRALHHHWLYARYHSHHHASIVTEPITSVIHPFAEE  182

Query  436  LLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYSNVEIMPSHLFKTIPVLKYL  615
            ++  V++ IP L T   G  S++    Y++  DF+  LG+ N E++P  LF   P LKYL
Sbjct  183  VVYFVLLAIPILSTVATGTVSVVTANGYLVYIDFMNYLGHCNFELVPKCLFHVFPPLKYL  242

Query  616  IYSPTYYGLHHMDKRTNFCLFMPLYD  693
            +Y+P+++ LHH   RTN+ LFMP+YD
Sbjct  243  LYTPSFHSLHHTQFRTNYSLFMPVYD  268



>ref|NP_001048490.1| Os02g0814200 [Oryza sativa Japonica Group]
 dbj|BAD21663.1| putative CER1 [Oryza sativa Japonica Group]
 dbj|BAD22402.1| putative CER1 [Oryza sativa Japonica Group]
 dbj|BAF10404.1| Os02g0814200 [Oryza sativa Japonica Group]
 gb|EAZ25056.1| hypothetical protein OsJ_08848 [Oryza sativa Japonica Group]
 dbj|BAG90785.1| unnamed protein product [Oryza sativa Japonica Group]
Length=635

 Score =   154 bits (390),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 82/206 (40%), Positives = 116/206 (56%), Gaps = 0/206 (0%)
 Frame = +1

Query  76   QLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPSLANLPT  255
            QLW + S         ++  + +DFEQID+E +WD+ +IL A++      + P     P 
Sbjct  63   QLWITVSRHQTARSKHKIVNKSLDFEQIDRERNWDDQIILTALVFYLVSATMPQAQVAPW  122

Query  256  WEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLHHDSKVPHPFTAGSAAFLEH  435
            W  KG+V   VLH G  E LYY +HR LH   LY  YH  HH S V  P T+    F E 
Sbjct  123  WSTKGMVVTAVLHAGPVEFLYYWLHRALHHHWLYARYHSHHHASIVTEPITSVIHPFAEE  182

Query  436  LLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYSNVEIMPSHLFKTIPVLKYL  615
            ++  V++ IP L T   G  S++    Y++  DF+  LG+ N E++P  LF   P LKYL
Sbjct  183  VVYFVLLAIPILSTVATGTVSVVTANGYLVYIDFMNYLGHCNFELVPKCLFHVFPPLKYL  242

Query  616  IYSPTYYGLHHMDKRTNFCLFMPLYD  693
            +Y+P+++ LHH   RTN+ LFMP+YD
Sbjct  243  LYTPSFHSLHHTQFRTNYSLFMPVYD  268



>emb|CAE03390.2| OSJNBa0004N05.14 [Oryza sativa Japonica Group]
Length=597

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 84/212 (40%), Positives = 118/212 (56%), Gaps = 0/212 (0%)
 Frame = +1

Query  58   LRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPS  237
            LR + +Q+W S S      R   +  + +DFEQ+D+  + D+ +IL  +L    Y   P+
Sbjct  56   LRMIHNQIWISLSRYQTARRKHLIVDRSLDFEQVDRVLYLDDQIILNGLLFYLGYAIIPN  115

Query  238  LANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLHHDSKVPHPFTAGS  417
               +P W   G +  ++LHMG  E LYY  HR LH   LY  YH  HH S V  P T+  
Sbjct  116  FRLMPVWRTNGALITILLHMGPVEFLYYWFHRALHHHFLYSRYHSHHHASIVTEPITSVI  175

Query  418  AAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYSNVEIMPSHLFKTI  597
              F EHL   ++  I  L   F+G GS++    YI   DF+  +G+ N E+MP  +F+T 
Sbjct  176  HPFAEHLAYFLLFSISILPPIFMGCGSVLAGVLYITYIDFMNNMGHCNFELMPKWMFQTF  235

Query  598  PVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYD  693
            P LKYLIY+P+++ LHH   RTN+ LFMP YD
Sbjct  236  PPLKYLIYTPSFHSLHHTQFRTNYSLFMPFYD  267



>dbj|BAK00236.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=619

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 131/232 (56%), Gaps = 2/232 (1%)
 Frame = +1

Query  4    WKESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDN  183
            W+E   D+  + IL    LR L  Q+W + S +      +++  +GI+F+Q+D+E +WD+
Sbjct  40   WREL--DLGYVAILPSMLLRALHDQVWITVSRLYNARGKRQIVDRGIEFDQVDRERNWDD  97

Query  184  FLILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPL  363
             +IL AIL     +  P   NLP W   G V  ++LH G  E LYY  HR LH   LY  
Sbjct  98   QIILSAILLLLGAVYLPGGQNLPWWRTDGAVLLVLLHAGPVEFLYYWFHRALHHHFLYTR  157

Query  364  YHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLR  543
            YH  HH S V  P T+    F E L   ++  +P +  A  G  SI+    Y++  DF+ 
Sbjct  158  YHSHHHASIVTEPITSVIHPFAELLAYQLLFSVPMITCALTGTASILTFEMYVIYIDFMN  217

Query  544  CLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYDML  699
             +G+ N E++P+ LFK IP LKYL+Y+P+++ LHH   RTN+ LFMP YD L
Sbjct  218  NMGHCNFELVPNRLFKWIPPLKYLMYTPSFHSLHHTQFRTNYSLFMPFYDYL  269



>ref|XP_002973631.1| hypothetical protein SELMODRAFT_99824, partial [Selaginella moellendorffii]
 gb|EFJ25291.1| hypothetical protein SELMODRAFT_99824, partial [Selaginella moellendorffii]
Length=226

 Score =   147 bits (371),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 71/187 (38%), Positives = 117/187 (63%), Gaps = 1/187 (1%)
 Frame = +1

Query  7    KESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNF  186
            + S  D W  H+++L  LR L  Q W + S + F  +  ++ Q  + +EQ+D+E+H DN 
Sbjct  40   RHSSTDSWWFHLVLLVFLRYLQQQAWITVSRLYFLVKKYQIQQFALSYEQVDREFHCDNH  99

Query  187  LILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSD-LYPL  363
            +I Q++  + A++  P+  +LP + + G++  +  H+ F+EP+YY +HR +HSS  L+  
Sbjct  100  MIFQSLALAAAHVWIPAFRDLPLFNWTGLLLLVFFHVVFTEPIYYFVHRAMHSSHILFCN  159

Query  364  YHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLR  543
            YH LHH S  P P TAG+  FLE L+   ++ IP +G   LG GS+++IY Y+L+FDF +
Sbjct  160  YHSLHHASTTPEPATAGTRTFLEELIQSALIAIPIIGVMALGGGSVVMIYVYLLSFDFFK  219

Query  544  CLGYSNV  564
             LG+ N+
Sbjct  220  QLGHCNL  226



>ref|XP_010691968.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=620

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 84/225 (37%), Positives = 122/225 (54%), Gaps = 0/225 (0%)
 Frame = +1

Query  19   EDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQ  198
             D+  L I+     R L +Q+W S+S          +  + ++FEQ+D+E +WD+ ++L 
Sbjct  42   RDLGYLAIIPFMLWRMLHNQIWISFSRYRTAKGNNLIVDKSLEFEQVDRERNWDDQILLN  101

Query  199  AILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLH  378
             I    A     +  N+P +   G++Y  +LHMG  E LYY +HR LH   LY  YH  H
Sbjct  102  VIAFYLANRGMETAKNVPFFRMDGLIYAFLLHMGPVEFLYYWLHRALHHHFLYSRYHSHH  161

Query  379  HDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYS  558
            H S V  P T+    F EH+L   +  IPTL T      SI+ +  Y+   D +  +G+ 
Sbjct  162  HLSIVTEPITSVIHPFAEHILYFTLFAIPTLSTTLARTSSIVSLALYVTYIDLMNNMGHC  221

Query  559  NVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYD  693
            N EI+P  LF   P LKYL+Y+P+++ LHH   RTN+ LFMP YD
Sbjct  222  NFEIVPKWLFSIFPPLKYLMYTPSFHSLHHTQFRTNYSLFMPFYD  266



>gb|EMT04955.1| Protein WAX2 [Aegilops tauschii]
Length=580

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 83/230 (36%), Positives = 130/230 (57%), Gaps = 2/230 (1%)
 Frame = +1

Query  10   ESWEDIWCLHILVLTGL--RGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDN  183
            + W D+  ++  +L  L  R   +Q+W S S      R   +  + ++F+Q+D+E  WD+
Sbjct  38   KGWGDMNLVYAAMLPALLLRLFHNQIWISLSRHQTARRKHIIVDRSLEFDQVDRERSWDD  97

Query  184  FLILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPL  363
              IL  +    AY + PS+  +P WE KG +   +LH+G  E +YY  HR LH   LY  
Sbjct  98   QAILATLFFYVAYAAIPSVRLMPMWETKGAIAIALLHVGPVEFIYYWFHRALHHHFLYSR  157

Query  364  YHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLR  543
            YH  HH S V  P TA    F+E +   ++  IP L   ++G+GS++ +  Y+   DF+ 
Sbjct  158  YHSHHHASIVTEPITAVIHPFVETIAYFLLFSIPMLIPIYMGYGSVLGVVLYLAYNDFIN  217

Query  544  CLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYD  693
             +G+ N E++P  +F+  P LKYL+Y+P+Y+ LHH   RTN+ L MP+YD
Sbjct  218  NMGHCNFEMLPKWIFQRFPPLKYLMYTPSYHSLHHTKFRTNYSLAMPIYD  267



>gb|ABD28319.2| Sterol desaturase [Medicago truncatula]
Length=493

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 83/212 (39%), Positives = 121/212 (57%), Gaps = 0/212 (0%)
 Frame = +1

Query  58   LRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPS  237
            +R L +Q+W S S         ++  +G++FEQ+D+E +WD+ ++  A++    YM FP 
Sbjct  62   IRMLHNQIWISISRYQTAKGKSKIVDKGLEFEQVDRETNWDDQILFTALVYYIGYMIFPM  121

Query  238  LANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLHHDSKVPHPFTAGS  417
             +NLP W   GV+   +LH G  E LYY +HR LH   LY  YH  HH S V  P T+ +
Sbjct  122  ASNLPWWRIDGVILTAILHAGPVEFLYYWLHRALHHHYLYSRYHSHHHSSIVTEPITSVT  181

Query  418  AAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYSNVEIMPSHLFKTI  597
              F EHL    +  IP L T F+   S+  +Y Y+   DF+  +G+ N E +P  L    
Sbjct  182  HPFAEHLSYFTLFAIPMLTTLFIKKSSVAALYGYVFFIDFMNNMGHCNFEFIPKKLLSYF  241

Query  598  PVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYD  693
            P+LKYL Y+P+++ LHH   R N+ LFMP+YD
Sbjct  242  PILKYLSYTPSFHSLHHTKFRANYSLFMPMYD  273



>ref|XP_002464501.1| hypothetical protein SORBIDRAFT_01g019590 [Sorghum bicolor]
 gb|EER91499.1| hypothetical protein SORBIDRAFT_01g019590 [Sorghum bicolor]
Length=619

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 82/212 (39%), Positives = 119/212 (56%), Gaps = 0/212 (0%)
 Frame = +1

Query  58   LRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPS  237
            LR L +Q+W + S +      +++  +GI+FEQ+D+E +WD+ ++L  IL    +M  P 
Sbjct  56   LRMLQNQVWITVSRLQNARGRRQIVDRGIEFEQVDRERNWDDQILLSGILMYLGFMYIPG  115

Query  238  LANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLHHDSKVPHPFTAGS  417
              +LP W   G V   +LH G  E +YY  HR LH   LY  YH  HH S V  P T+  
Sbjct  116  GQHLPLWRTDGAVLIALLHAGPVELIYYWFHRALHHHFLYTRYHSHHHASIVTEPITSVI  175

Query  418  AAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYSNVEIMPSHLFKTI  597
              F E +   ++  IP     F G  SI+    Y+   DF+  +G+ N E++P+ LFK  
Sbjct  176  HPFAELVAYELLFSIPLFVCIFNGTASILAFVIYVSYIDFMNNMGHCNFELVPNWLFKWF  235

Query  598  PVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYD  693
            P LKYL+Y+P+++ LHH   RTN+ LFMP YD
Sbjct  236  PPLKYLMYTPSFHSLHHTQFRTNYSLFMPFYD  267



>gb|ACN31737.1| unknown [Zea mays]
Length=600

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 91/233 (39%), Positives = 131/233 (56%), Gaps = 2/233 (1%)
 Frame = +1

Query  1    VWKESWEDIWCLHILVLTGL--RGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWH  174
            V    W DI     L+L  L  R + +Q+W S +         R+  +GI+F+Q+D+E  
Sbjct  12   VVARGWGDIDLAFALILPSLLLRMVHNQIWISAARYQTARSKHRIVDRGIEFDQVDRERG  71

Query  175  WDNFLILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDL  354
            WD+ +IL  +L    Y++ PS   +P W   G V   +LH G  E LYY  HR LH   L
Sbjct  72   WDDQIILNGLLFYVGYLAIPSARRMPAWRSDGAVAMALLHAGPVEFLYYWFHRALHHHFL  131

Query  355  YPLYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFD  534
            Y  YH  HH S V  P T+    F EH++  V+  IP L T ++G+ S++ I  YI   D
Sbjct  132  YSRYHSHHHSSIVTEPITSVIHPFAEHMVYYVLFAIPMLSTLYMGNASVLGIVLYIAYID  191

Query  535  FLRCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYD  693
            F+  +G+ N E++P  +F+  P LKYL+Y+P+++ LHH   RTN+ LFMPLYD
Sbjct  192  FMNNMGHCNFELVPRWMFQLFPPLKYLMYTPSFHSLHHTQFRTNYSLFMPLYD  244



>gb|ACR38546.1| unknown [Zea mays]
 gb|AFW72382.1| hypothetical protein ZEAMMB73_077345 [Zea mays]
Length=623

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 90/230 (39%), Positives = 130/230 (57%), Gaps = 2/230 (1%)
 Frame = +1

Query  10   ESWEDIWCLHILVLTGL--RGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDN  183
              W DI     L+L  L  R + +Q+W S +         R+  +GI+F+Q+D+E  WD+
Sbjct  38   RGWGDIDLAFALILPSLLLRMVHNQIWISAARYQTARSKHRIVDRGIEFDQVDRERGWDD  97

Query  184  FLILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPL  363
             +IL  +L    Y++ PS   +P W   G V   +LH G  E LYY  HR LH   LY  
Sbjct  98   QIILNGLLFYVGYLAIPSARRMPAWRSDGAVAMALLHAGPVEFLYYWFHRALHHHFLYSR  157

Query  364  YHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLR  543
            YH  HH S V  P T+    F EH++  V+  IP L T ++G+ S++ I  YI   DF+ 
Sbjct  158  YHSHHHSSIVTEPITSVIHPFAEHMVYYVLFAIPMLSTLYMGNASVLGIVLYIAYIDFMN  217

Query  544  CLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYD  693
             +G+ N E++P  +F+  P LKYL+Y+P+++ LHH   RTN+ LFMPLYD
Sbjct  218  NMGHCNFELVPRWMFQLFPPLKYLMYTPSFHSLHHTQFRTNYSLFMPLYD  267



>ref|XP_002454185.1| hypothetical protein SORBIDRAFT_04g026320 [Sorghum bicolor]
 gb|EES07161.1| hypothetical protein SORBIDRAFT_04g026320 [Sorghum bicolor]
Length=619

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 90/230 (39%), Positives = 128/230 (56%), Gaps = 2/230 (1%)
 Frame = +1

Query  10   ESWEDIWCLHILVLTGL--RGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDN  183
              W DI     L+L  L  R   +Q+W S +         R+  +GI+FEQ+D+E  WD+
Sbjct  38   RGWGDIDLAFALILPSLLLRMAHNQIWISAARYQTARSKHRIVDRGIEFEQVDRERGWDD  97

Query  184  FLILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPL  363
             +IL  +L    Y++ PS  +LP W   G     +LH G  E LYY  HR LH   LY  
Sbjct  98   QIILNGLLFYAGYLAIPSARHLPAWRTDGAAVMALLHAGPVEFLYYWFHRALHHHFLYSR  157

Query  364  YHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLR  543
            YH  HH S V  P T+    F EH++  V+  IP L T ++G+ S++ I  YI   DF+ 
Sbjct  158  YHSHHHSSIVTEPITSVIHPFAEHMVYYVLFAIPMLSTVYIGNASVLGIVVYIAYIDFMN  217

Query  544  CLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYD  693
             +G+ N E++P  +F+  P LKYL+Y+P+++ LHH   RTN+ LFMP YD
Sbjct  218  NMGHCNFELVPKWMFQVFPPLKYLMYTPSFHSLHHTQFRTNYSLFMPFYD  267



>ref|XP_004982905.1| PREDICTED: protein ECERIFERUM 1-like [Setaria italica]
Length=619

 Score =   153 bits (386),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 85/224 (38%), Positives = 125/224 (56%), Gaps = 0/224 (0%)
 Frame = +1

Query  22   DIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQA  201
            D+  L IL    LR L +Q+W + S +      +++  +GI+FEQ+D+E +WD+ ++L  
Sbjct  44   DVGYLAILPSLLLRVLHNQVWITVSRVQNARSRRQIVDRGIEFEQVDRERNWDDQILLSG  103

Query  202  ILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLHH  381
            IL     +  P   +LP W   G +   +LH G  E +YY  HR LH   LY  YH  HH
Sbjct  104  ILLYLGALYVPGGQHLPLWRADGFLLIALLHAGPVEFIYYWFHRALHHHFLYTRYHSHHH  163

Query  382  DSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYSN  561
             S V  P T+    F E +   ++  IP +  A  G  SI+    Y+L  DF+  +G+ N
Sbjct  164  ASIVTEPITSVIHPFAELVAYELLFAIPLISCALSGTASILAFEIYVLYIDFMNNMGHCN  223

Query  562  VEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYD  693
             E++P+ LFK  P LKYL+Y+P+++ LHH   RTN+ LFMP YD
Sbjct  224  FELVPNWLFKWFPPLKYLMYTPSFHSLHHTQFRTNYSLFMPFYD  267



>ref|XP_004953128.1| PREDICTED: protein ECERIFERUM 1-like [Setaria italica]
Length=620

 Score =   153 bits (386),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 86/212 (41%), Positives = 125/212 (59%), Gaps = 0/212 (0%)
 Frame = +1

Query  58   LRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPS  237
            LR + +Q+W S +         R+  +GIDF+Q+D+E  WD+ +IL  +L   AY+  PS
Sbjct  57   LRMVHNQIWISAARYQTARSKHRIVDRGIDFDQVDRERGWDDQIILNGLLFYVAYLLIPS  116

Query  238  LANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLHHDSKVPHPFTAGS  417
              ++P W   G V   +LH G  E LYY  HR LH   LY  YH  HH S V  P T+  
Sbjct  117  ARHMPAWRTDGAVAMALLHAGPVEFLYYWFHRALHHHFLYSRYHSHHHSSIVTEPITSVI  176

Query  418  AAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYSNVEIMPSHLFKTI  597
              F EH++  ++  IP L T ++G+GS++ I  YI   DF+  +G+ N E++P  +F+  
Sbjct  177  HPFAEHIVYYILFAIPMLTTIYMGNGSVLGIVLYIAYIDFMNNMGHCNFELVPKWMFQVF  236

Query  598  PVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYD  693
            P LKYL+Y+P+++ LHH   RTN+ LFMP YD
Sbjct  237  PPLKYLMYTPSFHSLHHTQFRTNYSLFMPFYD  268



>ref|XP_002262647.1| PREDICTED: protein ECERIFERUM 1 [Vitis vinifera]
 emb|CBI38119.3| unnamed protein product [Vitis vinifera]
Length=620

 Score =   152 bits (385),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 87/211 (41%), Positives = 122/211 (58%), Gaps = 0/211 (0%)
 Frame = +1

Query  61   RGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPSL  240
            R L +Q+W S +         R+  + I+FEQ+D+E +WD+ ++L  IL    YM  P  
Sbjct  57   RTLHNQIWISLARYRTAKGNNRIVDKSIEFEQVDRESNWDDQILLNGILFYVGYMILPGA  116

Query  241  ANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLHHDSKVPHPFTAGSA  420
            A++P W   GV+  ++LHMG  E LYY +HR LH   LY  YH  HH S V  P T+   
Sbjct  117  AHMPLWRTDGVLLTILLHMGPVEFLYYWLHRALHHHYLYSRYHSHHHSSIVTEPITSVIH  176

Query  421  AFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYSNVEIMPSHLFKTIP  600
             F EHL   ++  IP L   F+   SI  ++ YI   DF+  +G+ N E++P  LF   P
Sbjct  177  PFAEHLAYFLLFSIPLLAGIFMRKNSIAALFGYISYIDFMNNMGHCNFELIPKMLFSIFP  236

Query  601  VLKYLIYSPTYYGLHHMDKRTNFCLFMPLYD  693
             LKYL+Y+P+Y+ LHH   RTN+ LFMP+YD
Sbjct  237  PLKYLMYTPSYHSLHHTRFRTNYSLFMPIYD  267



>gb|AFW68611.1| hypothetical protein ZEAMMB73_227989 [Zea mays]
Length=419

 Score =   150 bits (380),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 81/212 (38%), Positives = 117/212 (55%), Gaps = 0/212 (0%)
 Frame = +1

Query  58   LRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPS  237
            LR L +Q W + S +      ++V  +GI+FEQ+D+E +WD+ ++L  IL        P 
Sbjct  56   LRALHNQAWITASRLQSARGRRQVVDRGIEFEQVDRERNWDDQILLSGILLYLGSTYLPG  115

Query  238  LANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLHHDSKVPHPFTAGS  417
              +LP W   G     +LH G  E +YY +HR LH   LY  YH  HH S V  P T+  
Sbjct  116  GQHLPLWRADGAALIALLHAGPVELVYYWLHRALHHHFLYSRYHSHHHASIVTEPITSVI  175

Query  418  AAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYSNVEIMPSHLFKTI  597
              F E +   ++  IP +     G  SII    Y++  DF+  +G+ N E++P+ LFK  
Sbjct  176  HPFAELVAYELLFSIPLIVCTLNGTASIIAFEIYVIYIDFMNNMGHCNFELVPNWLFKWF  235

Query  598  PVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYD  693
            P LKYL+Y+P+++ LHH   RTN+ LFMP YD
Sbjct  236  PPLKYLMYTPSFHSLHHTQFRTNYSLFMPFYD  267



>gb|KDP34470.1| hypothetical protein JCGZ_12753 [Jatropha curcas]
Length=281

 Score =   147 bits (372),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 89/231 (39%), Positives = 126/231 (55%), Gaps = 0/231 (0%)
 Frame = +1

Query  1    VWKESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWD  180
            V +E   D++   I  +  LR L +Q+W S+S  L     KR+  + I+FEQ+++E +WD
Sbjct  37   VKEEKERDLFNFIIFPVLILRFLHNQIWISFSRYLTAKGRKRIVDKDIEFEQLERESNWD  96

Query  181  NFLILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYP  360
            + +ILQ IL+     +    +  P W    VV  ++LH G  E LYY +HR LH   LY 
Sbjct  97   DQIILQGILSYILNKAITGASKFPLWRTDSVVIIILLHAGPVEFLYYWLHRALHHHFLYS  156

Query  361  LYHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFL  540
             YH  HH S V  P T+G   F E +   ++  IP  G   +G  S++    YI   DF+
Sbjct  157  RYHSHHHSSIVTQPITSGIHPFAEVMAYFMLFLIPISGLIIIGRASLVAFIGYIFYIDFM  216

Query  541  RCLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYD  693
              +G+ N EI P   F   P LKYLIY+P+++ LHH   RTN+ LFMP YD
Sbjct  217  NNMGHCNFEIFPKWFFSVFPPLKYLIYTPSFHSLHHTKFRTNYSLFMPFYD  267



>ref|XP_003625020.1| Protein WAX2 [Medicago truncatula]
 gb|AES81238.1| fatty acid hydroxylase superfamily protein [Medicago truncatula]
Length=615

 Score =   152 bits (385),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 83/212 (39%), Positives = 121/212 (57%), Gaps = 0/212 (0%)
 Frame = +1

Query  58   LRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPS  237
            +R L +Q+W S S         ++  +G++FEQ+D+E +WD+ ++  A++    YM FP 
Sbjct  53   IRMLHNQIWISISRYQTAKGKSKIVDKGLEFEQVDRETNWDDQILFTALVYYIGYMIFPM  112

Query  238  LANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLHHDSKVPHPFTAGS  417
             +NLP W   GV+   +LH G  E LYY +HR LH   LY  YH  HH S V  P T+ +
Sbjct  113  ASNLPWWRIDGVILTAILHAGPVEFLYYWLHRALHHHYLYSRYHSHHHSSIVTEPITSVT  172

Query  418  AAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYSNVEIMPSHLFKTI  597
              F EHL    +  IP L T F+   S+  +Y Y+   DF+  +G+ N E +P  L    
Sbjct  173  HPFAEHLSYFTLFAIPMLTTLFIKKSSVAALYGYVFFIDFMNNMGHCNFEFIPKKLLSYF  232

Query  598  PVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYD  693
            P+LKYL Y+P+++ LHH   R N+ LFMP+YD
Sbjct  233  PILKYLSYTPSFHSLHHTKFRANYSLFMPMYD  264



>ref|XP_010936011.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Elaeis guineensis]
Length=638

 Score =   152 bits (384),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 84/220 (38%), Positives = 119/220 (54%), Gaps = 14/220 (6%)
 Frame = +1

Query  76   QLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWH--------------WDNFLILQAILAS  213
            QLW ++S         R+  + +DF+Q+D+E +               D+ +IL A+L  
Sbjct  62   QLWITFSRYQTAKSKHRIVDKSLDFDQVDRERNCVRNAIESDGELDGRDDQIILTALLMY  121

Query  214  FAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLHHDSKV  393
               M  P  ++LP WE +GV   ++LHMG  E +YY +HR LH   LY  YH  HH S V
Sbjct  122  MGNMVVPGASHLPWWETRGVAITILLHMGPVEFIYYWLHRALHHHFLYSRYHSHHHASIV  181

Query  394  PHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYSNVEIM  573
              P T+    F E L   V+  IP +  AF G GSI     Y++  DF+  +G+ N E++
Sbjct  182  TEPITSVIHPFAEELSYFVLFAIPLMTMAFTGTGSIAAAVGYLMYIDFMNYMGHCNFELV  241

Query  574  PSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYD  693
            P  LF   P LKYL+Y+P+++ LHH   RTN+ LFMP YD
Sbjct  242  PKWLFSIFPPLKYLMYTPSFHSLHHTQFRTNYSLFMPFYD  281



>gb|EYU40309.1| hypothetical protein MIMGU_mgv1a003047mg [Erythranthe guttata]
Length=612

 Score =   152 bits (383),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 82/211 (39%), Positives = 116/211 (55%), Gaps = 0/211 (0%)
 Frame = +1

Query  61   RGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPSL  240
            R L +Q+W S S         R+  + I+FEQ+D+E +WD+ ++L  IL  F   +  S 
Sbjct  59   RILHNQIWISISRHRTAKGNNRILDRTIEFEQVDRESNWDDNILLSGILFYFFNSTLRSA  118

Query  241  ANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLHHDSKVPHPFTAGSA  420
            + LP W   G++  ++LH G  E LYY +HR LH   LY  YH  HH S V  P T+   
Sbjct  119  SFLPIWRNDGIIITILLHAGPVEYLYYWLHRGLHHHFLYTRYHSHHHSSIVTEPITSVIH  178

Query  421  AFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYSNVEIMPSHLFKTIP  600
             F EHL    +  IP   T      SII ++ YI   D +  +G+ N E++P  +F   P
Sbjct  179  PFAEHLSYFALFAIPMFATILTRTASIISLFGYITYIDLMNNMGHCNFELVPKWIFSIFP  238

Query  601  VLKYLIYSPTYYGLHHMDKRTNFCLFMPLYD  693
             LKYL+Y+P+++ LHH   RTN+ LFMP YD
Sbjct  239  PLKYLMYTPSFHSLHHTQFRTNYSLFMPFYD  269



>emb|CAN60676.1| hypothetical protein VITISV_029045 [Vitis vinifera]
Length=557

 Score =   151 bits (382),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 86/211 (41%), Positives = 123/211 (58%), Gaps = 0/211 (0%)
 Frame = +1

Query  61   RGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPSL  240
            R L +Q+W S +         R+  + I+FEQ+D+E +WD+ ++L  IL    YM  P +
Sbjct  57   RALHNQIWISLARYRTAKGNNRIVDKSIEFEQVDRESNWDDQILLNGILFYVVYMILPGV  116

Query  241  ANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLHHDSKVPHPFTAGSA  420
            A++P W   GV+  ++LHMG  E LYY +HR LH   LY  YH  HH S V  P T+   
Sbjct  117  AHMPLWRTDGVLLTILLHMGPVEFLYYWLHRALHHHYLYSRYHSHHHSSIVTEPITSVIH  176

Query  421  AFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYSNVEIMPSHLFKTIP  600
             F EHL   ++  IP L   F+   S+  ++ YI   DF+  +G+ N E++P  LF   P
Sbjct  177  PFAEHLAYFLLFLIPLLAGFFMRKSSMAAVFGYISYIDFMNNMGHCNFELIPKMLFSIFP  236

Query  601  VLKYLIYSPTYYGLHHMDKRTNFCLFMPLYD  693
             LKYL+Y+P+Y+ LHH   RTN+ LFMP+YD
Sbjct  237  PLKYLMYTPSYHSLHHTQFRTNYSLFMPIYD  267



>ref|XP_002262785.1| PREDICTED: protein ECERIFERUM 1 [Vitis vinifera]
 emb|CBI38118.3| unnamed protein product [Vitis vinifera]
Length=620

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 86/211 (41%), Positives = 123/211 (58%), Gaps = 0/211 (0%)
 Frame = +1

Query  61   RGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPSL  240
            R L +Q+W S +         R+  + I+FEQ+D+E +WD+ ++L  IL    YM  P +
Sbjct  57   RALHNQIWISLARYRTAKGNNRIVDKSIEFEQVDRESNWDDQILLNGILFYVVYMILPGV  116

Query  241  ANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLHHDSKVPHPFTAGSA  420
            A++P W   GV+  ++LHMG  E LYY +HR LH   LY  YH  HH S V  P T+   
Sbjct  117  AHMPLWRTDGVLLTILLHMGPVEFLYYWLHRALHHHYLYSRYHSHHHSSIVTEPITSVIH  176

Query  421  AFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYSNVEIMPSHLFKTIP  600
             F EHL   ++  IP L   F+   S+  ++ YI   DF+  +G+ N E++P  LF   P
Sbjct  177  PFAEHLAYFLLFLIPLLAGFFMRKSSMAAVFGYISYIDFMNNMGHCNFELIPKMLFSIFP  236

Query  601  VLKYLIYSPTYYGLHHMDKRTNFCLFMPLYD  693
             LKYL+Y+P+Y+ LHH   RTN+ LFMP+YD
Sbjct  237  PLKYLMYTPSYHSLHHTQFRTNYSLFMPIYD  267



>gb|EMS58604.1| Protein WAX2 [Triticum urartu]
Length=619

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 89/230 (39%), Positives = 129/230 (56%), Gaps = 2/230 (1%)
 Frame = +1

Query  10   ESWEDIWCLHILVLTG--LRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDN  183
            + W ++   +I +L    LR L  Q W + S +      +++  +GI+F+Q+D+E +WD+
Sbjct  38   KGWRELDLGYIAILPSMLLRALHDQAWITVSRLYNARGKRQIVDRGIEFDQVDRERNWDD  97

Query  184  FLILQAILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPL  363
             +IL AIL     +  P   NLP W   G V  ++LH G  E LYY  HR LH   LY  
Sbjct  98   QIILSAILLLLGSLYLPGGQNLPWWRIDGAVLLVLLHAGPVEFLYYWFHRALHHHFLYTR  157

Query  364  YHWLHHDSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLR  543
            YH  HH S V  P T+    F E L   ++  +P +  A  G  SII    Y++  DF+ 
Sbjct  158  YHSHHHASIVTEPITSVIHPFAELLAYQLLFSVPMITCALTGTASIITFEMYVIYIDFMN  217

Query  544  CLGYSNVEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYD  693
             +G+ N E++P+ LFK IP LKYL+Y+P+++ LHH   RTN+ LFMP YD
Sbjct  218  NMGHCNFELVPNRLFKWIPPLKYLMYTPSFHSLHHTQFRTNYSLFMPFYD  267



>ref|XP_009337262.1| PREDICTED: protein ECERIFERUM 1-like [Pyrus x bretschneideri]
Length=623

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 86/211 (41%), Positives = 118/211 (56%), Gaps = 0/211 (0%)
 Frame = +1

Query  61   RGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPSL  240
            R L +QLW S S         R+  +G++FEQ+D+E +WD+ ++   IL        P  
Sbjct  57   RFLHNQLWISLSRYRTAKGNGRIVDKGLEFEQVDRERNWDDQILFNGILFYLGSRHLPGA  116

Query  241  ANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLHHDSKVPHPFTAGSA  420
            ANLP W   G++  ++LH G  E LYY +HR LH   LY  YH  HH S V  P T+   
Sbjct  117  ANLPYWRTDGIILTILLHAGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIH  176

Query  421  AFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYSNVEIMPSHLFKTIP  600
             F EH+L   +  IP + T   G  SI+    Y    DF+  +G+ N E++P  LF   P
Sbjct  177  PFAEHILYFTLFAIPLMTTILTGTSSIVSFAGYATYIDFMNNMGHCNFELIPKWLFTIFP  236

Query  601  VLKYLIYSPTYYGLHHMDKRTNFCLFMPLYD  693
             LKYL+Y+P+Y+ LHH   RTN+CLFMP+YD
Sbjct  237  PLKYLLYTPSYHSLHHTQFRTNYCLFMPIYD  267



>gb|AES88391.2| fatty acid hydroxylase superfamily protein [Medicago truncatula]
Length=615

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 85/212 (40%), Positives = 121/212 (57%), Gaps = 0/212 (0%)
 Frame = +1

Query  58   LRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPS  237
            +R L +Q+W S S        +R+  +G++F+Q+D+E +WD+ ++  A++    Y  FP 
Sbjct  53   VRMLHNQIWISISRYQTAKGKRRIVDKGLEFDQVDRETNWDDQILFTALMFYILYTIFPM  112

Query  238  LANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLHHDSKVPHPFTAGS  417
             ANLP W   GV+   +LH G  E LYY +HR LH   LY  YH  HH S V  P TA +
Sbjct  113  AANLPWWRTDGVILTAILHAGPVEFLYYWLHRALHHHYLYSRYHSHHHSSIVTEPITAVT  172

Query  418  AAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYSNVEIMPSHLFKTI  597
              F E L    +  IP L T F+   S++ +Y YI   DF+  +G+ N E  P  LF   
Sbjct  173  HPFAEMLAYFTLFLIPMLTTLFMKKSSVVALYGYIFYIDFMNNMGHCNFEFFPKKLFSYF  232

Query  598  PVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYD  693
            P LKYL Y+P+++ LHH   R+N+ LFMP+YD
Sbjct  233  PQLKYLTYTPSFHSLHHTKFRSNYSLFMPIYD  264



>ref|XP_010054531.1| PREDICTED: protein ECERIFERUM 1-like [Eucalyptus grandis]
 gb|KCW76798.1| hypothetical protein EUGRSUZ_D01149 [Eucalyptus grandis]
Length=620

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 86/211 (41%), Positives = 124/211 (59%), Gaps = 0/211 (0%)
 Frame = +1

Query  61   RGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPSL  240
            R L +Q+W SYS         R+  +GI+FEQ+D+E +WD+ ++L  IL   ++M  P  
Sbjct  57   RLLHNQIWISYSRHRIAKGNNRIVDRGIEFEQVDRESNWDDQILLNGILFYVSHMIIPQA  116

Query  241  ANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLHHDSKVPHPFTAGSA  420
            ++LP W   GV+  +++H    E LYY +HR LH   LY  YH  HH S V  P ++   
Sbjct  117  SHLPLWRTDGVIITVLIHASVVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPISSVIH  176

Query  421  AFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYSNVEIMPSHLFKTIP  600
             F EH+   ++  IP   T F+   S++ +  YIL  DF+  LG+ N E++P  LF   P
Sbjct  177  PFAEHMAYFMLFAIPMFTTLFVRTASMVSLTGYILCIDFMNNLGHCNFELIPYWLFTIFP  236

Query  601  VLKYLIYSPTYYGLHHMDKRTNFCLFMPLYD  693
             LKYL+Y+P+Y+ LHH   RTN+ LFMPLYD
Sbjct  237  PLKYLMYTPSYHSLHHTQFRTNYSLFMPLYD  267



>gb|EEC67150.1| hypothetical protein OsI_33995 [Oryza sativa Indica Group]
Length=621

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 85/224 (38%), Positives = 123/224 (55%), Gaps = 0/224 (0%)
 Frame = +1

Query  22   DIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQA  201
            D+  + IL    LR L +Q W + S +      +++ ++GI+F+Q+D+E +WD+ +IL  
Sbjct  44   DLGYIAILPSLLLRMLHNQAWITISRLQNARGRRQIVRRGIEFDQVDRERNWDDQIILSG  103

Query  202  ILASFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLHH  381
            IL     +  P   +LP W   G     +LH G  E LYY  HR LH   LY  YH  HH
Sbjct  104  ILLYLGALYVPGGQHLPLWRTDGAGLIALLHAGPVEFLYYWFHRALHHHFLYTRYHSHHH  163

Query  382  DSKVPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYSN  561
             S V  P T+    F E +   ++  IP +  A  G  SII    Y++  DF+  +G+ N
Sbjct  164  SSIVTEPITSVIHPFAELVAYELLFSIPLIACALTGTASIIAFEMYLIYIDFMNNMGHCN  223

Query  562  VEIMPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYD  693
             E++PS LF   P LKYL+Y+P+++ LHH   RTN+ LFMP YD
Sbjct  224  FELVPSWLFTWFPPLKYLMYTPSFHSLHHTQFRTNYSLFMPFYD  267



>gb|ACG35856.1| CER1 [Zea mays]
Length=619

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 81/212 (38%), Positives = 117/212 (55%), Gaps = 0/212 (0%)
 Frame = +1

Query  58   LRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPS  237
            LR L +Q W + S +      ++V  +GI+FEQ+D+E +WD+ ++L  IL        P 
Sbjct  56   LRALHNQAWITASRLQSARGRRQVVDRGIEFEQVDRERNWDDQILLSGILLYLGSTYLPG  115

Query  238  LANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLHHDSKVPHPFTAGS  417
              +LP W   G     +LH G  E +YY +HR LH   LY  YH  HH S V  P T+  
Sbjct  116  GQHLPLWRADGAALIALLHAGPVELVYYWLHRALHHHFLYSRYHSHHHASIVTEPITSVI  175

Query  418  AAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYSNVEIMPSHLFKTI  597
              F E +   ++  IP +     G  SII    Y++  DF+  +G+ N E++P+ LFK  
Sbjct  176  HPFAELVAYELLFSIPLIVCTLNGTASIIAFEIYVIYIDFMNNMGHCNFELVPNWLFKWF  235

Query  598  PVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYD  693
            P LKYL+Y+P+++ LHH   RTN+ LFMP YD
Sbjct  236  PPLKYLMYTPSFHSLHHTQFRTNYSLFMPFYD  267



>ref|NP_001146661.1| uncharacterized protein LOC100280261 [Zea mays]
 gb|ACL54484.1| unknown [Zea mays]
 gb|AFW68612.1| CER1 [Zea mays]
Length=619

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 81/212 (38%), Positives = 117/212 (55%), Gaps = 0/212 (0%)
 Frame = +1

Query  58   LRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPS  237
            LR L +Q W + S +      ++V  +GI+FEQ+D+E +WD+ ++L  IL        P 
Sbjct  56   LRALHNQAWITASRLQSARGRRQVVDRGIEFEQVDRERNWDDQILLSGILLYLGSTYLPG  115

Query  238  LANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLHHDSKVPHPFTAGS  417
              +LP W   G     +LH G  E +YY +HR LH   LY  YH  HH S V  P T+  
Sbjct  116  GQHLPLWRADGAALIALLHAGPVELVYYWLHRALHHHFLYSRYHSHHHASIVTEPITSVI  175

Query  418  AAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYSNVEIMPSHLFKTI  597
              F E +   ++  IP +     G  SII    Y++  DF+  +G+ N E++P+ LFK  
Sbjct  176  HPFAELVAYELLFSIPLIVCTLNGTASIIAFEIYVIYIDFMNNMGHCNFELVPNWLFKWF  235

Query  598  PVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYD  693
            P LKYL+Y+P+++ LHH   RTN+ LFMP YD
Sbjct  236  PPLKYLMYTPSFHSLHHTQFRTNYSLFMPFYD  267



>ref|XP_003625022.1| Protein WAX2 [Medicago truncatula]
 gb|ABD28316.1| Sterol desaturase [Medicago truncatula]
 gb|AES81240.1| fatty acid hydroxylase superfamily protein [Medicago truncatula]
Length=617

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 88/221 (40%), Positives = 122/221 (55%), Gaps = 4/221 (2%)
 Frame = +1

Query  31   CLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILA  210
            C  ILV    R L +Q+W S S         ++  + ++FEQ+D+E +WD+ ++  A+L 
Sbjct  48   CPFILV----RMLHNQIWISISRYETARGKSKIVDKSLEFEQVDRETNWDDQILFTALLY  103

Query  211  SFAYMSFPSLANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLHHDSK  390
               YM FP  +NLP W   GV+   +LH G  E LYY +HR LH   LY  YH  HH S 
Sbjct  104  YIGYMIFPMASNLPWWRIDGVILTAILHAGPVEFLYYWLHRALHHHYLYSRYHSHHHSSI  163

Query  391  VPHPFTAGSAAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYSNVEI  570
            V  P T+ +  F EHL    +  IP L T F+   S+  +Y Y+   DF+  +G+ N E 
Sbjct  164  VTEPVTSVAHPFAEHLSYFTLFAIPMLTTLFIKKSSVAALYGYVFFIDFMNNMGHCNFEF  223

Query  571  MPSHLFKTIPVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYD  693
             P  LF   P LKYL Y+P+++ LHH   R N+ LFMP+YD
Sbjct  224  FPKKLFSYFPQLKYLSYTPSFHSLHHTKFRRNYSLFMPMYD  264



>gb|AAD29719.1|AF143746_1 CER1 [Oryza sativa Indica Group]
Length=621

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 82/212 (39%), Positives = 118/212 (56%), Gaps = 0/212 (0%)
 Frame = +1

Query  58   LRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPS  237
            LR L +Q W + S +      +++ ++GI+F+Q+D+E +WD+ +IL  IL     +  P 
Sbjct  56   LRMLHNQAWITISRLQNARGRRQIVRRGIEFDQVDRERNWDDQIILSGILLYLGALYVPG  115

Query  238  LANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLHHDSKVPHPFTAGS  417
              +LP W   G     +LH G  E LYY  HR LH   LY  YH  HH S V  P T+  
Sbjct  116  GQHLPLWRTDGAGLIALLHAGPVEFLYYWFHRALHHHFLYTRYHSHHHSSIVTEPITSVI  175

Query  418  AAFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYSNVEIMPSHLFKTI  597
              F E +   ++  IP +  A  G  SII    Y++  DF+  +G+ N E++PS LF   
Sbjct  176  HPFAELVAYELLFSIPLIACALTGTASIIAFEMYLIYIDFMNNMGHCNFELVPSWLFTWF  235

Query  598  PVLKYLIYSPTYYGLHHMDKRTNFCLFMPLYD  693
            P LKYL+Y+P+++ LHH   RTN+ LFMP YD
Sbjct  236  PPLKYLMYTPSFHSLHHTQFRTNYSLFMPFYD  267



>ref|XP_002265685.2| PREDICTED: protein ECERIFERUM 1-like [Vitis vinifera]
Length=619

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 87/211 (41%), Positives = 119/211 (56%), Gaps = 0/211 (0%)
 Frame = +1

Query  61   RGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPSL  240
            R L +QLW S S         R+  +GI+FEQ+D+E +WD+ +I   I+   AY   P  
Sbjct  57   RMLHNQLWISLSRHRTAKGNNRIVDKGIEFEQVDRERNWDDQIIFNGIIFYIAYFILPGA  116

Query  241  ANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLHHDSKVPHPFTAGSA  420
            +++P W   GVV  ++LH G  E LYY +HR LH   LY  YH  HH S V  P T+   
Sbjct  117  SHMPLWRVDGVVITILLHTGPVEFLYYWLHRALHHHYLYSRYHSHHHSSIVTEPITSVIH  176

Query  421  AFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYSNVEIMPSHLFKTIP  600
             F EH+   ++  IP L   F G   I+  + YI   DF+  +G+ N E++P  LF   P
Sbjct  177  PFAEHIGYFLLFSIPLLTMIFTGTSCIVAFFGYISYIDFMNNMGHCNFELVPKWLFSIFP  236

Query  601  VLKYLIYSPTYYGLHHMDKRTNFCLFMPLYD  693
             LKYL+Y+P+Y+ LHH   RTN+ LFMP YD
Sbjct  237  FLKYLMYTPSYFTLHHTQFRTNYSLFMPFYD  267



>ref|XP_008676840.1| PREDICTED: uncharacterized protein LOC100273712 isoform X1 [Zea 
mays]
 gb|AFW64027.1| hypothetical protein ZEAMMB73_844277 [Zea mays]
Length=667

 Score =   150 bits (380),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 80/208 (38%), Positives = 117/208 (56%), Gaps = 0/208 (0%)
 Frame = +1

Query  76   QLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPSLANLPT  255
            QLW + S         R+  + +DFEQ+D+E +WD+ ++L A+L      + P   ++P 
Sbjct  88   QLWITVSRHQTARSRHRIVNKSLDFEQVDRERNWDDQILLTALLFYAVNAAVPVAQSVPW  147

Query  256  WEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLHHDSKVPHPFTAGSAAFLEH  435
            W+ +G++   +LH+G  E LYY +HR LH   LY  YH  HH S V  P T+    F E 
Sbjct  148  WDSRGLLVAALLHVGPVEFLYYWLHRALHHHYLYARYHSHHHASIVTEPITSVIHPFAEE  207

Query  436  LLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYSNVEIMPSHLFKTIPVLKYL  615
            L+   +  IP L     G  S+ V   Y+   DF+  LG+ N E++P  LF   P LKYL
Sbjct  208  LVYFTLFAIPLLTMVGTGTASVAVANGYLAYIDFMNYLGHCNFELVPRLLFDVFPPLKYL  267

Query  616  IYSPTYYGLHHMDKRTNFCLFMPLYDML  699
            +Y+P+++ LHH   R+N+ LFMPLYD L
Sbjct  268  MYTPSFHSLHHTQFRSNYSLFMPLYDHL  295



>ref|XP_008676841.1| PREDICTED: uncharacterized protein LOC100273712 isoform X2 [Zea 
mays]
 gb|ACN28120.1| unknown [Zea mays]
 gb|AFW64029.1| CER1 [Zea mays]
Length=641

 Score =   150 bits (379),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 80/208 (38%), Positives = 117/208 (56%), Gaps = 0/208 (0%)
 Frame = +1

Query  76   QLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPSLANLPT  255
            QLW + S         R+  + +DFEQ+D+E +WD+ ++L A+L      + P   ++P 
Sbjct  62   QLWITVSRHQTARSRHRIVNKSLDFEQVDRERNWDDQILLTALLFYAVNAAVPVAQSVPW  121

Query  256  WEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLHHDSKVPHPFTAGSAAFLEH  435
            W+ +G++   +LH+G  E LYY +HR LH   LY  YH  HH S V  P T+    F E 
Sbjct  122  WDSRGLLVAALLHVGPVEFLYYWLHRALHHHYLYARYHSHHHASIVTEPITSVIHPFAEE  181

Query  436  LLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYSNVEIMPSHLFKTIPVLKYL  615
            L+   +  IP L     G  S+ V   Y+   DF+  LG+ N E++P  LF   P LKYL
Sbjct  182  LVYFTLFAIPLLTMVGTGTASVAVANGYLAYIDFMNYLGHCNFELVPRLLFDVFPPLKYL  241

Query  616  IYSPTYYGLHHMDKRTNFCLFMPLYDML  699
            +Y+P+++ LHH   R+N+ LFMPLYD L
Sbjct  242  MYTPSFHSLHHTQFRSNYSLFMPLYDHL  269



>ref|XP_008375723.1| PREDICTED: protein ECERIFERUM 1-like [Malus domestica]
Length=623

 Score =   150 bits (379),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 86/211 (41%), Positives = 118/211 (56%), Gaps = 0/211 (0%)
 Frame = +1

Query  61   RGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPSL  240
            R L +QLW S S         R+  +G++FEQ+D+E +WD+ ++   IL        P  
Sbjct  57   RFLHNQLWISLSRYRTAKGNGRIVDKGLEFEQVDRERNWDDQILFNGILFYLGSRHLPGA  116

Query  241  ANLPTWEFKGVVYCLVLHMGFSEPLYYLMHRLLHSSDLYPLYHWLHHDSKVPHPFTAGSA  420
             NLP W   GV+  ++LH G  E LYY +HR LH   LY  YH  HH S V  P T+   
Sbjct  117  TNLPFWRTDGVILTILLHAGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIH  176

Query  421  AFLEHLLLCVIVGIPTLGTAFLGHGSIIVIYSYILAFDFLRCLGYSNVEIMPSHLFKTIP  600
             F EH+   V+  IP L T + G  SI+    Y+   DF+  +G+ N E++P  LF   P
Sbjct  177  PFAEHISYFVLFAIPMLTTIYTGTSSIVSFAGYVTYIDFMNNMGHCNFELIPKWLFTIFP  236

Query  601  VLKYLIYSPTYYGLHHMDKRTNFCLFMPLYD  693
             LKYL+Y+P+ + LHH   RTN+CLFMP+YD
Sbjct  237  PLKYLLYTPSXHSLHHTQFRTNYCLFMPIYD  267



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1193157586335