BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF050N17

Length=668
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010660689.1|  PREDICTED: aspartokinase 2, chloroplastic is...    145   1e-36   Vitis vinifera
ref|XP_002275779.1|  PREDICTED: aspartokinase 2, chloroplastic is...    144   1e-36   Vitis vinifera
ref|XP_006364050.1|  PREDICTED: aspartokinase 2, chloroplastic-li...    132   3e-32   Solanum tuberosum [potatoes]
ref|XP_006364051.1|  PREDICTED: aspartokinase 2, chloroplastic-li...    132   3e-32   Solanum tuberosum [potatoes]
ref|XP_004228743.1|  PREDICTED: aspartokinase 2, chloroplastic-li...    129   5e-31   Solanum lycopersicum
ref|XP_010316459.1|  PREDICTED: aspartokinase 2, chloroplastic-li...    129   5e-31   Solanum lycopersicum
ref|XP_008362087.1|  PREDICTED: aspartokinase 2, chloroplastic-li...    127   1e-30   Malus domestica [apple tree]
ref|XP_008362086.1|  PREDICTED: aspartokinase 2, chloroplastic-li...    127   1e-30   Malus domestica [apple tree]
ref|XP_009781445.1|  PREDICTED: aspartokinase 2, chloroplastic-li...    127   3e-30   Nicotiana sylvestris
ref|XP_009781448.1|  PREDICTED: aspartokinase 2, chloroplastic-li...    127   3e-30   Nicotiana sylvestris
ref|XP_009781447.1|  PREDICTED: aspartokinase 2, chloroplastic-li...    127   3e-30   Nicotiana sylvestris
ref|XP_009781446.1|  PREDICTED: aspartokinase 2, chloroplastic-li...    127   3e-30   Nicotiana sylvestris
ref|XP_009378035.1|  PREDICTED: aspartokinase 2, chloroplastic-li...    125   2e-29   Pyrus x bretschneideri [bai li]
ref|XP_009378037.1|  PREDICTED: aspartokinase 2, chloroplastic-li...    125   2e-29   Pyrus x bretschneideri [bai li]
ref|XP_008231031.1|  PREDICTED: aspartokinase 2, chloroplastic is...    123   7e-29   Prunus mume [ume]
ref|XP_008231032.1|  PREDICTED: aspartokinase 2, chloroplastic is...    122   9e-29   Prunus mume [ume]
ref|XP_009607339.1|  PREDICTED: aspartokinase 2, chloroplastic-li...    122   9e-29   Nicotiana tomentosiformis
ref|XP_009607337.1|  PREDICTED: aspartokinase 2, chloroplastic-li...    122   9e-29   Nicotiana tomentosiformis
ref|XP_007215316.1|  hypothetical protein PRUPE_ppa003561mg             122   9e-29   Prunus persica
ref|XP_009607340.1|  PREDICTED: aspartokinase 2, chloroplastic-li...    122   1e-28   Nicotiana tomentosiformis
ref|XP_009607338.1|  PREDICTED: aspartokinase 2, chloroplastic-li...    122   1e-28   Nicotiana tomentosiformis
ref|XP_011468211.1|  PREDICTED: aspartokinase 2, chloroplastic is...    122   2e-28   Fragaria vesca subsp. vesca
ref|XP_004304561.1|  PREDICTED: aspartokinase 2, chloroplastic is...    122   2e-28   Fragaria vesca subsp. vesca
gb|KHG00746.1|  Aspartokinase 3, chloroplastic -like protein            120   4e-28   Gossypium arboreum [tree cotton]
ref|XP_006468884.1|  PREDICTED: aspartokinase 3, chloroplastic-li...    120   6e-28   Citrus sinensis [apfelsine]
ref|XP_006468885.1|  PREDICTED: aspartokinase 3, chloroplastic-li...    120   6e-28   Citrus sinensis [apfelsine]
ref|XP_008379051.1|  PREDICTED: aspartokinase 2, chloroplastic is...    120   7e-28   
ref|XP_008379050.1|  PREDICTED: aspartokinase 2, chloroplastic is...    120   7e-28   
ref|XP_008379052.1|  PREDICTED: aspartokinase 2, chloroplastic is...    120   7e-28   
gb|KDO43562.1|  hypothetical protein CISIN_1g008621mg                   118   8e-28   Citrus sinensis [apfelsine]
gb|KDO43560.1|  hypothetical protein CISIN_1g008621mg                   119   8e-28   Citrus sinensis [apfelsine]
gb|EYU34829.1|  hypothetical protein MIMGU_mgv1a003795mg                119   1e-27   Erythranthe guttata [common monkey flower]
gb|KDO43561.1|  hypothetical protein CISIN_1g008621mg                   118   1e-27   Citrus sinensis [apfelsine]
ref|XP_008357847.1|  PREDICTED: aspartokinase 2, chloroplastic-like     119   2e-27   
gb|KDO43558.1|  hypothetical protein CISIN_1g008621mg                   118   3e-27   Citrus sinensis [apfelsine]
gb|KDO43559.1|  hypothetical protein CISIN_1g008621mg                   118   3e-27   Citrus sinensis [apfelsine]
ref|XP_006446944.1|  hypothetical protein CICLE_v10014778mg             118   3e-27   Citrus clementina [clementine]
ref|XP_007032011.1|  Aspartate kinase 3 isoform 1                       118   4e-27   
ref|XP_007032013.1|  Aspartate kinase 3 isoform 3                       118   4e-27   
emb|CDP16734.1|  unnamed protein product                                117   7e-27   Coffea canephora [robusta coffee]
ref|XP_002512848.1|  aspartate kinase, putative                         117   1e-26   
ref|XP_011006114.1|  PREDICTED: aspartokinase 2, chloroplastic-li...    115   4e-26   Populus euphratica
ref|XP_011006115.1|  PREDICTED: aspartokinase 2, chloroplastic-li...    115   4e-26   Populus euphratica
ref|XP_011006109.1|  PREDICTED: aspartokinase 2, chloroplastic-li...    115   6e-26   Populus euphratica
ref|XP_011006113.1|  PREDICTED: aspartokinase 2, chloroplastic-li...    115   6e-26   Populus euphratica
ref|XP_002321084.2|  hypothetical protein POPTR_0014s14270g             114   9e-26   Populus trichocarpa [western balsam poplar]
gb|KCW55775.1|  hypothetical protein EUGRSUZ_I01605                     114   1e-25   Eucalyptus grandis [rose gum]
gb|KCW55774.1|  hypothetical protein EUGRSUZ_I01605                     114   1e-25   Eucalyptus grandis [rose gum]
ref|XP_010028950.1|  PREDICTED: aspartokinase 2, chloroplastic-like     114   1e-25   Eucalyptus grandis [rose gum]
ref|XP_006399912.1|  hypothetical protein EUTSA_v10013157mg             114   2e-25   Eutrema salsugineum [saltwater cress]
ref|XP_006399914.1|  hypothetical protein EUTSA_v10013157mg             113   2e-25   
gb|KJB11755.1|  hypothetical protein B456_001G275700                    112   2e-25   Gossypium raimondii
emb|CDY20797.1|  BnaA02g09370D                                          113   3e-25   Brassica napus [oilseed rape]
ref|XP_009127042.1|  PREDICTED: aspartokinase 3, chloroplastic-like     113   4e-25   Brassica rapa
ref|XP_009131382.1|  PREDICTED: aspartokinase 2, chloroplastic          112   4e-25   Brassica rapa
gb|KJB33202.1|  hypothetical protein B456_006G000400                    112   4e-25   Gossypium raimondii
gb|KJB11757.1|  hypothetical protein B456_001G275700                    111   4e-25   Gossypium raimondii
gb|KJB33201.1|  hypothetical protein B456_006G000400                    112   5e-25   Gossypium raimondii
emb|CDX78557.1|  BnaA03g04690D                                          112   5e-25   
gb|KJB33203.1|  hypothetical protein B456_006G000400                    112   6e-25   Gossypium raimondii
ref|XP_009388316.1|  PREDICTED: aspartokinase 2, chloroplastic-like     110   8e-25   
gb|KJB11753.1|  hypothetical protein B456_001G275700                    111   9e-25   Gossypium raimondii
ref|XP_006286781.1|  hypothetical protein CARUB_v10003334mg             111   9e-25   Capsella rubella
gb|KJB11752.1|  hypothetical protein B456_001G275700                    111   9e-25   Gossypium raimondii
ref|XP_011097259.1|  PREDICTED: aspartokinase 2, chloroplastic is...    111   1e-24   Sesamum indicum [beniseed]
ref|XP_011097258.1|  PREDICTED: aspartokinase 2, chloroplastic is...    111   1e-24   Sesamum indicum [beniseed]
emb|CDX70538.1|  BnaC03g06220D                                          111   1e-24   
emb|CDY06621.1|  BnaC02g13450D                                          111   1e-24   
ref|XP_010096037.1|  Aspartokinase 3                                    110   2e-24   
ref|XP_010492197.1|  PREDICTED: aspartokinase 2, chloroplastic-like     110   2e-24   Camelina sativa [gold-of-pleasure]
gb|KHG14818.1|  Aspartokinase 3, chloroplastic -like protein            110   3e-24   Gossypium arboreum [tree cotton]
ref|XP_008369639.1|  PREDICTED: aspartokinase 1, chloroplastic          109   5e-24   
ref|XP_010453516.1|  PREDICTED: aspartokinase 2, chloroplastic          109   6e-24   Camelina sativa [gold-of-pleasure]
ref|XP_011024774.1|  PREDICTED: aspartokinase 2, chloroplastic is...    109   7e-24   Populus euphratica
ref|XP_011024777.1|  PREDICTED: aspartokinase 3, chloroplastic is...    109   8e-24   Populus euphratica
dbj|BAE98441.1|  lysine-sensitive aspartate kinase                      107   9e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010420027.1|  PREDICTED: aspartokinase 2, chloroplastic-like     108   1e-23   Camelina sativa [gold-of-pleasure]
ref|XP_002301756.2|  hypothetical protein POPTR_0002s23800g             108   1e-23   
gb|KHN00622.1|  Aspartokinase 2, chloroplastic                          103   1e-23   Glycine soja [wild soybean]
ref|XP_004169933.1|  PREDICTED: aspartokinase 3, chloroplastic-like     104   2e-23   
ref|XP_010911752.1|  PREDICTED: aspartokinase 1, chloroplastic-like     103   3e-23   Elaeis guineensis
ref|NP_196910.1|  aspartokinase 2                                       107   4e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009359889.1|  PREDICTED: aspartokinase 1, chloroplastic-like     107   5e-23   Pyrus x bretschneideri [bai li]
ref|XP_009411806.1|  PREDICTED: aspartokinase 2, chloroplastic-like     107   5e-23   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHM99220.1|  Aspartokinase 1, chloroplastic                          106   9e-23   Glycine soja [wild soybean]
ref|XP_009388366.1|  PREDICTED: aspartokinase 1, chloroplastic-like     102   1e-22   
ref|XP_010656844.1|  PREDICTED: aspartokinase 1, chloroplastic is...    105   1e-22   Vitis vinifera
ref|XP_010492075.1|  PREDICTED: aspartokinase 1, chloroplastic-like     105   1e-22   Camelina sativa [gold-of-pleasure]
ref|XP_010656841.1|  PREDICTED: aspartokinase 1, chloroplastic is...    105   2e-22   Vitis vinifera
ref|XP_002882151.1|  hypothetical protein ARALYDRAFT_896038             104   3e-22   Arabidopsis lyrata subsp. lyrata
gb|EPS64336.1|  hypothetical protein M569_10444                         103   4e-22   Genlisea aurea
ref|XP_002871599.1|  lysine-sensitive aspartate kinase                  104   4e-22   
ref|XP_003553303.1|  PREDICTED: aspartokinase 1, chloroplastic-li...    103   5e-22   Glycine max [soybeans]
ref|XP_006408563.1|  hypothetical protein EUTSA_v10020441mg             103   5e-22   
ref|XP_006408564.1|  hypothetical protein EUTSA_v10020441mg             103   5e-22   Eutrema salsugineum [saltwater cress]
ref|XP_006604189.1|  PREDICTED: aspartokinase 1, chloroplastic-li...    103   6e-22   
emb|CAC06395.1|  aspartate kinase                                       103   7e-22   Arabidopsis thaliana [mouse-ear cress]
gb|AAB63104.1|  lysine-sensitive aspartate kinase                       103   7e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010250548.1|  PREDICTED: aspartokinase 2, chloroplastic-li...    103   8e-22   Nelumbo nucifera [Indian lotus]
ref|XP_010250546.1|  PREDICTED: aspartokinase 2, chloroplastic-li...    103   9e-22   Nelumbo nucifera [Indian lotus]
ref|NP_001238151.1|  precursor monofunctional aspartokinase             103   9e-22   
gb|KGN51126.1|  hypothetical protein Csa_5G457770                       103   1e-21   Cucumis sativus [cucumbers]
ref|XP_006574471.1|  PREDICTED: precursor monofunctional aspartok...    102   1e-21   
ref|XP_008776937.1|  PREDICTED: aspartokinase 2, chloroplastic-li...    102   1e-21   Phoenix dactylifera
ref|XP_006574470.1|  PREDICTED: precursor monofunctional aspartok...    102   1e-21   Glycine max [soybeans]
ref|XP_010926857.1|  PREDICTED: aspartokinase 2, chloroplastic is...    101   3e-21   
emb|CDX69652.1|  BnaA10g20010D                                          101   3e-21   
ref|XP_007151724.1|  hypothetical protein PHAVU_004G070100g             101   3e-21   Phaseolus vulgaris [French bean]
ref|XP_007151723.1|  hypothetical protein PHAVU_004G070100g             101   3e-21   Phaseolus vulgaris [French bean]
ref|XP_009121776.1|  PREDICTED: aspartokinase 1, chloroplastic          101   3e-21   Brassica rapa
gb|KFK25564.1|  hypothetical protein AALP_AA8G131200                    101   4e-21   Arabis alpina [alpine rockcress]
ref|XP_008790700.1|  PREDICTED: aspartokinase 2, chloroplastic-like     101   4e-21   Phoenix dactylifera
ref|XP_010926856.1|  PREDICTED: aspartokinase 2, chloroplastic is...    101   5e-21   Elaeis guineensis
ref|XP_008222377.1|  PREDICTED: aspartokinase 1, chloroplastic          101   5e-21   Prunus mume [ume]
ref|NP_186851.1|  aspartokinase 3                                       100   7e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008465552.1|  PREDICTED: aspartokinase 2, chloroplastic-li...    100   7e-21   Cucumis melo [Oriental melon]
ref|XP_008465546.1|  PREDICTED: aspartokinase 2, chloroplastic-li...    100   7e-21   Cucumis melo [Oriental melon]
ref|XP_008465539.1|  PREDICTED: aspartokinase 2, chloroplastic-li...    100   7e-21   Cucumis melo [Oriental melon]
ref|XP_010496416.1|  PREDICTED: aspartokinase 3, chloroplastic          100   7e-21   Camelina sativa [gold-of-pleasure]
ref|XP_003548032.1|  PREDICTED: aspartokinase 1, chloroplastic-li...    100   8e-21   
ref|XP_006599412.1|  PREDICTED: aspartokinase 1, chloroplastic-li...    100   8e-21   Glycine max [soybeans]
gb|KHN13387.1|  Aspartokinase 1, chloroplastic                          100   8e-21   Glycine soja [wild soybean]
ref|XP_010530884.1|  PREDICTED: aspartokinase 1, chloroplastic-like     100   1e-20   Tarenaya hassleriana [spider flower]
ref|XP_010453390.1|  PREDICTED: aspartokinase 1, chloroplastic          100   1e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010419903.1|  PREDICTED: aspartokinase 1, chloroplastic-like     100   1e-20   Camelina sativa [gold-of-pleasure]
ref|XP_002871558.1|  AK-LYS1                                          99.4    2e-20   Arabidopsis lyrata subsp. lyrata
ref|XP_004515405.1|  PREDICTED: aspartokinase 1, chloroplastic-li...  99.4    2e-20   Cicer arietinum [garbanzo]
emb|CDX91135.1|  BnaC02g04620D                                        99.4    2e-20   
emb|CDY09781.1|  BnaC09g43800D                                        99.4    2e-20   Brassica napus [oilseed rape]
ref|XP_004515404.1|  PREDICTED: aspartokinase 1, chloroplastic-li...  99.4    2e-20   Cicer arietinum [garbanzo]
ref|XP_009125901.1|  PREDICTED: aspartokinase 1, chloroplastic-like   99.4    2e-20   Brassica rapa
emb|CDX85659.1|  BnaA02g01540D                                        99.4    2e-20   
ref|XP_006300280.1|  hypothetical protein CARUB_v100158421mg          96.7    4e-20   
ref|XP_006399820.1|  hypothetical protein EUTSA_v10013112mg           99.0    4e-20   Eutrema salsugineum [saltwater cress]
ref|XP_002459732.1|  hypothetical protein SORBIDRAFT_02g009570        97.4    5e-20   
gb|ABK24292.1|  unknown                                               98.2    5e-20   Picea sitchensis
gb|AAO37952.1|  putative aspartate kinase                             94.7    6e-20   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006652023.1|  PREDICTED: aspartokinase 1, chloroplastic-like   98.2    6e-20   Oryza brachyantha
pdb|2CDQ|A  Chain A, Crystal Structure Of Arabidopsis Thaliana As...  97.8    6e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007223118.1|  hypothetical protein PRUPE_ppa003770mg           97.4    1e-19   
ref|XP_002466095.1|  hypothetical protein SORBIDRAFT_01g001140        97.4    1e-19   Sorghum bicolor [broomcorn]
emb|CAA67376.1|  aspartate kinase                                     97.4    1e-19   Arabidopsis thaliana [mouse-ear cress]
ref|NP_196832.1|  aspartokinase 1                                     97.4    1e-19   Arabidopsis thaliana [mouse-ear cress]
dbj|BAC84902.1|  putative precursor monofunctional aspartokinase      97.4    1e-19   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001059423.1|  Os07g0300900                                     97.4    1e-19   
ref|XP_006844541.1|  hypothetical protein AMTR_s00016p00169310        96.3    1e-19   
ref|XP_004956005.1|  PREDICTED: aspartokinase 2, chloroplastic-like   97.1    2e-19   Setaria italica
ref|XP_010435684.1|  PREDICTED: aspartokinase 3, chloroplastic-like   96.7    2e-19   Camelina sativa [gold-of-pleasure]
gb|EEE58127.1|  hypothetical protein OsJ_09026                        97.1    2e-19   Oryza sativa Japonica Group [Japonica rice]
gb|EEC74320.1|  hypothetical protein OsI_09598                        96.7    2e-19   Oryza sativa Indica Group [Indian rice]
ref|XP_004981039.1|  PREDICTED: aspartokinase 1, chloroplastic-like   96.7    2e-19   Setaria italica
gb|ABQ28733.1|  monofunctional aspartate kinase 2                     95.9    3e-19   Zea mays [maize]
ref|XP_006657643.1|  PREDICTED: aspartokinase 1, chloroplastic-like   96.3    3e-19   Oryza brachyantha
ref|XP_008669985.1|  PREDICTED: aspartokinase 2, chloroplastic        96.3    3e-19   
ref|XP_011086875.1|  PREDICTED: aspartokinase 2, chloroplastic        95.9    3e-19   Sesamum indicum [beniseed]
gb|ABF99918.1|  aspartate kinase family protein, expressed            95.5    4e-19   Oryza sativa Japonica Group [Japonica rice]
gb|EMT07729.1|  Aspartokinase 1, chloroplastic                        89.4    4e-19   
ref|NP_001051906.1|  Os03g0850400                                     95.5    4e-19   
gb|EEC76545.1|  hypothetical protein OsI_14341                        95.5    5e-19   Oryza sativa Indica Group [Indian rice]
gb|AAO20063.1|  putative aspartate kinase                             95.5    5e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006287431.1|  hypothetical protein CARUB_v10000635mg           95.1    6e-19   
ref|XP_010100040.1|  Aspartokinase 1                                  94.7    1e-18   
ref|XP_001773420.1|  predicted protein                                94.4    1e-18   
ref|XP_003562409.1|  PREDICTED: aspartokinase 1, chloroplastic is...  94.4    1e-18   Brachypodium distachyon [annual false brome]
ref|XP_010234251.1|  PREDICTED: aspartokinase 1, chloroplastic is...  94.4    1e-18   
ref|XP_001780779.1|  predicted protein                                94.0    1e-18   
gb|EEC76544.1|  hypothetical protein OsI_14340                        91.7    2e-18   Oryza sativa Indica Group [Indian rice]
gb|EMT10312.1|  Aspartokinase 1, chloroplastic                        94.4    2e-18   
ref|XP_007043813.1|  Aspartate kinase 1                               93.6    2e-18   
ref|XP_004310242.1|  PREDICTED: aspartokinase 1, chloroplastic        93.2    3e-18   Fragaria vesca subsp. vesca
gb|KEH25642.1|  monofunctional aspartokinase                          92.8    3e-18   Medicago truncatula
gb|KEH25640.1|  monofunctional aspartokinase                          92.8    4e-18   Medicago truncatula
gb|KEH25641.1|  monofunctional aspartokinase                          92.8    4e-18   Medicago truncatula
ref|XP_010682653.1|  PREDICTED: aspartokinase 1, chloroplastic is...  92.4    5e-18   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010682652.1|  PREDICTED: aspartokinase 1, chloroplastic is...  92.4    5e-18   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001288496.1|  uncharacterized protein LOC103644325             91.3    1e-17   Zea mays [maize]
gb|ABO09875.1|  monofunctional aspartate kinase 1                     91.3    1e-17   Zea mays [maize]
emb|CBI21283.3|  unnamed protein product                              89.4    5e-17   Vitis vinifera
gb|ABN05951.1|  Aspartate kinase region                               84.7    7e-17   Medicago truncatula
tpg|DAA56009.1|  TPA: hypothetical protein ZEAMMB73_791722            85.9    9e-17   
gb|KDP41849.1|  hypothetical protein JCGZ_26867                       87.4    2e-16   Jatropha curcas
tpg|DAA56005.1|  TPA: hypothetical protein ZEAMMB73_791722            85.5    2e-16   
ref|XP_002459021.1|  hypothetical protein SORBIDRAFT_03g044650        87.8    2e-16   Sorghum bicolor [broomcorn]
gb|AES80708.2|  monofunctional aspartokinase                          87.8    2e-16   Medicago truncatula
ref|XP_003624490.1|  Aspartokinase                                    87.8    2e-16   
tpg|DAA56010.1|  TPA: hypothetical protein ZEAMMB73_791722            82.8    3e-16   
tpg|DAA56007.1|  TPA: hypothetical protein ZEAMMB73_791722            85.5    6e-16   
tpg|DAA56008.1|  TPA: hypothetical protein ZEAMMB73_791722            85.9    6e-16   
ref|XP_004971149.1|  PREDICTED: aspartokinase 1, chloroplastic-like   86.3    8e-16   Setaria italica
emb|CBI35668.3|  unnamed protein product                              85.1    1e-15   Vitis vinifera
ref|XP_007515683.1|  aspartate kinase                                 85.5    1e-15   Bathycoccus prasinos
gb|EEE55936.1|  hypothetical protein OsJ_04629                        85.5    1e-15   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001045271.1|  Os01g0927900                                     85.1    2e-15   
ref|XP_006646639.1|  PREDICTED: aspartokinase 1, chloroplastic-like   85.1    2e-15   Oryza brachyantha
gb|EEC72085.1|  hypothetical protein OsI_05030                        85.1    2e-15   Oryza sativa Indica Group [Indian rice]
ref|XP_008681044.1|  PREDICTED: uncharacterized protein LOC100192...  80.9    3e-15   
ref|XP_003059042.1|  predicted protein                                84.7    3e-15   Micromonas pusilla CCMP1545
ref|NP_001130977.1|  uncharacterized protein LOC100192082             80.5    3e-15   
ref|XP_004143759.1|  PREDICTED: aspartokinase 2, chloroplastic-like   84.0    3e-15   
dbj|BAJ99203.1|  predicted protein                                    81.6    3e-14   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDM85877.1|  unnamed protein product                              81.3    3e-14   Triticum aestivum [Canadian hard winter wheat]
gb|EMS47783.1|  Aspartokinase 1, chloroplastic                        81.3    3e-14   Triticum urartu
ref|XP_002467671.1|  hypothetical protein SORBIDRAFT_01g032000        76.6    4e-14   
ref|XP_001415789.1|  predicted protein                                80.5    5e-14   Ostreococcus lucimarinus CCE9901
gb|EYU28463.1|  hypothetical protein MIMGU_mgv1a005583mg              79.7    7e-14   Erythranthe guttata [common monkey flower]
ref|XP_003564987.1|  PREDICTED: aspartokinase 2, chloroplastic-like   79.3    2e-13   Brachypodium distachyon [annual false brome]
ref|XP_003074218.1|  putative precursor monofunctional aspartokin...  76.6    7e-13   
ref|XP_002992028.1|  hypothetical protein SELMODRAFT_162121           76.6    7e-13   
ref|XP_002964498.1|  hypothetical protein SELMODRAFT_142417           76.6    8e-13   
emb|CEF96568.1|  Aspartate kinase, conserved site                     77.0    8e-13   Ostreococcus tauri
ref|XP_002507216.1|  predicted protein                                76.3    1e-12   Micromonas commoda
ref|XP_005650639.1|  aspartate kinase                                 72.8    2e-11   Coccomyxa subellipsoidea C-169
ref|XP_011399436.1|  Aspartokinase 1, chloroplastic                   71.6    4e-11   Auxenochlorella protothecoides
ref|XP_002947347.1|  hypothetical protein VOLCADRAFT_87637            70.9    9e-11   Volvox carteri f. nagariensis
ref|NP_001146140.1|  uncharacterized protein LOC100279708             65.9    1e-10   
ref|XP_005846857.1|  hypothetical protein CHLNCDRAFT_134660           68.9    3e-10   Chlorella variabilis
ref|XP_001698576.1|  aspartate kinase                                 68.6    5e-10   Chlamydomonas reinhardtii
gb|EMS63387.1|  Aspartokinase 1, chloroplastic                        67.4    1e-09   Triticum urartu
ref|WP_016525852.1|  aspartate kinase                                 66.2    2e-09   Treponema maltophilum
ref|WP_013758817.1|  aspartate kinase                                 65.1    5e-09   Treponema brennaborense
gb|KIY94042.1|  aspartate kinase                                      60.5    7e-09   Monoraphidium neglectum
ref|WP_004266577.1|  aspartate kinase                                 64.7    7e-09   Treponema saccharophilum
ref|WP_015707281.1|  aspartate kinase                                 63.9    1e-08   Treponema primitia
ref|WP_013702193.1|  aspartate kinase                                 63.2    2e-08   Treponema succinifaciens
gb|ERF61453.1|  amino acid kinase family protein                      63.2    3e-08   Treponema socranskii subsp. socranskii VPI DR56BR1116 = ATCC 35536
ref|WP_038080481.1|  aspartate kinase                                 62.8    3e-08   Treponema socranskii
ref|WP_016521831.1|  aspartate kinase                                 62.8    3e-08   
ref|WP_009104632.1|  aspartate kinase                                 62.8    3e-08   Treponema sp. JC4
ref|WP_022933427.1|  aspartate kinase                                 62.8    4e-08   Treponema bryantii
ref|WP_041908852.1|  hypothetical protein                             61.2    1e-07   
ref|WP_015710697.1|  aspartate kinase                                 61.2    1e-07   Treponema azotonutricium
ref|WP_027728545.1|  aspartate kinase                                 61.2    1e-07   Treponema sp. C6A8
ref|WP_013968408.1|  aspartate kinase                                 61.2    1e-07   Treponema caldarium
ref|XP_005534774.1|  aspartate kinase                                 60.5    2e-07   Cyanidioschyzon merolae strain 10D
ref|WP_010253784.1|  aspartate kinase                                 59.3    5e-07   Treponema primitia
gb|KJB11756.1|  hypothetical protein B456_001G275700                  58.5    9e-07   Gossypium raimondii
ref|WP_044013184.1|  aspartate kinase                                 58.5    9e-07   Hymenobacter sp. APR13
ref|WP_044187981.1|  aspartate kinase                                 58.2    1e-06   Porphyromonas sp. COT-290 OH860
ref|WP_018627512.1|  aspartate kinase                                 57.8    1e-06   Niabella aurantiaca
gb|EWM28259.1|  aspartate kinase                                      57.4    2e-06   Nannochloropsis gaditana
ref|WP_012790709.1|  aspartate kinase                                 56.6    4e-06   Chitinophaga pinensis
ref|WP_033369986.1|  aspartate kinase                                 56.6    4e-06   
ref|WP_029465923.1|  aspartate kinase                                 56.2    4e-06   
ref|WP_010664472.1|  aspartate kinase                                 55.8    7e-06   Marinilabilia salmonicolor
ref|WP_044125142.1|  aspartate kinase                                 55.8    7e-06   Porphyromonas sp. oral taxon 278
ref|WP_044001665.1|  aspartate kinase                                 55.5    1e-05   Hymenobacter swuensis
gb|KIG14159.1|  Aspartokinase                                         55.1    1e-05   Enhygromyxa salina
ref|WP_044231439.1|  aspartate kinase                                 54.7    2e-05   Porphyromonas sp. COT-290 OH3588
ref|WP_044114203.1|  aspartate kinase                                 54.7    2e-05   Porphyromonas sp. KLE 1280
ref|WP_044123858.1|  aspartate kinase                                 54.7    2e-05   Porphyromonas sp. oral taxon 279
emb|CBJ32322.1|  aspartate kinase                                     54.7    2e-05   Ectocarpus siliculosus
ref|XP_005713499.1|  unnamed protein product                          54.7    2e-05   Chondrus crispus [carageen]
ref|WP_013454968.1|  aspartate kinase                                 54.3    2e-05   Marivirga tractuosa
ref|WP_041291715.1|  aspartate kinase                                 54.3    2e-05   
ref|WP_037562472.1|  hypothetical protein                             54.3    2e-05   
gb|ERJ72961.1|  amino acid kinase family protein                      54.3    2e-05   Porphyromonas sp. oral taxon 278 str. W7784
gb|ACV07512.1|  aspartate kinase                                      54.3    3e-05   Kytococcus sedentarius DSM 20547
ref|XP_009035261.1|  hypothetical protein AURANDRAFT_52842            53.9    3e-05   Aureococcus anophagefferens
ref|WP_026852399.1|  aspartate kinase                                 53.9    3e-05   Geothrix fermentans
ref|WP_031497328.1|  aspartate kinase                                 53.5    4e-05   Bryobacter aggregatus
ref|WP_036878720.1|  aspartate kinase                                 53.5    4e-05   Porphyromonas sp. COT-239 OH1446
ref|WP_012874795.1|  aspartate kinase                                 53.1    5e-05   Thermobaculum terrenum
ref|WP_008664880.1|  aspartate kinase                                 52.4    6e-05   
gb|KDU79373.1|  amino acid kinase family protein                      53.1    6e-05   Porphyromonas sp. KLE 1280
gb|EJU17853.1|  amino acid kinase family protein                      53.1    6e-05   Porphyromonas sp. oral taxon 279 str. F0450
ref|WP_026260295.1|  aspartate kinase                                 52.8    6e-05   
ref|WP_022455947.1|  aspartokinase                                    52.8    7e-05   
ref|WP_026474688.1|  aspartate kinase                                 52.8    7e-05   Alkaliflexus imshenetskii
ref|WP_024996122.1|  aspartate kinase                                 52.8    7e-05   Bacteroides graminisolvens
ref|WP_005930909.1|  MULTISPECIES: aspartate kinase                   52.8    7e-05   Bacteroides salyersiae
ref|WP_002561502.1|  MULTISPECIES: aspartate kinase                   52.8    7e-05   Bacteroides
gb|EKD81471.1|  hypothetical protein ACD_39C01793G0002                52.8    7e-05   uncultured bacterium
ref|WP_019208829.1|  aspartate kinase                                 52.8    8e-05   Phocaeicola abscessus
gb|KIC72414.1|  Aspartokinase 2                                       52.4    9e-05   Candidatus Protochlamydia amoebophila
ref|WP_019949086.1|  hypothetical protein                             52.4    9e-05   Hymenobacter aerophilus
ref|WP_013768493.1|  aspartate kinase                                 52.4    1e-04   Haliscomenobacter hydrossis
ref|WP_044640796.1|  aspartate kinase                                 52.4    1e-04   Risungbinella massiliensis
ref|XP_005707902.1|  aspartate kinase                                 52.4    1e-04   Galdieria sulphuraria
ref|WP_036875115.1|  aspartate kinase                                 52.4    1e-04   Prevotella nigrescens
ref|WP_028976833.1|  aspartate kinase                                 52.0    1e-04   
emb|CAF23489.1|  probable aspartate kinase II precursor               52.0    1e-04   
gb|EGQ18175.1|  aspartate kinase                                      49.3    1e-04   
ref|WP_025497901.1|  hypothetical protein                             51.6    1e-04   
ref|WP_044169330.1|  aspartate kinase                                 52.0    1e-04   
gb|KDD72939.1|  amino acid kinase                                     52.0    1e-04   
ref|WP_042372408.1|  aspartate kinase                                 52.0    1e-04   
ref|WP_005788816.1|  MULTISPECIES: aspartate kinase                   52.0    2e-04   
ref|WP_029548259.1|  aspartate kinase                                 52.0    2e-04   
ref|WP_004289964.1|  MULTISPECIES: aspartate kinase                   52.0    2e-04   
ref|WP_016274338.1|  aspartate kinase                                 52.0    2e-04   
ref|WP_009124181.1|  aspartate kinase                                 52.0    2e-04   
ref|WP_022163052.1|  aspartokinase                                    52.0    2e-04   
ref|WP_005807007.1|  MULTISPECIES: aspartate kinase                   52.0    2e-04   
ref|WP_005780056.1|  aspartate kinase                                 52.0    2e-04   
ref|WP_005831418.1|  MULTISPECIES: aspartate kinase                   52.0    2e-04   
ref|WP_022384596.1|  aspartokinase                                    51.6    2e-04   
ref|WP_022019939.1|  aspartokinase                                    51.6    2e-04   
ref|WP_027325746.1|  aspartate kinase                                 51.6    2e-04   
ref|WP_032946041.1|  aspartate kinase                                 51.6    2e-04   
ref|WP_034543630.1|  aspartate kinase                                 51.6    2e-04   
ref|WP_021646265.1|  amino acid kinase family protein                 51.6    2e-04   
ref|WP_005939113.1|  MULTISPECIES: aspartate kinase                   51.6    2e-04   
ref|WP_007854227.1|  aspartate kinase                                 51.6    2e-04   
ref|WP_005841213.1|  MULTISPECIES: aspartate kinase                   51.6    2e-04   
ref|WP_016277830.1|  MULTISPECIES: aspartate kinase                   51.6    2e-04   
ref|WP_028786250.1|  aspartate kinase                                 51.6    2e-04   
ref|WP_025076188.1|  aspartate kinase                                 51.6    2e-04   
ref|WP_009000030.1|  aspartate kinase                                 51.6    2e-04   
ref|WP_004304027.1|  MULTISPECIES: aspartate kinase                   51.6    2e-04   
ref|WP_044165132.1|  aspartate kinase                                 51.6    2e-04   
ref|WP_044653154.1|  aspartate kinase                                 51.6    2e-04   
ref|WP_007748065.1|  aspartate kinase                                 51.6    2e-04   
ref|WP_007766339.1|  aspartate kinase                                 51.6    2e-04   
ref|WP_005678111.1|  MULTISPECIES: aspartate kinase                   51.6    2e-04   
ref|WP_008025480.1|  aspartate kinase                                 51.6    2e-04   
ref|WP_004297043.1|  aspartate kinase                                 51.6    2e-04   
ref|WP_039383914.1|  aspartate kinase                                 50.8    2e-04   
ref|WP_008762401.1|  aspartate kinase                                 51.6    2e-04   
ref|WP_004313659.1|  MULTISPECIES: aspartate kinase                   51.6    2e-04   
emb|CDA83684.1|  aspartokinase                                        51.6    2e-04   
ref|WP_010538616.1|  MULTISPECIES: aspartate kinase                   51.6    2e-04   
ref|WP_008764912.1|  MULTISPECIES: aspartate kinase                   51.6    2e-04   
ref|WP_020889007.1|  Aspartokinase                                    51.6    2e-04   
ref|WP_006976980.1|  aspartate kinase                                 51.6    2e-04   
ref|WP_031263545.1|  aspartate kinase                                 51.6    2e-04   
ref|WP_028726162.1|  aspartate kinase                                 51.2    2e-04   
ref|WP_010528812.1|  aspartate kinase                                 51.2    2e-04   
ref|WP_035444770.1|  aspartate kinase                                 51.2    3e-04   
ref|WP_004366096.1|  aspartate kinase                                 51.2    3e-04   
ref|WP_039357716.1|  aspartate kinase                                 50.8    3e-04   
ref|WP_027473068.1|  aspartate kinase                                 51.2    3e-04   
ref|WP_042243520.1|  aspartate kinase                                 50.8    3e-04   
ref|WP_041627508.1|  aspartate kinase                                 51.2    3e-04   
dbj|BAB19799.1|  aspartate kinase-homoserine dehydrogenase [          50.8    3e-04   
gb|KIC76756.1|  Aspartokinase 2                                       50.4    3e-04   
gb|AEV32646.1|  aspartate kinase                                      50.8    3e-04   
ref|WP_006744371.1|  aspartate kinase                                 50.8    3e-04   
ref|WP_024821264.1|  aspartate kinase                                 50.8    3e-04   
ref|WP_036851747.1|  aspartate kinase                                 50.8    3e-04   
ref|WP_025004256.1|  aspartate kinase                                 50.8    3e-04   
ref|WP_005640795.1|  aspartate kinase                                 50.8    3e-04   
gb|KIC72869.1|  Aspartokinase 2                                       50.4    3e-04   
ref|WP_022322412.1|  aspartokinase                                    50.8    3e-04   
ref|WP_036872970.1|  aspartate kinase                                 50.8    3e-04   
ref|WP_044044888.1|  aspartate kinase                                 50.4    3e-04   
ref|WP_025079653.1|  aspartate kinase                                 50.8    3e-04   
ref|WP_039745565.1|  aspartate kinase                                 50.8    4e-04   
ref|WP_002994788.1|  aspartate kinase                                 50.4    4e-04   
gb|ELX68357.1|  aspartate kinase                                      50.4    4e-04   
ref|WP_042102507.1|  aspartate kinase                                 50.1    4e-04   
ref|WP_044234308.1|  aspartate kinase                                 50.4    4e-04   
ref|WP_021684122.1|  putative aspartate kinase, monofunctional class  50.4    5e-04   
ref|WP_014710013.1|  aspartate kinase                                 50.4    5e-04   
ref|WP_028904654.1|  aspartate kinase                                 50.4    5e-04   
ref|WP_013616984.1|  aspartate kinase                                 50.4    5e-04   
ref|XP_005786070.1|  hypothetical protein EMIHUDRAFT_71644            50.4    5e-04   
ref|WP_022054382.1|  aspartokinase                                    50.4    5e-04   
ref|WP_008141737.1|  MULTISPECIES: aspartate kinase                   50.4    5e-04   
ref|WP_022040193.1|  aspartokinase                                    50.4    5e-04   
ref|XP_005773177.1|  hypothetical protein EMIHUDRAFT_75153            50.4    5e-04   
ref|WP_018710347.1|  MULTISPECIES: aspartate kinase                   50.4    5e-04   
ref|WP_007561801.1|  aspartate kinase                                 50.4    5e-04   
ref|WP_022129463.1|  aspartokinase                                    50.4    5e-04   
ref|WP_021971993.1|  aspartokinase                                    50.4    5e-04   
ref|WP_007566617.1|  aspartate kinase                                 50.1    5e-04   
ref|WP_022232574.1|  aspartokinase                                    50.1    5e-04   
ref|WP_022126397.1|  aspartokinase                                    50.1    6e-04   
ref|WP_022104540.1|  aspartokinase                                    50.1    6e-04   
ref|WP_005652628.1|  aspartate kinase                                 50.1    6e-04   
ref|WP_009121600.1|  aspartate kinase                                 50.1    6e-04   
ref|WP_003006083.1|  aspartate kinase                                 50.1    6e-04   
ref|WP_005037511.1|  aspartate kinase                                 50.1    6e-04   
ref|WP_016709538.1|  aspartate kinase                                 50.4    6e-04   
ref|WP_013547450.1|  aspartate kinase                                 50.1    6e-04   
ref|WP_024999615.1|  aspartate kinase                                 50.1    7e-04   
ref|WP_009316931.1|  MULTISPECIES: aspartate kinase                   50.1    7e-04   
ref|WP_044514329.1|  aspartate kinase                                 50.1    7e-04   
emb|CDR30973.1|  Aspartate kinase, monofunctional class               49.7    7e-04   
ref|WP_009018138.1|  aspartate kinase                                 49.7    7e-04   
ref|WP_015529118.1|  aspartate kinase, monofunctional class [         49.7    7e-04   
ref|WP_005854548.1|  MULTISPECIES: aspartate kinase                   49.7    7e-04   
ref|WP_018479093.1|  aspartate kinase                                 49.7    8e-04   
gb|EST13512.1|  aspartate kinase                                      49.7    8e-04   
ref|WP_005864474.1|  MULTISPECIES: aspartate kinase                   49.7    8e-04   
emb|CDC15911.1|  aspartokinase                                        49.7    8e-04   
ref|WP_025069392.1|  aspartate kinase                                 49.7    8e-04   
ref|WP_020249160.1|  hypothetical protein                             49.7    8e-04   
ref|WP_022353823.1|  aspartokinase                                    49.7    9e-04   
ref|WP_044610639.1|  aspartate kinase                                 48.1    9e-04   
ref|WP_016193592.1|  Aspartokinase                                    49.7    9e-04   
ref|WP_026763767.1|  aspartate kinase                                 49.7    9e-04   
ref|WP_039139226.1|  aspartate kinase                                 49.7    9e-04   
ref|WP_024594433.1|  aspartate kinase                                 49.7    0.001   
gb|ETR65688.1|  Aspartokinase                                         48.1    0.001   
ref|WP_032125700.1|  aspartate kinase                                 49.3    0.001   
ref|WP_024589893.1|  MULTISPECIES: aspartate kinase                   49.7    0.001   



>ref|XP_010660689.1| PREDICTED: aspartokinase 2, chloroplastic isoform X1 [Vitis vinifera]
Length=569

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 80/138 (58%), Positives = 94/138 (68%), Gaps = 5/138 (4%)
 Frame = +3

Query  264  METLMHLRGTTPYPYFPKECKASLHFRPLWSQTIDLR-HVYG---VCTSIKGSSRSRVLR  431
            M   +HL G T  P      + SLH +PLWSQ +D    V G   +C S+K SSR  VLR
Sbjct  1    MAGALHLCGVTT-PNCAVSSRRSLHCQPLWSQRVDFTLSVAGGSRLCRSVKDSSRKNVLR  59

Query  432  VSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREVADLILSFPEEKP  611
            V C   +ID+++ S T+N   DGV  + T  MKFGGSSVASA+RMREVADLILSFP E+P
Sbjct  60   VCCSGGSIDVLEKSKTENQTTDGVTEQLTIAMKFGGSSVASAERMREVADLILSFPNERP  119

Query  612  VIVLSAMGKTTNNLLLAG  665
            VIVLSAMGKTTN LLLAG
Sbjct  120  VIVLSAMGKTTNKLLLAG  137



>ref|XP_002275779.1| PREDICTED: aspartokinase 2, chloroplastic isoform X2 [Vitis vinifera]
Length=567

 Score =   144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 80/138 (58%), Positives = 94/138 (68%), Gaps = 5/138 (4%)
 Frame = +3

Query  264  METLMHLRGTTPYPYFPKECKASLHFRPLWSQTIDLR-HVYG---VCTSIKGSSRSRVLR  431
            M   +HL G T  P      + SLH +PLWSQ +D    V G   +C S+K SSR  VLR
Sbjct  1    MAGALHLCGVTT-PNCAVSSRRSLHCQPLWSQRVDFTLSVAGGSRLCRSVKDSSRKNVLR  59

Query  432  VSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREVADLILSFPEEKP  611
            V C   +ID+++ S T+N   DGV  + T  MKFGGSSVASA+RMREVADLILSFP E+P
Sbjct  60   VCCSGGSIDVLEKSKTENQTTDGVTEQLTIAMKFGGSSVASAERMREVADLILSFPNERP  119

Query  612  VIVLSAMGKTTNNLLLAG  665
            VIVLSAMGKTTN LLLAG
Sbjct  120  VIVLSAMGKTTNKLLLAG  137



>ref|XP_006364050.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X1 [Solanum 
tuberosum]
Length=569

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 88/135 (65%), Gaps = 6/135 (4%)
 Frame = +3

Query  264  METLMHLRGT-TPYPYFPKECKASLHFRPLWSQTIDLRHVYGVCTSIKGSSRSRVLRVSC  440
            M TL H  G  TPYP      K S+HF P       +  V     S+K S   RV R+ C
Sbjct  1    MATLSHFCGVKTPYPSV---LKRSVHF-PQLDFVGTVPFVSTPSKSVKASCCERVQRLVC  56

Query  441  KSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIV  620
            K+Q  D V    T+N  F  VP E TCVMKFGGSSVASA+RMREVADLILSFPEE+PVIV
Sbjct  57   KAQAAD-VNPKETKNESFGEVPDELTCVMKFGGSSVASAERMREVADLILSFPEERPVIV  115

Query  621  LSAMGKTTNNLLLAG  665
            LSAMGKTTNNLLLAG
Sbjct  116  LSAMGKTTNNLLLAG  130



>ref|XP_006364051.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X2 [Solanum 
tuberosum]
Length=567

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 88/135 (65%), Gaps = 6/135 (4%)
 Frame = +3

Query  264  METLMHLRGT-TPYPYFPKECKASLHFRPLWSQTIDLRHVYGVCTSIKGSSRSRVLRVSC  440
            M TL H  G  TPYP      K S+HF P       +  V     S+K S   RV R+ C
Sbjct  1    MATLSHFCGVKTPYPSV---LKRSVHF-PQLDFVGTVPFVSTPSKSVKASCCERVQRLVC  56

Query  441  KSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIV  620
            K+Q  D V    T+N  F  VP E TCVMKFGGSSVASA+RMREVADLILSFPEE+PVIV
Sbjct  57   KAQAAD-VNPKETKNESFGEVPDELTCVMKFGGSSVASAERMREVADLILSFPEERPVIV  115

Query  621  LSAMGKTTNNLLLAG  665
            LSAMGKTTNNLLLAG
Sbjct  116  LSAMGKTTNNLLLAG  130



>ref|XP_004228743.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X2 [Solanum 
lycopersicum]
Length=565

 Score =   129 bits (323),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 86/135 (64%), Gaps = 6/135 (4%)
 Frame = +3

Query  264  METLMHLRGT-TPYPYFPKECKASLHFRPLWSQTIDLRHVYGVCTSIKGSSRSRVLRVSC  440
            M TL H  G  TP P      K S+HF P       +  V     S+K S   RV R+ C
Sbjct  1    MATLSHFSGVKTPCPSI---FKRSVHF-PQLDFVATVPFVSAPSKSVKVSCCERVQRLVC  56

Query  441  KSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIV  620
            K+Q  D V    T+N  F   P E TCVMKFGGSSVASA+RMREVADLILSFPEE+PVIV
Sbjct  57   KAQATD-VNRKETKNESFGEAPDELTCVMKFGGSSVASAERMREVADLILSFPEERPVIV  115

Query  621  LSAMGKTTNNLLLAG  665
            LSAMGKTTNNLLLAG
Sbjct  116  LSAMGKTTNNLLLAG  130



>ref|XP_010316459.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X1 [Solanum 
lycopersicum]
Length=567

 Score =   129 bits (323),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 86/135 (64%), Gaps = 6/135 (4%)
 Frame = +3

Query  264  METLMHLRGT-TPYPYFPKECKASLHFRPLWSQTIDLRHVYGVCTSIKGSSRSRVLRVSC  440
            M TL H  G  TP P      K S+HF P       +  V     S+K S   RV R+ C
Sbjct  1    MATLSHFSGVKTPCPSI---FKRSVHF-PQLDFVATVPFVSAPSKSVKVSCCERVQRLVC  56

Query  441  KSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIV  620
            K+Q  D V    T+N  F   P E TCVMKFGGSSVASA+RMREVADLILSFPEE+PVIV
Sbjct  57   KAQATD-VNRKETKNESFGEAPDELTCVMKFGGSSVASAERMREVADLILSFPEERPVIV  115

Query  621  LSAMGKTTNNLLLAG  665
            LSAMGKTTNNLLLAG
Sbjct  116  LSAMGKTTNNLLLAG  130



>ref|XP_008362087.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X2 [Malus 
domestica]
Length=566

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 79/144 (55%), Positives = 93/144 (65%), Gaps = 16/144 (11%)
 Frame = +3

Query  264  METLMHL-RGTTPYPYFPKECKASLHFR-PLWSQTIDLRHVYGVCTSIKG--------SS  413
            MET +H  R  T  P  P+    SL F+ PLWSQ+  LR   GV +S  G        S 
Sbjct  1    METALHFSRVKTLCPASPER---SLRFKQPLWSQS--LRFATGVASS-NGFFASAKSFSC  54

Query  414  RSRVLRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREVADLILS  593
             SRVLRVSC+    D+++   T N        + TCVMKFGGSSVA+A+RMREVADLILS
Sbjct  55   TSRVLRVSCEGGIADVLEKKQTDNQSLGDNEKQLTCVMKFGGSSVATAERMREVADLILS  114

Query  594  FPEEKPVIVLSAMGKTTNNLLLAG  665
            FP+E+PVIVLSAMGKTTN LLLAG
Sbjct  115  FPQERPVIVLSAMGKTTNKLLLAG  138



>ref|XP_008362086.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X1 [Malus 
domestica]
Length=568

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 79/144 (55%), Positives = 93/144 (65%), Gaps = 16/144 (11%)
 Frame = +3

Query  264  METLMHL-RGTTPYPYFPKECKASLHFR-PLWSQTIDLRHVYGVCTSIKG--------SS  413
            MET +H  R  T  P  P+    SL F+ PLWSQ+  LR   GV +S  G        S 
Sbjct  1    METALHFSRVKTLCPASPER---SLRFKQPLWSQS--LRFATGVASS-NGFFASAKSFSC  54

Query  414  RSRVLRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREVADLILS  593
             SRVLRVSC+    D+++   T N        + TCVMKFGGSSVA+A+RMREVADLILS
Sbjct  55   TSRVLRVSCEGGIADVLEKKQTDNQSLGDNEKQLTCVMKFGGSSVATAERMREVADLILS  114

Query  594  FPEEKPVIVLSAMGKTTNNLLLAG  665
            FP+E+PVIVLSAMGKTTN LLLAG
Sbjct  115  FPQERPVIVLSAMGKTTNKLLLAG  138



>ref|XP_009781445.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X1 [Nicotiana 
sylvestris]
Length=564

 Score =   127 bits (318),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 89/136 (65%), Gaps = 11/136 (8%)
 Frame = +3

Query  264  METLMHLRGT-TPYPYFPKECKASLHFRPL-WSQTIDLRHVYGVCTSIKGSSRSRVLRVS  437
            M +L H  G  TP P   K    S+HFR L +  ++    V       K S   RV  V 
Sbjct  1    MASLSHFCGVKTPCPSLFKR---SVHFRQLDFVASVPFASVPS--KYAKASCYERVQSVI  55

Query  438  CKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREVADLILSFPEEKPVI  617
            CK+Q  D+V+L  T+N  F     EFTCVMKFGGSSVASA+RMREVADLILSFPEE+PVI
Sbjct  56   CKAQAADVVELKETKNEAF----GEFTCVMKFGGSSVASAERMREVADLILSFPEERPVI  111

Query  618  VLSAMGKTTNNLLLAG  665
            VLSAMGKTTNNLLLAG
Sbjct  112  VLSAMGKTTNNLLLAG  127



>ref|XP_009781448.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X4 [Nicotiana 
sylvestris]
Length=559

 Score =   127 bits (318),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 89/136 (65%), Gaps = 11/136 (8%)
 Frame = +3

Query  264  METLMHLRGT-TPYPYFPKECKASLHFRPL-WSQTIDLRHVYGVCTSIKGSSRSRVLRVS  437
            M +L H  G  TP P      K S+HFR L +  ++    V       K S   RV  V 
Sbjct  1    MASLSHFCGVKTPCPSL---FKRSVHFRQLDFVASVPFASVPS--KYAKASCYERVQSVI  55

Query  438  CKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREVADLILSFPEEKPVI  617
            CK+Q  D+V+L  T+N  F     EFTCVMKFGGSSVASA+RMREVADLILSFPEE+PVI
Sbjct  56   CKAQAADVVELKETKNEAF----GEFTCVMKFGGSSVASAERMREVADLILSFPEERPVI  111

Query  618  VLSAMGKTTNNLLLAG  665
            VLSAMGKTTNNLLLAG
Sbjct  112  VLSAMGKTTNNLLLAG  127



>ref|XP_009781447.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X3 [Nicotiana 
sylvestris]
Length=561

 Score =   127 bits (318),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 89/136 (65%), Gaps = 11/136 (8%)
 Frame = +3

Query  264  METLMHLRGT-TPYPYFPKECKASLHFRPL-WSQTIDLRHVYGVCTSIKGSSRSRVLRVS  437
            M +L H  G  TP P   K    S+HFR L +  ++    V       K S   RV  V 
Sbjct  1    MASLSHFCGVKTPCPSLFKR---SVHFRQLDFVASVPFASVPS--KYAKASCYERVQSVI  55

Query  438  CKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREVADLILSFPEEKPVI  617
            CK+Q  D+V+L  T+N  F     EFTCVMKFGGSSVASA+RMREVADLILSFPEE+PVI
Sbjct  56   CKAQAADVVELKETKNEAF----GEFTCVMKFGGSSVASAERMREVADLILSFPEERPVI  111

Query  618  VLSAMGKTTNNLLLAG  665
            VLSAMGKTTNNLLLAG
Sbjct  112  VLSAMGKTTNNLLLAG  127



>ref|XP_009781446.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X2 [Nicotiana 
sylvestris]
Length=562

 Score =   127 bits (318),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 89/136 (65%), Gaps = 11/136 (8%)
 Frame = +3

Query  264  METLMHLRGT-TPYPYFPKECKASLHFRPL-WSQTIDLRHVYGVCTSIKGSSRSRVLRVS  437
            M +L H  G  TP P      K S+HFR L +  ++    V       K S   RV  V 
Sbjct  1    MASLSHFCGVKTPCPSL---FKRSVHFRQLDFVASVPFASVPS--KYAKASCYERVQSVI  55

Query  438  CKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREVADLILSFPEEKPVI  617
            CK+Q  D+V+L  T+N  F     EFTCVMKFGGSSVASA+RMREVADLILSFPEE+PVI
Sbjct  56   CKAQAADVVELKETKNEAF----GEFTCVMKFGGSSVASAERMREVADLILSFPEERPVI  111

Query  618  VLSAMGKTTNNLLLAG  665
            VLSAMGKTTNNLLLAG
Sbjct  112  VLSAMGKTTNNLLLAG  127



>ref|XP_009378035.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X1 [Pyrus 
x bretschneideri]
Length=568

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 78/143 (55%), Positives = 91/143 (64%), Gaps = 14/143 (10%)
 Frame = +3

Query  264  METLMHL-RGTTPYPYFPKECKASLHFR-PLWSQTIDLRHVYGVCTS---IKGSSR----  416
            MET +H  R  T  P  P+    SL F+ PLWSQ   LR   GV +S     G+      
Sbjct  1    METALHFSRVKTLCPASPER---SLRFKQPLWSQR--LRFATGVASSNGFFAGAKNFPCT  55

Query  417  SRVLRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREVADLILSF  596
            SRVLRVSC+    D+++   T N        + TCVMKFGGSSVASA+RMREVA LILSF
Sbjct  56   SRVLRVSCEGGIADVLEKKQTDNQSLGDNEKQLTCVMKFGGSSVASAERMREVAHLILSF  115

Query  597  PEEKPVIVLSAMGKTTNNLLLAG  665
            P+E+PVIVLSAMGKTTN LLLAG
Sbjct  116  PQERPVIVLSAMGKTTNKLLLAG  138



>ref|XP_009378037.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X2 [Pyrus 
x bretschneideri]
Length=566

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 78/143 (55%), Positives = 91/143 (64%), Gaps = 14/143 (10%)
 Frame = +3

Query  264  METLMHL-RGTTPYPYFPKECKASLHFR-PLWSQTIDLRHVYGVCTS---IKGSSR----  416
            MET +H  R  T  P  P+    SL F+ PLWSQ   LR   GV +S     G+      
Sbjct  1    METALHFSRVKTLCPASPER---SLRFKQPLWSQR--LRFATGVASSNGFFAGAKNFPCT  55

Query  417  SRVLRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREVADLILSF  596
            SRVLRVSC+    D+++   T N        + TCVMKFGGSSVASA+RMREVA LILSF
Sbjct  56   SRVLRVSCEGGIADVLEKKQTDNQSLGDNEKQLTCVMKFGGSSVASAERMREVAHLILSF  115

Query  597  PEEKPVIVLSAMGKTTNNLLLAG  665
            P+E+PVIVLSAMGKTTN LLLAG
Sbjct  116  PQERPVIVLSAMGKTTNKLLLAG  138



>ref|XP_008231031.1| PREDICTED: aspartokinase 2, chloroplastic isoform X1 [Prunus 
mume]
Length=565

 Score =   123 bits (308),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 89/141 (63%), Gaps = 7/141 (5%)
 Frame = +3

Query  264  METLMHLRGT-TPYPYFPKECKASLHFRPLWSQTIDLRHVY----GVCTSIKG-SSRSRV  425
            M T +H  G  TP P      ++  + +PLWSQ +          G  TS K  S  SRV
Sbjct  1    MATALHFSGVKTPCPASASSERSLQYKQPLWSQRLRFATCVASNNGFYTSAKNFSCTSRV  60

Query  426  LRVSCKSQTI-DLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREVADLILSFPE  602
            LRVSC+   I D+++   T N        + TCVMKFGGSSVASA+RMREVADLILSFP+
Sbjct  61   LRVSCEGGGITDVLEKKQTDNQCLGENEKQLTCVMKFGGSSVASAERMREVADLILSFPQ  120

Query  603  EKPVIVLSAMGKTTNNLLLAG  665
            E+PVIVLSAMGKTTN LLLAG
Sbjct  121  ERPVIVLSAMGKTTNKLLLAG  141



>ref|XP_008231032.1| PREDICTED: aspartokinase 2, chloroplastic isoform X2 [Prunus 
mume]
Length=563

 Score =   122 bits (307),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 89/141 (63%), Gaps = 7/141 (5%)
 Frame = +3

Query  264  METLMHLRGT-TPYPYFPKECKASLHFRPLWSQTIDLRHVY----GVCTSIKG-SSRSRV  425
            M T +H  G  TP P      ++  + +PLWSQ +          G  TS K  S  SRV
Sbjct  1    MATALHFSGVKTPCPASASSERSLQYKQPLWSQRLRFATCVASNNGFYTSAKNFSCTSRV  60

Query  426  LRVSCKSQTI-DLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREVADLILSFPE  602
            LRVSC+   I D+++   T N        + TCVMKFGGSSVASA+RMREVADLILSFP+
Sbjct  61   LRVSCEGGGITDVLEKKQTDNQCLGENEKQLTCVMKFGGSSVASAERMREVADLILSFPQ  120

Query  603  EKPVIVLSAMGKTTNNLLLAG  665
            E+PVIVLSAMGKTTN LLLAG
Sbjct  121  ERPVIVLSAMGKTTNKLLLAG  141



>ref|XP_009607339.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X3 [Nicotiana 
tomentosiformis]
Length=554

 Score =   122 bits (307),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 61/79 (77%), Positives = 68/79 (86%), Gaps = 4/79 (5%)
 Frame = +3

Query  429  RVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREVADLILSFPEEK  608
            RV+CK+Q  D+V+L  T+N  F     EFTCVMKFGGSSVASA+RMREVADLILSFPEE+
Sbjct  50   RVTCKAQAADVVELKETKNEAF----GEFTCVMKFGGSSVASAERMREVADLILSFPEER  105

Query  609  PVIVLSAMGKTTNNLLLAG  665
            PVIVLSAMGKTTNNLLLAG
Sbjct  106  PVIVLSAMGKTTNNLLLAG  124



>ref|XP_009607337.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X1 [Nicotiana 
tomentosiformis]
Length=557

 Score =   122 bits (307),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 61/79 (77%), Positives = 68/79 (86%), Gaps = 4/79 (5%)
 Frame = +3

Query  429  RVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREVADLILSFPEEK  608
            RV+CK+Q  D+V+L  T+N  F     EFTCVMKFGGSSVASA+RMREVADLILSFPEE+
Sbjct  50   RVTCKAQAADVVELKETKNEAF----GEFTCVMKFGGSSVASAERMREVADLILSFPEER  105

Query  609  PVIVLSAMGKTTNNLLLAG  665
            PVIVLSAMGKTTNNLLLAG
Sbjct  106  PVIVLSAMGKTTNNLLLAG  124



>ref|XP_007215316.1| hypothetical protein PRUPE_ppa003561mg [Prunus persica]
 gb|EMJ16515.1| hypothetical protein PRUPE_ppa003561mg [Prunus persica]
Length=565

 Score =   122 bits (307),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 90/141 (64%), Gaps = 7/141 (5%)
 Frame = +3

Query  264  METLMHLRGT-TPYPYFPKECKASLHFRPLWSQTID----LRHVYGVCTSIKG-SSRSRV  425
            M T +H  G  TP P      ++  + +PLWSQ +     +    G  TS K  S  SRV
Sbjct  1    MATALHFSGVKTPCPASASSERSLQYKQPLWSQRLRFATRVASNNGFYTSAKNFSCTSRV  60

Query  426  LRVSCKSQTI-DLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREVADLILSFPE  602
            LRVSC+   I D+++   T N        + TCVMKFGGSSVASA+RMREVADLILSFP+
Sbjct  61   LRVSCEGGGITDVLEKKQTDNQCLGENEKQLTCVMKFGGSSVASAERMREVADLILSFPQ  120

Query  603  EKPVIVLSAMGKTTNNLLLAG  665
            E+PVIVLSAMGKTTN LLLAG
Sbjct  121  ERPVIVLSAMGKTTNKLLLAG  141



>ref|XP_009607340.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X4 [Nicotiana 
tomentosiformis]
Length=552

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/79 (77%), Positives = 68/79 (86%), Gaps = 4/79 (5%)
 Frame = +3

Query  429  RVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREVADLILSFPEEK  608
            RV+CK+Q  D+V+L  T+N  F     EFTCVMKFGGSSVASA+RMREVADLILSFPEE+
Sbjct  50   RVTCKAQAADVVELKETKNEAF----GEFTCVMKFGGSSVASAERMREVADLILSFPEER  105

Query  609  PVIVLSAMGKTTNNLLLAG  665
            PVIVLSAMGKTTNNLLLAG
Sbjct  106  PVIVLSAMGKTTNNLLLAG  124



>ref|XP_009607338.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X2 [Nicotiana 
tomentosiformis]
Length=555

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/79 (77%), Positives = 68/79 (86%), Gaps = 4/79 (5%)
 Frame = +3

Query  429  RVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREVADLILSFPEEK  608
            RV+CK+Q  D+V+L  T+N  F     EFTCVMKFGGSSVASA+RMREVADLILSFPEE+
Sbjct  50   RVTCKAQAADVVELKETKNEAF----GEFTCVMKFGGSSVASAERMREVADLILSFPEER  105

Query  609  PVIVLSAMGKTTNNLLLAG  665
            PVIVLSAMGKTTNNLLLAG
Sbjct  106  PVIVLSAMGKTTNNLLLAG  124



>ref|XP_011468211.1| PREDICTED: aspartokinase 2, chloroplastic isoform X2 [Fragaria 
vesca subsp. vesca]
Length=560

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 78/115 (68%), Gaps = 8/115 (7%)
 Frame = +3

Query  345  PLWSQTIDLRHVYGV-------CTSIKGSS-RSRVLRVSCKSQTIDLVQLSGTQNLGFDG  500
            PLWSQ   L     V       CTS K  S  SRVLRVSCK   +D++   G  N G   
Sbjct  24   PLWSQPQRLHFANSVSSSCGFYCTSGKYVSFASRVLRVSCKGGVVDVLDKKGKGNQGGAE  83

Query  501  VPSEFTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
               + TCVMKFGGSSVASA+RMRE+ADLI+SFP+E+PVIVLSAMGKTTN LLLAG
Sbjct  84   NDKQLTCVMKFGGSSVASAERMREIADLIVSFPQERPVIVLSAMGKTTNKLLLAG  138



>ref|XP_004304561.1| PREDICTED: aspartokinase 2, chloroplastic isoform X1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011468210.1| PREDICTED: aspartokinase 2, chloroplastic isoform X1 [Fragaria 
vesca subsp. vesca]
Length=562

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 78/115 (68%), Gaps = 8/115 (7%)
 Frame = +3

Query  345  PLWSQTIDLRHVYGV-------CTSIKGSS-RSRVLRVSCKSQTIDLVQLSGTQNLGFDG  500
            PLWSQ   L     V       CTS K  S  SRVLRVSCK   +D++   G  N G   
Sbjct  24   PLWSQPQRLHFANSVSSSCGFYCTSGKYVSFASRVLRVSCKGGVVDVLDKKGKGNQGGAE  83

Query  501  VPSEFTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
               + TCVMKFGGSSVASA+RMRE+ADLI+SFP+E+PVIVLSAMGKTTN LLLAG
Sbjct  84   NDKQLTCVMKFGGSSVASAERMREIADLIVSFPQERPVIVLSAMGKTTNKLLLAG  138



>gb|KHG00746.1| Aspartokinase 3, chloroplastic -like protein [Gossypium arboreum]
Length=517

 Score =   120 bits (302),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 81/127 (64%), Gaps = 4/127 (3%)
 Frame = +3

Query  291  TTPYPYFPKECKASLHFRPLWSQTIDLRHVYGV--CTSIKGSSRSRVLRVSCKSQTIDLV  464
            T P   FPK+   S H R  +S  +          C  ++   +SRV +VSC+   +D++
Sbjct  12   TAPSHSFPKQ--TSFHCRSAFSSQLHFGSFRSTDSCRRLRHCCKSRVFKVSCEGGNVDVI  69

Query  465  QLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTT  644
            + +  +        +E TCVMKFGGSSVASA+RMREVADLILSFP E+PVIVLSAMGKTT
Sbjct  70   ERNEVEKSTLGEAKNELTCVMKFGGSSVASAERMREVADLILSFPNERPVIVLSAMGKTT  129

Query  645  NNLLLAG  665
            N LLLAG
Sbjct  130  NKLLLAG  136



>ref|XP_006468884.1| PREDICTED: aspartokinase 3, chloroplastic-like isoform X1 [Citrus 
sinensis]
Length=559

 Score =   120 bits (301),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 81/119 (68%), Gaps = 5/119 (4%)
 Frame = +3

Query  324  KASLHFRPLWSQTIDLRHVYG----VCTSIKGSSRSRV-LRVSCKSQTIDLVQLSGTQNL  488
            K SLH + L  Q  +          +C S++ S   R  LRVSC+   ID+++   ++NL
Sbjct  13   KNSLHCQALSWQRFEFAKCVSSSSRLCVSVRNSCGGRCGLRVSCEGARIDVIERKKSENL  72

Query  489  GFDGVPSEFTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            G D    + TCVMKFGGSS+ASA+RMREVA+LILSFP E+PVIVLSAMGKTTN LLLAG
Sbjct  73   GVDESEKQLTCVMKFGGSSLASAERMREVAELILSFPNERPVIVLSAMGKTTNKLLLAG  131



>ref|XP_006468885.1| PREDICTED: aspartokinase 3, chloroplastic-like isoform X2 [Citrus 
sinensis]
Length=557

 Score =   120 bits (301),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 81/119 (68%), Gaps = 5/119 (4%)
 Frame = +3

Query  324  KASLHFRPLWSQTIDLRHVYG----VCTSIKGSSRSRV-LRVSCKSQTIDLVQLSGTQNL  488
            K SLH + L  Q  +          +C S++ S   R  LRVSC+   ID+++   ++NL
Sbjct  13   KNSLHCQALSWQRFEFAKCVSSSSRLCVSVRNSCGGRCGLRVSCEGARIDVIERKKSENL  72

Query  489  GFDGVPSEFTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            G D    + TCVMKFGGSS+ASA+RMREVA+LILSFP E+PVIVLSAMGKTTN LLLAG
Sbjct  73   GVDESEKQLTCVMKFGGSSLASAERMREVAELILSFPNERPVIVLSAMGKTTNKLLLAG  131



>ref|XP_008379051.1| PREDICTED: aspartokinase 2, chloroplastic isoform X2 [Malus domestica]
Length=568

 Score =   120 bits (301),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 84/140 (60%), Gaps = 8/140 (6%)
 Frame = +3

Query  264  METLMHLRGTTPYPYFPKECKASLHF-RPLWSQTIDLRHVYGVCTSIKGSSR-----SRV  425
            M T +H  G       P   + SLHF +PL SQ++              S++     SRV
Sbjct  1    MATALHFSGVKTL--CPSSSERSLHFNQPLLSQSLGFATCVASSNGFYASAKDFSCTSRV  58

Query  426  LRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREVADLILSFPEE  605
            LRVSC+    D+ +     N        + TCVMKFGGSSVASA+RMREVADLILSFP+E
Sbjct  59   LRVSCEGXIADVXEKKRXDNQSLGENEKQLTCVMKFGGSSVASAERMREVADLILSFPQE  118

Query  606  KPVIVLSAMGKTTNNLLLAG  665
            +PV+VLSAMGKTTN LLLAG
Sbjct  119  RPVVVLSAMGKTTNKLLLAG  138



>ref|XP_008379050.1| PREDICTED: aspartokinase 2, chloroplastic isoform X1 [Malus domestica]
Length=568

 Score =   120 bits (301),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 84/140 (60%), Gaps = 8/140 (6%)
 Frame = +3

Query  264  METLMHLRGTTPYPYFPKECKASLHF-RPLWSQTIDLRHVYGVCTSIKGSSR-----SRV  425
            M T +H  G       P   + SLHF +PL SQ++              S++     SRV
Sbjct  1    MATALHFSGVKTL--CPSSSERSLHFNQPLLSQSLGFATCVASSNGFYASAKDFSCTSRV  58

Query  426  LRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREVADLILSFPEE  605
            LRVSC+    D+ +     N        + TCVMKFGGSSVASA+RMREVADLILSFP+E
Sbjct  59   LRVSCEGXIADVXEKKRXDNQSLGENEKQLTCVMKFGGSSVASAERMREVADLILSFPQE  118

Query  606  KPVIVLSAMGKTTNNLLLAG  665
            +PV+VLSAMGKTTN LLLAG
Sbjct  119  RPVVVLSAMGKTTNKLLLAG  138



>ref|XP_008379052.1| PREDICTED: aspartokinase 2, chloroplastic isoform X3 [Malus domestica]
Length=566

 Score =   120 bits (301),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 84/140 (60%), Gaps = 8/140 (6%)
 Frame = +3

Query  264  METLMHLRGTTPYPYFPKECKASLHF-RPLWSQTIDLRHVYGVCTSIKGSSR-----SRV  425
            M T +H  G       P   + SLHF +PL SQ++              S++     SRV
Sbjct  1    MATALHFSGVKTL--CPSSSERSLHFNQPLLSQSLGFATCVASSNGFYASAKDFSCTSRV  58

Query  426  LRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREVADLILSFPEE  605
            LRVSC+    D+ +     N        + TCVMKFGGSSVASA+RMREVADLILSFP+E
Sbjct  59   LRVSCEGXIADVXEKKRXDNQSLGENEKQLTCVMKFGGSSVASAERMREVADLILSFPQE  118

Query  606  KPVIVLSAMGKTTNNLLLAG  665
            +PV+VLSAMGKTTN LLLAG
Sbjct  119  RPVVVLSAMGKTTNKLLLAG  138



>gb|KDO43562.1| hypothetical protein CISIN_1g008621mg [Citrus sinensis]
Length=358

 Score =   118 bits (296),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 83/119 (70%), Gaps = 5/119 (4%)
 Frame = +3

Query  324  KASLHFRPL-WSQTIDLRHVYG---VCTSIKGSSRSRV-LRVSCKSQTIDLVQLSGTQNL  488
            K SLH + L W +    + V     +C S++ S   R  LRVSC+   ID+++   ++NL
Sbjct  13   KNSLHCQALSWQRFAFAKCVSSSSRLCVSVRNSCGGRGGLRVSCEGARIDVIERKKSENL  72

Query  489  GFDGVPSEFTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            G D    + TCVMKFGGSS+ASA+RMREVA+LILSFP E+PVIVLSAMGKTTN LLLAG
Sbjct  73   GVDESEKQLTCVMKFGGSSLASAERMREVAELILSFPNERPVIVLSAMGKTTNKLLLAG  131



>gb|KDO43560.1| hypothetical protein CISIN_1g008621mg [Citrus sinensis]
Length=387

 Score =   119 bits (297),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 83/119 (70%), Gaps = 5/119 (4%)
 Frame = +3

Query  324  KASLHFRPL-WSQTIDLRHVYG---VCTSIKGSSRSRV-LRVSCKSQTIDLVQLSGTQNL  488
            K SLH + L W +    + V     +C S++ S   R  LRVSC+   ID+++   ++NL
Sbjct  13   KNSLHCQALSWQRFAFAKCVSSSSRLCVSVRNSCGGRGGLRVSCEGARIDVIERKKSENL  72

Query  489  GFDGVPSEFTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            G D    + TCVMKFGGSS+ASA+RMREVA+LILSFP E+PVIVLSAMGKTTN LLLAG
Sbjct  73   GVDESEKQLTCVMKFGGSSLASAERMREVAELILSFPNERPVIVLSAMGKTTNKLLLAG  131



>gb|EYU34829.1| hypothetical protein MIMGU_mgv1a003795mg [Erythranthe guttata]
Length=563

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 76/111 (68%), Gaps = 6/111 (5%)
 Frame = +3

Query  333  LHFRPLWSQTIDLRHVYGVCTSIKGSSRSRVLRVSCKSQTIDLVQLSGTQNLGFDGVPSE  512
            LHF       + L  V G C  + G S++  LR+ C +  +D+++++ T +   D    E
Sbjct  33   LHF------AVSLPSVIGPCLPLNGLSQTLALRLRCAASKVDVLEMNDTLSQDSDQSAKE  86

Query  513  FTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
             TCVMKFGGSSVASA RMREVADLIL FPEE+PVIVLSAMGKTTN LLLAG
Sbjct  87   LTCVMKFGGSSVASADRMREVADLILGFPEERPVIVLSAMGKTTNKLLLAG  137



>gb|KDO43561.1| hypothetical protein CISIN_1g008621mg [Citrus sinensis]
Length=456

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 73/94 (78%), Gaps = 1/94 (1%)
 Frame = +3

Query  387  VCTSIKGSSRSRV-LRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQR  563
            +C S++ S   R  LRVSC+   ID+++   ++NLG D    + TCVMKFGGSS+ASA+R
Sbjct  38   LCVSVRNSCGGRGGLRVSCEGARIDVIERKKSENLGVDESEKQLTCVMKFGGSSLASAER  97

Query  564  MREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            MREVA+LILSFP E+PVIVLSAMGKTTN LLLAG
Sbjct  98   MREVAELILSFPNERPVIVLSAMGKTTNKLLLAG  131



>ref|XP_008357847.1| PREDICTED: aspartokinase 2, chloroplastic-like [Malus domestica]
Length=566

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 84/140 (60%), Gaps = 8/140 (6%)
 Frame = +3

Query  264  METLMHLRGTTPYPYFPKECKASLHF-RPLWSQTIDLRHVYGVCTSIKGSSR-----SRV  425
            M T +H  G       P   + SLHF + L SQ++              S++     SRV
Sbjct  1    MATALHFSGVKTLC--PSSSERSLHFNQXLLSQSLGFATCVASSNGFYASAKDFSCTSRV  58

Query  426  LRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREVADLILSFPEE  605
            LRVSC+    D+ +   T N        + TCVMKFGGSSVASA+RMREVADLILSFP+E
Sbjct  59   LRVSCEGXIADVXEKKRTDNQSLGENEKQLTCVMKFGGSSVASAERMREVADLILSFPQE  118

Query  606  KPVIVLSAMGKTTNNLLLAG  665
            +PV+VLSAMGKTTN LLLAG
Sbjct  119  RPVVVLSAMGKTTNKLLLAG  138



>gb|KDO43558.1| hypothetical protein CISIN_1g008621mg [Citrus sinensis]
Length=559

 Score =   118 bits (296),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 83/119 (70%), Gaps = 5/119 (4%)
 Frame = +3

Query  324  KASLHFRPL-WSQTIDLRHVYG---VCTSIKGSSRSRV-LRVSCKSQTIDLVQLSGTQNL  488
            K SLH + L W +    + V     +C S++ S   R  LRVSC+   ID+++   ++NL
Sbjct  13   KNSLHCQALSWQRFAFAKCVSSSSRLCVSVRNSCGGRGGLRVSCEGARIDVIERKKSENL  72

Query  489  GFDGVPSEFTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            G D    + TCVMKFGGSS+ASA+RMREVA+LILSFP E+PVIVLSAMGKTTN LLLAG
Sbjct  73   GVDESEKQLTCVMKFGGSSLASAERMREVAELILSFPNERPVIVLSAMGKTTNKLLLAG  131



>gb|KDO43559.1| hypothetical protein CISIN_1g008621mg [Citrus sinensis]
Length=557

 Score =   118 bits (296),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 73/94 (78%), Gaps = 1/94 (1%)
 Frame = +3

Query  387  VCTSIKGSSRSRV-LRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQR  563
            +C S++ S   R  LRVSC+   ID+++   ++NLG D    + TCVMKFGGSS+ASA+R
Sbjct  38   LCVSVRNSCGGRGGLRVSCEGARIDVIERKKSENLGVDESEKQLTCVMKFGGSSLASAER  97

Query  564  MREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            MREVA+LILSFP E+PVIVLSAMGKTTN LLLAG
Sbjct  98   MREVAELILSFPNERPVIVLSAMGKTTNKLLLAG  131



>ref|XP_006446944.1| hypothetical protein CICLE_v10014778mg [Citrus clementina]
 gb|ESR60184.1| hypothetical protein CICLE_v10014778mg [Citrus clementina]
Length=557

 Score =   118 bits (296),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 83/119 (70%), Gaps = 5/119 (4%)
 Frame = +3

Query  324  KASLHFRPL-WSQTIDLRHVYG---VCTSIKGSSRSRV-LRVSCKSQTIDLVQLSGTQNL  488
            K SLH + L W +    + V     +C S++ S   R  LRVSC+   ID+++   ++NL
Sbjct  13   KNSLHCQALSWQRFAFAKCVSSSSRLCVSVRNSCGGRGGLRVSCEGARIDVIERKKSENL  72

Query  489  GFDGVPSEFTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            G D    + TCVMKFGGSS+ASA+RMREVA+LILSFP E+PVIVLSAMGKTTN LLLAG
Sbjct  73   GVDESEKQLTCVMKFGGSSLASAERMREVAELILSFPNERPVIVLSAMGKTTNKLLLAG  131



>ref|XP_007032011.1| Aspartate kinase 3 isoform 1 [Theobroma cacao]
 ref|XP_007032012.1| Aspartate kinase 3 isoform 1 [Theobroma cacao]
 ref|XP_007032015.1| Aspartate kinase 3 isoform 1 [Theobroma cacao]
 gb|EOY02937.1| Aspartate kinase 3 isoform 1 [Theobroma cacao]
 gb|EOY02938.1| Aspartate kinase 3 isoform 1 [Theobroma cacao]
 gb|EOY02941.1| Aspartate kinase 3 isoform 1 [Theobroma cacao]
Length=566

 Score =   118 bits (296),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 85/129 (66%), Gaps = 5/129 (4%)
 Frame = +3

Query  291  TTPYPYFPKE----CKASLHFRPLWSQTIDLRHVYGVCTSIKGSSRSRVLRVSCKSQTID  458
            T P   FPK+    C+++L  + L            +C +++   +SRV +VSC+   +D
Sbjct  13   TAPSHLFPKQRSLPCRSALPSQ-LNFAAFRSSSSSNLCWNLRHCCKSRVFKVSCQGGNVD  71

Query  459  LVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGK  638
            +++ +  +  G     ++ TCVMKFGGSSVASA+RMREVADLILSFP E+PVIVLSAMGK
Sbjct  72   VIERNEIEEAGSGEADNQLTCVMKFGGSSVASAERMREVADLILSFPNERPVIVLSAMGK  131

Query  639  TTNNLLLAG  665
            TTN LLLAG
Sbjct  132  TTNKLLLAG  140



>ref|XP_007032013.1| Aspartate kinase 3 isoform 3 [Theobroma cacao]
 ref|XP_007032014.1| Aspartate kinase 3 isoform 3 [Theobroma cacao]
 gb|EOY02939.1| Aspartate kinase 3 isoform 3 [Theobroma cacao]
 gb|EOY02940.1| Aspartate kinase 3 isoform 3 [Theobroma cacao]
Length=564

 Score =   118 bits (295),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 85/129 (66%), Gaps = 5/129 (4%)
 Frame = +3

Query  291  TTPYPYFPKE----CKASLHFRPLWSQTIDLRHVYGVCTSIKGSSRSRVLRVSCKSQTID  458
            T P   FPK+    C+++L  + L            +C +++   +SRV +VSC+   +D
Sbjct  13   TAPSHLFPKQRSLPCRSALPSQ-LNFAAFRSSSSSNLCWNLRHCCKSRVFKVSCQGGNVD  71

Query  459  LVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGK  638
            +++ +  +  G     ++ TCVMKFGGSSVASA+RMREVADLILSFP E+PVIVLSAMGK
Sbjct  72   VIERNEIEEAGSGEADNQLTCVMKFGGSSVASAERMREVADLILSFPNERPVIVLSAMGK  131

Query  639  TTNNLLLAG  665
            TTN LLLAG
Sbjct  132  TTNKLLLAG  140



>emb|CDP16734.1| unnamed protein product [Coffea canephora]
Length=570

 Score =   117 bits (294),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 84/130 (65%), Gaps = 9/130 (7%)
 Frame = +3

Query  294  TPYPYFPKECKASLHFRPL------WSQTIDLRHVYGVCTSIKGSSRSRVLRVSCKSQTI  455
            TP+   P  C     F+PL      +   + L  + G  +S+K S + R LRV C+   +
Sbjct  13   TPFQASPWRCS---RFQPLLQSQQRFESFVSLLSLPGGFSSLKVSYQERDLRVRCQGGNL  69

Query  456  DLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMG  635
             +++   T+   F+   +E TCVMKFGGSSVASA+RMREVADLI SFPEE+P+IVLSAMG
Sbjct  70   HILERGQTETHDFEESANELTCVMKFGGSSVASAERMREVADLICSFPEERPIIVLSAMG  129

Query  636  KTTNNLLLAG  665
            KTTNNLL AG
Sbjct  130  KTTNNLLQAG  139



>ref|XP_002512848.1| aspartate kinase, putative [Ricinus communis]
 gb|EEF49351.1| aspartate kinase, putative [Ricinus communis]
Length=556

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 70/139 (50%), Positives = 93/139 (67%), Gaps = 7/139 (5%)
 Frame = +3

Query  264  METLMHLRG--TTPYPYFPKECKASLHFRPLWSQTIDLRHVYGVCTSIKGSS-RSRVLRV  434
            M   +H  G     +P FPK+      F   ++ ++ +    G+  S+K SS  SRVLRV
Sbjct  1    MAAALHFGGGKVACHPVFPKKALQCQAFG--FANSVAVPSSKGLFKSVKFSSCTSRVLRV  58

Query  435  SCKSQTIDLVQLSGTQNLGFDGVPSE--FTCVMKFGGSSVASAQRMREVADLILSFPEEK  608
            SC+ + ID+++ + +++     V SE  FTCVMKFGGSS+ASA+RMREVADLILSF +E 
Sbjct  59   SCEGRNIDVLERNKSESSIDGNVESEKQFTCVMKFGGSSLASAERMREVADLILSFADET  118

Query  609  PVIVLSAMGKTTNNLLLAG  665
            P+IVLSAMGKTTN LLLAG
Sbjct  119  PIIVLSAMGKTTNKLLLAG  137



>ref|XP_011006114.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X3 [Populus 
euphratica]
Length=561

 Score =   115 bits (288),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 65/137 (47%), Positives = 89/137 (65%), Gaps = 11/137 (8%)
 Frame = +3

Query  264  METLMHLRGT---TPYPYFPKECKASLHFRPLWSQTIDLRHVYGVCTSIKGSSRSRVLRV  434
            ME  +H   T      P F K     +H + L  Q ++      V T++  S  +RVL+V
Sbjct  1    MENTLHFSATLQAAASPVFSKRMN-KMHCQSLRVQMVNYN---SVATNLTLSRSNRVLKV  56

Query  435  SCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREVADLILSFPEEKPV  614
            SC++ ++D+++++ T+N       ++ TCVMKFGGSS+ASA RMREVA+LILSF  E+PV
Sbjct  57   SCEAASVDVLEMNKTENQA----ETQLTCVMKFGGSSLASAWRMREVAELILSFRNERPV  112

Query  615  IVLSAMGKTTNNLLLAG  665
            IVLSAMGKTTN LLLAG
Sbjct  113  IVLSAMGKTTNKLLLAG  129



>ref|XP_011006115.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X4 [Populus 
euphratica]
Length=559

 Score =   115 bits (288),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 65/137 (47%), Positives = 89/137 (65%), Gaps = 11/137 (8%)
 Frame = +3

Query  264  METLMHLRGT---TPYPYFPKECKASLHFRPLWSQTIDLRHVYGVCTSIKGSSRSRVLRV  434
            ME  +H   T      P F K     +H + L  Q ++      V T++  S  +RVL+V
Sbjct  1    MENTLHFSATLQAAASPVFSKRMN-KMHCQSLRVQMVNYN---SVATNLTLSRSNRVLKV  56

Query  435  SCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREVADLILSFPEEKPV  614
            SC++ ++D+++++ T+N       ++ TCVMKFGGSS+ASA RMREVA+LILSF  E+PV
Sbjct  57   SCEAASVDVLEMNKTENQA----ETQLTCVMKFGGSSLASAWRMREVAELILSFRNERPV  112

Query  615  IVLSAMGKTTNNLLLAG  665
            IVLSAMGKTTN LLLAG
Sbjct  113  IVLSAMGKTTNKLLLAG  129



>ref|XP_011006109.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X1 [Populus 
euphratica]
 ref|XP_011006110.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X1 [Populus 
euphratica]
 ref|XP_011006111.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X1 [Populus 
euphratica]
 ref|XP_011006112.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X1 [Populus 
euphratica]
Length=586

 Score =   115 bits (288),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 65/137 (47%), Positives = 89/137 (65%), Gaps = 11/137 (8%)
 Frame = +3

Query  264  METLMHLRGT---TPYPYFPKECKASLHFRPLWSQTIDLRHVYGVCTSIKGSSRSRVLRV  434
            ME  +H   T      P F K     +H + L  Q ++      V T++  S  +RVL+V
Sbjct  1    MENTLHFSATLQAAASPVFSKRMN-KMHCQSLRVQMVNYN---SVATNLTLSRSNRVLKV  56

Query  435  SCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREVADLILSFPEEKPV  614
            SC++ ++D+++++ T+N       ++ TCVMKFGGSS+ASA RMREVA+LILSF  E+PV
Sbjct  57   SCEAASVDVLEMNKTENQA----ETQLTCVMKFGGSSLASAWRMREVAELILSFRNERPV  112

Query  615  IVLSAMGKTTNNLLLAG  665
            IVLSAMGKTTN LLLAG
Sbjct  113  IVLSAMGKTTNKLLLAG  129



>ref|XP_011006113.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X2 [Populus 
euphratica]
Length=584

 Score =   115 bits (287),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 65/137 (47%), Positives = 89/137 (65%), Gaps = 11/137 (8%)
 Frame = +3

Query  264  METLMHLRGT---TPYPYFPKECKASLHFRPLWSQTIDLRHVYGVCTSIKGSSRSRVLRV  434
            ME  +H   T      P F K     +H + L  Q ++      V T++  S  +RVL+V
Sbjct  1    MENTLHFSATLQAAASPVFSKRMN-KMHCQSLRVQMVNYN---SVATNLTLSRSNRVLKV  56

Query  435  SCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREVADLILSFPEEKPV  614
            SC++ ++D+++++ T+N       ++ TCVMKFGGSS+ASA RMREVA+LILSF  E+PV
Sbjct  57   SCEAASVDVLEMNKTENQA----ETQLTCVMKFGGSSLASAWRMREVAELILSFRNERPV  112

Query  615  IVLSAMGKTTNNLLLAG  665
            IVLSAMGKTTN LLLAG
Sbjct  113  IVLSAMGKTTNKLLLAG  129



>ref|XP_002321084.2| hypothetical protein POPTR_0014s14270g [Populus trichocarpa]
 gb|EEE99399.2| hypothetical protein POPTR_0014s14270g [Populus trichocarpa]
Length=561

 Score =   114 bits (286),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 88/137 (64%), Gaps = 11/137 (8%)
 Frame = +3

Query  264  METLMHLRGT---TPYPYFPKECKASLHFRPLWSQTIDLRHVYGVCTSIKGSSRSRVLRV  434
            M   +H   T    P P F K     +H + L  Q ++        T++  S  +RVL+V
Sbjct  1    MANTLHFSATLQAAPSPVFSKRMN-KMHCQSLRVQMVNYN---SEATNLALSRSNRVLKV  56

Query  435  SCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREVADLILSFPEEKPV  614
            SC++ ++D+++++ T N       ++ TCVMKFGGSS+ASA+RMREVA+LILSF  E+PV
Sbjct  57   SCEAASVDVLEMNKTDNQA----ETQLTCVMKFGGSSLASAERMREVAELILSFRNERPV  112

Query  615  IVLSAMGKTTNNLLLAG  665
            IVLSAMGKTTN LLLAG
Sbjct  113  IVLSAMGKTTNKLLLAG  129



>gb|KCW55775.1| hypothetical protein EUGRSUZ_I01605 [Eucalyptus grandis]
Length=525

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 67/90 (74%), Gaps = 0/90 (0%)
 Frame = +3

Query  396  SIKGSSRSRVLRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREV  575
            S+K S RS V +V C    +D+++ S     GF    ++  CVMKFGGSSVASA+RMREV
Sbjct  49   SVKKSCRSGVFKVCCAGANVDVLEKSSAVTQGFGDSENQLNCVMKFGGSSVASAERMREV  108

Query  576  ADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            ADL+LSFP E+PVIVLSAMGKTTNNLL AG
Sbjct  109  ADLVLSFPNERPVIVLSAMGKTTNNLLQAG  138



>gb|KCW55774.1| hypothetical protein EUGRSUZ_I01605 [Eucalyptus grandis]
Length=539

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 67/90 (74%), Gaps = 0/90 (0%)
 Frame = +3

Query  396  SIKGSSRSRVLRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREV  575
            S+K S RS V +V C    +D+++ S     GF    ++  CVMKFGGSSVASA+RMREV
Sbjct  49   SVKKSCRSGVFKVCCAGANVDVLEKSSAVTQGFGDSENQLNCVMKFGGSSVASAERMREV  108

Query  576  ADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            ADL+LSFP E+PVIVLSAMGKTTNNLL AG
Sbjct  109  ADLVLSFPNERPVIVLSAMGKTTNNLLQAG  138



>ref|XP_010028950.1| PREDICTED: aspartokinase 2, chloroplastic-like [Eucalyptus grandis]
 gb|KCW55773.1| hypothetical protein EUGRSUZ_I01605 [Eucalyptus grandis]
Length=565

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 67/90 (74%), Gaps = 0/90 (0%)
 Frame = +3

Query  396  SIKGSSRSRVLRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREV  575
            S+K S RS V +V C    +D+++ S     GF    ++  CVMKFGGSSVASA+RMREV
Sbjct  49   SVKKSCRSGVFKVCCAGANVDVLEKSSAVTQGFGDSENQLNCVMKFGGSSVASAERMREV  108

Query  576  ADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            ADL+LSFP E+PVIVLSAMGKTTNNLL AG
Sbjct  109  ADLVLSFPNERPVIVLSAMGKTTNNLLQAG  138



>ref|XP_006399912.1| hypothetical protein EUTSA_v10013157mg [Eutrema salsugineum]
 ref|XP_006399913.1| hypothetical protein EUTSA_v10013157mg [Eutrema salsugineum]
 gb|ESQ41365.1| hypothetical protein EUTSA_v10013157mg [Eutrema salsugineum]
 gb|ESQ41366.1| hypothetical protein EUTSA_v10013157mg [Eutrema salsugineum]
Length=545

 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 70/90 (78%), Gaps = 0/90 (0%)
 Frame = +3

Query  396  SIKGSSRSRVLRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREV  575
            +++ S R+  LRVSC++  +DL++   T+     G   E TCVMKFGGSSVASA+RM+E+
Sbjct  44   TVERSCRNTALRVSCEAARVDLLERKETETCNLSGTGKELTCVMKFGGSSVASAERMKEI  103

Query  576  ADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            A+LILSFP+E+PV+VLSAMGKTTN LL AG
Sbjct  104  ANLILSFPDERPVVVLSAMGKTTNKLLTAG  133



>ref|XP_006399914.1| hypothetical protein EUTSA_v10013157mg [Eutrema salsugineum]
 gb|ESQ41367.1| hypothetical protein EUTSA_v10013157mg [Eutrema salsugineum]
Length=554

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 70/90 (78%), Gaps = 0/90 (0%)
 Frame = +3

Query  396  SIKGSSRSRVLRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREV  575
            +++ S R+  LRVSC++  +DL++   T+     G   E TCVMKFGGSSVASA+RM+E+
Sbjct  44   TVERSCRNTALRVSCEAARVDLLERKETETCNLSGTGKELTCVMKFGGSSVASAERMKEI  103

Query  576  ADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            A+LILSFP+E+PV+VLSAMGKTTN LL AG
Sbjct  104  ANLILSFPDERPVVVLSAMGKTTNKLLTAG  133



>gb|KJB11755.1| hypothetical protein B456_001G275700 [Gossypium raimondii]
Length=416

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 76/109 (70%), Gaps = 7/109 (6%)
 Frame = +3

Query  339  FRPLWSQTIDLRHVYGVCTSIKGSSRSRVLRVSCKSQTIDLVQLSGTQNLGFDGVPSEFT  518
            FRP  S +  LR++     S++    SRV RV C+   +D++Q +  +        ++ T
Sbjct  40   FRP--SNSSILRNI-----SLRRCCESRVFRVCCQGGNVDVIQRNEFEAASSGEAENQLT  92

Query  519  CVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            CVMKFGGSSVASA+RMREVADLILSFP E+PVIVLSAMGKTTN LLLAG
Sbjct  93   CVMKFGGSSVASAERMREVADLILSFPNERPVIVLSAMGKTTNKLLLAG  141



>emb|CDY20797.1| BnaA02g09370D [Brassica napus]
Length=578

 Score =   113 bits (282),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = +3

Query  414  RSRVLRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREVADLILS  593
            ++R LRV+C++++ +L++   T+    +    + TCVMKFGGSSVASA+RMREVA+LILS
Sbjct  46   KNRSLRVTCEARSAELLERKNTETFKLNRTEIKLTCVMKFGGSSVASAERMREVANLILS  105

Query  594  FPEEKPVIVLSAMGKTTNNLLLAG  665
            FP+EKPV+VLSAMGKTTNNLL+AG
Sbjct  106  FPDEKPVVVLSAMGKTTNNLLMAG  129



>ref|XP_009127042.1| PREDICTED: aspartokinase 3, chloroplastic-like [Brassica rapa]
Length=573

 Score =   113 bits (282),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = +3

Query  414  RSRVLRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREVADLILS  593
            ++R LRV+C++++ +L++   T+    +    + TCVMKFGGSSVASA+RM+EVA+LILS
Sbjct  46   KNRTLRVTCEARSAELLERKDTETFKLNRTERKLTCVMKFGGSSVASAERMKEVANLILS  105

Query  594  FPEEKPVIVLSAMGKTTNNLLLAG  665
            FP+EKPV+VLSAMGKTTNNLL+AG
Sbjct  106  FPDEKPVVVLSAMGKTTNNLLMAG  129



>ref|XP_009131382.1| PREDICTED: aspartokinase 2, chloroplastic [Brassica rapa]
Length=537

 Score =   112 bits (280),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 69/90 (77%), Gaps = 0/90 (0%)
 Frame = +3

Query  396  SIKGSSRSRVLRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREV  575
            +I+ S R+  LRVSC++  +DL++   T+     G   E TCVMKFGGSSV SA+RM+EV
Sbjct  36   TIEHSCRNIALRVSCEAARVDLIERKETETSSVSGTGKELTCVMKFGGSSVESAERMKEV  95

Query  576  ADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            A+LILSFP+E+PVIVLSAMGKTTN LL AG
Sbjct  96   ANLILSFPDERPVIVLSAMGKTTNKLLKAG  125



>gb|KJB33202.1| hypothetical protein B456_006G000400 [Gossypium raimondii]
Length=511

 Score =   112 bits (279),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 81/127 (64%), Gaps = 4/127 (3%)
 Frame = +3

Query  291  TTPYPYFPKECKASLHFRPLWSQTIDLRHVYGVCT--SIKGSSRSRVLRVSCKSQTIDLV  464
            T P   FPK+   S H R  +   ++        +   ++   +SRV +VSC+   +D++
Sbjct  12   TAPSHSFPKQ--TSFHCRSAFLSQLNFGSFRSTDSYRRLRHCCKSRVFKVSCEGGNVDVI  69

Query  465  QLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTT  644
            + +  +        +E TCVMKFGGSSVASA+R+REVADLILSFP E+PV+VLSAMGKTT
Sbjct  70   ERNEVEKSTLGEAKNELTCVMKFGGSSVASAERIREVADLILSFPNERPVVVLSAMGKTT  129

Query  645  NNLLLAG  665
            N LLLAG
Sbjct  130  NKLLLAG  136



>gb|KJB11757.1| hypothetical protein B456_001G275700 [Gossypium raimondii]
Length=474

 Score =   111 bits (278),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 76/109 (70%), Gaps = 7/109 (6%)
 Frame = +3

Query  339  FRPLWSQTIDLRHVYGVCTSIKGSSRSRVLRVSCKSQTIDLVQLSGTQNLGFDGVPSEFT  518
            FRP  S +  LR++     S++    SRV RV C+   +D++Q +  +        ++ T
Sbjct  40   FRP--SNSSILRNI-----SLRRCCESRVFRVCCQGGNVDVIQRNEFEAASSGEAENQLT  92

Query  519  CVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            CVMKFGGSSVASA+RMREVADLILSFP E+PVIVLSAMGKTTN LLLAG
Sbjct  93   CVMKFGGSSVASAERMREVADLILSFPNERPVIVLSAMGKTTNKLLLAG  141



>gb|KJB33201.1| hypothetical protein B456_006G000400 [Gossypium raimondii]
Length=556

 Score =   112 bits (280),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 81/127 (64%), Gaps = 4/127 (3%)
 Frame = +3

Query  291  TTPYPYFPKECKASLHFRPLWSQTIDLRHVYGVCT--SIKGSSRSRVLRVSCKSQTIDLV  464
            T P   FPK+   S H R  +   ++        +   ++   +SRV +VSC+   +D++
Sbjct  12   TAPSHSFPKQ--TSFHCRSAFLSQLNFGSFRSTDSYRRLRHCCKSRVFKVSCEGGNVDVI  69

Query  465  QLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTT  644
            + +  +        +E TCVMKFGGSSVASA+R+REVADLILSFP E+PV+VLSAMGKTT
Sbjct  70   ERNEVEKSTLGEAKNELTCVMKFGGSSVASAERIREVADLILSFPNERPVVVLSAMGKTT  129

Query  645  NNLLLAG  665
            N LLLAG
Sbjct  130  NKLLLAG  136



>emb|CDX78557.1| BnaA03g04690D [Brassica napus]
Length=537

 Score =   112 bits (279),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 69/90 (77%), Gaps = 0/90 (0%)
 Frame = +3

Query  396  SIKGSSRSRVLRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREV  575
            +++ S R+  LRVSC++  +DL++   T+     G   E TCVMKFGGSSV SA+RM+EV
Sbjct  36   TVEHSCRNIALRVSCEAARVDLIERKETETRSVSGTGKELTCVMKFGGSSVESAERMKEV  95

Query  576  ADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            A+LILSFP+E+PVIVLSAMGKTTN LL AG
Sbjct  96   ANLILSFPDERPVIVLSAMGKTTNKLLKAG  125



>gb|KJB33203.1| hypothetical protein B456_006G000400 [Gossypium raimondii]
Length=543

 Score =   112 bits (279),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 81/127 (64%), Gaps = 4/127 (3%)
 Frame = +3

Query  291  TTPYPYFPKECKASLHFRPLWSQTIDLRHVYGVCT--SIKGSSRSRVLRVSCKSQTIDLV  464
            T P   FPK+   S H R  +   ++        +   ++   +SRV +VSC+   +D++
Sbjct  12   TAPSHSFPKQ--TSFHCRSAFLSQLNFGSFRSTDSYRRLRHCCKSRVFKVSCEGGNVDVI  69

Query  465  QLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTT  644
            + +  +        +E TCVMKFGGSSVASA+R+REVADLILSFP E+PV+VLSAMGKTT
Sbjct  70   ERNEVEKSTLGEAKNELTCVMKFGGSSVASAERIREVADLILSFPNERPVVVLSAMGKTT  129

Query  645  NNLLLAG  665
            N LLLAG
Sbjct  130  NKLLLAG  136



>ref|XP_009388316.1| PREDICTED: aspartokinase 2, chloroplastic-like, partial [Musa 
acuminata subsp. malaccensis]
Length=458

 Score =   110 bits (276),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 66/88 (75%), Gaps = 0/88 (0%)
 Frame = +3

Query  402  KGSSRSRVLRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREVAD  581
            +G  R+R LRVSC+       +    +  G DG   + + VMKFGGSSVASA+RM+EVAD
Sbjct  49   RGYPRNRSLRVSCERGVSAFFEEDEAERQGADGDAPQLSIVMKFGGSSVASAERMKEVAD  108

Query  582  LILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            LILSFPEE+PVIVLSAMGKTTNNLLLAG
Sbjct  109  LILSFPEERPVIVLSAMGKTTNNLLLAG  136



>gb|KJB11753.1| hypothetical protein B456_001G275700 [Gossypium raimondii]
Length=558

 Score =   111 bits (278),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 76/109 (70%), Gaps = 7/109 (6%)
 Frame = +3

Query  339  FRPLWSQTIDLRHVYGVCTSIKGSSRSRVLRVSCKSQTIDLVQLSGTQNLGFDGVPSEFT  518
            FRP  S +  LR++     S++    SRV RV C+   +D++Q +  +        ++ T
Sbjct  40   FRP--SNSSILRNI-----SLRRCCESRVFRVCCQGGNVDVIQRNEFEAASSGEAENQLT  92

Query  519  CVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            CVMKFGGSSVASA+RMREVADLILSFP E+PVIVLSAMGKTTN LLLAG
Sbjct  93   CVMKFGGSSVASAERMREVADLILSFPNERPVIVLSAMGKTTNKLLLAG  141



>ref|XP_006286781.1| hypothetical protein CARUB_v10003334mg [Capsella rubella]
 gb|EOA19679.1| hypothetical protein CARUB_v10003334mg [Capsella rubella]
Length=545

 Score =   111 bits (278),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 75/104 (72%), Gaps = 0/104 (0%)
 Frame = +3

Query  354  SQTIDLRHVYGVCTSIKGSSRSRVLRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKF  533
            S ++ L     V  +++ S R+  LRVSC++  +DL++   T+     G   + TCVMKF
Sbjct  30   SNSVTLAASSAVFRTVEHSCRNVALRVSCEAVRVDLLERQDTEICNSSGTGKDLTCVMKF  89

Query  534  GGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            GGSSVASA+RM+EVA+LILSFP+E+PVIVLSAMGKTTN LL AG
Sbjct  90   GGSSVASAERMKEVANLILSFPDERPVIVLSAMGKTTNKLLKAG  133



>gb|KJB11752.1| hypothetical protein B456_001G275700 [Gossypium raimondii]
Length=556

 Score =   111 bits (278),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 76/109 (70%), Gaps = 7/109 (6%)
 Frame = +3

Query  339  FRPLWSQTIDLRHVYGVCTSIKGSSRSRVLRVSCKSQTIDLVQLSGTQNLGFDGVPSEFT  518
            FRP  S +  LR++     S++    SRV RV C+   +D++Q +  +        ++ T
Sbjct  40   FRP--SNSSILRNI-----SLRRCCESRVFRVCCQGGNVDVIQRNEFEAASSGEAENQLT  92

Query  519  CVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            CVMKFGGSSVASA+RMREVADLILSFP E+PVIVLSAMGKTTN LLLAG
Sbjct  93   CVMKFGGSSVASAERMREVADLILSFPNERPVIVLSAMGKTTNKLLLAG  141



>ref|XP_011097259.1| PREDICTED: aspartokinase 2, chloroplastic isoform X2 [Sesamum 
indicum]
Length=554

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 65/81 (80%), Gaps = 1/81 (1%)
 Frame = +3

Query  426  LRVSCKSQ-TIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREVADLILSFPE  602
            LR+ C +   +D+++ + TQN   D +  E TCVMKFGGSSVASA RM+EVADLILSFPE
Sbjct  54   LRLRCDAAGKVDVLEKNDTQNQDSDQIAEELTCVMKFGGSSVASADRMKEVADLILSFPE  113

Query  603  EKPVIVLSAMGKTTNNLLLAG  665
            E+PVIVLSAMGKTTN LLLAG
Sbjct  114  ERPVIVLSAMGKTTNKLLLAG  134



>ref|XP_011097258.1| PREDICTED: aspartokinase 2, chloroplastic isoform X1 [Sesamum 
indicum]
Length=556

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 65/81 (80%), Gaps = 1/81 (1%)
 Frame = +3

Query  426  LRVSCKSQ-TIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREVADLILSFPE  602
            LR+ C +   +D+++ + TQN   D +  E TCVMKFGGSSVASA RM+EVADLILSFPE
Sbjct  54   LRLRCDAAGKVDVLEKNDTQNQDSDQIAEELTCVMKFGGSSVASADRMKEVADLILSFPE  113

Query  603  EKPVIVLSAMGKTTNNLLLAG  665
            E+PVIVLSAMGKTTN LLLAG
Sbjct  114  ERPVIVLSAMGKTTNKLLLAG  134



>emb|CDX70538.1| BnaC03g06220D [Brassica napus]
Length=546

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 69/90 (77%), Gaps = 0/90 (0%)
 Frame = +3

Query  396  SIKGSSRSRVLRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREV  575
            +++ S R+  LRVSC++  +DL++   T+     G   E TCVMKFGGSSV SA+RM+EV
Sbjct  45   TVEHSCRNTPLRVSCEAARVDLIERKQTETRSVSGTGKELTCVMKFGGSSVESAERMKEV  104

Query  576  ADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            A+LILSFP+E+PVIVLSAMGKTTN LL AG
Sbjct  105  ANLILSFPDERPVIVLSAMGKTTNKLLKAG  134



>emb|CDY06621.1| BnaC02g13450D [Brassica napus]
Length=576

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = +3

Query  414  RSRVLRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREVADLILS  593
            ++R LRV+C++++ +L++   T+    +    + TCVMKFGGSSVASA+RM+EVA LILS
Sbjct  46   KNRTLRVTCEARSAELLERKDTETFKLNRTEIKLTCVMKFGGSSVASAERMKEVAKLILS  105

Query  594  FPEEKPVIVLSAMGKTTNNLLLAG  665
            FP+EKPV+VLSAMGKTTNNLL+AG
Sbjct  106  FPDEKPVVVLSAMGKTTNNLLMAG  129



>ref|XP_010096037.1| Aspartokinase 3 [Morus notabilis]
 gb|EXB62843.1| Aspartokinase 3 [Morus notabilis]
Length=552

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 70/139 (50%), Positives = 88/139 (63%), Gaps = 10/139 (7%)
 Frame = +3

Query  264  METLMHLRGTTPYPYF--PKECKASLHFRPLWSQTIDLRHVYGVCT-SIKGSSRSRVLRV  434
            MET +   G + +     P      LHF    S      +  G CT + K S RS VLRV
Sbjct  1    METSLQYCGASSWKSLQQPPASSHRLHFSTSVSS-----NYKGWCTIAKKQSCRSGVLRV  55

Query  435  SCKSQ-TIDLVQL-SGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREVADLILSFPEEK  608
            SC++   +D+++  +  +N        +FTCVMKFGGSSVASA+RM+EVA+LILSFPEE+
Sbjct  56   SCEAGGVVDVIERKTQLENPSLGENEKQFTCVMKFGGSSVASAERMKEVAELILSFPEER  115

Query  609  PVIVLSAMGKTTNNLLLAG  665
            PVIVLSAMGKTTN LLLAG
Sbjct  116  PVIVLSAMGKTTNKLLLAG  134



>ref|XP_010492197.1| PREDICTED: aspartokinase 2, chloroplastic-like [Camelina sativa]
 ref|XP_010492198.1| PREDICTED: aspartokinase 2, chloroplastic-like [Camelina sativa]
Length=546

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 71/94 (76%), Gaps = 0/94 (0%)
 Frame = +3

Query  384  GVCTSIKGSSRSRVLRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQR  563
             V  +++ S R+  LRVSC++  +DL++   T+     G   + TCVMKFGGSSVASA+R
Sbjct  41   AVFRNVEHSCRNLALRVSCEAVRVDLLERKETETCNSSGTGKDLTCVMKFGGSSVASAER  100

Query  564  MREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            M+EVA+L+LSFP+E+PVIVLSAMGKTTN LL AG
Sbjct  101  MKEVANLVLSFPDERPVIVLSAMGKTTNTLLKAG  134



>gb|KHG14818.1| Aspartokinase 3, chloroplastic -like protein [Gossypium arboreum]
Length=536

 Score =   110 bits (274),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 76/109 (70%), Gaps = 7/109 (6%)
 Frame = +3

Query  339  FRPLWSQTIDLRHVYGVCTSIKGSSRSRVLRVSCKSQTIDLVQLSGTQNLGFDGVPSEFT  518
            FRP  S +  LR++     S++    SRV RV C+   +D+++ +  +        ++ T
Sbjct  40   FRP--SNSSILRNI-----SLRRCCESRVFRVCCQGGNVDVIKRNEFEAASSGEAENQLT  92

Query  519  CVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            CVMKFGGSSVASA+RMREVADLILSFP E+PVIVLSAMGKTTN LLLAG
Sbjct  93   CVMKFGGSSVASAERMREVADLILSFPNERPVIVLSAMGKTTNKLLLAG  141



>ref|XP_008369639.1| PREDICTED: aspartokinase 1, chloroplastic [Malus domestica]
Length=565

 Score =   109 bits (273),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 64/134 (48%), Positives = 88/134 (66%), Gaps = 22/134 (16%)
 Frame = +3

Query  324  KASLHFR----PLWSQTIDLRHVYGVCTS----------IKGSSRSRVLRVSCKSQTIDL  461
            +ASLHFR    P +S+T  L H+  V ++          ++ + R   LR   + + I+ 
Sbjct  2    EASLHFRGVRIPCYSRTPRLMHLSQVSSALSPSRSLYAAVENACRRSRLRAKSEKRRIEA  61

Query  462  V------QLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVL  623
            V      + + T++ G D VP  FTCVMKFGGSS+ASA+R+RE+A L++SFP+EKP+IVL
Sbjct  62   VLGEEEEEENATESRGSDAVP--FTCVMKFGGSSLASAERVREIAQLVVSFPDEKPIIVL  119

Query  624  SAMGKTTNNLLLAG  665
            SAMGKTTNNLLLAG
Sbjct  120  SAMGKTTNNLLLAG  133



>ref|XP_010453516.1| PREDICTED: aspartokinase 2, chloroplastic [Camelina sativa]
 ref|XP_010453517.1| PREDICTED: aspartokinase 2, chloroplastic [Camelina sativa]
Length=545

 Score =   109 bits (272),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 74/104 (71%), Gaps = 0/104 (0%)
 Frame = +3

Query  354  SQTIDLRHVYGVCTSIKGSSRSRVLRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKF  533
            S ++ L     V  +++ S R+  LRVSC++  +DL++    +     G   + TCVMKF
Sbjct  30   SNSVTLASSCAVFRTVEHSCRNIALRVSCEAVRVDLLERKEPETCNSSGTGKDLTCVMKF  89

Query  534  GGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            GGSSVASA+RM+EVA+LILSFP+E+PVIVLSAMGKTTN LL AG
Sbjct  90   GGSSVASAERMKEVANLILSFPDERPVIVLSAMGKTTNTLLKAG  133



>ref|XP_011024774.1| PREDICTED: aspartokinase 2, chloroplastic isoform X1 [Populus 
euphratica]
 ref|XP_011024776.1| PREDICTED: aspartokinase 2, chloroplastic isoform X1 [Populus 
euphratica]
Length=557

 Score =   109 bits (272),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 71/94 (76%), Gaps = 5/94 (5%)
 Frame = +3

Query  387  VCTSIKGSSRSR-VLRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQR  563
            V TS+  S RSR  L+VSC++ ++DL++ +   N        + TCVMKFGGSSVASA+R
Sbjct  40   VATSLVLSKRSRRALKVSCEAASVDLLETNKIDN----EAEKKITCVMKFGGSSVASAER  95

Query  564  MREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            MREVA+LILSFP E+P IVLSAMGKTTN LLLAG
Sbjct  96   MREVAELILSFPNERPAIVLSAMGKTTNKLLLAG  129



>ref|XP_011024777.1| PREDICTED: aspartokinase 3, chloroplastic isoform X2 [Populus 
euphratica]
Length=555

 Score =   109 bits (272),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 71/94 (76%), Gaps = 5/94 (5%)
 Frame = +3

Query  387  VCTSIKGSSRSR-VLRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQR  563
            V TS+  S RSR  L+VSC++ ++DL++ +   N        + TCVMKFGGSSVASA+R
Sbjct  40   VATSLVLSKRSRRALKVSCEAASVDLLETNKIDN----EAEKKITCVMKFGGSSVASAER  95

Query  564  MREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            MREVA+LILSFP E+P IVLSAMGKTTN LLLAG
Sbjct  96   MREVAELILSFPNERPAIVLSAMGKTTNKLLLAG  129



>dbj|BAE98441.1| lysine-sensitive aspartate kinase [Arabidopsis thaliana]
Length=322

 Score =   107 bits (266),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 0/90 (0%)
 Frame = +3

Query  396  SIKGSSRSRVLRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREV  575
             ++ S R+  LRVSC++  +DL+Q    +     G   E TCVMKFGGSSV SA+RM+EV
Sbjct  43   DVEHSCRNIGLRVSCEALRVDLLQRKEPETCDSSGTGKELTCVMKFGGSSVESAERMKEV  102

Query  576  ADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            A+LILSFP+E+PVIVLSAMGKTTN LL AG
Sbjct  103  ANLILSFPDERPVIVLSAMGKTTNKLLKAG  132



>ref|XP_010420027.1| PREDICTED: aspartokinase 2, chloroplastic-like [Camelina sativa]
 ref|XP_010420028.1| PREDICTED: aspartokinase 2, chloroplastic-like [Camelina sativa]
Length=545

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 74/104 (71%), Gaps = 0/104 (0%)
 Frame = +3

Query  354  SQTIDLRHVYGVCTSIKGSSRSRVLRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKF  533
            S ++ L     +  +++ S R+  LRVSC++  +DL++    +     G   + TCVMKF
Sbjct  30   SNSVTLASSCAIFRTVEHSCRNIALRVSCEAVRVDLLERKEPETCNSTGTGKDLTCVMKF  89

Query  534  GGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            GGSSVASA+RM+EVA+LILSFP+E+PVIVLSAMGKTTN LL AG
Sbjct  90   GGSSVASAERMKEVANLILSFPDERPVIVLSAMGKTTNTLLKAG  133



>ref|XP_002301756.2| hypothetical protein POPTR_0002s23800g [Populus trichocarpa]
 gb|EEE81029.2| hypothetical protein POPTR_0002s23800g [Populus trichocarpa]
Length=557

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 66/123 (54%), Positives = 79/123 (64%), Gaps = 11/123 (9%)
 Frame = +3

Query  303  PYFPKECKA-SLHFRPLWSQTIDLRHVYGVCTSIKGSSRSR-VLRVSCKSQTIDLVQLSG  476
            P F K     SL  RP      +L     V TS+  S RSR   +VSC++ ++DL++ + 
Sbjct  16   PVFSKRMHGQSLRHRPSPPLNYNL-----VATSLVLSKRSRRAFKVSCEAASVDLLETNK  70

Query  477  TQNLGFDGVPSEFTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLL  656
              N        + TCVMKFGGSSVASA+RMREVA+LILSFP E PVIVLSAMGKTTN LL
Sbjct  71   IDN----EAEKKITCVMKFGGSSVASAERMREVAELILSFPNESPVIVLSAMGKTTNKLL  126

Query  657  LAG  665
            LAG
Sbjct  127  LAG  129



>gb|KHN00622.1| Aspartokinase 2, chloroplastic [Glycine soja]
Length=163

 Score =   103 bits (256),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 65/79 (82%), Gaps = 3/79 (4%)
 Frame = +3

Query  435  SCKSQTIDLVQLSGTQN--LGFDGVPSEFTCVMKFGGSSVASAQRMREVADLILSFPEEK  608
            +CK+ T D+++ + T+N  +  +G  S FTCVMKFGGSSVASA RM+EVA LILSFPEE+
Sbjct  57   TCKASTSDVIEKNATENGMVSSEGETS-FTCVMKFGGSSVASADRMKEVATLILSFPEER  115

Query  609  PVIVLSAMGKTTNNLLLAG  665
            P++VLSAMGKTTN LLLAG
Sbjct  116  PIVVLSAMGKTTNKLLLAG  134



>ref|XP_004169933.1| PREDICTED: aspartokinase 3, chloroplastic-like, partial [Cucumis 
sativus]
Length=224

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 67/139 (48%), Positives = 83/139 (60%), Gaps = 11/139 (8%)
 Frame = +3

Query  264  METLMHLRGTTPYPYFPKECKA----SLHFRPLWSQTIDLRHVYGVCTSIKGSSRSRV-L  428
            ME  ++L G          C++     LHF    +QT       G+ T+ K  S  RV L
Sbjct  1    MEGALNLLGGATICPASTRCQSLLSPQLHFVSSIAQT------AGLYTNGKRLSCRRVGL  54

Query  429  RVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREVADLILSFPEEK  608
            RV C+    D++    T++        +FTCVMKFGGSSVASA+RM EVA+LI SFPEE+
Sbjct  55   RVRCERNVADVLDRKVTESRSSGDNEQQFTCVMKFGGSSVASAERMMEVAELIRSFPEER  114

Query  609  PVIVLSAMGKTTNNLLLAG  665
            PVIVLSAMGKTTN LLLAG
Sbjct  115  PVIVLSAMGKTTNKLLLAG  133



>ref|XP_010911752.1| PREDICTED: aspartokinase 1, chloroplastic-like, partial [Elaeis 
guineensis]
Length=210

 Score =   103 bits (256),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 61/80 (76%), Gaps = 0/80 (0%)
 Frame = +3

Query  426  LRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREVADLILSFPEE  605
            L+V C+     +V+       G DG  ++ + VMKFGGSSVASA RM+EVADLILSFPEE
Sbjct  57   LKVRCQRAVSAVVEKDEVVREGADGNAAQLSIVMKFGGSSVASADRMKEVADLILSFPEE  116

Query  606  KPVIVLSAMGKTTNNLLLAG  665
            +PVIVLSAMGKTTNNLLLAG
Sbjct  117  RPVIVLSAMGKTTNNLLLAG  136



>ref|NP_196910.1| aspartokinase 2 [Arabidopsis thaliana]
 ref|NP_001078581.1| aspartokinase 2 [Arabidopsis thaliana]
 sp|O23653.2|AK2_ARATH RecName: Full=Aspartokinase 2, chloroplastic; AltName: Full=Aspartate 
kinase 2; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB08285.1| lysine-sensitive aspartate kinase [Arabidopsis thaliana]
 gb|AED91982.1| aspartokinase 2 [Arabidopsis thaliana]
 gb|AED91983.1| aspartokinase 2 [Arabidopsis thaliana]
Length=544

 Score =   107 bits (266),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 68/94 (72%), Gaps = 0/94 (0%)
 Frame = +3

Query  384  GVCTSIKGSSRSRVLRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQR  563
             V   ++ S R+  LRVSC++  +DL+Q    +     G   E TCVMKFGGSSV SA+R
Sbjct  39   AVFRDVEHSCRNIGLRVSCEALRVDLLQRKEPETCDSSGTGKELTCVMKFGGSSVESAER  98

Query  564  MREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            M+EVA+LILSFP+E+PVIVLSAMGKTTN LL AG
Sbjct  99   MKEVANLILSFPDERPVIVLSAMGKTTNKLLKAG  132



>ref|XP_009359889.1| PREDICTED: aspartokinase 1, chloroplastic-like [Pyrus x bretschneideri]
Length=566

 Score =   107 bits (266),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 87/134 (65%), Gaps = 22/134 (16%)
 Frame = +3

Query  324  KASLHFR----PLWSQTIDLRHVYGVC----------TSIKGSSRSRVLRVSCKSQTIDL  461
            +ASLHFR    P +S+T  L H+  V            +++ + RS  LR   + + I+ 
Sbjct  2    EASLHFRGVRIPGYSRTPRLWHLSRVSLGASPSRSIYAAVENACRSGSLRAKSEKRRIEA  61

Query  462  V------QLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVL  623
            V      + + T++ G D  P  FTCVMKFGGSS+ASA+R+RE+A L++SFP+EKP++VL
Sbjct  62   VLGDEEDEENATESRGSDAPP--FTCVMKFGGSSLASAERIREIAQLVVSFPDEKPIVVL  119

Query  624  SAMGKTTNNLLLAG  665
            SAMGKTTNNLLLAG
Sbjct  120  SAMGKTTNNLLLAG  133



>ref|XP_009411806.1| PREDICTED: aspartokinase 2, chloroplastic-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009411807.1| PREDICTED: aspartokinase 2, chloroplastic-like [Musa acuminata 
subsp. malaccensis]
Length=579

 Score =   107 bits (266),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 71/101 (70%), Gaps = 9/101 (9%)
 Frame = +3

Query  372  RHVYGVCTSIKGSSRSRVLRVSCK---SQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGS  542
            R   G+C       + RVL+V C+   S  +D+V+       G  G P++ + VMKFGGS
Sbjct  45   RQREGIC------GKRRVLKVRCERRVSAVVDVVEKDVALRQGSGGNPAQLSIVMKFGGS  98

Query  543  SVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            SVASA+RM+EVA LILSFPEE+PVIVLSAMGKTTNNLLLAG
Sbjct  99   SVASAERMKEVAGLILSFPEERPVIVLSAMGKTTNNLLLAG  139



>gb|KHM99220.1| Aspartokinase 1, chloroplastic [Glycine soja]
Length=553

 Score =   106 bits (264),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 69/87 (79%), Gaps = 4/87 (5%)
 Frame = +3

Query  408  SSRSRVLRVSC-KSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREVADL  584
            S R   LRVSC K+   D+V+    ++ GF  + + +TCVMKFGGSSVA+A+RMREVA+L
Sbjct  42   SERVATLRVSCIKATESDVVE---GESGGFADIETSYTCVMKFGGSSVANAERMREVANL  98

Query  585  ILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            ILSFPEE+P+IVLSAMGKTTN LLLAG
Sbjct  99   ILSFPEERPIIVLSAMGKTTNMLLLAG  125



>ref|XP_009388366.1| PREDICTED: aspartokinase 1, chloroplastic-like, partial [Musa 
acuminata subsp. malaccensis]
Length=260

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 66/98 (67%), Gaps = 6/98 (6%)
 Frame = +3

Query  372  RHVYGVCTSIKGSSRSRVLRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVA  551
            R   G+C       + R L+V C+ +   +V+       G D    + + VMKFGGSSVA
Sbjct  45   RKREGIC------GKRRALKVCCERRVSAVVEKDAVLRQGADSNVEQLSIVMKFGGSSVA  98

Query  552  SAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            SA+RM+EVADLILSFPEE+P IVLSAMGKTTNNLLLAG
Sbjct  99   SAERMKEVADLILSFPEEQPAIVLSAMGKTTNNLLLAG  136



>ref|XP_010656844.1| PREDICTED: aspartokinase 1, chloroplastic isoform X2 [Vitis vinifera]
Length=534

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 66/94 (70%), Gaps = 0/94 (0%)
 Frame = +3

Query  384  GVCTSIKGSSRSRVLRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQR  563
            G+  +     R RVLRV CK     +++   ++N   D    +  CVMKFGGSS+ASA+R
Sbjct  45   GLFAAFGDGCRRRVLRVGCKKGVEAVLREEASENESSDDNVEKLACVMKFGGSSLASAER  104

Query  564  MREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            MREVADL+L F +E+PVIVLSAMGKTTNNLLLAG
Sbjct  105  MREVADLVLQFRDERPVIVLSAMGKTTNNLLLAG  138



>ref|XP_010492075.1| PREDICTED: aspartokinase 1, chloroplastic-like [Camelina sativa]
Length=574

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 64/87 (74%), Gaps = 0/87 (0%)
 Frame = +3

Query  405  GSSRSRVLRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREVADL  584
            GSS  RV    C+++TI  V      N   +     FTCVMKFGGSSVA+A+RMREVADL
Sbjct  55   GSSIRRVSGSGCRNKTIRAVLDEKKTNAITEVEEKGFTCVMKFGGSSVATAERMREVADL  114

Query  585  ILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            IL+FPEE PVIVLSAMGKTTNNLLLAG
Sbjct  115  ILTFPEESPVIVLSAMGKTTNNLLLAG  141



>ref|XP_010656841.1| PREDICTED: aspartokinase 1, chloroplastic isoform X1 [Vitis vinifera]
Length=573

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 66/94 (70%), Gaps = 0/94 (0%)
 Frame = +3

Query  384  GVCTSIKGSSRSRVLRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQR  563
            G+  +     R RVLRV CK     +++   ++N   D    +  CVMKFGGSS+ASA+R
Sbjct  45   GLFAAFGDGCRRRVLRVGCKKGVEAVLREEASENESSDDNVEKLACVMKFGGSSLASAER  104

Query  564  MREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            MREVADL+L F +E+PVIVLSAMGKTTNNLLLAG
Sbjct  105  MREVADLVLQFRDERPVIVLSAMGKTTNNLLLAG  138



>ref|XP_002882151.1| hypothetical protein ARALYDRAFT_896038 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58410.1| hypothetical protein ARALYDRAFT_896038 [Arabidopsis lyrata subsp. 
lyrata]
Length=562

 Score =   104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 71/98 (72%), Gaps = 7/98 (7%)
 Frame = +3

Query  372  RHVYGVCTSIKGSSRSRVLRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVA  551
            R+V   C +I       VLRV+C++  ++L++  G++    +    + TCVMKFGGSSVA
Sbjct  43   RNVDHACKNI-------VLRVTCEAGRVELLERKGSETFKLNRTEKKLTCVMKFGGSSVA  95

Query  552  SAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            SA+RM++VA LILS+P+EKPV+VLSAM KTTN LL+AG
Sbjct  96   SAERMKQVAKLILSYPDEKPVVVLSAMAKTTNKLLMAG  133



>gb|EPS64336.1| hypothetical protein M569_10444, partial [Genlisea aurea]
Length=484

 Score =   103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = +3

Query  432  VSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREVADLILSFPEEKP  611
            + C++  ID+++ + T+    D      TCVMKFGGSSVASA+R+REVADLIL  PEE+P
Sbjct  1    IRCEAGKIDVLEKNPTRLKNLDPASENLTCVMKFGGSSVASAERIREVADLILGLPEERP  60

Query  612  VIVLSAMGKTTNNLLLAG  665
            VIVLSAMGKTTNNLLLAG
Sbjct  61   VIVLSAMGKTTNNLLLAG  78



>ref|XP_002871599.1| lysine-sensitive aspartate kinase [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47858.1| lysine-sensitive aspartate kinase [Arabidopsis lyrata subsp. 
lyrata]
Length=545

 Score =   104 bits (259),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +3

Query  384  GVCTSIKGSSRSRVLRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQR  563
             V  +++ S R+  LRVSC+   +DL++    +         E TCVMKFGGSSV SA+R
Sbjct  40   AVFRAVEHSCRNIALRVSCEDVRVDLLERKEHETCYSSATGKELTCVMKFGGSSVESAER  99

Query  564  MREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            M+EVA+LILSFP+E+PVIVLSAMGKTTN LL AG
Sbjct  100  MKEVANLILSFPDERPVIVLSAMGKTTNKLLKAG  133



>ref|XP_003553303.1| PREDICTED: aspartokinase 1, chloroplastic-like isoform X1 [Glycine 
max]
 gb|KHN28578.1| Aspartokinase 1, chloroplastic [Glycine soja]
Length=562

 Score =   103 bits (258),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 67/87 (77%), Gaps = 4/87 (5%)
 Frame = +3

Query  408  SSRSRVLRVSCKSQT-IDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREVADL  584
            S R   LRVSC  +T  D+V+    ++ GF      +TCVMKFGGSSVA+A+RMREVA+L
Sbjct  51   SERVAALRVSCSKETESDVVE---GESGGFAETEMSYTCVMKFGGSSVANAERMREVANL  107

Query  585  ILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            ILSFPEE+P+IVLSAMGKTTN LLLAG
Sbjct  108  ILSFPEERPIIVLSAMGKTTNMLLLAG  134



>ref|XP_006408563.1| hypothetical protein EUTSA_v10020441mg [Eutrema salsugineum]
 gb|ESQ50016.1| hypothetical protein EUTSA_v10020441mg [Eutrema salsugineum]
Length=549

 Score =   103 bits (258),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 47/83 (57%), Positives = 66/83 (80%), Gaps = 0/83 (0%)
 Frame = +3

Query  417  SRVLRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREVADLILSF  596
            +R LRV+C++  ++L++   ++    +    + TCVMKFGGSSVASA+RM++VA+LILSF
Sbjct  47   TRALRVTCEAGRVELLERKDSETFKLNRSEKKLTCVMKFGGSSVASAERMKQVANLILSF  106

Query  597  PEEKPVIVLSAMGKTTNNLLLAG  665
            P+EKPV+VLSAM KTTN LL+AG
Sbjct  107  PDEKPVVVLSAMAKTTNKLLMAG  129



>ref|XP_006408564.1| hypothetical protein EUTSA_v10020441mg [Eutrema salsugineum]
 ref|XP_006408565.1| hypothetical protein EUTSA_v10020441mg [Eutrema salsugineum]
 ref|XP_006408566.1| hypothetical protein EUTSA_v10020441mg [Eutrema salsugineum]
 dbj|BAJ33777.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ50017.1| hypothetical protein EUTSA_v10020441mg [Eutrema salsugineum]
 gb|ESQ50018.1| hypothetical protein EUTSA_v10020441mg [Eutrema salsugineum]
 gb|ESQ50019.1| hypothetical protein EUTSA_v10020441mg [Eutrema salsugineum]
Length=552

 Score =   103 bits (258),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 47/83 (57%), Positives = 66/83 (80%), Gaps = 0/83 (0%)
 Frame = +3

Query  417  SRVLRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREVADLILSF  596
            +R LRV+C++  ++L++   ++    +    + TCVMKFGGSSVASA+RM++VA+LILSF
Sbjct  47   TRALRVTCEAGRVELLERKDSETFKLNRSEKKLTCVMKFGGSSVASAERMKQVANLILSF  106

Query  597  PEEKPVIVLSAMGKTTNNLLLAG  665
            P+EKPV+VLSAM KTTN LL+AG
Sbjct  107  PDEKPVVVLSAMAKTTNKLLMAG  129



>ref|XP_006604189.1| PREDICTED: aspartokinase 1, chloroplastic-like isoform X2 [Glycine 
max]
 ref|XP_006604190.1| PREDICTED: aspartokinase 1, chloroplastic-like isoform X3 [Glycine 
max]
 ref|XP_006604191.1| PREDICTED: aspartokinase 1, chloroplastic-like isoform X4 [Glycine 
max]
Length=571

 Score =   103 bits (258),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 67/87 (77%), Gaps = 4/87 (5%)
 Frame = +3

Query  408  SSRSRVLRVSCKSQT-IDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREVADL  584
            S R   LRVSC  +T  D+V+    ++ GF      +TCVMKFGGSSVA+A+RMREVA+L
Sbjct  51   SERVAALRVSCSKETESDVVE---GESGGFAETEMSYTCVMKFGGSSVANAERMREVANL  107

Query  585  ILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            ILSFPEE+P+IVLSAMGKTTN LLLAG
Sbjct  108  ILSFPEERPIIVLSAMGKTTNMLLLAG  134



>emb|CAC06395.1| aspartate kinase [Arabidopsis thaliana]
Length=544

 Score =   103 bits (257),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 66/94 (70%), Gaps = 0/94 (0%)
 Frame = +3

Query  384  GVCTSIKGSSRSRVLRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQR  563
             V   ++ S R+  LRVSC++  +DL+Q    +     G   E TCVMKFGGSSV SA+R
Sbjct  39   AVFRDVEHSCRNIGLRVSCEALRVDLLQRKEPETCDSSGTGKELTCVMKFGGSSVGSAER  98

Query  564  MREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            M+EVA+LI SFP+E+PVIVLSAMGKT N LL AG
Sbjct  99   MKEVANLIFSFPDERPVIVLSAMGKTINKLLKAG  132



>gb|AAB63104.1| lysine-sensitive aspartate kinase [Arabidopsis thaliana]
Length=544

 Score =   103 bits (257),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 66/94 (70%), Gaps = 0/94 (0%)
 Frame = +3

Query  384  GVCTSIKGSSRSRVLRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQR  563
             V   ++ S R+  LRVSC++  +DL+Q    +     G   E TCVMKFGGSSV SA+R
Sbjct  39   AVFRDVEHSCRNIGLRVSCEALRVDLLQRKEPETCDSSGTGKELTCVMKFGGSSVGSAER  98

Query  564  MREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            M+EVA+LI SFP+E+PVIVLSAMGKT N LL AG
Sbjct  99   MKEVANLIFSFPDERPVIVLSAMGKTINKLLKAG  132



>ref|XP_010250548.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X2 [Nelumbo 
nucifera]
Length=576

 Score =   103 bits (257),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 81/134 (60%), Gaps = 13/134 (10%)
 Frame = +3

Query  294  TPYPYFPKECKASLHFRPLWSQTI-----DLRHVYGVCTSI-----KGSSRSRVLRVSCK  443
            TP+  F +    S HF PL S  +     DL  +      +     +G    R  ++SC+
Sbjct  12   TPHTGFRR---YSSHFLPLSSVKLSSTLSDLAALVASSAGLLNRRPEGPRTRRAFKISCE  68

Query  444  SQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVL  623
            +  +   +    ++  FD    + TCVMKFGGSSVASA+RM+EVA+LILSFPEE+PV+VL
Sbjct  69   TGALAFREKVENESQSFDRNVGQLTCVMKFGGSSVASAERMKEVAELILSFPEERPVLVL  128

Query  624  SAMGKTTNNLLLAG  665
            SAMGKTTN LLLAG
Sbjct  129  SAMGKTTNKLLLAG  142



>ref|XP_010250546.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X1 [Nelumbo 
nucifera]
Length=578

 Score =   103 bits (257),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 81/134 (60%), Gaps = 13/134 (10%)
 Frame = +3

Query  294  TPYPYFPKECKASLHFRPLWSQTI-----DLRHVYGVCTSI-----KGSSRSRVLRVSCK  443
            TP+  F +    S HF PL S  +     DL  +      +     +G    R  ++SC+
Sbjct  12   TPHTGFRR---YSSHFLPLSSVKLSSTLSDLAALVASSAGLLNRRPEGPRTRRAFKISCE  68

Query  444  SQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVL  623
            +  +   +    ++  FD    + TCVMKFGGSSVASA+RM+EVA+LILSFPEE+PV+VL
Sbjct  69   TGALAFREKVENESQSFDRNVGQLTCVMKFGGSSVASAERMKEVAELILSFPEERPVLVL  128

Query  624  SAMGKTTNNLLLAG  665
            SAMGKTTN LLLAG
Sbjct  129  SAMGKTTNKLLLAG  142



>ref|NP_001238151.1| precursor monofunctional aspartokinase [Glycine max]
 gb|AAD41796.1| precursor monofunctional aspartokinase [Glycine max]
Length=564

 Score =   103 bits (256),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 79/117 (68%), Gaps = 12/117 (10%)
 Frame = +3

Query  321  CKASLHFRPLWSQTIDLRHVYGVCTSIKGSSRSRVLRVSCKSQTIDLVQLSGTQN--LGF  494
            CK+ + F  L +  +  R V+G        +R      +CK+ T D+++ + T+N  +  
Sbjct  28   CKSQIGFAALGA-PVCARRVWG--------NRVAFSVTTCKASTSDVIEKNATENGMVSS  78

Query  495  DGVPSEFTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            +G  S FTCVMKFGGSSVASA RM+EVA LILSFPEE+P++VLSAMGKTTN LLLAG
Sbjct  79   EGETS-FTCVMKFGGSSVASADRMKEVATLILSFPEERPIVVLSAMGKTTNKLLLAG  134



>gb|KGN51126.1| hypothetical protein Csa_5G457770 [Cucumis sativus]
Length=560

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 67/139 (48%), Positives = 83/139 (60%), Gaps = 11/139 (8%)
 Frame = +3

Query  264  METLMHLRGTTPYPYFPKECKA----SLHFRPLWSQTIDLRHVYGVCTSIKGSSRSRV-L  428
            ME  ++L G          C++     LHF    +QT       G+ T+ K  S  RV L
Sbjct  1    MEGALNLLGGATICPASTRCQSLLSPQLHFVSSIAQT------AGLYTNGKRLSCRRVGL  54

Query  429  RVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREVADLILSFPEEK  608
            RV C+    D++    T++        +FTCVMKFGGSSVASA+RM EVA+LI SFPEE+
Sbjct  55   RVRCERNVADVLDRKVTESRSSGDNEQQFTCVMKFGGSSVASAERMMEVAELIRSFPEER  114

Query  609  PVIVLSAMGKTTNNLLLAG  665
            PVIVLSAMGKTTN LLLAG
Sbjct  115  PVIVLSAMGKTTNKLLLAG  133



>ref|XP_006574471.1| PREDICTED: precursor monofunctional aspartokinase isoform X2 
[Glycine max]
Length=562

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 65/79 (82%), Gaps = 3/79 (4%)
 Frame = +3

Query  435  SCKSQTIDLVQLSGTQN--LGFDGVPSEFTCVMKFGGSSVASAQRMREVADLILSFPEEK  608
            +CK+ T D+++ + T+N  +  +G  S FTCVMKFGGSSVASA RM+EVA LILSFPEE+
Sbjct  57   TCKASTSDVIEKNATENGMVSSEGETS-FTCVMKFGGSSVASADRMKEVATLILSFPEER  115

Query  609  PVIVLSAMGKTTNNLLLAG  665
            P++VLSAMGKTTN LLLAG
Sbjct  116  PIVVLSAMGKTTNKLLLAG  134



>ref|XP_008776937.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008776944.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008776949.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X2 [Phoenix 
dactylifera]
Length=567

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 61/80 (76%), Gaps = 0/80 (0%)
 Frame = +3

Query  426  LRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREVADLILSFPEE  605
            L+V C+     +V+       G DG  ++ + VMKFGGSSVASA RMREVADLILSFPEE
Sbjct  57   LKVCCERGLSAIVEKHEVVREGADGNAAQLSIVMKFGGSSVASADRMREVADLILSFPEE  116

Query  606  KPVIVLSAMGKTTNNLLLAG  665
            +PVIVLSAMGKTTNNLLLAG
Sbjct  117  RPVIVLSAMGKTTNNLLLAG  136



>ref|XP_006574470.1| PREDICTED: precursor monofunctional aspartokinase isoform X1 
[Glycine max]
Length=564

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 65/79 (82%), Gaps = 3/79 (4%)
 Frame = +3

Query  435  SCKSQTIDLVQLSGTQN--LGFDGVPSEFTCVMKFGGSSVASAQRMREVADLILSFPEEK  608
            +CK+ T D+++ + T+N  +  +G  S FTCVMKFGGSSVASA RM+EVA LILSFPEE+
Sbjct  57   TCKASTSDVIEKNATENGMVSSEGETS-FTCVMKFGGSSVASADRMKEVATLILSFPEER  115

Query  609  PVIVLSAMGKTTNNLLLAG  665
            P++VLSAMGKTTN LLLAG
Sbjct  116  PIVVLSAMGKTTNKLLLAG  134



>ref|XP_010926857.1| PREDICTED: aspartokinase 2, chloroplastic isoform X2 [Elaeis 
guineensis]
Length=497

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 60/80 (75%), Gaps = 0/80 (0%)
 Frame = +3

Query  426  LRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREVADLILSFPEE  605
            L+V C+     +V+         DG  ++ + VMKFGGSSVASA RMREVADLILSFPEE
Sbjct  57   LKVCCEKGASAIVEKHEVVREDADGNAAQLSIVMKFGGSSVASADRMREVADLILSFPEE  116

Query  606  KPVIVLSAMGKTTNNLLLAG  665
            +PVIVLSAMGKTTNNLLLAG
Sbjct  117  RPVIVLSAMGKTTNNLLLAG  136



>emb|CDX69652.1| BnaA10g20010D [Brassica napus]
Length=551

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 69/98 (70%), Gaps = 14/98 (14%)
 Frame = +3

Query  372  RHVYGVCTSIKGSSRSRVLRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVA  551
            R+V G C  +KG+     +R   + +  D+++         +G    FTCVMKFGGSSVA
Sbjct  55   RNVSGSC--LKGT-----VRAVMEEEKTDVIKER-------EGDEKRFTCVMKFGGSSVA  100

Query  552  SAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            +A+RMREVADLIL+FPEE PVIVLSAMGKTTNNLLLAG
Sbjct  101  TAERMREVADLILAFPEESPVIVLSAMGKTTNNLLLAG  138



>ref|XP_007151724.1| hypothetical protein PHAVU_004G070100g [Phaseolus vulgaris]
 gb|ESW23718.1| hypothetical protein PHAVU_004G070100g [Phaseolus vulgaris]
Length=543

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 66/82 (80%), Gaps = 7/82 (9%)
 Frame = +3

Query  432  VSCKSQTIDLVQLSGTQNLGFDGVPSE----FTCVMKFGGSSVASAQRMREVADLILSFP  599
            V+CK+   D+++ S T+   ++ V SE    FTCVMKFGGSSVAS++RM+EVA LILSFP
Sbjct  50   VTCKASANDVIEKSVTE---YEKVSSEGEISFTCVMKFGGSSVASSERMKEVATLILSFP  106

Query  600  EEKPVIVLSAMGKTTNNLLLAG  665
            EE+P++VLSAMGKTTN LLLAG
Sbjct  107  EERPIVVLSAMGKTTNKLLLAG  128



>ref|XP_007151723.1| hypothetical protein PHAVU_004G070100g [Phaseolus vulgaris]
 gb|ESW23717.1| hypothetical protein PHAVU_004G070100g [Phaseolus vulgaris]
Length=545

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 66/82 (80%), Gaps = 7/82 (9%)
 Frame = +3

Query  432  VSCKSQTIDLVQLSGTQNLGFDGVPSE----FTCVMKFGGSSVASAQRMREVADLILSFP  599
            V+CK+   D+++ S T+   ++ V SE    FTCVMKFGGSSVAS++RM+EVA LILSFP
Sbjct  50   VTCKASANDVIEKSVTE---YEKVSSEGEISFTCVMKFGGSSVASSERMKEVATLILSFP  106

Query  600  EEKPVIVLSAMGKTTNNLLLAG  665
            EE+P++VLSAMGKTTN LLLAG
Sbjct  107  EERPIVVLSAMGKTTNKLLLAG  128



>ref|XP_009121776.1| PREDICTED: aspartokinase 1, chloroplastic [Brassica rapa]
Length=571

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 69/98 (70%), Gaps = 14/98 (14%)
 Frame = +3

Query  372  RHVYGVCTSIKGSSRSRVLRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVA  551
            R+V G C  +KG+     +R   + +  D+++         +G    FTCVMKFGGSSVA
Sbjct  55   RNVSGSC--LKGT-----VRAVMEEEKTDVIKER-------EGDEKRFTCVMKFGGSSVA  100

Query  552  SAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            +A+RMREVADLIL+FPEE PVIVLSAMGKTTNNLLLAG
Sbjct  101  TAERMREVADLILAFPEESPVIVLSAMGKTTNNLLLAG  138



>gb|KFK25564.1| hypothetical protein AALP_AA8G131200 [Arabis alpina]
Length=572

 Score =   101 bits (252),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 65/89 (73%), Gaps = 2/89 (2%)
 Frame = +3

Query  405  GSS-RSRVLRVSCKSQTIDLVQLSGTQNLGFDGVPSE-FTCVMKFGGSSVASAQRMREVA  578
            GSS R RVL   C      ++    T  +  + V  + FTCVMKFGGSSVASA+RM+EVA
Sbjct  51   GSSIRRRVLSTGCGKTVRAVLDEKKTDVIKEEVVEEKRFTCVMKFGGSSVASAERMKEVA  110

Query  579  DLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            DLIL+FPEE PVIVLSAMGKTTNNLLLAG
Sbjct  111  DLILTFPEESPVIVLSAMGKTTNNLLLAG  139



>ref|XP_008790700.1| PREDICTED: aspartokinase 2, chloroplastic-like [Phoenix dactylifera]
Length=569

 Score =   101 bits (252),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 60/79 (76%), Gaps = 0/79 (0%)
 Frame = +3

Query  429  RVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREVADLILSFPEEK  608
            +V C+     +V+  G    G DG  ++ + VMKFGGSSVASA RMREVA+LIL FPEE+
Sbjct  58   KVRCQRGASAIVEKDGLVREGADGNAAQLSIVMKFGGSSVASADRMREVANLILRFPEER  117

Query  609  PVIVLSAMGKTTNNLLLAG  665
            PVIVLSAMGKTTNNLLLAG
Sbjct  118  PVIVLSAMGKTTNNLLLAG  136



>ref|XP_010926856.1| PREDICTED: aspartokinase 2, chloroplastic isoform X1 [Elaeis 
guineensis]
Length=567

 Score =   101 bits (251),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 60/80 (75%), Gaps = 0/80 (0%)
 Frame = +3

Query  426  LRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREVADLILSFPEE  605
            L+V C+     +V+         DG  ++ + VMKFGGSSVASA RMREVADLILSFPEE
Sbjct  57   LKVCCEKGASAIVEKHEVVREDADGNAAQLSIVMKFGGSSVASADRMREVADLILSFPEE  116

Query  606  KPVIVLSAMGKTTNNLLLAG  665
            +PVIVLSAMGKTTNNLLLAG
Sbjct  117  RPVIVLSAMGKTTNNLLLAG  136



>ref|XP_008222377.1| PREDICTED: aspartokinase 1, chloroplastic [Prunus mume]
Length=570

 Score =   101 bits (251),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 66/139 (47%), Positives = 86/139 (62%), Gaps = 27/139 (19%)
 Frame = +3

Query  324  KASLHFR----PLWSQTIDLRHVYGV--CTSIKGSSRS-----------RVLRVSCKSQT  452
            +ASLHF     P +S+T  L H+      +S+   SRS             LR + + + 
Sbjct  2    EASLHFHGVRIPCYSRTPRLSHLSSKPWLSSVASPSRSFHAAMENACKGSSLRGNSEKKR  61

Query  453  IDLV--------QLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREVADLILSFPEEK  608
            I+ V        + + T++ G D  P  FTCVMKFGGSS+ASA+R+RE+A LI+SFPEEK
Sbjct  62   IEAVLGGGEEEEEENATESHGSDVAP--FTCVMKFGGSSLASAERIREIAQLIVSFPEEK  119

Query  609  PVIVLSAMGKTTNNLLLAG  665
            PV+VLSAMGKTTNNLLLAG
Sbjct  120  PVVVLSAMGKTTNNLLLAG  138



>ref|NP_186851.1| aspartokinase 3 [Arabidopsis thaliana]
 sp|Q9S702.1|AK3_ARATH RecName: Full=Aspartokinase 3, chloroplastic; AltName: Full=Aspartate 
kinase 3; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF03452.1|AC010797_28 putative aspartate kinase [Arabidopsis thaliana]
 gb|AAF14833.1|AC011664_15 putative aspartate kinase [Arabidopsis thaliana]
 gb|AAM65905.1| putative aspartate kinase [Arabidopsis thaliana]
 dbj|BAE98365.1| putative aspartate kinase [Arabidopsis thaliana]
 gb|AEE73750.1| aspartokinase 3 [Arabidopsis thaliana]
Length=559

 Score =   100 bits (250),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 67/90 (74%), Gaps = 0/90 (0%)
 Frame = +3

Query  396  SIKGSSRSRVLRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREV  575
            ++  S ++  LRV+C++  ++L++   ++    +    + TCVMKFGGSSVASA+RM +V
Sbjct  44   NVDRSCKNIALRVTCEAGRVELLERKASETFKLNKTEKKLTCVMKFGGSSVASAERMIQV  103

Query  576  ADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            A LILSFP+EKPV+VLSAM KTTN LL+AG
Sbjct  104  AKLILSFPDEKPVVVLSAMAKTTNKLLMAG  133



>ref|XP_008465552.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X3 [Cucumis 
melo]
Length=564

 Score =   100 bits (250),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 62/86 (72%), Gaps = 0/86 (0%)
 Frame = +3

Query  408  SSRSRVLRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREVADLI  587
            S R   LRV C+    D++    T++        +FTCVMKFGGSSVASA+RM EVA+LI
Sbjct  48   SCRRLGLRVRCERNAADVLDRKVTESRSSGDNEQQFTCVMKFGGSSVASAERMMEVAELI  107

Query  588  LSFPEEKPVIVLSAMGKTTNNLLLAG  665
             SFPEE+PVIVLSAMGKTTN LLLAG
Sbjct  108  RSFPEERPVIVLSAMGKTTNKLLLAG  133



>ref|XP_008465546.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X2 [Cucumis 
melo]
Length=566

 Score =   100 bits (250),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 62/86 (72%), Gaps = 0/86 (0%)
 Frame = +3

Query  408  SSRSRVLRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREVADLI  587
            S R   LRV C+    D++    T++        +FTCVMKFGGSSVASA+RM EVA+LI
Sbjct  48   SCRRLGLRVRCERNAADVLDRKVTESRSSGDNEQQFTCVMKFGGSSVASAERMMEVAELI  107

Query  588  LSFPEEKPVIVLSAMGKTTNNLLLAG  665
             SFPEE+PVIVLSAMGKTTN LLLAG
Sbjct  108  RSFPEERPVIVLSAMGKTTNKLLLAG  133



>ref|XP_008465539.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X1 [Cucumis 
melo]
Length=581

 Score =   100 bits (250),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 62/86 (72%), Gaps = 0/86 (0%)
 Frame = +3

Query  408  SSRSRVLRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREVADLI  587
            S R   LRV C+    D++    T++        +FTCVMKFGGSSVASA+RM EVA+LI
Sbjct  48   SCRRLGLRVRCERNAADVLDRKVTESRSSGDNEQQFTCVMKFGGSSVASAERMMEVAELI  107

Query  588  LSFPEEKPVIVLSAMGKTTNNLLLAG  665
             SFPEE+PVIVLSAMGKTTN LLLAG
Sbjct  108  RSFPEERPVIVLSAMGKTTNKLLLAG  133



>ref|XP_010496416.1| PREDICTED: aspartokinase 3, chloroplastic [Camelina sativa]
 ref|XP_010496417.1| PREDICTED: aspartokinase 3, chloroplastic [Camelina sativa]
Length=568

 Score =   100 bits (250),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +3

Query  426  LRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREVADLILSFPEE  605
            LRV+C++  ++L++    +    +    + TCVMKFGGSSVASA+RM++VA LILSFP+E
Sbjct  58   LRVTCEAARVELLERKEYETFKLNKTEKKLTCVMKFGGSSVASAERMKQVAKLILSFPDE  117

Query  606  KPVIVLSAMGKTTNNLLLAG  665
            KPV+VLSAM KTTN LL+AG
Sbjct  118  KPVVVLSAMAKTTNKLLMAG  137



>ref|XP_003548032.1| PREDICTED: aspartokinase 1, chloroplastic-like isoform X1 [Glycine 
max]
Length=567

 Score =   100 bits (250),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 66/80 (83%), Gaps = 4/80 (5%)
 Frame = +3

Query  435  SCK-SQTIDLVQLSGTQN--LGFDGVPSEFTCVMKFGGSSVASAQRMREVADLILSFPEE  605
            +CK S T D+++ S T+N  +  +G  S FTCVMKFGGSSVASA+RM+EVA LILSFPEE
Sbjct  55   TCKASTTSDVIEKSVTENRVVSIEGETS-FTCVMKFGGSSVASAERMKEVATLILSFPEE  113

Query  606  KPVIVLSAMGKTTNNLLLAG  665
            +P++VLSAMGKTTN LLLAG
Sbjct  114  RPIVVLSAMGKTTNKLLLAG  133



>ref|XP_006599412.1| PREDICTED: aspartokinase 1, chloroplastic-like isoform X2 [Glycine 
max]
Length=565

 Score =   100 bits (249),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 66/80 (83%), Gaps = 4/80 (5%)
 Frame = +3

Query  435  SCK-SQTIDLVQLSGTQN--LGFDGVPSEFTCVMKFGGSSVASAQRMREVADLILSFPEE  605
            +CK S T D+++ S T+N  +  +G  S FTCVMKFGGSSVASA+RM+EVA LILSFPEE
Sbjct  55   TCKASTTSDVIEKSVTENRVVSIEGETS-FTCVMKFGGSSVASAERMKEVATLILSFPEE  113

Query  606  KPVIVLSAMGKTTNNLLLAG  665
            +P++VLSAMGKTTN LLLAG
Sbjct  114  RPIVVLSAMGKTTNKLLLAG  133



>gb|KHN13387.1| Aspartokinase 1, chloroplastic [Glycine soja]
Length=568

 Score =   100 bits (249),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 66/80 (83%), Gaps = 4/80 (5%)
 Frame = +3

Query  435  SCK-SQTIDLVQLSGTQN--LGFDGVPSEFTCVMKFGGSSVASAQRMREVADLILSFPEE  605
            +CK S T D+++ S T+N  +  +G  S FTCVMKFGGSSVASA+RM+EVA LILSFPEE
Sbjct  55   TCKASTTSDVIEKSVTENRVVSIEGETS-FTCVMKFGGSSVASAERMKEVATLILSFPEE  113

Query  606  KPVIVLSAMGKTTNNLLLAG  665
            +P++VLSAMGKTTN LLLAG
Sbjct  114  RPIVVLSAMGKTTNKLLLAG  133



>ref|XP_010530884.1| PREDICTED: aspartokinase 1, chloroplastic-like [Tarenaya hassleriana]
Length=572

 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 65/85 (76%), Gaps = 1/85 (1%)
 Frame = +3

Query  414  RSRVLRVSCKSQTIDLVQLSGTQNLG-FDGVPSEFTCVMKFGGSSVASAQRMREVADLIL  590
            R+R+   SC+     +++ S T+     +     FTCVMKFGGSS+ASA+RM+EVADLIL
Sbjct  55   RTRLSLRSCRGAVRAVLEESKTETKAETEDEEKGFTCVMKFGGSSLASAERMKEVADLIL  114

Query  591  SFPEEKPVIVLSAMGKTTNNLLLAG  665
            SFPEE+PV+VLSAMGKTTNNLLLAG
Sbjct  115  SFPEERPVVVLSAMGKTTNNLLLAG  139



>ref|XP_010453390.1| PREDICTED: aspartokinase 1, chloroplastic [Camelina sativa]
Length=573

 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 64/87 (74%), Gaps = 1/87 (1%)
 Frame = +3

Query  405  GSSRSRVLRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREVADL  584
            GSS +RV    C++    ++    T  L  +     FTCVMKFGGSSVA+A+RMREVADL
Sbjct  55   GSSVTRVSGSGCRNSIRAVLDEKKTDALT-EVEEKGFTCVMKFGGSSVATAERMREVADL  113

Query  585  ILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            IL+FPEE PVIVLSAMGKTTNNLLLAG
Sbjct  114  ILTFPEESPVIVLSAMGKTTNNLLLAG  140



>ref|XP_010419903.1| PREDICTED: aspartokinase 1, chloroplastic-like [Camelina sativa]
Length=574

 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/51 (92%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +3

Query  513  FTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            FTCVMKFGGSSVA+A+RMREVADLIL+FPEE PVIVLSAMGKTTNNLLLAG
Sbjct  91   FTCVMKFGGSSVATAERMREVADLILTFPEESPVIVLSAMGKTTNNLLLAG  141



>ref|XP_002871558.1| AK-LYS1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47817.1| AK-LYS1 [Arabidopsis lyrata subsp. lyrata]
Length=570

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/51 (92%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +3

Query  513  FTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            FTCVMKFGGSSVASA+RM+EVADLIL+FPEE PVIVLSAMGKTTNNLLLAG
Sbjct  88   FTCVMKFGGSSVASAERMKEVADLILTFPEESPVIVLSAMGKTTNNLLLAG  138



>ref|XP_004515405.1| PREDICTED: aspartokinase 1, chloroplastic-like isoform X2 [Cicer 
arietinum]
Length=558

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 59/138 (43%), Positives = 86/138 (62%), Gaps = 12/138 (9%)
 Frame = +3

Query  264  METLMHLRGTTPYPYFPKECKASLHFRPLWSQTIDLRHVYGVCTSIKGSSRSRVLRVSCK  443
            M + ++LR     PY P      + +R       D+  ++ V      +  + +L+V+CK
Sbjct  1    MASALNLRHYGVKPYLP------VTWRQRNGSVSDVHRLF-VWNDNNYNKTASLLKVTCK  53

Query  444  SQTIDLVQLSGTQNLGFDGVPSE----FTCVMKFGGSSVASAQRMREVADLILSFPEEKP  611
              T D+++    +N+G   V S+    ++CVMKFGGSSVASA RM+EV +L+LSFPEE+P
Sbjct  54   V-TNDVLEKHVIENVGGKLVMSDETMSYSCVMKFGGSSVASADRMKEVVNLVLSFPEERP  112

Query  612  VIVLSAMGKTTNNLLLAG  665
            ++VLSAMGKTTN LLLAG
Sbjct  113  IVVLSAMGKTTNKLLLAG  130



>emb|CDX91135.1| BnaC02g04620D [Brassica napus]
Length=555

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/51 (90%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +3

Query  513  FTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            FTCVMKFGGSSVA+A+RMREVADL+L+FPEE PVIVLSAMGKTTNNLLLAG
Sbjct  92   FTCVMKFGGSSVATAERMREVADLVLTFPEESPVIVLSAMGKTTNNLLLAG  142



>emb|CDY09781.1| BnaC09g43800D [Brassica napus]
Length=550

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/51 (90%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +3

Query  513  FTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            FTCVMKFGGSSVA+A+RMREVADLIL+FPEE PV+VLSAMGKTTNNLLLAG
Sbjct  87   FTCVMKFGGSSVATAERMREVADLILAFPEESPVVVLSAMGKTTNNLLLAG  137



>ref|XP_004515404.1| PREDICTED: aspartokinase 1, chloroplastic-like isoform X1 [Cicer 
arietinum]
Length=560

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 59/138 (43%), Positives = 86/138 (62%), Gaps = 12/138 (9%)
 Frame = +3

Query  264  METLMHLRGTTPYPYFPKECKASLHFRPLWSQTIDLRHVYGVCTSIKGSSRSRVLRVSCK  443
            M + ++LR     PY P      + +R       D+  ++ V      +  + +L+V+CK
Sbjct  1    MASALNLRHYGVKPYLP------VTWRQRNGSVSDVHRLF-VWNDNNYNKTASLLKVTCK  53

Query  444  SQTIDLVQLSGTQNLGFDGVPSE----FTCVMKFGGSSVASAQRMREVADLILSFPEEKP  611
              T D+++    +N+G   V S+    ++CVMKFGGSSVASA RM+EV +L+LSFPEE+P
Sbjct  54   V-TNDVLEKHVIENVGGKLVMSDETMSYSCVMKFGGSSVASADRMKEVVNLVLSFPEERP  112

Query  612  VIVLSAMGKTTNNLLLAG  665
            ++VLSAMGKTTN LLLAG
Sbjct  113  IVVLSAMGKTTNKLLLAG  130



>ref|XP_009125901.1| PREDICTED: aspartokinase 1, chloroplastic-like [Brassica rapa]
Length=574

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/51 (90%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +3

Query  513  FTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            FTCVMKFGGSSVA+A+RMREVADL+L+FPEE PVIVLSAMGKTTNNLLLAG
Sbjct  91   FTCVMKFGGSSVATAERMREVADLVLTFPEESPVIVLSAMGKTTNNLLLAG  141



>emb|CDX85659.1| BnaA02g01540D [Brassica napus]
Length=554

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/51 (90%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +3

Query  513  FTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            FTCVMKFGGSSVA+A+RMREVADL+L+FPEE PVIVLSAMGKTTNNLLLAG
Sbjct  91   FTCVMKFGGSSVATAERMREVADLVLTFPEESPVIVLSAMGKTTNNLLLAG  141



>ref|XP_006300280.1| hypothetical protein CARUB_v100158421mg, partial [Capsella rubella]
 gb|EOA33178.1| hypothetical protein CARUB_v100158421mg, partial [Capsella rubella]
Length=307

 Score = 96.7 bits (239),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 64/89 (72%), Gaps = 0/89 (0%)
 Frame = +3

Query  399  IKGSSRSRVLRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREVA  578
            +  S ++  LRV+C++  ++L++    +    +    + TCVMKFGGSSVASA+RM++VA
Sbjct  46   VDHSCKNIALRVTCEAARVELLEREDYETFKLNRTERKLTCVMKFGGSSVASAERMKQVA  105

Query  579  DLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
             LI S P+EKPV+VLSAM KTTN LL+AG
Sbjct  106  KLIFSSPDEKPVVVLSAMAKTTNKLLMAG  134



>ref|XP_006399820.1| hypothetical protein EUTSA_v10013112mg [Eutrema salsugineum]
 gb|ESQ41273.1| hypothetical protein EUTSA_v10013112mg [Eutrema salsugineum]
Length=571

 Score = 99.0 bits (245),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 47/51 (92%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +3

Query  513  FTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            FTCVMKFGGSSVA+A+RMREVADLIL+FPEE PVIVLSAMGKTTNNLLLAG
Sbjct  88   FTCVMKFGGSSVATAERMREVADLILTFPEECPVIVLSAMGKTTNNLLLAG  138



>ref|XP_002459732.1| hypothetical protein SORBIDRAFT_02g009570 [Sorghum bicolor]
 gb|EER96253.1| hypothetical protein SORBIDRAFT_02g009570 [Sorghum bicolor]
Length=458

 Score = 97.4 bits (241),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 55/66 (83%), Gaps = 3/66 (5%)
 Frame = +3

Query  468  LSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTN  647
            ++  Q  G DG   E T VMKFGGSSVASA+RMREVADLILSFPEE+PV+VLSAMGKTTN
Sbjct  63   VAAAQERGGDG---ELTVVMKFGGSSVASAERMREVADLILSFPEERPVVVLSAMGKTTN  119

Query  648  NLLLAG  665
             LL+AG
Sbjct  120  KLLMAG  125



>gb|ABK24292.1| unknown [Picea sitchensis]
Length=568

 Score = 98.2 bits (243),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 69/96 (72%), Gaps = 1/96 (1%)
 Frame = +3

Query  378  VYGVCTSIKGSSRSRVLRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASA  557
            V G C  +K  +  R   V  +S++I +  +  ++N+       EFTCVMKFGGSSVASA
Sbjct  50   VDGFCGVVKVCNSGRKTAV-IRSESIGVAVVEKSENVQKKSDEPEFTCVMKFGGSSVASA  108

Query  558  QRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            +RM+EVADLILSF +E+P++VLSAMGK+TNNLL AG
Sbjct  109  ERMKEVADLILSFDQERPLVVLSAMGKSTNNLLQAG  144



>gb|AAO37952.1| putative aspartate kinase [Oryza sativa Japonica Group]
Length=221

 Score = 94.7 bits (234),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 46/51 (90%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = +3

Query  513  FTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            FT  MKFGGSSVASA+RMREVADLILSFPEE PV+VLSAMGKTTNNLLLAG
Sbjct  80   FTVAMKFGGSSVASAERMREVADLILSFPEETPVVVLSAMGKTTNNLLLAG  130



>ref|XP_006652023.1| PREDICTED: aspartokinase 1, chloroplastic-like [Oryza brachyantha]
Length=561

 Score = 98.2 bits (243),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 63/88 (72%), Gaps = 2/88 (2%)
 Frame = +3

Query  408  SSRSRVLRVSCKSQTIDLVQLSG--TQNLGFDGVPSEFTCVMKFGGSSVASAQRMREVAD  581
            SSR+R L V C+S    +V   G          V + FT VMKFGGSSVASA+RMREVAD
Sbjct  39   SSRTRGLVVRCRSGAPAVVLNKGDAASVAAASAVATGFTVVMKFGGSSVASAERMREVAD  98

Query  582  LILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            LIL FPEE PV+VLSAMGKTTNNLLLAG
Sbjct  99   LILGFPEENPVVVLSAMGKTTNNLLLAG  126



>pdb|2CDQ|A Chain A, Crystal Structure Of Arabidopsis Thaliana Aspartate 
Kinase Complexed With Lysine And S-Adenosylmethionine
 pdb|2CDQ|B Chain B, Crystal Structure Of Arabidopsis Thaliana Aspartate 
Kinase Complexed With Lysine And S-Adenosylmethionine
Length=510

 Score = 97.8 bits (242),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 46/51 (90%), Positives = 49/51 (96%), Gaps = 0/51 (0%)
 Frame = +3

Query  513  FTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
             TCVMKFGGSSVASA+RM+EVADLIL+FPEE PVIVLSAMGKTTNNLLLAG
Sbjct  27   ITCVMKFGGSSVASAERMKEVADLILTFPEESPVIVLSAMGKTTNNLLLAG  77



>ref|XP_007223118.1| hypothetical protein PRUPE_ppa003770mg [Prunus persica]
 gb|EMJ24317.1| hypothetical protein PRUPE_ppa003770mg [Prunus persica]
Length=550

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 65/139 (47%), Positives = 84/139 (60%), Gaps = 27/139 (19%)
 Frame = +3

Query  324  KASLHFR----PLWSQTIDLRHVYGV--CTSIKGSSRSR-----------VLRVSCKSQT  452
            +ASLHF     P +S+T  L H+      +S+   SRS             LR + + + 
Sbjct  2    EASLHFHGVRIPCYSRTPRLSHLSSKPWLSSVASPSRSFHAAMENACKGISLRGNSEKKR  61

Query  453  IDLV--------QLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREVADLILSFPEEK  608
            I+ V        +   T + G D  P  FTCVMKFGGSS+ASA+R+RE+A LI+SFP+EK
Sbjct  62   IEAVLGGEEEEEEEKATGSHGSDTAP--FTCVMKFGGSSLASAERIREIAQLIVSFPDEK  119

Query  609  PVIVLSAMGKTTNNLLLAG  665
            PV+VLSAMGKTTNNLLLAG
Sbjct  120  PVVVLSAMGKTTNNLLLAG  138



>ref|XP_002466095.1| hypothetical protein SORBIDRAFT_01g001140 [Sorghum bicolor]
 gb|EER93093.1| hypothetical protein SORBIDRAFT_01g001140 [Sorghum bicolor]
Length=566

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/53 (87%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +3

Query  507  SEFTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            +EFT VMKFGGSS+ASA+RMREVADLILSFP+E PV+VLSAMGKTTNNLLLAG
Sbjct  79   AEFTVVMKFGGSSLASAERMREVADLILSFPDETPVVVLSAMGKTTNNLLLAG  131



>emb|CAA67376.1| aspartate kinase [Arabidopsis thaliana]
Length=569

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/51 (90%), Positives = 49/51 (96%), Gaps = 0/51 (0%)
 Frame = +3

Query  513  FTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
             TCVMKFGGSSVASA+RM+EVADLIL+FPEE PVIVLSAMGKTTNNLLLAG
Sbjct  86   ITCVMKFGGSSVASAERMKEVADLILTFPEESPVIVLSAMGKTTNNLLLAG  136



>ref|NP_196832.1| aspartokinase 1 [Arabidopsis thaliana]
 sp|Q9LYU8.1|AK1_ARATH RecName: Full=Aspartokinase 1, chloroplastic; AltName: Full=Aspartate 
kinase 1; Flags: Precursor [Arabidopsis thaliana]
 emb|CAB86635.1| aspartate kinase [Arabidopsis thaliana]
 gb|AAL15305.1| AT5g13280/T31B5_100 [Arabidopsis thaliana]
 gb|AAN18062.1| At5g13280/T31B5_100 [Arabidopsis thaliana]
 gb|AED91874.1| aspartokinase 1 [Arabidopsis thaliana]
Length=569

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/51 (90%), Positives = 49/51 (96%), Gaps = 0/51 (0%)
 Frame = +3

Query  513  FTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
             TCVMKFGGSSVASA+RM+EVADLIL+FPEE PVIVLSAMGKTTNNLLLAG
Sbjct  86   ITCVMKFGGSSVASAERMKEVADLILTFPEESPVIVLSAMGKTTNNLLLAG  136



>dbj|BAC84902.1| putative precursor monofunctional aspartokinase [Oryza sativa 
Japonica Group]
 dbj|BAD31993.1| putative precursor monofunctional aspartokinase [Oryza sativa 
Japonica Group]
Length=573

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/53 (89%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +3

Query  507  SEFTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            SE T VMKFGGSSVASA+RMREVADLILSFPEE+PVIVLSAMGKTTN LL+AG
Sbjct  88   SELTVVMKFGGSSVASAERMREVADLILSFPEERPVIVLSAMGKTTNKLLMAG  140



>ref|NP_001059423.1| Os07g0300900 [Oryza sativa Japonica Group]
 dbj|BAC84901.1| putative precursor monofunctional aspartokinase [Oryza sativa 
Japonica Group]
 dbj|BAD31992.1| putative precursor monofunctional aspartokinase [Oryza sativa 
Japonica Group]
 dbj|BAF21337.1| Os07g0300900 [Oryza sativa Japonica Group]
 dbj|BAG88180.1| unnamed protein product [Oryza sativa Japonica Group]
Length=575

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/53 (89%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +3

Query  507  SEFTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            SE T VMKFGGSSVASA+RMREVADLILSFPEE+PVIVLSAMGKTTN LL+AG
Sbjct  88   SELTVVMKFGGSSVASAERMREVADLILSFPEERPVIVLSAMGKTTNKLLMAG  140



>ref|XP_006844541.1| hypothetical protein AMTR_s00016p00169310 [Amborella trichopoda]
 gb|ERN06216.1| hypothetical protein AMTR_s00016p00169310 [Amborella trichopoda]
Length=464

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 59/83 (71%), Gaps = 6/83 (7%)
 Frame = +3

Query  426  LRVSCKSQTIDLVQLSGTQNLGFDGVPS---EFTCVMKFGGSSVASAQRMREVADLILSF  596
            LRV C+ Q   +V+      +GF  V     + +CVMKFGGSSVASA RMREVADLIL F
Sbjct  12   LRVRCERQAFAVVE---KLEIGFKIVEENAGQLSCVMKFGGSSVASADRMREVADLILGF  68

Query  597  PEEKPVIVLSAMGKTTNNLLLAG  665
            PEE+PVIVLSAMGKTTN LL  G
Sbjct  69   PEERPVIVLSAMGKTTNKLLQGG  91



>ref|XP_004956005.1| PREDICTED: aspartokinase 2, chloroplastic-like [Setaria italica]
Length=568

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +3

Query  498  GVPSEFTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            G   E T VMKFGGSSVASA+RMREVADLILSFPEE+PVIVLSAMGKTTN LL+AG
Sbjct  76   GAEPELTVVMKFGGSSVASAERMREVADLILSFPEERPVIVLSAMGKTTNKLLMAG  131



>ref|XP_010435684.1| PREDICTED: aspartokinase 3, chloroplastic-like [Camelina sativa]
Length=553

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = +3

Query  426  LRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREVADLILSFPEE  605
            LRV+C++  ++L++    +    +    + TCVMKFGGSSVASA+RM++VA LILSFP+E
Sbjct  58   LRVTCEAARVELLERKEYETFKLNKTEKKLTCVMKFGGSSVASAERMKQVAKLILSFPDE  117

Query  606  KPVIVLSAMGKTTNNLLL  659
            KPV+VLSAM KTTN LL+
Sbjct  118  KPVVVLSAMAKTTNKLLM  135



>gb|EEE58127.1| hypothetical protein OsJ_09026 [Oryza sativa Japonica Group]
Length=659

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/53 (89%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +3

Query  507  SEFTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            SE T VMKFGGSSVASA+RMREVADLILSFPEE+PVIVLSAMGKTTN LL+AG
Sbjct  88   SELTVVMKFGGSSVASAERMREVADLILSFPEERPVIVLSAMGKTTNKLLMAG  140



>gb|EEC74320.1| hypothetical protein OsI_09598 [Oryza sativa Indica Group]
Length=659

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/53 (89%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +3

Query  507  SEFTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            SE T VMKFGGSSVASA+RMREVADLILSFPEE+PVIVLSAMGKTTN LL+AG
Sbjct  88   SELTVVMKFGGSSVASAERMREVADLILSFPEERPVIVLSAMGKTTNKLLMAG  140



>ref|XP_004981039.1| PREDICTED: aspartokinase 1, chloroplastic-like [Setaria italica]
Length=565

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/51 (92%), Positives = 49/51 (96%), Gaps = 0/51 (0%)
 Frame = +3

Query  513  FTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            FT VMKFGGSS+ASA+RMREVADLILSFPEE PVIVLSAMGKTTNNLLLAG
Sbjct  80   FTVVMKFGGSSLASAERMREVADLILSFPEETPVIVLSAMGKTTNNLLLAG  130



>gb|ABQ28733.1| monofunctional aspartate kinase 2 [Zea mays]
Length=527

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +3

Query  489  GFDGVPSEFTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            G  G   E T VMKFGGSSVASA+RMREVADLILSFPEE PV+VLSAMGKTTN LL+AG
Sbjct  32   GDGGAAPELTVVMKFGGSSVASAERMREVADLILSFPEEHPVVVLSAMGKTTNKLLMAG  90



>ref|XP_006657643.1| PREDICTED: aspartokinase 1, chloroplastic-like [Oryza brachyantha]
Length=571

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/53 (87%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +3

Query  507  SEFTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            +E T VMKFGGSSVASA+RMREVADLILSFPEE+PVIVLSAMGKTTN LL+AG
Sbjct  84   AELTVVMKFGGSSVASAERMREVADLILSFPEERPVIVLSAMGKTTNKLLMAG  136



>ref|XP_008669985.1| PREDICTED: aspartokinase 2, chloroplastic [Zea mays]
 gb|ACF79023.1| unknown [Zea mays]
 tpg|DAA39408.1| TPA: aspartokinase [Zea mays]
Length=565

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +3

Query  489  GFDGVPSEFTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            G  G   E T VMKFGGSSVASA+RMREVADLILSFPEE PV+VLSAMGKTTN LL+AG
Sbjct  70   GDGGAAPELTVVMKFGGSSVASAERMREVADLILSFPEEHPVVVLSAMGKTTNKLLMAG  128



>ref|XP_011086875.1| PREDICTED: aspartokinase 2, chloroplastic [Sesamum indicum]
 ref|XP_011086876.1| PREDICTED: aspartokinase 2, chloroplastic [Sesamum indicum]
Length=570

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 57/84 (68%), Gaps = 1/84 (1%)
 Frame = +3

Query  414  RSRVLRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREVADLILS  593
            +SR   + C  +  D+             V  E TCVMKFGGSSVASA+RMREV  LILS
Sbjct  57   KSRFFTI-CSRKDADVAAFEEANFSSEKNVDEELTCVMKFGGSSVASAERMREVVRLILS  115

Query  594  FPEEKPVIVLSAMGKTTNNLLLAG  665
            FPEE+P++VLSAMGKTTNNLL AG
Sbjct  116  FPEERPIVVLSAMGKTTNNLLRAG  139



>gb|ABF99918.1| aspartate kinase family protein, expressed [Oryza sativa Japonica 
Group]
Length=495

 Score = 95.5 bits (236),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 46/51 (90%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = +3

Query  513  FTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            FT  MKFGGSSVASA+RMREVADLILSFPEE PV+VLSAMGKTTNNLLLAG
Sbjct  80   FTVAMKFGGSSVASAERMREVADLILSFPEETPVVVLSAMGKTTNNLLLAG  130



>gb|EMT07729.1| Aspartokinase 1, chloroplastic [Aegilops tauschii]
Length=94

 Score = 89.4 bits (220),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 44/49 (90%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  513  FTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLL  659
            FT VMKFGGSSV SA RMREVADLILSFPEE PV+VLSAMGKTTNNLLL
Sbjct  37   FTVVMKFGGSSVLSAARMREVADLILSFPEETPVVVLSAMGKTTNNLLL  85



>ref|NP_001051906.1| Os03g0850400 [Oryza sativa Japonica Group]
 dbj|BAF13820.1| Os03g0850400, partial [Oryza sativa Japonica Group]
Length=537

 Score = 95.5 bits (236),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 46/51 (90%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = +3

Query  513  FTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            FT  MKFGGSSVASA+RMREVADLILSFPEE PV+VLSAMGKTTNNLLLAG
Sbjct  52   FTVAMKFGGSSVASAERMREVADLILSFPEETPVVVLSAMGKTTNNLLLAG  102



>gb|EEC76545.1| hypothetical protein OsI_14341 [Oryza sativa Indica Group]
Length=566

 Score = 95.5 bits (236),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 46/51 (90%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = +3

Query  513  FTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            FT  MKFGGSSVASA+RMREVADLILSFPEE PV+VLSAMGKTTNNLLLAG
Sbjct  81   FTVAMKFGGSSVASAERMREVADLILSFPEETPVVVLSAMGKTTNNLLLAG  131



>gb|AAO20063.1| putative aspartate kinase [Oryza sativa Japonica Group]
 gb|ABF99917.1| aspartate kinase family protein, expressed [Oryza sativa Japonica 
Group]
 gb|EEE60306.1| hypothetical protein OsJ_13379 [Oryza sativa Japonica Group]
Length=565

 Score = 95.5 bits (236),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 46/51 (90%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = +3

Query  513  FTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            FT  MKFGGSSVASA+RMREVADLILSFPEE PV+VLSAMGKTTNNLLLAG
Sbjct  80   FTVAMKFGGSSVASAERMREVADLILSFPEETPVVVLSAMGKTTNNLLLAG  130



>ref|XP_006287431.1| hypothetical protein CARUB_v10000635mg [Capsella rubella]
 gb|EOA20329.1| hypothetical protein CARUB_v10000635mg [Capsella rubella]
Length=548

 Score = 95.1 bits (235),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 46/51 (90%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = +3

Query  513  FTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
             TCVMKFGGSSVASA+RMREVA LIL+FPEE PVIVLSAMGKTTNNLLLAG
Sbjct  89   ITCVMKFGGSSVASAERMREVAGLILTFPEESPVIVLSAMGKTTNNLLLAG  139



>ref|XP_010100040.1| Aspartokinase 1 [Morus notabilis]
 gb|EXB81211.1| Aspartokinase 1 [Morus notabilis]
Length=575

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/51 (88%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +3

Query  513  FTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
             TCVMKFGGSSVASA R+RE+ADLI SFPEE PVIVLSAMGKTTNNLLLAG
Sbjct  87   LTCVMKFGGSSVASAHRIREIADLIRSFPEENPVIVLSAMGKTTNNLLLAG  137



>ref|XP_001773420.1| predicted protein [Physcomitrella patens]
 gb|EDQ61793.1| predicted protein [Physcomitrella patens]
Length=578

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +3

Query  501  VPSEFTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            + S+FT VMKFGGSSVASA RMREVA LILSFP+E+PVIVLSAMGKTTNNLL AG
Sbjct  92   LSSDFTTVMKFGGSSVASAHRMREVAQLILSFPDERPVIVLSAMGKTTNNLLKAG  146



>ref|XP_003562409.1| PREDICTED: aspartokinase 1, chloroplastic isoform X2 [Brachypodium 
distachyon]
Length=569

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/51 (86%), Positives = 49/51 (96%), Gaps = 0/51 (0%)
 Frame = +3

Query  513  FTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            FT VMKFGGSSVA+A+RM+EVADL+LSFPEE PV+VLSAMGKTTNNLLLAG
Sbjct  82   FTVVMKFGGSSVATAERMKEVADLVLSFPEETPVVVLSAMGKTTNNLLLAG  132



>ref|XP_010234251.1| PREDICTED: aspartokinase 1, chloroplastic isoform X1 [Brachypodium 
distachyon]
Length=570

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/51 (86%), Positives = 49/51 (96%), Gaps = 0/51 (0%)
 Frame = +3

Query  513  FTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            FT VMKFGGSSVA+A+RM+EVADL+LSFPEE PV+VLSAMGKTTNNLLLAG
Sbjct  82   FTVVMKFGGSSVATAERMKEVADLVLSFPEETPVVVLSAMGKTTNNLLLAG  132



>ref|XP_001780779.1| predicted protein [Physcomitrella patens]
 gb|EDQ54418.1| predicted protein [Physcomitrella patens]
Length=527

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 64/89 (72%), Gaps = 8/89 (9%)
 Frame = +3

Query  411  SRSRV--LRVSCKSQTIDLVQLSGTQNLGFDG--VPSEFTCVMKFGGSSVASAQRMREVA  578
             R+RV  L+V C +    + +L G      +G  +  +FT VMKFGGSSVASA RM+EVA
Sbjct  20   DRTRVWSLQVRCDAGVSVVKELVGED----EGRRIVQDFTTVMKFGGSSVASAHRMKEVA  75

Query  579  DLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
             LILSFPEEKP+IVLSAMGKTTNNLL AG
Sbjct  76   QLILSFPEEKPIIVLSAMGKTTNNLLKAG  104



>gb|EEC76544.1| hypothetical protein OsI_14340 [Oryza sativa Indica Group]
Length=333

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/47 (94%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = +3

Query  525  MKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            MKFGGSSVASA+RMREVADLILSFPEE PV+VLSAMGKTTNNLLLAG
Sbjct  1    MKFGGSSVASAERMREVADLILSFPEETPVVVLSAMGKTTNNLLLAG  47



>gb|EMT10312.1| Aspartokinase 1, chloroplastic [Aegilops tauschii]
Length=748

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/51 (88%), Positives = 49/51 (96%), Gaps = 0/51 (0%)
 Frame = +3

Query  513  FTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            FT VMKFGGSSV+SA RMRE+ADLILSFPEE+PV+VLSAMGKTTNNLLLAG
Sbjct  74   FTVVMKFGGSSVSSAARMREMADLILSFPEERPVVVLSAMGKTTNNLLLAG  124



>ref|XP_007043813.1| Aspartate kinase 1 [Theobroma cacao]
 gb|EOX99644.1| Aspartate kinase 1 [Theobroma cacao]
Length=575

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +3

Query  510  EFTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            +FTCVMKFGGSSVASA+RM+E+ADLI SF EE+PVIVLSAMGKTTN LLLAG
Sbjct  91   QFTCVMKFGGSSVASAERMKEIADLIQSFEEERPVIVLSAMGKTTNKLLLAG  142



>ref|XP_004310242.1| PREDICTED: aspartokinase 1, chloroplastic [Fragaria vesca subsp. 
vesca]
Length=561

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/51 (82%), Positives = 49/51 (96%), Gaps = 0/51 (0%)
 Frame = +3

Query  513  FTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            F+CVMKFGGSSV +A+R+RE+A LI+SFPEEKPV+VLSAMGKTTNNLLLAG
Sbjct  79   FSCVMKFGGSSVGTAERIREIAQLIVSFPEEKPVVVLSAMGKTTNNLLLAG  129



>gb|KEH25642.1| monofunctional aspartokinase [Medicago truncatula]
Length=515

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +3

Query  498  GVPSEFTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            G+   +TCVMKFGGSSVASA+RM EVA L++SFPEE+P++VLSAMGKTTN LLLAG
Sbjct  75   GIKRSYTCVMKFGGSSVASAERMMEVAGLVMSFPEERPIVVLSAMGKTTNKLLLAG  130



>gb|KEH25640.1| monofunctional aspartokinase [Medicago truncatula]
Length=558

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +3

Query  498  GVPSEFTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            G+   +TCVMKFGGSSVASA+RM EVA L++SFPEE+P++VLSAMGKTTN LLLAG
Sbjct  75   GIKRSYTCVMKFGGSSVASAERMMEVAGLVMSFPEERPIVVLSAMGKTTNKLLLAG  130



>gb|KEH25641.1| monofunctional aspartokinase [Medicago truncatula]
Length=560

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +3

Query  498  GVPSEFTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            G+   +TCVMKFGGSSVASA+RM EVA L++SFPEE+P++VLSAMGKTTN LLLAG
Sbjct  75   GIKRSYTCVMKFGGSSVASAERMMEVAGLVMSFPEERPIVVLSAMGKTTNKLLLAG  130



>ref|XP_010682653.1| PREDICTED: aspartokinase 1, chloroplastic isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=565

 Score = 92.4 bits (228),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 63/91 (69%), Gaps = 1/91 (1%)
 Frame = +3

Query  396  SIKGSSRSRVLRVSCKSQTIDL-VQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMRE  572
            ++   ++S   R++C  Q  +  +Q     N   D    EF+ VMKFGGSS+ASA+R++E
Sbjct  44   TVASKNKSSTSRITCCLQVEERHIQPQSQSNADDDKEDHEFSVVMKFGGSSLASAERIKE  103

Query  573  VADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            VA L+LSFPEE PV+VLSAMGKTTNNLL AG
Sbjct  104  VAQLVLSFPEENPVVVLSAMGKTTNNLLNAG  134



>ref|XP_010682652.1| PREDICTED: aspartokinase 1, chloroplastic isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=567

 Score = 92.4 bits (228),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 63/91 (69%), Gaps = 1/91 (1%)
 Frame = +3

Query  396  SIKGSSRSRVLRVSCKSQTIDL-VQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMRE  572
            ++   ++S   R++C  Q  +  +Q     N   D    EF+ VMKFGGSS+ASA+R++E
Sbjct  44   TVASKNKSSTSRITCCLQVEERHIQPQSQSNADDDKEDHEFSVVMKFGGSSLASAERIKE  103

Query  573  VADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            VA L+LSFPEE PV+VLSAMGKTTNNLL AG
Sbjct  104  VAQLVLSFPEENPVVVLSAMGKTTNNLLNAG  134



>ref|NP_001288496.1| uncharacterized protein LOC103644325 [Zea mays]
 gb|ACR34218.1| unknown [Zea mays]
 tpg|DAA52504.1| TPA: aspartokinase [Zea mays]
Length=568

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/51 (86%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = +3

Query  513  FTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            FT VMKFGGSS+ASA+RMREVA LILSFP+E PV+VLSAMGKTTNNLLLAG
Sbjct  83   FTVVMKFGGSSLASAERMREVAGLILSFPDETPVVVLSAMGKTTNNLLLAG  133



>gb|ABO09875.1| monofunctional aspartate kinase 1 [Zea mays]
Length=581

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/51 (86%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = +3

Query  513  FTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            FT VMKFGGSS+ASA+RMREVA LILSFP+E PV+VLSAMGKTTNNLLLAG
Sbjct  96   FTVVMKFGGSSLASAERMREVAGLILSFPDETPVVVLSAMGKTTNNLLLAG  146



>emb|CBI21283.3| unnamed protein product [Vitis vinifera]
Length=479

 Score = 89.4 bits (220),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 43/47 (91%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +3

Query  525  MKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            MKFGGSSVASA+RMREVADLILSFP E+PVIVLSAMGKTTN LLLAG
Sbjct  1    MKFGGSSVASAERMREVADLILSFPNERPVIVLSAMGKTTNKLLLAG  47



>gb|ABN05951.1| Aspartate kinase region [Medicago truncatula]
Length=147

 Score = 84.7 bits (208),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 57/81 (70%), Gaps = 3/81 (4%)
 Frame = +3

Query  417  SRVLRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREVADLILSF  596
            S  +R+SC S         G + L  +     ++ VMKFGGSSVA+A RM+E+A+LILSF
Sbjct  49   SDAVRISCCSNNARESDF-GAEKL--EETEKSYSVVMKFGGSSVANAVRMKEIANLILSF  105

Query  597  PEEKPVIVLSAMGKTTNNLLL  659
            PEE+P+IVLSAMGKTTN LLL
Sbjct  106  PEERPIIVLSAMGKTTNKLLL  126



>tpg|DAA56009.1| TPA: hypothetical protein ZEAMMB73_791722 [Zea mays]
Length=237

 Score = 85.9 bits (211),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +3

Query  510  EFTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            + + VMKFGGSSV+SA RM EVA LIL+FPEE+PV+VLSAMGKTTNNLLLAG
Sbjct  82   QLSVVMKFGGSSVSSAARMAEVAGLILTFPEERPVVVLSAMGKTTNNLLLAG  133



>gb|KDP41849.1| hypothetical protein JCGZ_26867 [Jatropha curcas]
Length=463

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +3

Query  525  MKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            MKFGGSSVASA+RM+EVADLILSFP E+PVIVLSAMGKTTN LLLAG
Sbjct  1    MKFGGSSVASAERMKEVADLILSFPNERPVIVLSAMGKTTNKLLLAG  47



>tpg|DAA56005.1| TPA: hypothetical protein ZEAMMB73_791722 [Zea mays]
 tpg|DAA56006.1| TPA: hypothetical protein ZEAMMB73_791722 [Zea mays]
Length=312

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +3

Query  507  SEFTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
             + + VMKFGGSSV+SA RM EVA LIL+FPEE+PV+VLSAMGKTTNNLLLAG
Sbjct  81   DQLSVVMKFGGSSVSSAARMAEVAGLILTFPEERPVVVLSAMGKTTNNLLLAG  133



>ref|XP_002459021.1| hypothetical protein SORBIDRAFT_03g044650 [Sorghum bicolor]
 gb|EES04141.1| hypothetical protein SORBIDRAFT_03g044650 [Sorghum bicolor]
Length=555

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +3

Query  507  SEFTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
             + + VMKFGGSSVASA RM EVA LIL+FPEE+PV+VLSAMGKTTNNLLLAG
Sbjct  81   DQLSVVMKFGGSSVASAARMAEVAGLILTFPEERPVVVLSAMGKTTNNLLLAG  133



>gb|AES80708.2| monofunctional aspartokinase [Medicago truncatula]
Length=557

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/83 (57%), Positives = 59/83 (71%), Gaps = 3/83 (4%)
 Frame = +3

Query  417  SRVLRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREVADLILSF  596
            S  +R+SC S         G + L  +     ++ VMKFGGSSVA+A RM+E+A+LILSF
Sbjct  49   SDAVRISCCSNNARESDF-GAEKL--EETEKSYSVVMKFGGSSVANAVRMKEIANLILSF  105

Query  597  PEEKPVIVLSAMGKTTNNLLLAG  665
            PEE+P+IVLSAMGKTTN LLLAG
Sbjct  106  PEERPIIVLSAMGKTTNKLLLAG  128



>ref|XP_003624490.1| Aspartokinase [Medicago truncatula]
Length=602

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/83 (57%), Positives = 59/83 (71%), Gaps = 3/83 (4%)
 Frame = +3

Query  417  SRVLRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREVADLILSF  596
            S  +R+SC S         G + L  +     ++ VMKFGGSSVA+A RM+E+A+LILSF
Sbjct  49   SDAVRISCCSNNARESDF-GAEKL--EETEKSYSVVMKFGGSSVANAVRMKEIANLILSF  105

Query  597  PEEKPVIVLSAMGKTTNNLLLAG  665
            PEE+P+IVLSAMGKTTN LLLAG
Sbjct  106  PEERPIIVLSAMGKTTNKLLLAG  128



>tpg|DAA56010.1| TPA: hypothetical protein ZEAMMB73_791722 [Zea mays]
Length=144

 Score = 82.8 bits (203),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +3

Query  510  EFTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLL  659
            + + VMKFGGSSV+SA RM EVA LIL+FPEE+PV+VLSAMGKTTNNLLL
Sbjct  82   QLSVVMKFGGSSVSSAARMAEVAGLILTFPEERPVVVLSAMGKTTNNLLL  131



>tpg|DAA56007.1| TPA: hypothetical protein ZEAMMB73_791722 [Zea mays]
Length=432

 Score = 85.5 bits (210),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +3

Query  507  SEFTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
             + + VMKFGGSSV+SA RM EVA LIL+FPEE+PV+VLSAMGKTTNNLLLAG
Sbjct  81   DQLSVVMKFGGSSVSSAARMAEVAGLILTFPEERPVVVLSAMGKTTNNLLLAG  133



>tpg|DAA56008.1| TPA: hypothetical protein ZEAMMB73_791722 [Zea mays]
Length=476

 Score = 85.9 bits (211),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +3

Query  507  SEFTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
             + + VMKFGGSSV+SA RM EVA LIL+FPEE+PV+VLSAMGKTTNNLLLAG
Sbjct  81   DQLSVVMKFGGSSVSSAARMAEVAGLILTFPEERPVVVLSAMGKTTNNLLLAG  133



>ref|XP_004971149.1| PREDICTED: aspartokinase 1, chloroplastic-like [Setaria italica]
Length=554

 Score = 86.3 bits (212),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +3

Query  507  SEFTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
             + + VMKFGGSSV+SA RM EVADLIL+FPEE+PV+VLSAMGKTTN LLLAG
Sbjct  79   DQLSVVMKFGGSSVSSAARMEEVADLILAFPEERPVVVLSAMGKTTNLLLLAG  131



>emb|CBI35668.3| unnamed protein product [Vitis vinifera]
Length=482

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/47 (85%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +3

Query  525  MKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            MKFGGSS+ASA+RMREVADL+L F +E+PVIVLSAMGKTTNNLLLAG
Sbjct  1    MKFGGSSLASAERMREVADLVLQFRDERPVIVLSAMGKTTNNLLLAG  47



>ref|XP_007515683.1| aspartate kinase [Bathycoccus prasinos]
 emb|CCO14562.1| aspartate kinase [Bathycoccus prasinos]
Length=576

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +3

Query  510  EFTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            + T VMKFGGSSVA A+RMREVA+++LSFPEE PV+VLSAMGK+TNNLL+ G
Sbjct  84   QHTVVMKFGGSSVADAERMREVANIVLSFPEEMPVLVLSAMGKSTNNLLMCG  135



>gb|EEE55936.1| hypothetical protein OsJ_04629 [Oryza sativa Japonica Group]
Length=552

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +3

Query  507  SEFTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
             + + VMKFGGSSV+SA RMREVA LIL+FPEE+PV+VLSAMGKTTN LLLAG
Sbjct  68   DQLSVVMKFGGSSVSSAARMREVAGLILAFPEERPVVVLSAMGKTTNLLLLAG  120



>ref|NP_001045271.1| Os01g0927900 [Oryza sativa Japonica Group]
 dbj|BAD88162.1| putative aspartate kinase [Oryza sativa Japonica Group]
 dbj|BAD88202.1| putative aspartate kinase [Oryza sativa Japonica Group]
 dbj|BAF07185.1| Os01g0927900 [Oryza sativa Japonica Group]
 dbj|BAG93334.1| unnamed protein product [Oryza sativa Japonica Group]
Length=570

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +3

Query  507  SEFTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
             + + VMKFGGSSV+SA RMREVA LIL+FPEE+PV+VLSAMGKTTN LLLAG
Sbjct  96   DQLSVVMKFGGSSVSSAARMREVAGLILAFPEERPVVVLSAMGKTTNLLLLAG  148



>ref|XP_006646639.1| PREDICTED: aspartokinase 1, chloroplastic-like [Oryza brachyantha]
Length=560

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +3

Query  507  SEFTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
             + + VMKFGGSSV+SA RMREVA LIL+FPEE+PV+VLSAMGKTTN LLLAG
Sbjct  86   DQLSVVMKFGGSSVSSAARMREVAGLILAFPEERPVVVLSAMGKTTNLLLLAG  138



>gb|EEC72085.1| hypothetical protein OsI_05030 [Oryza sativa Indica Group]
Length=570

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +3

Query  507  SEFTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
             + + VMKFGGSSV+SA RMREVA LIL+FPEE+PV+VLSAMGKTTN LLLAG
Sbjct  96   DQLSVVMKFGGSSVSSAARMREVAGLILAFPEERPVVVLSAMGKTTNLLLLAG  148



>ref|XP_008681044.1| PREDICTED: uncharacterized protein LOC100192082 isoform X2 [Zea 
mays]
 gb|ACN30839.1| unknown [Zea mays]
 gb|AFW68351.1| aspartokinase isoform 1 [Zea mays]
 gb|AFW68352.1| aspartokinase isoform 2 [Zea mays]
Length=170

 Score = 80.9 bits (198),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +3

Query  513  FTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLL  659
            FT VMKFGGSS+ASA+RMREVA LILSF +E PV VLSAMGKTTNNLLL
Sbjct  96   FTFVMKFGGSSLASAERMREVAGLILSFLDEMPVAVLSAMGKTTNNLLL  144



>ref|XP_003059042.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH57497.1| predicted protein [Micromonas pusilla CCMP1545]
Length=575

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = +3

Query  513  FTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            ++ VMKFGGSSVA A RMREVAD+IL+FP+E PVIVLSAMGK+TNNL+ AG
Sbjct  96   YSVVMKFGGSSVADAARMREVADIILAFPDELPVIVLSAMGKSTNNLIEAG  146



>ref|NP_001130977.1| uncharacterized protein LOC100192082 [Zea mays]
 ref|XP_008681041.1| PREDICTED: uncharacterized protein LOC100192082 isoform X1 [Zea 
mays]
 ref|XP_008681042.1| PREDICTED: uncharacterized protein LOC100192082 isoform X1 [Zea 
mays]
 ref|XP_008681043.1| PREDICTED: uncharacterized protein LOC100192082 isoform X1 [Zea 
mays]
 gb|ACF79390.1| unknown [Zea mays]
 gb|ACF82734.1| unknown [Zea mays]
 gb|ACR38480.1| unknown [Zea mays]
 gb|AFW68347.1| aspartokinase isoform 1 [Zea mays]
 gb|AFW68348.1| aspartokinase isoform 2 [Zea mays]
 gb|AFW68349.1| aspartokinase isoform 3 [Zea mays]
 gb|AFW68350.1| aspartokinase isoform 4 [Zea mays]
Length=173

 Score = 80.5 bits (197),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +3

Query  513  FTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLL  659
            FT VMKFGGSS+ASA+RMREVA LILSF +E PV VLSAMGKTTNNLLL
Sbjct  96   FTFVMKFGGSSLASAERMREVAGLILSFLDEMPVAVLSAMGKTTNNLLL  144



>ref|XP_004143759.1| PREDICTED: aspartokinase 2, chloroplastic-like [Cucumis sativus]
Length=474

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/47 (87%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +3

Query  525  MKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            MKFGGSSVASA+RM EVA+LI SFPEE+PVIVLSAMGKTTN LLLAG
Sbjct  1    MKFGGSSVASAERMMEVAELIRSFPEERPVIVLSAMGKTTNKLLLAG  47



>dbj|BAJ99203.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=564

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 62/100 (62%), Gaps = 10/100 (10%)
 Frame = +3

Query  396  SIKGSSRSRVLRVSCKSQTIDLVQLSGTQNLGFDGVP----------SEFTCVMKFGGSS  545
            ++ G+ R R+L ++         ++ G  +    GV            + + VMKFGGSS
Sbjct  35   ALVGTRRGRILAMAAADSARCRAKIGGDGDGVLAGVAVHGGTGAEGEDQLSVVMKFGGSS  94

Query  546  VASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            V+SA RM+EVA LI +FPEE+PV+VLSAMGKTTN LLLAG
Sbjct  95   VSSAARMKEVAGLIQAFPEERPVVVLSAMGKTTNLLLLAG  134



>emb|CDM85877.1| unnamed protein product [Triticum aestivum]
Length=563

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 51/68 (75%), Gaps = 2/68 (3%)
 Frame = +3

Query  468  LSGTQNLGFDGVPSE--FTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKT  641
            L+G    G  G   E   + VMKFGGSSV+SA RM+EVA LI +FPEE+PV+VLSAMGKT
Sbjct  67   LAGVAVHGGTGAEGEDQLSVVMKFGGSSVSSAARMKEVAGLIQAFPEERPVVVLSAMGKT  126

Query  642  TNNLLLAG  665
            TN LLLAG
Sbjct  127  TNLLLLAG  134



>gb|EMS47783.1| Aspartokinase 1, chloroplastic [Triticum urartu]
Length=534

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 61/98 (62%), Gaps = 3/98 (3%)
 Frame = +3

Query  372  RHVYGVCTSIKGSSRSRVLRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVA  551
            R   G+  +   S+R R  R       +  V + G    G +G   + + VMKFGGSSV+
Sbjct  40   RRGRGLAMAGADSARCRAKREGAGDGVLAGVAVHG--GTGAEG-EDQLSVVMKFGGSSVS  96

Query  552  SAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            SA RM EVA LI +FPEE+PV+VLSAMGKTTN LLLAG
Sbjct  97   SAARMTEVAGLIQAFPEERPVVVLSAMGKTTNLLLLAG  134



>ref|XP_002467671.1| hypothetical protein SORBIDRAFT_01g032000 [Sorghum bicolor]
 gb|EER94669.1| hypothetical protein SORBIDRAFT_01g032000 [Sorghum bicolor]
Length=130

 Score = 76.6 bits (187),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 48/64 (75%), Gaps = 5/64 (8%)
 Frame = +3

Query  468  LSGTQNLGFDGVPSEFTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTN  647
            ++  Q  G DG   E T VMKFGGSSVAS +RMREV  LIL FPEE+P++VLSA+ KTTN
Sbjct  65   VAAAQERGGDG---ELTVVMKFGGSSVASTERMREV--LILKFPEERPIVVLSAIVKTTN  119

Query  648  NLLL  659
             LL+
Sbjct  120  KLLM  123



>ref|XP_001415789.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO94081.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=463

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +3

Query  525  MKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            MKFGGSSVA A R+REVA ++LSFPEE PV+VLSAMGKTTNNLL AG
Sbjct  1    MKFGGSSVADAARVREVAQIVLSFPEEMPVLVLSAMGKTTNNLLAAG  47



>gb|EYU28463.1| hypothetical protein MIMGU_mgv1a005583mg [Erythranthe guttata]
Length=478

 Score = 79.7 bits (195),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +3

Query  525  MKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            MKFGGSSVASA+RMREVA LILSFP+E P+IVLSAMGK+TN L+ AG
Sbjct  1    MKFGGSSVASAERMREVAHLILSFPDENPIIVLSAMGKSTNYLIRAG  47



>ref|XP_003564987.1| PREDICTED: aspartokinase 2, chloroplastic-like [Brachypodium 
distachyon]
Length=567

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +3

Query  510  EFTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            + + VMKFGGSS++SA RM EVA LI +FPEE+PV+VLSAMGKTTN LLLAG
Sbjct  84   QLSVVMKFGGSSMSSAARMEEVAGLITAFPEERPVVVLSAMGKTTNLLLLAG  135



>ref|XP_003074218.1| putative precursor monofunctional aspartokina (ISS) [Ostreococcus 
tauri]
Length=423

 Score = 76.6 bits (187),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +3

Query  495  DGVPSEFTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            D +    T VMKFGGSS+A A R+REV  ++ SFPEE PV+VLSAMGKTTN+LL AG
Sbjct  46   DALDWAHTTVMKFGGSSLADAARVREVGAIVRSFPEETPVVVLSAMGKTTNDLLRAG  102



>ref|XP_002992028.1| hypothetical protein SELMODRAFT_162121 [Selaginella moellendorffii]
 gb|EFJ06877.1| hypothetical protein SELMODRAFT_162121 [Selaginella moellendorffii]
Length=468

 Score = 76.6 bits (187),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +3

Query  525  MKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            MKFGGSSV+SA RM+EVA L+ SFP E+PV+VLSAMGKTTNNLL AG
Sbjct  1    MKFGGSSVSSAARMKEVATLVQSFPGERPVLVLSAMGKTTNNLLAAG  47



>ref|XP_002964498.1| hypothetical protein SELMODRAFT_142417 [Selaginella moellendorffii]
 gb|EFJ34831.1| hypothetical protein SELMODRAFT_142417 [Selaginella moellendorffii]
Length=468

 Score = 76.6 bits (187),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +3

Query  525  MKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            MKFGGSSV+SA RM+EVA L+ SFP E+PV+VLSAMGKTTNNLL AG
Sbjct  1    MKFGGSSVSSAARMKEVATLVQSFPGERPVLVLSAMGKTTNNLLAAG  47



>emb|CEF96568.1| Aspartate kinase, conserved site [Ostreococcus tauri]
Length=520

 Score = 77.0 bits (188),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +3

Query  495  DGVPSEFTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            D +    T VMKFGGSS+A A R+REV  ++ SFPEE PV+VLSAMGKTTN+LL AG
Sbjct  46   DALDWAHTTVMKFGGSSLADAARVREVGAIVRSFPEETPVVVLSAMGKTTNDLLRAG  102



>ref|XP_002507216.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO68474.1| predicted protein [Micromonas sp. RCC299]
Length=498

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +3

Query  510  EFTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            +++ VMKFGGSS+AS+QRMREVA+++++  ++ PV+VLSAMG+TTNNLL AG
Sbjct  18   KYSLVMKFGGSSIASSQRMREVAEIVITVQDDLPVVVLSAMGRTTNNLLDAG  69



>ref|XP_005650639.1| aspartate kinase [Coccomyxa subellipsoidea C-169]
 gb|EIE26095.1| aspartate kinase [Coccomyxa subellipsoidea C-169]
Length=458

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +3

Query  525  MKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAGA  668
            MKFGGSS+ASA+RM+EVA +I SFP++ P +VLSAMGKTTN LL AGA
Sbjct  1    MKFGGSSLASAERMKEVASIICSFPDQYPCVVLSAMGKTTNLLLQAGA  48



>ref|XP_011399436.1| Aspartokinase 1, chloroplastic [Auxenochlorella protothecoides]
 gb|KFM26498.1| Aspartokinase 1, chloroplastic [Auxenochlorella protothecoides]
Length=501

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +3

Query  507  SEFTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
             + + VMKFGGSSVA+A+R+REVA ++ SFP+  P +VLSAMGKTTN LL AG
Sbjct  35   DQVSVVMKFGGSSVANAERLREVASIVCSFPDHLPCVVLSAMGKTTNLLLQAG  87



>ref|XP_002947347.1| hypothetical protein VOLCADRAFT_87637 [Volvox carteri f. nagariensis]
 gb|EFJ51395.1| hypothetical protein VOLCADRAFT_87637 [Volvox carteri f. nagariensis]
Length=557

 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = +3

Query  507  SEFTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            S+   V KFGGSSV  A+RMREVAD+I SFP+  P +VLSAMGKTTN LL +G
Sbjct  69   SQVNVVYKFGGSSVRDAERMREVADIICSFPQYLPCVVLSAMGKTTNMLLESG  121



>ref|NP_001146140.1| uncharacterized protein LOC100279708 [Zea mays]
 ref|XP_008651340.1| PREDICTED: uncharacterized protein LOC100279708 isoform X1 [Zea 
mays]
 gb|ACL53340.1| unknown [Zea mays]
Length=102

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/34 (91%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +3

Query  564  MREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            MREVADLILSFP+E PV+VLSAMGKTTNNLLLAG
Sbjct  1    MREVADLILSFPDETPVVVLSAMGKTTNNLLLAG  34



>ref|XP_005846857.1| hypothetical protein CHLNCDRAFT_134660 [Chlorella variabilis]
 gb|EFN54755.1| hypothetical protein CHLNCDRAFT_134660 [Chlorella variabilis]
Length=477

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +3

Query  528  KFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            +FGGSSVA+A+RM+EVAD+I SFP   P +VLSAMGKTTN LL AG
Sbjct  17   RFGGSSVATAERMKEVADIICSFPHHLPCVVLSAMGKTTNLLLQAG  62



>ref|XP_001698576.1| aspartate kinase [Chlamydomonas reinhardtii]
 gb|EDP08069.1| aspartate kinase [Chlamydomonas reinhardtii]
Length=545

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +3

Query  510  EFTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            +   V KFGGSSV  A+RMREVAD+I SFP+  P +VLSAMGKTTN LL  G
Sbjct  56   QVNVVYKFGGSSVRDAERMREVADIICSFPQYLPCVVLSAMGKTTNMLLECG  107



>gb|EMS63387.1| Aspartokinase 1, chloroplastic [Triticum urartu]
Length=814

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/34 (94%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +3

Query  564  MREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            MREVADLILSFPEE PV+VLSAMGKTTNNLLLAG
Sbjct  1    MREVADLILSFPEETPVVVLSAMGKTTNNLLLAG  34



>ref|WP_016525852.1| aspartate kinase [Treponema maltophilum]
 gb|EPF31241.1| aspartate kinase [Treponema maltophilum ATCC 51939]
Length=444

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +3

Query  519  CVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
             VMKFGGSSVASA+R+R VA +I ++ ++KPV+VLSAMG TT++LL A 
Sbjct  2    IVMKFGGSSVASAERIRHVASIIGAYKDKKPVVVLSAMGDTTDHLLRAA  50



>ref|WP_013758817.1| aspartate kinase [Treponema brennaborense]
 gb|AEE17112.1| aspartate kinase [Treponema brennaborense DSM 12168]
Length=448

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  522  VMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            VMKFGGSSVA A+R+R VA +I ++ ++KPV+VLSAMG TT++LL A 
Sbjct  3    VMKFGGSSVADAERIRHVASIIKTYADKKPVVVLSAMGDTTDHLLEAA  50



>gb|KIY94042.1| aspartate kinase [Monoraphidium neglectum]
Length=72

 Score = 60.5 bits (145),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +3

Query  507  SEFTCVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKT  641
            S+   V KFGGSSV  A+RMREVAD+I  FPE  P +VLSAMGK 
Sbjct  24   SQVDVVYKFGGSSVRDAERMREVADIICGFPEHLPCVVLSAMGKV  68



>ref|WP_004266577.1| aspartate kinase [Treponema saccharophilum]
 gb|EIC03081.1| aspartate kinase [Treponema saccharophilum DSM 2985]
Length=441

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +3

Query  519  CVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
             VMKFGGSSVA+A+R+R VA++I ++ E++P +VLSAMG TT++LL A 
Sbjct  2    IVMKFGGSSVANAERIRHVAEIIRAYAEKRPAVVLSAMGDTTDHLLEAA  50



>ref|WP_015707281.1| aspartate kinase [Treponema primitia]
 gb|AEF84490.1| lysine-sensitive aspartokinase 3 (Lysine-sensitiveaspartokinase 
III) (Aspartate kinase III) [Treponema primitia ZAS-2]
Length=451

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +3

Query  519  CVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
             VMKFGGSSVA+A+R+R VAD++     EKPV+VLSAMG TT++LL A 
Sbjct  2    IVMKFGGSSVANAERIRHVADIVARRIAEKPVLVLSAMGDTTDHLLEAA  50



>ref|WP_013702193.1| aspartate kinase [Treponema succinifaciens]
 gb|AEB14939.1| aspartate kinase [Treponema succinifaciens DSM 2489]
Length=441

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = +3

Query  519  CVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
             VMKFGGSSVA+A R++ VA++I ++  E+PV+VLSAMG TT++LL A 
Sbjct  2    IVMKFGGSSVANADRIKHVAEIIQAYKGERPVVVLSAMGDTTDHLLEAA  50



>gb|ERF61453.1| amino acid kinase family protein [Treponema socranskii subsp. 
socranskii VPI DR56BR1116 = ATCC 35536]
 gb|ERJ98210.1| amino acid kinase family protein [Treponema socranskii subsp. 
socranskii VPI DR56BR1116 = ATCC 35536]
Length=456

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  522  VMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            VMKFGGSSVA+A+R+R VA +I ++ + +PV+VLSAMG TT++LL A 
Sbjct  18   VMKFGGSSVANAERIRHVASIIKAYQKSRPVVVLSAMGDTTDHLLEAA  65



>ref|WP_038080481.1| aspartate kinase [Treponema socranskii]
Length=441

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = +3

Query  519  CVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
             VMKFGGSSVA+A+R+R VA +I ++ + +PV+VLSAMG TT++LL A 
Sbjct  2    IVMKFGGSSVANAERIRHVASIIKAYQKSRPVVVLSAMGDTTDHLLEAA  50



>ref|WP_016521831.1| aspartate kinase [Treponema socranskii]
 gb|EPF25671.1| aspartate kinase [Treponema socranskii subsp. paredis ATCC 35535]
Length=441

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = +3

Query  519  CVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
             VMKFGGSSVA+A+R+R VA +I ++ + +PV+VLSAMG TT++LL A 
Sbjct  2    IVMKFGGSSVANAERIRHVASIIKAYQKSRPVVVLSAMGDTTDHLLEAA  50



>ref|WP_009104632.1| aspartate kinase [Treponema sp. JC4]
 gb|EID85312.1| aspartate kinase [Treponema sp. JC4]
Length=441

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = +3

Query  519  CVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
             VMKFGGSSVA+A+R++ VA +I ++ E++P +VLSAMG TT++LL A 
Sbjct  2    IVMKFGGSSVANAERIKHVASIIKAYQEKRPAVVLSAMGDTTDHLLAAA  50



>ref|WP_022933427.1| aspartate kinase [Treponema bryantii]
Length=441

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = +3

Query  519  CVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
             VMKFGGSSVA+A+R++ VA +I ++ E++P +VLSAMG TT++LL A 
Sbjct  2    IVMKFGGSSVANAERIKHVASIIKAYQEKRPAVVLSAMGDTTDHLLEAA  50



>ref|WP_041908852.1| hypothetical protein [Candidatus Iainarchaeum andersonii]
Length=442

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = +3

Query  519  CVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
             VMKFGGSS+A+ QR+R   ++I S  ++KP++VLSA+GKTT+NLL AG
Sbjct  2    LVMKFGGSSLANPQRIRNACEIIKSRLKKKPIVVLSALGKTTDNLLSAG  50



>ref|WP_015710697.1| aspartate kinase [Treponema azotonutricium]
 gb|AEF82415.1| lysine-sensitive aspartokinase 3 (Lysine-sensitiveaspartokinase 
III) (Aspartate kinase III) [Treponema azotonutricium ZAS-9]
Length=446

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = +3

Query  519  CVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
             VMKFGGSSVA+A+R+R +A+++ +  E KPV+VLSAMG TT++LL A 
Sbjct  2    IVMKFGGSSVANAERLRHMAEIVKTQLERKPVLVLSAMGDTTDHLLEAA  50



>ref|WP_027728545.1| aspartate kinase [Treponema sp. C6A8]
Length=441

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +3

Query  519  CVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
             VMKFGGSSVA+A+R++ VA +I ++ + +P +VLSAMG TT++LL A 
Sbjct  2    IVMKFGGSSVANAERIKHVASIIKAYQQNRPAVVLSAMGDTTDHLLAAA  50



>ref|WP_013968408.1| aspartate kinase [Treponema caldaria]
 gb|AEJ19097.1| aspartate kinase [Treponema caldaria DSM 7334]
Length=443

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = +3

Query  519  CVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
             VMKFGGSSVA+A+R+R VA ++ S  ++KPV+VLSAMG TT++LL A 
Sbjct  2    IVMKFGGSSVANAERIRYVAGIVKSQIDQKPVLVLSAMGDTTDHLLEAA  50



>ref|XP_005534774.1| aspartate kinase [Cyanidioschyzon merolae strain 10D]
 dbj|BAM80167.1| aspartate kinase [Cyanidioschyzon merolae strain 10D]
Length=609

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 38/51 (75%), Gaps = 3/51 (6%)
 Frame = +3

Query  522  VMKFGGSSVASAQRMREVADLI---LSFPEEKPVIVLSAMGKTTNNLLLAG  665
            V KFGGSSVA A+RMREVA L+   +    + PV+VLSAMG TTN+L+ AG
Sbjct  128  VCKFGGSSVADAERMREVARLVRRQIELSRQYPVVVLSAMGSTTNDLIAAG  178



>ref|WP_010253784.1| aspartate kinase [Treponema primitia]
Length=449

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +3

Query  519  CVMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNN  650
             VMKFGGSSVA+A+R+R VA+++ S   EKP++VLSAMG TT++
Sbjct  2    IVMKFGGSSVANAERIRHVAEIVKSQIAEKPILVLSAMGDTTDH  45



>gb|KJB11756.1| hypothetical protein B456_001G275700 [Gossypium raimondii]
Length=529

 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 50/85 (59%), Gaps = 7/85 (8%)
 Frame = +3

Query  339  FRPLWSQTIDLRHVYGVCTSIKGSSRSRVLRVSCKSQTIDLVQLSGTQNLGFDGVPSEFT  518
            FRP  S +  LR++     S++    SRV RV C+   +D++Q +  +        ++ T
Sbjct  40   FRP--SNSSILRNI-----SLRRCCESRVFRVCCQGGNVDVIQRNEFEAASSGEAENQLT  92

Query  519  CVMKFGGSSVASAQRMREVADLILS  593
            CVMKFGGSSVASA+RMRE  +  +S
Sbjct  93   CVMKFGGSSVASAERMREAGEKAVS  117



>ref|WP_044013184.1| aspartate kinase [Hymenobacter sp. APR13]
 gb|AII50641.1| hypothetical protein N008_01410 [Hymenobacter sp. APR13]
Length=441

 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 37/45 (82%), Gaps = 1/45 (2%)
 Frame = +3

Query  522  VMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLL  656
            V+KFGG+SV SAQRMREVA+LI + P E+ ++VLSAM  TTN L+
Sbjct  3    VLKFGGTSVGSAQRMREVAELIHA-PHERRIVVLSAMSGTTNTLV  46



>ref|WP_044187981.1| aspartate kinase [Porphyromonas sp. COT-290 OH860]
 gb|KGN85022.1| aspartate kinase [Porphyromonas sp. COT-290 OH860]
Length=448

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 37/45 (82%), Gaps = 1/45 (2%)
 Frame = +3

Query  522  VMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLL  656
            VMKFGG+SVASA+R+R VADLI S PE K ++VLSAM  TTN L+
Sbjct  3    VMKFGGTSVASAERIRHVADLITSTPEPK-LVVLSAMAGTTNMLV  46



>ref|WP_018627512.1| aspartate kinase [Niabella aurantiaca]
Length=420

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +3

Query  522  VMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNL  653
            V KFGG+SV SA+R+  VAD++  FP++  VIV+SAMGKTTN L
Sbjct  3    VYKFGGASVNSAERVSNVADILERFPDDDLVIVISAMGKTTNAL  46



>gb|EWM28259.1| aspartate kinase [Nannochloropsis gaditana]
Length=572

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 39/51 (76%), Gaps = 2/51 (4%)
 Frame = +3

Query  519  CVMKFGGSSVASAQRMREVADLILSFPEE--KPVIVLSAMGKTTNNLLLAG  665
             +MKFGGSS+A+A+R+  VA LI S  E+  +P +V SAMGKTTNNLL AG
Sbjct  120  VIMKFGGSSLANAERVDYVASLIKSQIEQGYRPTVVCSAMGKTTNNLLNAG  170



>ref|WP_012790709.1| aspartate kinase [Chitinophaga pinensis]
 gb|ACU60533.1| aspartate kinase [Chitinophaga pinensis DSM 2588]
Length=421

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +3

Query  522  VMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNL  653
            V KFGG+S+ S +R+++VA ++ SFP+++ +IV+SAMGKTTN L
Sbjct  3    VFKFGGASLESVERIQQVATIVQSFPDQQILIVISAMGKTTNEL  46



>ref|WP_033369986.1| aspartate kinase, partial [Hymenobacter norwichensis]
Length=438

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 36/45 (80%), Gaps = 1/45 (2%)
 Frame = +3

Query  522  VMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLL  656
            V+KFGG+SV SAQRMREVA+L+   P ++ V+VLSAM  TTN L+
Sbjct  3    VLKFGGTSVGSAQRMREVAELV-DIPGQRRVVVLSAMSGTTNTLV  46



>ref|WP_029465923.1| aspartate kinase [Chitinophaga sp. JGI 0001002-D04]
Length=421

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +3

Query  522  VMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNL  653
            V KFGG+S+ S +R+R V  ++ SFP+E+ +IV+SAMGKTTN L
Sbjct  3    VFKFGGASLESIERIRNVGAIVQSFPDEQLLIVISAMGKTTNEL  46



>ref|WP_010664472.1| aspartate kinase [Marinilabilia salmonicolor]
Length=436

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 36/45 (80%), Gaps = 2/45 (4%)
 Frame = +3

Query  522  VMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLL  656
            V+KFGG+SV SAQRMREVADLI     ++ ++VLSAM  TTN+L+
Sbjct  3    VLKFGGTSVGSAQRMREVADLITG--SDRKIVVLSAMSGTTNSLV  45



>ref|WP_044125142.1| aspartate kinase [Porphyromonas sp. oral taxon 278]
Length=448

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 37/48 (77%), Gaps = 1/48 (2%)
 Frame = +3

Query  522  VMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            VMKFGG+SVASA+R+R VADLI +  E K ++VLSAM  TTN L+  G
Sbjct  3    VMKFGGTSVASAERIRHVADLITATDEVK-IVVLSAMAGTTNALVEIG  49



>ref|WP_044001665.1| aspartate kinase [Hymenobacter swuensis]
 gb|AHJ97159.1| aspartate kinase [Hymenobacter swuensis DY53]
Length=441

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +3

Query  522  VMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            ++KFGG+SV SAQRMREVA+LI +   ++ ++VLSAM  TTN L+  G
Sbjct  3    ILKFGGTSVGSAQRMREVAELIHASHLQRRIVVLSAMSGTTNALVEIG  50



>gb|KIG14159.1| Aspartokinase [Enhygromyxa salina]
Length=419

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +3

Query  522  VMKFGGSSVASAQRMREVADLILSFPEEKP-VIVLSAMGKTTNNLL  656
            VMKFGGSSVA   RMR VA +I +   E+P V+V+SAMGKTT+ L+
Sbjct  9    VMKFGGSSVADFDRMRRVAQIIAATASERPTVVVVSAMGKTTDRLV  54



>ref|WP_044231439.1| aspartate kinase [Porphyromonas sp. COT-290 OH3588]
 gb|KGO00900.1| aspartate kinase [Porphyromonas sp. COT-290 OH3588]
Length=448

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 36/45 (80%), Gaps = 1/45 (2%)
 Frame = +3

Query  522  VMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLL  656
            VMKFGG+SVASA+R+R VADLI S  E K ++VLSAM  TTN L+
Sbjct  3    VMKFGGTSVASAERIRHVADLITSTSEPK-LVVLSAMAGTTNMLV  46



>ref|WP_044114203.1| aspartate kinase [Porphyromonas sp. KLE 1280]
Length=450

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 36/48 (75%), Gaps = 1/48 (2%)
 Frame = +3

Query  522  VMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            VMKFGG+SVASAQR+  VADLI +  E K ++VLSAM  TTN L+  G
Sbjct  3    VMKFGGTSVASAQRIAHVADLITATDEPK-IVVLSAMAGTTNALVEIG  49



>ref|WP_044123858.1| aspartate kinase [Porphyromonas sp. oral taxon 279]
Length=450

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 36/48 (75%), Gaps = 1/48 (2%)
 Frame = +3

Query  522  VMKFGGSSVASAQRMREVADLILSFPEEKPVIVLSAMGKTTNNLLLAG  665
            VMKFGG+SVASAQR+  VADLI +  E K ++VLSAM  TTN L+  G
Sbjct  3    VMKFGGTSVASAQRIAHVADLITATDEPK-IVVLSAMAGTTNALVEIG  49



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1050626367960